
Sample records for ferroplasma acidarmanus sp

  1. Acidithiobacillus caldus , Leptospirillum spp., Ferroplasma spp. and ...

    African Journals Online (AJOL)

    Acidithiobacillus caldus , Leptospirillum spp., Ferroplasma spp. and Sulphobacillus spp. mixed strains for use in cobalt and copper removal from water. ... Such findings suggest that if optimal conditions for biosorption of the metals by micro-organisms are achieved, this should afford a cost-effective method of removing metal ...

  2. ORF Alignment: NC_002689 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available yltransferases involved in cell wall biogenesis ... [Ferroplasma acidarmanus] ... Length = 194 ... Query: 9 ... ISFVIPTINEE...KTIGSVIDGIHENFPNAEIILVDTNSTDKTKEIAKSKGATVIEEPRKGY 68 ... ++ +IPTINEE+TIGSVIDG...+ ... + ... EII+VDTNSTD+TKEIA ... +GATVI E R GY Sbjct: 1 ... VTAIIPTINEEETIGSVIDGLLNSVEGIE

  3. Activities of methionine-γ-lyase in the acidophilic archaeon “Ferroplasma acidarmanus” strain fer1

    Directory of Open Access Journals (Sweden)

    Khan MA


    Full Text Available M A Khan,1 Madeline M López-Muñoz,2 Charles W Kaspar,3 Kai F Hung1 1Department of Biological Sciences, Eastern Illinois University, Charleston, IL, USA; 2Department of Biology, Universidad de Puerto Rico, Mayaguez, Puerto Rico; 3Bacteriology Department, University of Wisconsin, Madison, WI, USA Abstract: Biogeochemical processes on exposed pyrite ores result in extremely high levels of sulfuric acid at these locations. Acidophiles that thrive in these conditions must overcome significant challenges, including an environment with proton concentrations at pH 3 or below. The role of sulfur metabolism in the archaeon “Ferroplasma acidarmanus” strain fer1's ability to thrive in this environment was investigated due to its growth-dependent production of methanethiol, a volatile organic sulfur compound. Two putative sequences for methionine-γ-lyase (EC, an enzyme known to carry out α, γ-elimination on L-methionine to produce methanethiol, were identified in fer1. Bioinformatic analyses identified a conserved pyridoxal-5'-phosphate (PLP binding domain and a partially conserved catalytic domain in both putative sequences. Detection of PLP-dependent and L-methionine-dependent production of α-keto compounds and thiol groups in fer1 confirmed the presence of methionine-γ-lyase activity. Further, fer1 lysate was capable of processing related substrates, including D-methionine, L-cysteine, L-cystathionine, and L/D-homocysteine. When the two putative fer1 methionine-γ-lyase gene-coded proteins were expressed in Escherichia coli cells, one sequence demonstrated an ability to carry out α, γ-elimination activity, while the other exhibited γ-replacement activity. These fer1 methionine-γ-lyases also exhibited optimum pH, substrate specificity, and catalytic preferences that are different from methionine-γ-lyases from other organisms. These differences are discussed in the context of molecular phylogeny constructed using a maximum

  4. sp

    African Journals Online (AJOL)


    adopted as the first line drug. SP has few untoward effects if used carefully in therapeutic doses. Nausea, vomiting, generalized body weakness; diarrhea, skin rashes and hematological reactions are some of the associated side effects. The drug can cause severe skin reactions such as Steven Johnson's syndrome. This.

  5. Acidithiobacillus caldus, Leptospirillum spp., Ferroplasma spp. and ...

    African Journals Online (AJOL)

    conditions such as pH, temperature, time, volume and metal concentration on the efficiency of the biosorption process was ... metals by micro-organisms are achieved, this should afford a cost-effective method of removing metal species from water ..... TSEZOS M (1983) The role of chitin in uranium adsorption by Rhizopus.

  6. Archaeal Lipid Genes: Clues to Life in Acid and the Evolution of Membranes (United States)

    Macalady, J. L.; Croft, L.; Vestling, M. M.; Harms, A. C.; Zheng, L.; Baumler, D. J.; Kaspar, C. W.; Banfield, J. F.


    Microorganisms living in acid mine drainage environments face extraordinary challenges. Acid-loving archaea such as Ferroplasma acidarmanus maintain pH gradients of 4 to 5 pH units across their membranes and thrive in hot, extremely low pH (0-1), metal-rich, solutions. New lipid analyses for two extremely acidophilic archaea, F. acidarmanus and F. acidiphilum, reveal that all known archaeal acidophiles have cell membranes composed primarily of tetraether-linked lipids. Because tetraether lipids assemble in rigid monolayers that exclude protons and metals, we suggest that tetraether synthesis genes are essential for archaeal survival in acid. Fusion of two diether-linked lipids to form a tetraether-linked lipid is a distinctive biochemical reaction with no analogy in bacteria and eukaryotes. In addition to archaeal acidophiles, tetraethers are present in members of every archaeal lineage except halophiles. Genes responsible for tetraether synthesis and subsequent biochemical steps which "tune" membrane lipid properties in response to environmental changes have not been identified to date. Comparative genomic analyses using the newly completed genome of F. acidarmanus and available genomes from Bacteria, Archaea and Eukarya have generated candidate tetraether synthase genes found only in archaea. Because tetraether-linked lipids are advantageous for acid-loving and possibly also for heat-loving archaea, the phylogeny of these genes has the potential to shed new light on role of hot, acid environments in early evolution.

  7. SP. Pescado

    Directory of Open Access Journals (Sweden)

    Renato Gendre


    Full Text Available Nell'occhiello di un articolo dal titolo Il Peru dei de[Jini rosa e de/la grande pioggia si legge: "da una partenza  in aereo al «pescado»  che ti  sfamera."1 Questa parola spagnola, giustamente chiusa tra caporali, a noi pare molto interes­ sante, perche, nonostante l'apparenza, non ha nulla da spartire sotto i1 profilo se­ mantico con l'it. pescato. lnfatti, tutti i piu importanti dizionari della lingua italiana, di ieri e di oggi, etimologici e non 2, registrano  accanto a pescata,  ii lemma pescato, 3 ma lo spiegano come "quantita di pesce catturato nel corso di una battuta o di una stagione di pesca",4 mentre lo sp. pescado  indica i1 "pesce (solo nel senso di: pesGe pescato da mangiare [...]".s

  8. Draft genome sequences of six neonatal meningitis-causing escherichia coli isolates (SP-4, SP-5, SP-13, SP-16, SP-46, and SP-65) (United States)

    Neonatal meningitis Escherichia coli isolates (SP-4, SP-5, SP-13, SP-16, SP-46, and SP-65) were recovered from infants in the Netherlands from 1989 to 1997. Here, we report the draft genome sequences for these six E. coli isolates, which are currently being used to validate food safety processing te...

  9. ExaSP2

    Energy Technology Data Exchange (ETDEWEB)


    ExaSP2 is a reference implementation of typical linear algebra algorithms and workloads for a quantum molecular dynamics (QMD) electronic structure code. The algorithm is based on a recursive second-order Fermi-Operator expansion method (SP2) and is tailored for density functional based tight-binding calculations of material systems.

  10. Fuzzy SP-irresolute functions

    International Nuclear Information System (INIS)

    Abbas, S.E.


    In this paper, fuzzy SP-irresolute, fuzzy SP-irresolute open and fuzzy SP-irresolute closed functions between fuzzy topological spaces in Sostak sense are defined. Their properties and the relationships between these functions and other functions introduced previously are investigated. Next fuzzy SP-connectedness is introduced and studied with the help of r-fuzzy strongly preopen sets

  11. Cryptosporidium sp. in lizards

    Czech Academy of Sciences Publication Activity Database

    Koudela, Břetislav; Modrý, D.


    Roč. 45, č. 1 (1998), s. 8 ISSN 1066-5234. [ Cryptosporidium sp. in lazards. 01.01.1998-02.01.1998, Praha] R&D Projects: GA ČR GA508/95/0273; GA AV ČR IPP2020702 Subject RIV: fp - Other Medical Disciplines

  12. Tsukamurella inchonensis sp. nov. (United States)

    Yassin, A F; Rainey, F A; Brzezinka, H; Burghardt, J; Lee, H J; Schaal, K P


    Chemotaxonomic and genomic 16S ribosomal DNA sequence analyses of two isolates obtained from two different clinical materials clearly delineated a new species of the genus Tsukamurella. This new species can be identified by its 16S ribosomal DNA similarity values, as well as its physiological characteristics. The name Tsukamurella inchonensis sp. nov. is proposed for these isolates, which are represented by strain IMMIB D-771T (= DSM 44067T) (T = type strain). This strain exhibits only 45% DNA relatedness to Tsukamurella paurometabola.

  13. SP-100 surety evaluation

    International Nuclear Information System (INIS)


    This report describes surety evaluations conducted during GFY 1985 in support of the General Electric design for a Space Nuclear Power System - SP-100. Those surety evaluations address both safety and safeguards requirements, which are derived from OSNP-1 and supporting documents. The report includes results of neutronics (criticality) calculations performed by Los Alamos. The results have been benchmarked against independent calculations performed by General Electric with different codes. These comparisons show close agreement, and are summarized. Los Alamos has also provided specifications of explosion and fire environments, which have been used in evaluation of the GE SP-100 concept. Following the summary of key results, surety requirements are given and recommendations toward specification of requirements for later SP-100 project phases are presented. A conceptual design summary is presented. To establish a comprehensive background for surety evaluations, a reference mission profile and potential accidents for each phase of the mission are identified. The main body of the report addresses surety of the General Electric Thermoelectric Conversion design. GE has also developed a Stirling Engine concept, and performed comprehensive surety evaluations for it. These evaluations are reported

  14. Control of Branchionus sp. and Amoeba sp. in cultures of Arthrospira sp. Control de Branchionus sp. y Amoeba sp. en cultivos de Arthrospira sp.

    Directory of Open Access Journals (Sweden)

    Carlos Méndez


    Full Text Available Cultivation of cyanobacterium Arthrospira sp. has been developed in many countries for the production of proteins, pigments and other compounds. Outdoor mass cultures are often affected by biological contamination, drastically reducing productivity as far as bringing death. This study evaluates the control of Branchionus sp. and Amoeba sp. with two chemical compounds: urea (U and ammonium bicarbonate (AB, in laboratory conditions and outdoor mass culture of Arthrospira sp. The lethal concentration 100 (LC100 at 24 h for Branchionus sp. and Amoeba sp. determined was of 60-80 mg L-1 (U and 100-150 mg L-1 (AB. The average effective inhibition concentration for 50% of the population (IC50 in Arthrospira sp., after 72 h, was 80 mg L-1 (U and 150 mg L-1 (AB. The application of doses of 60 mg L-1 (U or 100 mg L-1 (AB in the outdoor mass culture of this contaminated microalga, completely inhibited grazing and did not affect the growth of Arthrospira sp. but rather promoted rapid recovery of algal density at levels prior to infestation. These compounds provided an economical and effective control of predators in cultures of Arthrospira sp.El cultivo de la cianobacteria Arthrospira sp. ha sido desarrollado en muchos países para la obtención de proteínas, pigmentos y otros compuestos. Cultivo que a nivel industrial se ve afectado frecuentemente por contaminación biológica, reduciendo drásticamente la productividad hasta causar la muerte. Este estudio evalúa el control de Branchionus sp. y de Amoeba sp. con dos compuestos químicos, la urea (U y bicarbonato de amonio (AB en cultivos de Arthrospira sp. La concentración letal 100 (LC100 determinada a las 24 h para Branchionus sp. y Amoeba sp. fue de 60-80 mg L-1 (U y 100-150 mg L-1 (AB. La concentración media de inhibición efectiva, después de 72 h, para el 50% de la población (IC50 en Arthrospira fue de 80 mg L-1 (U y 150 mg L-1 (AB. La aplicación de dosis de 60 mg L-1 (U ó 100 mg L-1 (AB en

  15. Tsukamurella pulmonis sp. nov. (United States)

    Yassin, A F; Rainey, F A; Brzezinka, H; Burghardt, J; Rifai, M; Seifert, P; Feldmann, K; Schaal, K P


    Chemotaxonomic and 16S ribosomal DNA sequence analyses of an isolate from the sputum of a patient with a mycobacterial lung infection clearly delineated a new species of the genus Tsukamurella. This new species can be defined on the basis of genotypic and phenotypic data. The name Tsukamurella pulmonis sp. nov. is proposed for this organism; the type strain is IMMIB D-1321T (= DSM 44142T). This isolate shows 44.2 and 36.2% DNA relatedness to Tsukamurella paurometabola DSM 20162T (T = type strain) and Tsukamurella inchonensis DSM 44067T, respectively.

  16. Acetobacter intermedius, sp. nov. (United States)

    Boesch, C; Trcek, J; Sievers, M; Teuber, M


    Strains of a new species in the genus Acetobacter, for which we propose the name A. intermedius sp. nov., were isolated and characterized in pure culture from different sources (Kombucha beverage, cider vinegar, spirit vinegar) and different countries (Switzerland, Slovenia). The isolated strains grow in media with 3% acetic acid and 3% ethanol as does A. europaeus, do, however, not require acetic acid for growth. These characteristics phenotypically position A. intermedius between A. europaeus and A. xylinus, DNA-DNA hybridizations of A. intermedius-DNA with DNA of the type strains of Acetobacter europaeus, A. xylinus, A. aceti, A. hansenii, A. liquefaciens, A. methanolicus, A. pasteurianus, A. diazotrophicus, Gluconobacter oxydans and Escherichia coli HB 101 indicated less than 60% DNA similarity. The important features of the new species are described. Acetobacter intermedius strain TF2 (DSM11804) isolated from the liquid phase of a tea fungus beverage (Kombucha) is the type strain.

  17. Tsukamurella tyrosinosolvens sp. nov. (United States)

    Yassin, A F; Rainey, F A; Burghardt, J; Brzezinka, H; Schmitt, S; Seifert, P; Zimmermann, O; Mauch, H; Gierth, D; Lux, I; Schaal, K P


    Chemotaxonomic and 16S ribosomal DNA sequence analyses of four bacterial isolates from blood cultures from patients with cardiac pacemaker implants and sputa of patients with chronic lung infections clearly demonstrated that these bacteria belong to the genus Tsukamurella. DNA-DNA hybridization data, as well as the physiological characteristics of the isolates, indicate that they are closely related and belong to a single species that differs from previously described members of the genus Tsukamurella. The name Tsukamurella tyrosinosolvens sp. nov. is proposed for these isolates, and the new species is represented by strain IMMIB D-1397T (= DSM 44234T). Strain IMMIB D-1397T exhibits 53.4, 53.5, and 54.7% DNA-DNA relatedness to Tsukamurella paurometabola DSM 20162T, Tsukamurella inchonensis DSM 44067T, and Tsukamurella pulmonis DSM 44142T, respectively.

  18. Bradysia sp. em morangueiro Bradysia sp. in strawberry

    Directory of Open Access Journals (Sweden)

    Bernadete Radin


    Full Text Available No trabalho, relatam-se os primeiros registros de Bradysia sp. (Insecta: Diptera: Sciaridae em morangueiro (Fragaria x ananassa Duch., cultivado no Município de Eldorado do Sul, RS. O cultivo foi realizado em sacolas com três metros de comprimento, preenchidas com substrato composto de casca de arroz e turfa, dispostas horizontalmente sobre bancadas de madeira, em ambiente protegido. A presença de Bradysia sp. foi observada na segunda quinzena de agosto de 2005. Neste trabalho, estão descritos os sintomas apresentados no morangueiro pela praga, prováveis conseqüências sobre o aparecimento de doenças e uma breve descrição morfológica da Bradysia sp., adulto e fase larval.This paper describes the first record of Bradysia sp. (Insecta; Diptera; Sciaridae in strawberry (Fragaria x ananassa, cultivated in the city of Eldorado do Sul, RS, Brazil. Strawberry was planted in plastic bags filled with a mixture of burnt rice hulls and peat and cultivated in a greenhouse. The presence of Bradysia sp was noticed in the second fortnight of August, 2005. The symptoms in strawberry and the probable consequences in terms of disease arising were described in the present study, as well as the morphological characterization of Bradysia sp. and its illustrations.

  19. SP-100 reactor design

    International Nuclear Information System (INIS)

    Armijo, J.S.; Atwell, J.; Pluta, P.R.; Smith, M.A.; Solorzano, E.R.


    The SP-100 space reactor power system is being designed and developed as part of the Ground Engineering System (GES) contract between General Electric Company as the system developer and the Department of Energy. Other key participants in the GES program include Westinghouse Hanford Company (site operator), Los Alamos National Laboratory (fuel development and production), Oak Ridge National Laboratory (materials), and Westinghouse, Advanced Energy Systems Division (shield, HTS equipment). The GES Program includes two major elements. First, the development of a Reference Flight System design at 100 kWe output to the user, and second the validation of the Reference Flight System design by analysis and by testing. Development of key technologies along with component and system testing is an essential part of the validation program. The nuclear subsystem validation includes the design, manufacture, assembly and operational testing of a Ground Reactor Test Assembly. The subject of this paper is the reactor design for the Reference Flight System. The reference flight design is in the preliminary design stage and will evolve over the next year

  20. Penicillium araracuarense sp. nov., Penicillium elleniae sp. nov., Penicillium penarojense sp. nov., Penicillium vanderhammenii sp. nov. and Penicillium wotroi sp. nov., isolated from leaf litter

    DEFF Research Database (Denmark)

    Houbraken, Jos; López-Quintero, Carlos A.; Frisvad, Jens Christian


    Several species of the genus Penicillium were isolated during a survey of the mycobiota of leaf litter and soil in Colombian Amazon forest. Five species, Penicillium penarojense sp. nov. (type strain CBS 113178T = IBT 23262T), Penicillium wotroi sp. nov. (type strain CBS 118171T = IBT 23253T......), Penicillium araracuarense sp. nov. (type strain CBS 113149T = IBT 23247T), Penicillium elleniae sp. nov. (type strain CBS 118135T = IBT 23229T) and Penicillium vanderhammenii sp. nov. (type strain CBS 126216T = IBT 23203T) are described here as novel species. Their taxonomic novelty was determined using......, andrastin A, pulvilloric acid, paxillin, paspaline and janthitrem, were commonly produced by these phylogenetically related species. The novel species had a high growth rate on agar media, but could be distinguished from each other by several macro- and microscopical characteristics....

  1. Uji Fitokimia, Kandungan Total Fenol dan Aktivitas Antioksidan Mikroalga Spirulina sp., Chlorella sp., dan Nannochloropsis sp.

    Directory of Open Access Journals (Sweden)

    Diini Fithriani


    Full Text Available Penelitian ini bertujuan untuk mengetahui kandungan fitokimia, total fenol, dan aktivitas antioksidan dari mikroalga Spirulina sp., Nannochloropsis sp., dan Chlorella sp. Mikroalga diekstrak dengan ekstraksi tunggal menggunakan etanol. Skrining fitokimia dilakukan secara kualitatif. Analisis total fenol dilakukan secara spektrofotometri dengan metode Folin-Ciocalteu. Analisis antioksidan dilakukan dengan metode 2,2-diphenyl-1-picrylhydrazyl (DPPH dan Ferric Reducing Antioxidant Power (FRAP. Skrining fitokimia menunjukkan keberadaan tanin, flavonoid, steroid, glikosida, dan alkaloid pada ekstrak etanol ketiga jenis mikroalga, sedangkan saponin hanya terdeteksi pada ekstrak etanol Spirulina sp. dan Chlorella sp., adapun triterpenoid tidak terdeteksi pada ekstrak etanol ketiga jenis mikroalga. Hasil penelitian menunjukkan bahwa kandungan total fenol, aktivitas antioksidan (IC50, dan kapasitas antioksidan (FRAP tertinggi diperoleh pada ekstrak etanol Spirulina sp. dengan nilai berturut turut sebesar 0,32 ± 0,025 mg GAE g-1D.W., 518,94 ppm, dan  49,95 ± 2,02 (mmol Fe2+ eq.g-1D.W. Dalam penelitian ini diketahui bahwa kandungan fenol total memiliki korelasi  yang kuat  dengan kapasitas antioksidan metode FRAP (R2= 0,84, dan aktivitas antioksidan metode DPPH (R2= 0,79.

  2. Uji Fitokimia, Kandungan Total Fenol Dan Aktivitas Antioksidan Mikroalga Spirulina Sp., Chlorella Sp., dan Nannochloropsis Sp.

    Directory of Open Access Journals (Sweden)

    Diini Fithriani


    Full Text Available Penelitian ini bertujuan untuk mengetahui kandungan fitokimia, total fenol, dan aktivitas antioksidan dari mikroalga Spirulina sp., Nannochloropsis sp., dan Chlorella sp. Mikroalga diekstrak dengan ekstraksi tunggal menggunakan etanol. Skrining fitokimia dilakukan secara kualitatif. Analisis total fenol dilakukan secara spektrofotometri dengan metode Folin-Ciocalteu. Analisis antioksidan dilakukan dengan metode 2,2-diphenyl-1-picrylhydrazyl (DPPH dan Ferric Reducing Antioxidant Power (FRAP. Skrining fitokimia menunjukkan keberadaan tanin, flavonoid, steroid, glikosida, dan alkaloid pada ekstrak etanol ketiga jenis mikroalga, sedangkan saponin hanya terdeteksi pada ekstrak etanol Spirulina sp. dan Chlorella sp., adapun triterpenoid tidak terdeteksi pada ekstrak etanol ketiga jenis mikroalga. Hasil penelitian menunjukkan bahwa kandungan total fenol, aktivitas antioksidan (IC50, dan kapasitas antioksidan (FRAP tertinggi diperoleh pada ekstrak etanol Spirulina sp. dengan nilai berturut turut sebesar 0,32 ± 0,025 mg GAE g-1D.W., 518,94 ppm, dan  49,95 ± 2,02 (mmol Fe2+ eq.g-1D.W. Dalam penelitian ini diketahui bahwa kandungan fenol total memiliki korelasi  yang kuat  dengan kapasitas antioksidan metode FRAP (R2= 0,84, dan aktivitas antioksidan metode DPPH (R2= 0,79.

  3. Lactobacillus apinorum sp. nov., Lactobacillus mellifer sp. nov., Lactobacillus mellis sp. nov., Lactobacillus melliventris sp. nov., Lactobacillus kimbladii sp. nov., Lactobacillus helsingborgensis sp. nov. and Lactobacillus kullabergensis sp. nov., isolated from the honey stomach of the honeybee Apis mellifera (United States)

    Alsterfjord, Magnus; Nilson, Bo; Butler, Èile; Vásquez, Alejandra


    We previously discovered a symbiotic lactic acid bacterial (LAB) microbiota in the honey stomach of the honeybee Apis mellifera. The microbiota was composed of several phylotypes of Bifidobacterium and Lactobacillus. 16S rRNA gene sequence analyses and phenotypic and genetic characteristics revealed that the phylotypes isolated represent seven novel species. One grouped with Lactobacillus kunkeei and the others belong to the Lactobacillus buchneri and Lactobacillus delbrueckiisubgroups of Lactobacillus. We propose the names Lactobacillus apinorum sp. nov., Lactobacillus mellifer sp. nov., Lactobacillus mellis sp. nov., Lactobacillus melliventris sp. nov., Lactobacillus kimbladii sp. nov., Lactobacillus helsingborgensis sp. nov. and Lactobacillus kullabergensis sp. nov. for these novel species, with the respective type strains being Fhon13NT ( = DSM 26257T = CCUG 63287T), Bin4NT ( = DSM 26254T = CCUG 63291T), Hon2NT ( = DSM 26255T = CCUG 63289T), Hma8NT ( = DSM 26256T = CCUG 63629T), Hma2NT ( = DSM 26263T = CCUG 63633T), Bma5NT ( = DSM 26265T = CCUG 63301T) and Biut2NT ( = DSM 26262T = CCUG 63631T). PMID:24944337

  4. Ecdysteroids from a Zoanthus sp. (United States)

    Suksamrarn, Apichart; Jankam, Aroon; Tarnchompoo, Bongkoch; Putchakarn, Sumaitt


    A new ecdysteroid, zoanthusterone, has been isolated from a marine zoanthid, Zoanthus sp. Ten known ecdysteroids, ponasterone A, 20-hydroxyecdysone 2-acetate, viticosterone E, integristerone A 25-acetate, 2-deoxy-20-hydroxyecdysone, ecdysone, ajugasterone C, dacryhainansterone, inokosterone, and 20-hydroxyecdysone, have also been isolated. This is the first report of ecdysteroids in a Zoanthus species.

  5. Sporulation of Cyclospora sp. oocysts.


    Smith, H V; Paton, C A; Mitambo, M M; Girdwood, R W


    Cyclospora sp. oocysts sporulated maximally at 22 and 30 degrees C for 14 days retarded sporulation. Up to 12% of human- and baboon-derived oocysts previously stored at 4 degrees C for 1 to 2 months sporulated when stored for 6 to 7 days at 30 degrees C.

  6. An Sp1/Sp3 binding polymorphism confers methylation protection.

    Directory of Open Access Journals (Sweden)

    Yanis A Boumber


    Full Text Available Hundreds of genes show aberrant DNA hypermethylation in cancer, yet little is known about the causes of this hypermethylation. We identified RIL as a frequent methylation target in cancer. In search for factors that influence RIL hypermethylation, we found a 12-bp polymorphic sequence around its transcription start site that creates a long allele. Pyrosequencing of homozygous tumors revealed a 2.1-fold higher methylation for the short alleles (P<0.001. Bisulfite sequencing of cancers heterozygous for RIL showed that the short alleles are 3.1-fold more methylated than the long (P<0.001. The comparison of expression levels between unmethylated long and short EBV-transformed cell lines showed no difference in expression in vivo. Electrophorectic mobility shift assay showed that the inserted region of the long allele binds Sp1 and Sp3 transcription factors, a binding that is absent in the short allele. Transient transfection of RIL allele-specific transgenes showed no effects of the additional Sp1 site on transcription early on. However, stable transfection of methylation-seeded constructs showed gradually decreasing transcription levels from the short allele with eventual spreading of de novo methylation. In contrast, the long allele showed stable levels of expression over time as measured by luciferase and approximately 2-3-fold lower levels of methylation by bisulfite sequencing (P<0.001, suggesting that the polymorphic Sp1 site protects against time-dependent silencing. Our finding demonstrates that, in some genes, hypermethylation in cancer is dictated by protein-DNA interactions at the promoters and provides a novel mechanism by which genetic polymorphisms can influence an epigenetic state.

  7. Antioxidant capacity, polyphenol content and iron bioavailability from algae (Ulva sp., Sargassum sp. and Porphyra sp.) in human subjects. (United States)

    García-Casal, Maria N; Ramírez, José; Leets, Irene; Pereira, Ana C; Quiroga, Maria F


    Marine algae are easily produced and are good sources of Fe. If this Fe is bioavailable, algae consumption could help to combat Fe deficiency and anaemia worldwide. The objective of the present study was to evaluate Fe bioavailability, polyphenol content and antioxidant capacity from three species of marine algae distributed worldwide. A total of eighty-three subjects received maize- or wheat-based meals containing marine algae (Ulva sp., Sargassum sp. and Porphyra sp.) in different proportions (2.5, 5.0 and 7.5 g) added to the water to prepare the dough. All meals administered contained radioactive Fe. Absorption was evaluated calculating radioactive Fe incorporation in subjects' blood. The three species of marine algae were analysed for polyphenol content and reducing power. Algae significantly increased Fe absorption in maize- or wheat-based meals, especially Sargassum sp., due to its high Fe content. Increases in absorption were dose-dependent and higher in wheat- than in maize-based meals. Total polyphenol content was 10.84, 18.43 and 80.39 gallic acid equivalents/g for Ulva sp., Porphyra sp. and Sargassum sp., respectively. The antioxidant capacity was also significantly higher in Sargassum sp. compared with the other two species analysed. Ulva sp., Sargassum sp. and Porphyra sp. are good sources of bioavailable Fe. Sargassum sp. resulted in the highest Fe intake due to its high Fe content, and a bread containing 7.5 g Sargassum sp. covers daily Fe needs. The high polyphenol content found in Sargassum sp. could be partly responsible for the antioxidant power reported here, and apparently did not affect Fe absorption.

  8. Pantoea rodasii sp. nov., Pantoea rwandensis sp. nov. and Pantoea wallisii sp. nov., isolated from Eucalyptus. (United States)

    Brady, Carrie L; Cleenwerck, Ilse; van der Westhuizen, Lorinda; Venter, Stephanus N; Coutinho, Teresa A; De Vos, Paul


    Several Gram-negative-staining, facultatively anaerobic bacterial isolates were obtained from Eucalyptus seedlings showing symptoms of bacterial blight and dieback in Colombia, Rwanda and South Africa. Partial 16S rRNA gene sequencing, together with partial gyrB sequencing, placed the isolates in the genus Pantoea and indicated that they constituted three novel species. Multilocus sequence analysis (MLSA) based on partial sequences of gyrB, rpoB, infB and atpD revealed Pantoea dispersa, Pantoea eucrina and Pantoea cypripedii as their closest phylogenetic relatives. DNA-DNA hybridization studies confirmed the classification of the new isolates as three novel species and phenotypic tests allowed them to be differentiated from their closest phylogenetic neighbours. The names Pantoea rodasii sp. nov. [type strain LMG 26273(T)=BD 943(T) (deposited with the Plant Pathogenic and Plant Protecting Bacteria Collection, South Africa)=BCC 581(T) (deposited with the Bacterial Culture Collection, Forestry and Agricultural Institute, South Africa)], Pantoea rwandensis sp. nov. (type strain LMG 26275(T)=BD 944(T)=BCC 571(T)) and Pantoea wallisii sp. nov. (type strain LMG 26277(T)=BD 946(T)=BCC 682(T)) are proposed.


    Directory of Open Access Journals (Sweden)

    Eva Ari Wahyuni


    Full Text Available DISTRIBUTION OF Solen sp IN BANGKALAN WATERSSolen sp potential needs to be developed on the island of Madura, particularly in Bangkalan. Solen sp utilization has increased which has the potential to overfishing. Therefore, this study aims to determine the density of Solen sp and their ecology in the waters Modung village, Modung District, Bangkalan. The experiment was conducted in April 2015 using the descriptive method. The materials used include Solen sp and physico-chemical parameters of the environment (temperature, salinity, pH, and substrate. The analyzes were conducted at the Laboratory of Marine Science, Department of Marine Sciences, Trunojoyo University of Madura by using the tool grabsampler, sieveshaker, and pipetting with gravimetric method. The analysis shows the range of values of temperature between 29-300C, salinity between 31-32 ppt, pH were 7.9-8.0 and the type of substrate in the form of sandy mud, as well as the density of Solen sp from 8-10 individuals/m2. All measurement results indicate normal conditions and in accordance with the sea water quality standard for marine life, which can be a suitable habitat for the growth and development of Solen sp. This condition is thought to affect the density of Solen sp.Keywords: Bangkalan, density, distribution, Solen sp, substrate.ABSTRAKPotensi Solen sp perlu dikembangkan di pulau Madura, khususnya di Kabupaten Bangkalan. Pemanfaatan Solen sp mengalami peningkatan sehingga berpotensi overfishing. Untuk itu, penelitian ini bertujuan untuk mengetahui kepadatan Solen sp dan ekologinya di perairan desa Modung, Kecamatan Modung, Kabupaten Bangkalan. Penelitian dilaksanakan pada bulan April 2015 dengan metode deskriptif. Materi dan bahan yang digunakan diantaranya Solen sp dan parameter fisika-kimia lingkungan (suhu, salinitas, pH, dan substrat. Analisa dilakukan di Laboratorium Ilmu Kelautan, Program studi/Jurusan Ilmu Kelautan Universitas Trunojoyo Madura dengan menggunakan alat

  10. Especificidad del hongo micorrizico (Rhizoctonia sp.) en Phalaenopsis sp., Cymbidium sp., Trichoceros antenifer, Oncidium excavatum, y Cyrtochilum sp.


    Ordoñez, Silvia L.; Pillacela Zhunio, Dora Priscila; Salazar, Jazmín M.; Peña Tapia, Denisse Fabiola


    Las orquídeas producen abundantes semillas pequeñas, careciendo de endospermo, cotiledones y sustancias de reserva para llevar a cabo su germinación. Es por esto que estratégicamente las semillas establecen una relación simbiótica con un hongo micorrízico que favorece a su germinación y desarrollo. El objetivo de este estudio fue determinar la especificidad del hongo micorrízico (Rhizoctonia sp.) en la germinación de cinco géneros de orquídeas. Se usaron dos medios de cultivo: 1) PhytamaxTM y...

  11. Rodentibacter gen. nov including Rodentibacter pneumotropicus comb. nov., Rodentibacter heylii sp nov., Rodentibacter myodis sp nov., Rodentibacter ratti sp nov., Rodentibacter heidelbergensis sp nov., Rodentibacter trehalosifermentans sp nov., Rodentibacter rarus sp nov., Rodentibacter mrazii

    DEFF Research Database (Denmark)

    Adhikary, Sadhana; Nicklas, Werner; Bisgaard, Magne


    genomic comparison allowed the estimation of DNA–DNA renaturation. Rodentibacter heylii sp. nov. was proposed for a group that included the biovar Heyl of [ Pasteurella ] pneumotropica with the type strain ATCC 12555T (=CCUG 998T). A group was proposed as Rodentibacter ratti sp. nov., which included...

  12. Xylanolytic enzyme systems in Arthrobacter sp MTCC 5214 and Lactobacillus sp.

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Jalal, T.

    The production of extracellular xylanolytic enzymes such as xylanase, alfa-L-arabinofuranosidase (alfa-l-AFase), and acetyl xylan esterase (Axe) by marine Arthrobacter sp and Lactobacillus sp was investigated using different carbon sources Induction...

  13. Evaluation of antioxidant and cytotoxic properties of Cynobacteria, Limnothrix sp. and Leptolyngbya sp. from Arabian sea

    Digital Repository Service at National Institute of Oceanography (India)

    Anas, A.; Vinothkumar, S.; Gupta, S.; Jasmin, C.; Joseph, V.; Parameswaran, P.S.; Nair, S.

    The hexane fractions of the marine cyanobacteria: Leptolyngbya sp. and Limnothrix sp., collected from Arabian Sea were found to display promising antioxidant properties than their ethyl acetate fraction during radical scavenging ABTS/DPPH assays (IC...

  14. First report of Anisakis sp. in Epinephelus sp. in East Indonesia


    Annytha Ina Rohi Detha; Diana Agustiani Wuri; Julianty Almet; Yuni Riwu; Christin Melky


    Objective: The present research was conducted to identify the prevalence of Anisakis sp. as fish-borne zoonoses in Epinephelus sp. in territorial waters of East Nusa Tenggara, Indonesia. Materials and methods: A total of 50 fish (Epinephelus sp.) were collected from Kupang Fish Market in East Nusa Tenggara. Identification of Anisakis sp. was performed based on morphological observations considering shape of ventriculus, boring tooth, and mucron using binocular microscope. Results: Prev...

  15. Specialised predation by Palpimanus sp. (Araneae: Palpimanidae ...

    African Journals Online (AJOL)

    This is the first detailed report on the natural prey and the prey-capture tactics of a Palpimanus sp. from Entebbe (Uganda). Although this species fed occasionally on insects, its dominant prey in the field was other spiders, especially jumping spiders (Salticidae) and their eggs. Encounters between Palpimanus sp. and ...

  16. Guide til gode spørgeskemaer

    DEFF Research Database (Denmark)

    Olsen, Henning

    Spørgeskemaundersøgelser bliver ofte brugt til at dokumentere forskellige forhold og begrunde politiske beslutninger. Men resultaterne kan være forbundet med stor usikkerhed. Det kræver omhu og stor sproglig formåen at udarbejde spørgeskemaer. Seniorforsker Henning Olsen har i flere år arbejdet med...... viden om, hvordan folk forstår sproglige meddelelser og genkalder sig informationer. I guiden behandles emner som fx styrende problemstillinger og spørgsmåls fokus og neutralitet, formulering af åbne eller lukkede spørgsmål og svarkategorier, tematiske spørgeforløb, aflastning af svarpersoners...

  17. Listeria floridensis sp. nov., Listeria aquatica sp. nov., Listeria cornellensis sp. nov., Listeria riparia sp. nov. and Listeria grandensis sp. nov., from agricultural and natural environments. (United States)

    den Bakker, Henk C; Warchocki, Steven; Wright, Emily M; Allred, Adam F; Ahlstrom, Christina; Manuel, Clyde S; Stasiewicz, Matthew J; Burrell, Angela; Roof, Sherry; Strawn, Laura K; Fortes, Esther; Nightingale, Kendra K; Kephart, Daniel; Wiedmann, Martin


    Sampling of agricultural and natural environments in two US states (Colorado and Florida) yielded 18 Listeria-like isolates that could not be assigned to previously described species using traditional methods. Using whole-genome sequencing and traditional phenotypic methods, we identified five novel species, each with a genome-wide average BLAST nucleotide identity (ANIb) of less than 85% to currently described species. Phylogenetic analysis based on 16S rRNA gene sequences and amino acid sequences of 31 conserved loci showed the existence of four well-supported clades within the genus Listeria; (i) a clade representing Listeria monocytogenes, L. marthii, L. innocua, L. welshimeri, L. seeligeri and L. ivanovii, which we refer to as Listeria sensu stricto, (ii) a clade consisting of Listeria fleischmannii and two newly described species, Listeria aquatica sp. nov. (type strain FSL S10-1188(T) = DSM 26686(T) = LMG 28120(T) = BEI NR-42633(T)) and Listeria floridensis sp. nov. (type strain FSL S10-1187(T) = DSM 26687(T) = LMG 28121(T) = BEI NR-42632(T)), (iii) a clade consisting of Listeria rocourtiae, L. weihenstephanensis and three novel species, Listeria cornellensis sp. nov. (type strain TTU A1-0210(T) = FSL F6-0969(T) = DSM 26689(T) = LMG 28123(T) = BEI NR-42630(T)), Listeria grandensis sp. nov. (type strain TTU A1-0212(T) = FSL F6-0971(T) = DSM 26688(T) = LMG 28122(T) = BEI NR-42631(T)) and Listeria riparia sp. nov. (type strain FSL S10-1204(T) = DSM 26685(T) = LMG 28119(T) = BEI NR- 42634(T)) and (iv) a clade containing Listeria grayi. Genomic and phenotypic data suggest that the novel species are non-pathogenic. © 2014 IUMS.

  18. Predictive value of Sp1/Sp3/FLIP signature for prostate cancer recurrence.

    Directory of Open Access Journals (Sweden)

    Roble G Bedolla

    Full Text Available Prediction of prostate cancer prognosis is challenging and predictive biomarkers of recurrence remain elusive. Although prostate specific antigen (PSA has high sensitivity (90% at a PSA level of 4.0 ng/mL, its low specificity leads to many false positive results and considerable overtreatment of patients and its performance at lower ranges is poor. Given the histopathological and molecular heterogeneity of prostate cancer, we propose that a panel of markers will be a better tool than a single marker. We tested a panel of markers composed of the anti-apoptotic protein FLIP and its transcriptional regulators Sp1 and Sp3 using prostate tissues from 64 patients with recurrent and non-recurrent cancer who underwent radical prostatectomy as primary treatment for prostate cancer and were followed with PSA measurements for at least 5 years. Immunohistochemical staining for Sp1, Sp3, and FLIP was performed on these tissues and scored based on the proportion and intensity of staining. The predictive value of the FLIP/Sp1/Sp3 signature for clinical outcome (recurrence vs. non-recurrence was explored with logistic regression, and combinations of FLIP/Sp1/Sp3 and Gleason score were analyzed with a stepwise (backward and forward logistic model. The discrimination of the markers was identified by sensitivity-specificity analysis and the diagnostic value of FLIP/Sp1/Sp3 was determined using area under the curve (AUC for receiver operator characteristic curves. The AUCs for FLIP, Sp1, Sp3, and Gleason score for predicting PSA failure and non-failure were 0.71, 0.66, 0.68, and 0.76, respectively. However, this increased to 0.93 when combined. Thus, the "biomarker signature" of FLIP/Sp1/Sp3 combined with Gleason score predicted disease recurrence and stratified patients who are likely to benefit from more aggressive treatment.

  19. Antibacterial Actions and Potential Phototoxic Effects of Volatile oils of Foeniculum sp. (fennel, Salvia sp. (sage, Vitis sp. (grape, Lavandula sp. (lavender

    Directory of Open Access Journals (Sweden)

    Elif Ayse Erdogan Eliuz


    Full Text Available In the present study, the volatile compounds of essential oil of Foeniculum vulgare (fennel, Salvia officinalis (sage, Vitis vinifera (grape, Lavandula angustifolia (lavender were analysed by gas chromatography-mass spectrometry (GC-MS using the Nist and Willey libraries. It was determined that the main components of Foeniculum sp. were anethole (41.11%, carvacrol (9.18%. whereas main components of Salvia sp were 1.8 cineole (34.09%, caryophyllene (10.95%, camphor (9.44%, α-pinene (8.42%. Vitis sp. contained linoleic acid (36.98%, 2,4-decadienal (30.79%. Finally, volatile component of Lavandula sp. was linalool (33.57%, linalyl acetate (30.74%. Photoxic antibacterial activity of volatile oil of those plants against Escherichia coli (ATCC 25293, Klebsiella pneumoniae (10031, Salmonella thyphimurium, Bacillus subtilis (ATCC 6633, Staphylococcus aureus (ATCC 25925, Enterococcus feacalis (ATCC 29212 were examined by using disc diffusion method. We demonstrated that volatile oil effectively can be activated by a standard LED light. In vitro, significant phototoxicity was demonstrated by volatile oil of Foeniculum sp. and Vitis sp. (P < 0.05, while minor phototoxicity was induced by Lavandula sp. Therefore, volatile oil of plant can be considered as a potential photosensitizer in the photochemical therapy.

  20. TurboSP and the Topological Trigger

    CERN Document Server

    Belavin, Vladislav


    TurboSP was originally proposed as an alternative to Full stream in LHCb data flow. TurboSP is a data flow strategy which not only selects events that should be preserved, like in Full stream, but also provides selective persistence. This is achieved by saving candidates and subset of the reconstruction. During this summer project we investigated the physics viability of using TurboSP with the topological lines and found out a possibility to reduce the number of kept tracks per event by two times while keeping a ratio of fully picked up interesting decay modes on $\\sim 97 \\%$ level.

  1. Amphibian (Xenopus sp.) iodothyronine deiodinase ... (United States)

    The U.S. EPA-MED amphibian thyroid group is currently screening chemicals for inhibition of human iodothyronine deiodinase activity as components of the thyroid system important in human development. Amphibians are a bellwether taxonomic group to gauge toxicity of chemicals in the environment. Amphibian thyroid function is not only important in development but also metamorphosis. Xenopus sp. have been used extensively as model organisms and are well characterized genetically. We propose to screen a list of chemicals (selected from the human DIO screening results) to test for inhibition of Xenopus deiodinases. Large quantities of the enzymes will be produced using an adenovirus system. Our preliminary results show that there may be catalytic differences between human and Xenopus deiodinases. The Twin Ports Early Career Scientists is a new group formed within the Duluth-Superior scientific community. This presentation will provide a basic introduction to my research and our mission at EPA, and help to establish networking and collaboration relationships across disciplines and institutions.

  2. Detection of Salmonella sp., Vibrio sp. and total plate count bacteria on blood cockle (Anadara granosa) (United States)

    Ekawati, ER; Yusmiati, S. N. H.


    Blood cockle (Anadara granosa) has high level of zinc and protein, which is beneficial for therapeutic function for malnourished particularly stunting case in children. Zinc in animal foods is more absorbable than that from vegetable food. Blood cockle (Anadara granosa) is rich in nutrient and an excellent environment for the growth of microorganisms. This research aimed to identify the contamination of Salmonella sp., Vibrio sp. and total plate count bacteria on blood cockle (Anadara granosa). This was observation research with laboratory analysis. Salmonella sp. and Vibrio sp. were detected from blood cockle. Total plate count was determine of the total amount of the bacteria. Results detected from 20 samples of blood cockle showed that all samples were negative of Salmonella sp. and 1 sample positive Vibrio sp. The result of total plate count bacteria was sample.

  3. Helicotylenchus stylocercus n. sp. and Rotylenchus phaliurus n. sp. (Nematoda: Hoplolaimidae) from Costa Rica. (United States)

    Siddiqi, M R; Pinochet, J


    Two new species of plant-parasitic nematodes from Costa Rica are described. Helicotygenchus styloeercus n. sp., from soil around roots of banana at Coto, is distinguished hy the female tail, which bears a large pillarlike ventral projection. Rotylenchus phaliurus n. sp., from soil artmnd roots of Dioscoroea sp. at Sixaola, differs from R. caudaphasmidius in having the conus equal to or more than half the spear length, and large terminal annules on the female tail.

  4. SP (4,R) symmetry in light nuclei

    International Nuclear Information System (INIS)

    Peterson, D.R.


    A classification of nuclear states according to the noncompact sympletic Lie algebras sp(2n,R), n = 1, 2, 3, is investigated. Such a classification has recently been shown to be physically meaningful. This classification scheme is the appropriate generalization fo Elliott's SU 3 model of rotational states in deformed light nuclei to include core excitations. A restricted classification according to the Lie algebra, sp(4,R), is motivated. Truncation of the model space to a single sp(4,R) irreducible representation allows the inclusion of states possessing very high excitation energy. An sp(4,R) model study is performed on S = T = 0 positive-parity rotational bands in the deformed light nuclei 16 O and 24 Mg. States are included in the model space that possess up to 10h ω in excitation energy. Results for the B(E2) transition rates compare favorable with experiment, without resort to effective charges

  5. EOP Gold Coral (Gerardia sp.) Growth Measurements (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gold coral (Gerardia sp.) trees that were inspected years earlier on Pisces submersible dives were revisited and their change in size measured. The fishery for...

  6. Silencing the SpMPK1, SpMPK2, and SpMPK3 Genes in Tomato Reduces Abscisic Acid—Mediated Drought Tolerance

    Directory of Open Access Journals (Sweden)

    Yan Liang


    Full Text Available Drought is a major threat to agriculture production worldwide. Mitogen-activated protein kinases (MAPKs play a pivotal role in sensing and converting stress signals into appropriate responses so that plants can adapt and survive. To examine the function of MAPKs in the drought tolerance of tomato plants, we silenced the SpMPK1, SpMPK2, and SpMPK3 genes in wild-type plants using the virus-induced gene silencing (VIGS method. The results indicate that silencing the individual genes or co-silencing SpMPK1, SpMPK2, and SpMPK3 reduced the drought tolerance of tomato plants by varying degrees. Co-silencing SpMPK1 and SpMPK2 impaired abscisic acid (ABA-induced and hydrogen peroxide (H2O2-induced stomatal closure and enhanced ABA-induced H2O2 production. Similar results were observed when silencing SpMPK3 alone, but not when SpMPK1 and SpMPK2 were individually silenced. These data suggest that the functions of SpMPK1 and SpMPK2 are redundant, and they overlap with that of SpMPK3 in drought stress signaling pathways. In addition, we found that SpMPK3 may regulate H2O2 levels by mediating the expression of CAT1. Hence, SpMPK1, SpMPK2, and SpMPK3 may play crucial roles in enhancing tomato plants’ drought tolerance by influencing stomatal activity and H2O2 production via the ABA-H2O2 pathway.

  7. Penggunaan Jamur Antagonis Trichoderma SP. Dan Gliocladium SP. Untuk Mengendalikan Penyakit Layu Fusarium Pada Tanaman Bawang Merah (Allium Ascalonicum L.)


    Arie Ramadhina, Arie Ramadhina; Lisnawita, Lisnawita; Lubis, Lahmuddin


    The use of antagonism fungus of Trichoderma sp. and Gliocladium sp. for controlling wilt(Fusarium oxysporum) in red onion plants. The aim of the research was to know the effectiviness ofantagonism fungus of Trichoderma sp. and Gliocladium sp. in controlling wilt in red onion plants.The research used non-factorial RAK (random group design) with eight treatments: control, 10grams of F. oxysporum, 12 grams of Trichoderma sp., 18 grams of Trichoderma sp., 24 grams ofTrichoderma sp., and 12 grams ...

  8. Chaenorhinum semispeluncarum sp. nov. and C. yildirimlii sp. nov. (Scrophulariaceae) from east Anatolia, Turkey

    DEFF Research Database (Denmark)

    Yildirim, Hasan; Tan, Kit; Senol, Serdar


    Chaenorhinum semispeluncarum H. Yildirim, Kit Tan, S. Senol & A. Pirhan sp. nov. and C. yildirimlii Kit Tan, H. Yildirim, S. Senol & A. Pirhan sp. nov. (Scrophulariaceae, C. sect. Microrrhinum) from east Anatolia are described and illustrated. They are both narrow endemics related to the rare C...

  9. Metallaphotoredox-catalysed sp3-sp3 cross-coupling of carboxylic acids with alkyl halides (United States)

    Johnston, Craig P.; Smith, Russell T.; Allmendinger, Simon; MacMillan, David W. C.


    In the past 50 years, cross-coupling reactions mediated by transition metals have changed the way in which complex organic molecules are synthesized. The predictable and chemoselective nature of these transformations has led to their widespread adoption across many areas of chemical research. However, the construction of a bond between two sp3-hybridized carbon atoms, a fundamental unit of organic chemistry, remains an important yet elusive objective for engineering cross-coupling reactions. In comparison to related procedures with sp2-hybridized species, the development of methods for sp3-sp3 bond formation via transition metal catalysis has been hampered historically by deleterious side-reactions, such as β-hydride elimination with palladium catalysis or the reluctance of alkyl halides to undergo oxidative addition. To address this issue, nickel-catalysed cross-coupling processes can be used to form sp3-sp3 bonds that utilize organometallic nucleophiles and alkyl electrophiles. In particular, the coupling of alkyl halides with pre-generated organozinc, Grignard and organoborane species has been used to furnish diverse molecular structures. However, the manipulations required to produce these activated structures is inefficient, leading to poor step- and atom-economies. Moreover, the operational difficulties associated with making and using these reactive coupling partners, and preserving them through a synthetic sequence, has hindered their widespread adoption. A generically useful sp3-sp3 coupling technology that uses bench-stable, native organic functional groups, without the need for pre-functionalization or substrate derivatization, would therefore be valuable. Here we demonstrate that the synergistic merger of photoredox and nickel catalysis enables the direct formation of sp3-sp3 bonds using only simple carboxylic acids and alkyl halides as the nucleophilic and electrophilic coupling partners, respectively. This metallaphotoredox protocol is suitable for

  10. Five novel Wickerhamomyces- and Metschnikowia-related yeast species, Wickerhamomyces chaumierensis sp. nov., Candida pseudoflosculorum sp. nov., Candida danieliae sp. nov., Candida robnettiae sp. nov. and Candida eppingiae sp. nov., isolated from plants

    NARCIS (Netherlands)

    Groenewald, Marizeth; Robert, Vincent; Smith, Maudy Th

    On the basis of nucleotide divergences in the D1/D2 domain of the 26S rRNA gene and the internal transcribed spacers (ITS) domain of the rRNA gene, five novel yeast species, Wickerhamomyces chaumierensis sp. nov. (CBS 8565(T)  = JCM 17246(T)), Candida pseudoflosculorum sp. nov. (CBS 8584(T)  = JCM

  11. SP-100/Brayton power system concepts

    International Nuclear Information System (INIS)

    Owen, D.F.


    Use of closed Brayton cycle (CBC) power conversion technology has been investigated for use with SP-100 reactors for space power systems. The CBC power conversion technology is being developed by Rockwell International under the Dynamic Isotype Power System (DIPS) and Space Station Freedom solar dynamic power system programs to provide highly efficient power conversion with radioisotype and solar collector heat sources. Characteristics including mass, radiator area, thermal power, and operating temperatures for systems utilizing SP-100 reactor and CBC power conversion technology were determined for systems in the 10-to 100-kWe power range. Possible SP-100 reactor/CBC power system configurations are presented. Advantages of CBC power conversion technology with regard to reactor thermal power, operating temperature, and development status are discussed

  12. Ovos de Toxocara sp. e larvas de Ancylostoma sp. em praça pública de Lavras, MG Toxocara sp. eggs and Ancylostoma sp. larva in public parks, Brazil

    Directory of Open Access Journals (Sweden)

    Antônio Marcos Guimarães


    Full Text Available Larva migrans visceral e cutânea são zoonoses parasitárias causadas pela infecção da larva de Toxocara sp. e Ancylostoma sp., respectivamente. O objetivo do estudo foi verificar a contaminação por ovos de Toxocara sp. e ovos e larvas de Ancylostoma sp. em amostras de solos coletadas de praças públicas e de áreas de recreação infantil de Lavras, Estado de Minas Gerais, por meio da técnica de centrífugo-flutuação e do método de Baermann. A ocorrência de ovos de Toxocara sp. e, ovos e larvas de Ancylostoma sp. foi observada em 69,6% (16/23 das amostras de solo coletadas de praças públicas. A contaminação somente por ovos de Ancylostoma sp. em amostras de solo coletadas em escolas/creches foi de 22,2% (4/18. A percentagem de amostras de areia coletadas de escolas/creches contaminadas somente com larvas de Ancylostoma sp. foi de 11,1% (2/18. Praças públicas são as áreas com maior risco potencial de infecção por Toxocara sp. e Ancylostoma sp. Exame coproparasitológico realizado em 174 amostras de fezes de cães observou 58% e 23%, respectivamente, com ovos de Ancylostoma sp. e Toxocara sp.Visceral and cutaneous larva migrans are parasitic zoonoses caused by the infection of larval nematodes Toxocara sp. and Ancylostoma sp. respectively. The objective of this study was to investigate the contamination by Toxocara sp. eggs and Ancylostoma sp. eggs and larva of soil samples collected from public parks and children's playground areas in state of Minas Gerais, Brazil, using both Baermann's method and centrifugal flotation technique. Toxocara sp. and Ancylostoma sp. eggs were observed in soil samples collected from public squares in 17.4% (4/23 and 69.6 (16/23 respectively. In schools and child day care settings the contamination by Ancylostoma sp. larva in sand samples was 11.1% (2/18. Public parks are settings of more potential risk of Toxocara sp. eggs and Ancylostoma sp. infection. Stool parasitology testing of 174 stool

  13. Nitrogen fixation in Asaia sp. (family Acetobacteraceae). (United States)

    Samaddar, Neeloy; Paul, Arundhati; Chakravorty, Somnath; Chakraborty, Writachit; Mukherjee, Joydeep; Chowdhuri, Debarati; Gachhui, Ratan


    The genus Asaia (family Acetobacteraceae) was first introduced with a single species-Asaia bogorensis and later six more species were described namely A. siamensis, A. krungthepensis, A. lannaensis, A. platycodi, A. prunellae, and A. astilbes. Acetobacteraceae family has been divided into ten genera but, only three of them include nitrogen fixing species: Gluconacetobacter, Acetobacter, and Swaminathania. This article originated from our study primarily aimed to isolate new endosymbiotic nitrogen fixer among Acetobacteraceae during which we have isolated, for the first time in India, four different strains of Asaia sp. from three different sources: Michalia champaca flower, Anopheles mosquito, and ant Tetraponera rufonigra. All the endosymbiotic strains isolated possess the ability to fix nitrogen. Evidence for both nitrogenase activity and the presence of nifH gene in isolated Asaia sp. is presented. Asaia bogorensis (MTCC 4041(T)) and A. siamensis (MTCC 4042(T)), two of the validated type strains available from the repository, were tested positive for the presence of functional nitrogenase. The nifH gene sequences from these type strains were also confirmed and compared with other nitrogen fixing members of the family Acetobacteraceae. Our result corroborate with the previous reports that Asaia sp. are indeed widely distributed in nature but this is the first time demonstration of their functional nitrogenase activity. This study shows Asaia sp. as fourth genera of nitrogen fixing bacteria in the family Acetobacteraceae.

  14. Molecular characterization of Trichoderma sp. isolated from ...

    African Journals Online (AJOL)

    The genetic relatedness among 15 isolates of Trichoderma sp. was analyzed with six micro-satellite primers. ISSR profiles showed 83.7% genetic diversity among the isolates with the formation of four clusters. Analysis of dendrogram revealed that similarity coefficient ranged from 0.27 to 0.95. ITS-PCR of rDNA region with ...

  15. Som man spørger

    DEFF Research Database (Denmark)

    Bjerg, Lars

    Indhold: Input og outputinterview ; Tre interviewtyper ; Tre grundprincipper ; De syv dødssynder ; Åbne, simple og neutrale spørgsmål ; Skuffespørgsmål ; Fokus ; Aktiv lytning ; Mål ; Strategi ; Abstrakt og konkret ; Det kritiske interview ; Kilder med et budskab ; Oldfruens fif ; Resumé i punktform...


    Directory of Open Access Journals (Sweden)



    Full Text Available Ten isolates of fungus were isolated from oil palm stem at oil palm plantation in Medan All of them were tested its abilities to degrade lignin. The results showed that one of them was able to grow on ligninase media and the fungi has the ability to degrade ligin. The fungi is identified as Melanotus sp.

  17. Biosorption of uranium by Azolla, SP, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Ludmila C.; Alves, Eliakim G.; Marumo, Julio T., E-mail: [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Ferreira, Rafael V. de P., E-mail: [Itatijuca Biotech, Sao Paulo, SP (Brazil); Canevesi, Rafael L.S.; Silva, Edson A., E-mail: [Universidade Estadual do Oeste Parana (UNIOESTE), Toledo, PR (Brazil)


    Radioactive liquid waste needs special attention and requires suitable treatment before deposition. Among the potential technologies under development for the treatment of liquid radioactive wastes the biosorption has been highlighted by being an efficient and low cost technique. Biosorption process involves the exchange of ions contained in the biomass matrix by others present in solution. There are many biomasses that could be applied in treatment of radioactive wastes, for example, agricultural residues and macrophyte. The aim of this study is evaluate the ability of the Azolla sp., a floating aquatic plant, to absorb uranium in solution. Azolla sp. is a macrophyte that has been used to treat effluents containing heavy metals. The biosorption capacity of uranium by Azolla sp. was experimentally determined and modeled by isotherms. Experiments were performed to determine metal uptake, and then the solutions were analyzed by inductively coupled plasma optical emission spectrometry (ICP-OES). The isotherms applied to model the data was Langmuir, Freundlich, Sips Toth, Redlich Peternson, Two-Site-Langmuir, Radke Prausnitz to develop a technique for the treatment of radioactive liquid waste generated at the Nuclear and Energy Research Institute (IPEN-CNEN/SP), Brazil. (author)

  18. Biosorption of uranium by Azolla, SP, Brazil

    International Nuclear Information System (INIS)

    Vieira, Ludmila C.; Alves, Eliakim G.; Marumo, Julio T.; Ferreira, Rafael V. de P.; Canevesi, Rafael L.S.; Silva, Edson A.


    Radioactive liquid waste needs special attention and requires suitable treatment before deposition. Among the potential technologies under development for the treatment of liquid radioactive wastes the biosorption has been highlighted by being an efficient and low cost technique. Biosorption process involves the exchange of ions contained in the biomass matrix by others present in solution. There are many biomasses that could be applied in treatment of radioactive wastes, for example, agricultural residues and macrophyte. The aim of this study is evaluate the ability of the Azolla sp., a floating aquatic plant, to absorb uranium in solution. Azolla sp. is a macrophyte that has been used to treat effluents containing heavy metals. The biosorption capacity of uranium by Azolla sp. was experimentally determined and modeled by isotherms. Experiments were performed to determine metal uptake, and then the solutions were analyzed by inductively coupled plasma optical emission spectrometry (ICP-OES). The isotherms applied to model the data was Langmuir, Freundlich, Sips Toth, Redlich Peternson, Two-Site-Langmuir, Radke Prausnitz to develop a technique for the treatment of radioactive liquid waste generated at the Nuclear and Energy Research Institute (IPEN-CNEN/SP), Brazil. (author)

  19. Carbon sp chains in graphene nanoholes

    DEFF Research Database (Denmark)

    Castelli, Ivano Eligio; Ferri, Nicola; Onida, Giovanni


    Nowadays sp carbon chains terminated by graphene or graphitic-like carbon are synthesized routinely in several nanotech labs. We propose an ab initio study of such carbon-only materials, by computing their structure and stability, as well as their electronic, vibrational and magnetic properties. We...

  20. Lipid contents of the sponge Haliclona sp.

    Digital Repository Service at National Institute of Oceanography (India)

    Parameswaran, P.S.; Das, B.; Kamat, S.Y.

    Several fatty acids, sterols, batyl alcohol and its analogs and an N-acylated sphingosine (ceramide) have been isolated from the lipid fraction of the extract of the sponge Haliclona sp. The major sterol is found to be cholesterol (54%), followed...

  1. Test af spørgeskema

    DEFF Research Database (Denmark)

    Hermansen, Jonathan


    Denne bog gennemgår alle surveyarbejdets faser og giver en praktisk indføring i •design af undersøgelsen og udvælgelse af stikprøver, •formulering af spørgeskemaer samt indsamling og kodning af data, •metoder til at analysere resultaterne....

  2. Botrallin from the endophytic fungus Hyalodendriella sp ...

    African Journals Online (AJOL)



    Dec 12, 2011 ... Bioassay-guided fractionation of the crude methanol extract of the mycelia from the endophytic fungus. Hyalodendriella sp. Ponipodef12, associated with the hybrid 'Neva' of Populus deltoides Marsh × P. nigra L., led to the isolation of one compound coded as P12-1 which was identified as botrallin (1,7-.

  3. C (sp2)–C (sp2) cross coupling reaction catalyzed by a palladacycle ...

    Indian Academy of Sciences (India)

    (sp2) cross coupling reaction catalyzed by a palladacycle phosphine complex: A simple and sustainable protocol in aqueous media. Seyyed Javad Sabounchei Marjan Hosseinzadeh. Articles Volume 127 Issue 11 November 2015 pp 1919- ...

  4. Nanocrystalline sp{sup 2} and sp{sup 3} carbons: CVD synthesis and applications

    Energy Technology Data Exchange (ETDEWEB)

    Terranova, M. L. [Università degli Studi di Roma “Tor Vergata,” via Della Ricerca Scientifica, Dipartimento di Scienze e Tecnologie Chimiche—MinimaLab (Italy); Rossi, M. [Università degli Studi di Roma “Sapienza,” via A. Scarpa, Dipartimento di Scienze di Base e Applicate per l’Ingegneria and Centro di Ricerca per le Nanotecnologie Applicate all’Ingegneria (CNIS) (Italy); Tamburri, E., E-mail: [Università degli Studi di Roma “Tor Vergata,” via Della Ricerca Scientifica, Dipartimento di Scienze e Tecnologie Chimiche—MinimaLab (Italy)


    The design and production of innovative materials based on nanocrystalline sp{sup 2}- and sp{sup 3}-coordinated carbons is presently a focus of the scientific community. We present a review of the nanostructures obtained in our labs using a series of synthetic routes, which make use of chemical vapor deposition (CVD) techniques for the selective production of non-planar graphitic nanostructures, nanocrystalline diamonds, and hybrid two-phase nanostructures.

  5. Analisis Fosfor pada Cacing Tanah (Megascolex sp. dan Fridericia sp.) Secara Spektrofotometri Sinar Tampak


    Safira, Cut Shafa


    Earthworm is natural resource which can be used for medication due to its highly amount of minerals. One of these minerals is phosphorus. The aim of this research are to identify, determine and know the difference content of phosphorus in Megascolex sp. and Fridericia sp. Qualitative analysis shows positive results with addition of ammonium molybdate 4% and BaCl2 5%. Quantitative analysis was done using visible spectrophotometer with ascorbic acid method, measuring blu-colored molybdenum ...

  6. Differences in nutrient uptake capacity of the benthic filamentous algae Cladophora sp., Klebsormidium sp. and Pseudanabaena sp. under varying N/P conditions. (United States)

    Liu, Junzhuo; Vyverman, Wim


    The N/P ratio of wastewater can vary greatly and directly affect algal growth and nutrient removal process. Three benthic filamentous algae species Cladophora sp., Klebsormidium sp. and Pseudanabaena sp. were isolated from a periphyton bioreactor and cultured under laboratory conditions on varying N/P ratios to determine their ability to remove nitrate and phosphorus. The N/P ratio significantly influenced the algal growth and phosphorus uptake process. Appropriate N/P ratios for nitrogen and phosphorus removal were 5-15, 7-10 and 7-20 for Cladophora sp., Klebsormidium sp. and Pseudanabaena sp., respectively. Within these respective ranges, Cladophora sp. had the highest biomass production, while Pseudanabaena sp. had the highest nitrogen and phosphorus contents. This study indicated that Cladophora sp. had a high capacity of removing phosphorus from wastewaters of low N/P ratio, and Pseudanabaena sp. was highly suitable for removing nitrogen from wastewaters with high N/P ratio. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Anomalous self potential (sp) log signatures observed in a water ...

    African Journals Online (AJOL)

    Geophysical logging was done after drilling had been completed in a water well at Okwudor, South Eastern Nigeria. Three electric logs were run viz: Self Potential (SP), Resistivity N16″ and N64″ logs. An anomaly was observed in the SP log. The SP results from this well show some deviation from the standard norm.

  8. Biosorption of chromium by mangrove-derived Aplanochytrium sp ...

    African Journals Online (AJOL)

    The microbial dried biomass of Thraustochytrids is used as bioadsorbent for the removal of the chromium in aqueous solution. In this investigation, three species of Thraustochydrids namely Aplanochytrium sp., Thraustochytrium sp. and Schizochytrium sp. were tested for the efficiency of chromium accumulation by culturing ...

  9. Babesia peircei sp. nov. from the jackass penguin

    African Journals Online (AJOL)


    Jan 9, 1992 ... An avian piroplasm, Babesia peircei sp. nov. is described from the jackass penguin Spheniscus demersus. Morphological differences between Babesia peircei sp. nov. and the other valid Babesia spp. are discussed together with the possible vectors. 'n Voal-piroplasma, Babesia peircei sp. nov. afkomstig ...

  10. Occurrence of Aspergillus sp., Fusarium sp., and aflatoxins in corn hybrids with different systems of storage

    Directory of Open Access Journals (Sweden)

    Adriana Sbardelotto Di Domenico


    Full Text Available The aim of this study was to assess alternatives for viable corn storage for small rural properties in two annual storage experiments. A 4×5 factorial design was used with four types of storage (conventional bags, hermetic bags, metal silos and corncobs and five periods of storage (0, 3, 6, 9 and 12 months. We used corn hybrids 2B688RR and 30K73Hx cultivated in winter 2012 and summer 2012/2013 in the city of Dois Vizinhos, Paraná, Brazil. The moisture contents, counts of Aspergillus sp. and Fusarium sp., and the occurrence of aflatoxins (B1, B2, G1 and G2 were assessed. The kernels stored in hermetic bags had lower moisture contents. Aspergillus sp. and Fusarium sp. were observed in 20.37 and 86.11% of winter storage samples, respectively, and in 83.3 and 91.6% of summer storage samples, respectively. The storage system and time of storage had no influence on the occurrence of Aspergillus sp. and aflatoxins in the winter crop samples. The corncobs from the summer crop samples had the lowest counts of Aspergillus sp. and did not have aflatoxins. We detected aflatoxins at concentrations of 2.8-14.5 and 3-197.5 µg kg-1 in the winter and summer crop samples, respectively.

  11. Two new species of suctorians, Acineta satyanandani sp. nov. and Paracineta karunakarani sp. nov. epizoic on ostracods

    Digital Repository Service at National Institute of Oceanography (India)

    Santhakumari, V.

    Two, species of protozoic suctorians, Acineta satyanandani sp. nov. and Paracineta karunakarani sp. nov., are described. These were found attached on the body of the marine ostracod, Cypridina dentata (Muller), collected from the shelf and slope...

  12. The family Carabodidae (Acari, Oribatida) VIII. The genus Machadocepheus (first part) Machadocepheusleoneae sp. n. and Machadocepheusrachii sp. n. from Gabon. (United States)

    Fernandez, Nestor; Theron, Pieter; Rollard, Christine; Leiva, Sergio


    The genus Machadocepheus, being one of the more complex genera of the Carabodidae family, is briefly outlined to demonstrate this complexity. Descriptions of two new species from Gabon, Machadocepheusleoneae sp. n. and Machadocepheusrachii sp. n. are given.

  13. First report of Giardia sp. and Cryptosporidium sp. in fecal samples in blue macaw (Anodorhynchus hyacinthinus) in southern Brazil


    Matheus Hillard Farret; Vinicius da Rosa Fanfa; Luisa Ragagnin; Aleksandro Schafer da Silva; Silvia Gonzalez Monteiro


    This study reports the gastrointestinal parasitism by Giardia sp. and Cryptosporidium sp. in blue macaw (Anodorhynchus hyacinthinus) in the southern region of Brazil. Fecal samples of two species kept in captivity in the state of Rio Grande do Sul were analyzed by the direct smear method, centrifugal flotation technique with zinc sulfate and Kinyoun staining technique for research of parasites. Mixed infection by eggs of Capillaria, cysts of Giardia sp. and oocysts of Cryptosporidium sp. was ...

  14. Agromyces italicus sp. nov., Agromyces humatus sp. nov. and Agromyces lapidis sp. nov., isolated from Roman catacombs. (United States)

    Jurado, Valme; Groth, Ingrid; Gonzalez, Juan M; Laiz, Leonila; Schuetze, Barbara; Saiz-Jimenez, Cesareo


    A polyphasic study was carried out to clarify the taxonomic positions of three Gram-positive isolates from the Catacombs of Domitilla, Rome (Italy). 16S rRNA gene sequence comparisons placed these strains within the genus Agromyces. The morphological and chemotaxonomic characteristics of these isolates were consistent with the description of the genus Agromyces. The three isolates could be readily distinguished from one another and from representatives of all Agromyces species with validly published names by a broad range of phenotypic characteristics and DNA-DNA relatedness studies. Therefore, these isolates are proposed to represent three novel species of the genus Agromyces, Agromyces italicus sp. nov. (type strain CD1(T)=HKI 0325(T)=DSM 16388(T)=NCIMB 14011(T)), Agromyces humatus sp. nov. (type strain CD5(T)=HKI 0327(T)=DSM 16389(T)=NCIMB 14012(T)) and Agromyces lapidis sp. nov. (type strain CD55(T)=HKI 0324(T)=DSM 16390(T)=NCIMB 14013(T)).

  15. Cryptotrichosporon argae sp. nov., Cryptotrichosporon brontae sp. nov. and Cryptotrichosporon steropae sp. nov., isolated from forest soils. (United States)

    Pontes, Ana; Röhl, Oliver; Maldonado, Cristina; Yurkov, Andrey M; Sampaio, José Paulo


    Yeast strains belonging to the basidiomycetous genus Cryptotrichosporon were isolated from forest soils in Serra da Arrábida Natural Park in Portugal. Similar to the already-known representatives of this genus, the new isolates formed pigmented colonies of a distinctive pale orange colour. Phylogenetic analyses employing concatenated sequences of the D1/D2 domains of the 26S (large subunit) rRNA gene and the internal transcribed spacer (ITS) region supported the recognition of three novel species: Cryptotrichosporon argae sp. nov. (type strain CM 19T=CBS 14376T=PYCC 7010T=DSM 104550T; MycoBank accession number MB 817168), Cryptotrichosporon brontae sp. nov. (type strain CM 1562T=CBS 14303T=PYCC 7011T=DSM 104551T; MycoBank accession number MB 817077) and Cryptotrichosporon steropae sp. nov. (type strain OR 395T=CBS 14302T=PYCC 7012T=DSM 104552T; MycoBank accession number MB 817078).

  16. Fitoremediasi limbah budidaya sidat menggunakan filamentous algae (Spirogyra sp.

    Directory of Open Access Journals (Sweden)

    Tri Apriadi


    Full Text Available Penelitian ini bertujuan untuk mengetahui potensi dari filamentous algae (Spirogyra sp. sebagai agen bioremediasi dalam mereduksi kandungan bahan organik limbah budidaya sidat. Penelitian menggunakan rancangan acak lengkap dengan perlakuan perbedaan dosis limbah (25 %, 50 %, 75 %, 100%. Wadah penelitian berupa akuarium resirkulasi menggunakan sistem carrousel. Dilakukan pengukuran secara rutin terhadap beberapa parameter kualitas air serta perubahan bobot Spirogyra sp. selama dua minggu retensi. Diperoleh hasil bahwa penurunan konsentrasi bahan organik menggunakan Spirogyra sp. berlangsung efektif hingga hari keenam. Spirogyra sp. mampu mentolelir limbah budidaya sidat pada dosis limbah 25% dan 50%. Spirogyra sp. pada perlakuan dosis limbah 50% memiliki kemampuan yang lebih baik dalam menurunkan bahan organik limbah budidaya sidat.

  17. A superhard sp3 microporous carbon with direct bandgap (United States)

    Pan, Yilong; Xie, Chenlong; Xiong, Mei; Ma, Mengdong; Liu, Lingyu; Li, Zihe; Zhang, Shuangshuang; Gao, Guoying; Zhao, Zhisheng; Tian, Yongjun; Xu, Bo; He, Julong


    Carbon allotropes with distinct sp, sp2, and sp3 hybridization possess various different properties. Here, a novel all-sp3 hybridized tetragonal carbon, namely the P carbon, was predicted by the evolutionary particle swarm structural search. It demonstrated a low density among all-sp3 carbons, due to the corresponding distinctive microporous structure. P carbon is thermodynamically stable than the known C60 and could be formed through the single-walled carbon nanotubes (SWCNTs) compression. P carbon is a direct bandgap semiconductor displaying a strong and superhard nature. The unique combination of electrical and mechanical properties constitutes P carbon a potential superhard material for semiconductor industrial fields.

  18. Sp6 and Sp8 Transcription Factors Control AER Formation and Dorsal-Ventral Patterning in Limb Development (United States)

    Haro, Endika; Delgado, Irene; Junco, Marisa; Yamada, Yoshihiko; Mansouri, Ahmed; Oberg, Kerby C.; Ros, Marian A.


    The formation and maintenance of the apical ectodermal ridge (AER) is critical for the outgrowth and patterning of the vertebrate limb. The induction of the AER is a complex process that relies on integrated interactions among the Fgf, Wnt, and Bmp signaling pathways that operate within the ectoderm and between the ectoderm and the mesoderm of the early limb bud. The transcription factors Sp6 and Sp8 are expressed in the limb ectoderm and AER during limb development. Sp6 mutant mice display a mild syndactyly phenotype while Sp8 mutants exhibit severe limb truncations. Both mutants show defects in AER maturation and in dorsal-ventral patterning. To gain further insights into the role Sp6 and Sp8 play in limb development, we have produced mice lacking both Sp6 and Sp8 activity in the limb ectoderm. Remarkably, the elimination or significant reduction in Sp6;Sp8 gene dosage leads to tetra-amelia; initial budding occurs, but neither Fgf8 nor En1 are activated. Mutants bearing a single functional allele of Sp8 (Sp6−/−;Sp8+/−) exhibit a split-hand/foot malformation phenotype with double dorsal digit tips probably due to an irregular and immature AER that is not maintained in the center of the bud and on the abnormal expansion of Wnt7a expression to the ventral ectoderm. Our data are compatible with Sp6 and Sp8 working together and in a dose-dependent manner as indispensable mediators of Wnt/βcatenin and Bmp signaling in the limb ectoderm. We suggest that the function of these factors links proximal-distal and dorsal-ventral patterning. PMID:25166858

  19. Bioakumulasi logam berat Cu oleh Bacillus sp

    Directory of Open Access Journals (Sweden)

    Riesta Primaharinastiti


    Full Text Available The research was conducted to investigate the ability of Bacillus sp in accumulating Cu and how much it can be acumulated. Themedium used to growth the bacterium was Nutrient Broth and Atomic Absorption Spectrophotometry methods was used to assay theCu, both in the cells and medium. The result of this study showed that Bacillus sp incubated in the Nutrient Broth medium containing10 ppm of Cu, with continuous stirring in the room temperature was able to reduce Cu in the medium 8.912–12.623% and accumulateCu in the cell 0.1149–0.1400 %/mg cells. Based on this result, it is necessary to develop more studies to find out what factors thatinfluence the accumulation process and to optimize the bioprocess.

  20. Analysis list: SP2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SP2 Blood,Liver,Pluripotent stem cell + hg19,, http://dbarchive.biosciencedbc

  1. Superfield quantization in Sp(2) covariant formalism

    CERN Document Server

    Lavrov, P M


    The rules of the superfield Sp(2) covariant quantization of the arbitrary gauge theories for the case of the introduction of the gauging with the derivative equations for the gauge functional are generalized. The possibilities of realization of the expanded anti-brackets are considered and it is shown, that only one of the realizations is compatible with the transformations of the expanded BRST-symmetry in the form of super translations along the Grassmann superspace coordinates

  2. Carbon sp chains in graphene nanoholes (United States)

    Castelli, Ivano E.; Ferri, Nicola; Onida, Giovanni; Manini, Nicola


    Nowadays sp carbon chains terminated by graphene or graphitic-like carbon are synthesized routinely in several nanotech labs. We propose an ab initio study of such carbon-only materials, by computing their structure and stability, as well as their electronic, vibrational and magnetic properties. We adopt a fair compromise of microscopic realism with a certain level of idealization in the model configurations, and predict a number of properties susceptible to comparison with experiment.

  3. Commercial technologies from the SP-100 program

    International Nuclear Information System (INIS)

    Truscello, V.C.; Fujita, T.; Mondt, J.F.


    For more than a decade, Jet Propulsion Labortory and Los Alamos have managed a multi-agency funded effort to develop a space reactor power system. This SP-100 Program has developed technologies required for space power systems that can be implemented in the industrial and commercial sectors to improve competitiveness in the global economy. Initial steps taken to transfer this technology from the laboratories to industrial and commercial entities within United States include: (1) identifying specific technologies having commercial potential; (2) distributing information describing the identified technologies and interacting with interested commercial and industrial entities to develop application-specific details and requirements; and (3) providing a technological data base that leads to transfer of technology or the forming of teaming arrangements to accomplish the transfer by tailoring the technology to meet application-specific requirements. SP-100 technologies having commercial potential encompass fabrication processes, devices, and components. Examples: a process for bonding refractory metals to graphite, a device to sense the position of an actuator and a component to enable rotating machines to operate without supplying lubrication (self-lubricating ball bearing). Shortly after the NASA Regional Technology Transfer Centers widely disseminated information covering SP-100 technologies, over one hundred expressions of interest were received, which indicate that there is a large potential benefit in transferring SP-100 technology. Interactions with industrial and commercial entities have identified a substantial need for creating teaming arrangements involving the interested entity and personnel from laboratories and their contractors, who have the knowledge and ability to tailor the technology to meet application-specific requirements. copyright 1995 American Institute of Physics

  4. Sterols from the Madagascar sponge Fascaplysinopsis sp. (United States)

    Aknin, Maurice; Gros, Emmanuelle; Vacelet, Jean; Kashman, Yoel; Gauvin-Bialecki, Anne


    The sponge Fascaplysinopsis sp. (order Dictyoceratida, Family Thorectidae) from the west coast of Madagascar (Indian Ocean) is a particularly rich source of bioactive nitrogenous macrolides. The previous studies on this organism led to the suggestion that the latter should originate from associated microsymbionts. In order to evaluate the influence of microsymbionts on lipid content, 10 samples of Fascaplysinopsis sp. were investigated for their sterol composition. Contrary to the secondary metabolites, the sterol patterns established were qualitatively and quantitatively stable: 14 sterols with different unsaturated nuclei, Δ(5), Δ(7) and Δ(5,7), were identified; the last ones being the main sterols of the investigated sponges. The chemotaxonomic significance of these results for the order Dictyoceratida is also discussed in the context of the literature. The conjugated diene system in Δ(5,7) sterols is known to be unstable and easily photo-oxidized during storage and/or experiments to produce 5α,8α-epidioxy sterols. However, in this study, no 5α,8α-epidioxysterols (or only trace amounts) were observed. Thus, it was supposed that photo-oxidation was avoided thanks to the natural antioxidants detected in Fascaplysinopsis sp. by both the DPPH and β-caroten bleaching assays.

  5. Sterols from the Madagascar Sponge Fascaplysinopsis sp.

    Directory of Open Access Journals (Sweden)

    Yoel Kashman


    Full Text Available The sponge Fascaplysinopsis sp. (order Dictyoceratida, Family Thorectidae from the west coast of Madagascar (Indian Ocean is a particularly rich source of bioactive nitrogenous macrolides. The previous studies on this organism led to the suggestion that the latter should originate from associated microsymbionts. In order to evaluate the influence of microsymbionts on lipid content, 10 samples of Fascaplysinopsis sp. were investigated for their sterol composition. Contrary to the secondary metabolites, the sterol patterns established were qualitatively and quantitatively stable: 14 sterols with different unsaturated nuclei, D5, D7 and D5,7, were identified; the last ones being the main sterols of the investigated sponges. The chemotaxonomic significance of these results for the order Dictyoceratida is also discussed in the context of the literature. The conjugated diene system in D5,7 sterols is known to be unstable and easily photo-oxidized during storage and/or experiments to produce 5a,8a-epidioxy sterols. However, in this study, no 5a,8a-epidioxysterols (or only trace amounts were observed. Thus, it was supposed that photo-oxidation was avoided thanks to the natural antioxidants detected in Fascaplysinopsis sp. by both the DPPH and b-caroten bleaching assays.

  6. Syrian hamsters (Mesocricetus auratus) with simultaneous intestinal Giardia sp., Spironucleus sp., and trichomonad infections. (United States)

    Sheppard, Barbara J; Stockdale Walden, Heather D; Kondo, Hirotaka


    A commercial facility producing hamsters with a history of infection by dwarf tapeworm (Hymenolepis nana) submitted 15 animals for necropsy and postmortem parasitological and microscopic examination. No tapeworms were detected grossly or microscopically. Fecal examination including gastrointestinal mucosal smears demonstrated mixed intestinal bacteria and low numbers of Giardia sp. Histologic examination of small intestine demonstrated filling of the small intestinal crypts by large numbers of 7-9 µm × 3 µm, rod to crescent or teardrop-shaped flagellates consistent with Spironucleus sp. These organisms had two 1-µm, basophilic, oval nuclei and multiple superficial flagella-like structures. Much larger 10-15 µm × 8-10 µm, oval to pear-shaped organisms were also present in lower numbers and usually located with the crypts. These larger flagellates had multiple flagella and a basophilic rod-shaped nucleus. The larger flagellates included Giardia sp., which had an intimate interface with the surface of the mucosal epithelium, bilaterally symmetry, and binucleation. Lower numbers of trichomonads were also present and were distinguished by an undulating surface membrane and a single nucleus. The mucosa was hyperplastic and moderately inflamed. Although the tapeworm infection was resolved, diagnosis of multiple intestinal flagellates by fecal examination is complicated by the varying sensitivity and diagnostic accuracy of different types of fecal analysis for different flagellate types. Key differences in the morphology and location of the different types of flagellates as observed by histology of intestinal tissues provide important additional diagnostic information to distinguish trichomonads, Spironucleus sp., and Giardia sp.

  7. Borrelia bissettiae sp. nov. and Borrelia californiensis sp. nov. prevail in diverse enzootic transmission cycles (United States)

    Margos, Gabriele; Lane, Robert S.; Fedorova, Natalia; Koloczek, Johannes; Piesman, Joseph; Hojgaard, Andrias; Sing, Andreas; Fingerle, Volker


    Two species of the genus Borrelia, Borrelia bissettiae sp. nov. and Borrelia californiensis sp. nov., were first described by Postic and co-workers on the basis of genetic analyses of several loci. Multilocus sequence analysis of eight housekeeping loci confirmed that these two Borrelia genomospecies are distinct members of the Borrelia burgdorferi sensu lato complex. B. bissettiae sp. nov. was initially described in transmission cycles involving Neotoma fuscipes wood rats and Ixodes pacificus ticks in California, and Neotoma mexicana and Ixodes spinipalpis in Colorado. The preferred host of B. californiensis sp. nov. appears to be the California kangaroo rat, Dipodomys californicus; Ixodes jellisoni, I. spinipalipis and I. pacificus ticks are naturally infected with it. Thus, the ecological associations of the two genomospecies and their genetic distance from all other known Borrelia genomospecies species justify their description as separate genomospecies: B. bissettiae sp. nov. (type strain DN127T=DSM 17990T= CIP 109136T) and B. californiensis (type strain CA446T=DSM 17989T=ATCC BAA-2689T). PMID:26813420


    Directory of Open Access Journals (Sweden)



    Full Text Available Streptomyces sp was conducted from December 2010 - June 2011 at the Laboratoryof Microbiology, Biology Department, Math and Science Faculty, UdayanaUniversity Bukit Jimbaran-Bali. Implementation stages of the research consisted ofisolation and testing of the antibiotic activity Streptomyces sp to inhibit growthbacterial pathogens Erwinia sp as a cause of disease in plants fallen foul (Soft rot ofAloe barbadensis Mill.The results of this study have eight isolates of Streptomyces spwith macroscopic and microscopic characters are varied. Furthermore, all isolateswere obtained and then tested against antibiotic activity to inhibit growth the bacteriaErwinia sp. Test results obtained by Streptomyces sp that has the most effective ininhibiting the ability of the bacteria Erwinia sp isolates are Streptomyces sp2for (45%.

  9. SpAHA1 and SpSOS1 Coordinate in Transgenic Yeast to Improve Salt Tolerance.

    Directory of Open Access Journals (Sweden)

    Yang Zhou

    Full Text Available In plant cells, the plasma membrane Na+/H+ antiporter SOS1 (salt overly sensitive 1 mediates Na+ extrusion using the proton gradient generated by plasma membrane H+-ATPases, and these two proteins are key plant halotolerance factors. In the present study, two genes from Sesuvium portulacastrum, encoding plasma membrane Na+/H+ antiporter (SpSOS1 and H+-ATPase (SpAHA1, were cloned. Localization of each protein was studied in tobacco cells, and their functions were analyzed in yeast cells. Both SpSOS1 and SpAHA1 are plasma membrane-bound proteins. Real-time polymerase chain reaction (PCR analyses showed that SpSOS1 and SpAHA1 were induced by salinity, and their expression patterns in roots under salinity were similar. Compared with untransformed yeast cells, SpSOS1 increased the salt tolerance of transgenic yeast by decreasing the Na+ content. The Na+/H+ exchange activity at plasma membrane vesicles was higher in SpSOS1-transgenic yeast than in the untransformed strain. No change was observed in the salt tolerance of yeast cells expressing SpAHA1 alone; however, in yeast transformed with both SpSOS1 and SpAHA1, SpAHA1 generated an increased proton gradient that stimulated the Na+/H+ exchange activity of SpSOS1. In this scenario, more Na+ ions were transported out of cells, and the yeast cells co-expressing SpSOS1 and SpAHA1 grew better than the cells transformed with only SpSOS1 or SpAHA1. These findings demonstrate that the plasma membrane Na+/H+ antiporter SpSOS1 and H+-ATPase SpAHA1 can function in coordination. These results provide a reference for developing more salt-tolerant crops via co-transformation with the plasma membrane Na+/H+ antiporter and H+-ATPase.

  10. Copper resistance of different ectomycorrhizal fungi such as Pisolithus microcarpus, Pisolithus sp., Scleroderma sp. and Suillus sp.

    Directory of Open Access Journals (Sweden)

    R.F. Silva


    Full Text Available Environments contaminated with heavy metals negatively impact the living organisms. Ectomycorrhizal fungi have shown important role in these impacted sites. Thus, this study aimed to evaluate the copper-resistance of ectomycorrhizal fungi isolates Pisolithus microcarpus - UFSC-Pt116; Pisolithus sp. - UFSC-PT24, Suillus sp. - UFSM RA 2.8 and Scleroderma sp. - UFSC-Sc124 to different copper doses in solid and liquid media. The copper doses tested were: 0.00, 0.25, 0.5, 0.75, 1.0 and 1.25 mmol L-1 in the solid medium and 0.00, 0.32, 0.64 and 0.96 mmol L-1 in the liquid medium. Copper was amended as copper sulphate in order to supplement the culture medium MNM at pH 4.8, with seven replicates to each fungus-dose combination. The fungal isolates were incubated for 30 days at 28 °C. UFSC-Pt116 showed high copper-resistance such as accessed by CL50 determinations (concentration to reduce 50% of the growth as while as UFSC-PT24 displayed copper-resistance mechanism at 0.50 mmol L-1 in solid medium. The UFSC-PT24 and UFSC-Sc124 isolates have increased copper-resistance in liquid medium. The higher production of extracellular pigment was detected in UFSC-Pt116 cultures. The UFSC-Pt116 and UFSC-PT24 isolates showed higher resistance for copper and produced higher mycelium biomass than the other isolates. In this way, the isolates UFSG-Pt116 and UFSC-PT24 can be important candidates to survive in copper-contaminated areas, and can show important role in plants symbiosis in these contaminated sites.

  11. Isolation of C11 Cyclopentenones from Two Didemnid Species, Lissoclinum sp. and Diplosoma sp.

    Directory of Open Access Journals (Sweden)

    Katsuhiro Ueda


    Full Text Available A series of new C11 cyclopentenones 1-7 was isolated, together with four known metabolites 9/10, 12 and 13, from the extract of the didemnid ascidian Lissoclinum sp. The other didemnid ascidian Diplosoma sp. contained didemnenones 1, 2 and 5, and five known metabolites 8-12. The structures of 1-7 were elucidated by spectroscopic analyses. Cytotoxicity of the isolated compounds was evaluated against three human cancer cell lines (HCT116, A431 and A549.

  12. Construction of human MASP-2-CCP1/2SP, CCP2SP, SP plasmid DNA nanolipoplexes and the effects on tuberculosis in BCG-infected mice. (United States)

    Gao, Qi; Dong, Xinfang; Luo, Yanping; Zhang, Guochao; Shan, Jinyu; Wang, Qian; He, Qi; Zhang, Lifeng; Wang, Jingqiu; Zhu, Bingdong; Ma, Xingming


    The lectin pathway, one of the complement cascade systems, provides the primary line of defense against invading pathogens. The serine protease of MASP-2 plays an essential role in complement activation of the lectin pathway. The C-terminal segment of MASP-2 is comprised of the CCP1-CCP2-SP domains, and is the crucial catalytic segment. However, what is the effect of CCP1-CCP2-SP domains in controlling chronic infection is unknown. In order to evaluate the potential impact of CCP1-CCP2-SP domains on tuberculosis, we constructed the human MASP-2 CCP1/2SP, CCP2SP and SP recombinant plasmids, and delivered these plasmids by DNA-DOTAP:cholesterol cationic nanolipoplexes to BCG-infected mice. After 21 days post DNA-DOTAP:chol nanolipoplexes application, we analyzed bacteria loads of pulmonary, pathology of granuloma, lymphocyte subpopulations. The C3a, C4a and MASP-2 levels in serum were measured with enzyme-linked immunosorbent assays. Compared to the control group that received GFP DNA-DOTAP:chol nanolipoplexes, MASP-2 CCP1/2SP DNA-DOTAP:chol nanolipoplexes treated group showed significantly enlarged pulmonary granulomas lesion (P  0.05). These findings provided experimental evidence that MASP-2 CCP1/2SP DNA nanolipoplexes shown the negative efficacy in controlling Mycobacterium tuberculosis infection, and displayed a potential role of down-regulating T-cell-mediated immunity in tuberculosis. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Quality improvement on half-fin anchovy (Setipinna taty) fish sauce by Psychrobacter sp. SP-1 fermentation. (United States)

    Zheng, Bin; Liu, Yu; He, Xiaoxia; Hu, Shiwei; Li, Shijie; Chen, Meiling; Jiang, Wei


    A method of improving fish sauce quality during fermentation was investigated. Psychrobacter sp. SP-1, a halophilic protease-producing bacterium, was isolated from fish sauce with flavor-enhancing properties and non-biogenic amine-producing activity. The performance of Psychrobacter sp. SP-1 in Setipinna taty fish sauce fermentation was investigated further. The inoculation of Psychrobacter sp. SP-1 did not significantly affect pH or NaCl concentration changes (P > 0.05), although it significantly increased total moderately halophilic microbial count, protease activity, total soluble nitrogen content and amino acid nitrogen content, and also promoted the umami taste and meaty aroma (P < 0.05). Furthermore, the inoculation of Psychrobacter sp. SP-1 significantly decreased total volatile basic nitrogen content and biogenic amines content (P < 0.05), which were regarded as harmful compounds in foods. The results of the present study demonstrate that Psychrobacter sp. SP-1 can be used as a potential starter culture for improving fish sauce quality by fermentation. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  14. Dominancy of Trichodesmium sp. in the Biawak Island (United States)

    Prihadi, D. J.


    The Biawak Island is one of the small islands in West Java Province with an abundance of marine biological resources. This research was conducted to collect the primary producer zooplankton and water quality parameters. Direct observation is done by field surveys and measurement in situ for plankton and environmental parameters such as temperature, water transparency, water current, salinity, dissolved oxygen, and pH. Trichodesmium sp. was found dominance in where some other types of zooplankton were found in the area, like Scenedesmus sp., Sagitta sp., Acartia sp. also occurred. Further, the most abundance of Trichodesmium sp. was found in southern of Biawak Island where mangroves, coral and seagrass ecosystem provide nutrients which indirectly support the abundance of planktons. Trichodesmium sp. is plankton that can survive in water with minimum nutrient.

  15. The SP Theory of Intelligence: An Overview

    Directory of Open Access Journals (Sweden)

    J Gerard Wolff


    Full Text Available This article is an overview of the SP theory of intelligence, which aims to simplify and integrate concepts across artificial intelligence, mainstream computing and human perception and cognition, with information compression as a unifying theme. It is conceived of as a brain-like system that receives "New" information and stores some or all of it in compressed form as "Old" information; and it is realised in the form of a computer model, a first version of the SP machine. The matching and unification of patterns and the concept of multiple alignment are central ideas. Using heuristic techniques, the system builds multiple alignments that are "good" in terms of information compression. For each multiple alignment, probabilities may be calculated for associated inferences. Unsupervised learning is done by deriving new structures from partial matches between patterns and via heuristic search for sets of structures that are "good" in terms of information compression. These are normally ones that people judge to be "natural", in accordance with the "DONSVIC" principle—the discovery of natural structures via information compression. The SP theory provides an interpretation for concepts and phenomena in several other areas, including "computing", aspects of mathematics and logic, the representation of knowledge, natural language processing, pattern recognition, several kinds of reasoning, information storage and retrieval, planning and problem solving, information compression, neuroscience and human perception and cognition. Examples include the parsing and production of language with discontinuous dependencies in syntax, pattern recognition at multiple levels of abstraction and its integration with part-whole relations, nonmonotonic reasoning and reasoning with default values, reasoning in Bayesian networks, including "explaining away", causal diagnosis, and the solving of a geometric analogy problem.

  16. Early SP-100 flight mission designs

    International Nuclear Information System (INIS)

    Josloff, A.T.; Shepard, N.F.; Kirpich, A.S.; Murata, R.; Smith, M.A.; Stephen, J.D.


    Early flight mission objectives can be met with a Space Reactor Power System (SRPS) using thermoelectric conversion in conjunction with fast spectrum, lithium-cooled reactors. This paper describes two system design options using thermoelectric technology to accommodate an early launch. In the first of these options, radiatively coupled Radioiosotope Thermoelectric Generator (RTG) unicouples are adapted for use with a SP-100-type reactor heat source. Unicouples have been widely used as the conversion technology in RTGs and have demonstrated the long-life characteristics necessary for a highly relible SRPS. The thermoelectric leg height is optimized in conjunction with the heat rejection temperature to provide a mass optimum 6-kW e system configured for launch on a Delta II launch vehicle. The flight-demonstrated status of this conversion technology provides a high confidence that such a system can be designed, assembled, tested, and launched by 1997. The use of a SP-100-type reactor assures compliance with safety requirements and expedites the flight safety approval process while, at the same time, providing flight performance verification for a heat source technology with the growth potential to meet future national needs for higher power levels. A 15-kW 2 , Atlas IIAS-launched system using the compact, conductively coupled multicouple converters being developed under the SP-100 program to support an early flight system launch also described. Both design concepts have been scaled to 20-kW e in order to support recent studies by DOE/NASA for higher power early launch missions

  17. Amino Alcohols from the Ascidian Pseudodistoma sp.

    Directory of Open Access Journals (Sweden)

    Tae Hyung Won


    Full Text Available Seven new amino alcohol compounds, pseudoaminols A–G (1–7, were isolated from the ascidian Pseudodistoma sp. collected off the coast of Chuja-do, Korea. Structures of these new compounds were determined by analysis of the spectroscopic data and from chemical conversion. The presence of an N-carboxymethyl group in two of the new compounds (6 and 7 is unprecedented among amino alcohols. Several of these compounds exhibited moderate antimicrobial activity and cytotoxicity, as well as weak inhibitory activity toward Na+/K+-ATPase.

  18. SP-100 control drive assembly development (United States)

    Gleason, Thomas; Gilchrist, A. Richard; Schuster, Gary


    The SP-100 is an electrical generating nuclear power system for space operation. This paper describes the nuclear reactor control systems and the methods used to assure reliable performance for the 10-year design life. Reliable performance is achieved by redundancy and by selecting highly reliable components and design features. Reliability is quantified by analysis using established reliability data. Areas lacking reliability data are identified for development testing. A specific development test description is provided as an example to demonstrate how this process is meeting the system reliability goals.


    Directory of Open Access Journals (Sweden)

    Zumrotus Sholichah


    Full Text Available Nyamuk Culex sp lebih menyukai meletakkan telurnya pada genangan air berpolutan tinggi, berkembang biak di air keruh dan lebih menyukai genangan air yang sudah lama daripada genangan air yang baru. Aktif menggigit pada malam hari. Tempat yang gelap, sejuk dan lembab merupakan tempat yang disukai untuk beristirahat. Nyamuk betina dewasa menggigit dengan abdomen terletak sejajar dengan permukaan induk semang yang sedang digigit.Gangguan yang ditimbulkan oleh nyamuk selain dapat menularkan penyakit juga dapat sangat mengganggu dengan dengungan dan gigitannya sehingga bagi orang-orang tertentu dapat menimbulkan phobi (entomopobhia serta dapat menyebabkan dermatitis dan urticaria.

  20. Methyl (Sp-2-(diphenylphosphinoferrocene-1-carboxylate

    Directory of Open Access Journals (Sweden)

    Petr Štěpnička


    Full Text Available The title compound, [Fe(C5H5(C19H16O2P], obtained serendipitously during recrystallization of 1-hydroxybenzotriazolyl (Sp-2-(diphenylphosphinoferrocene-1-carboxylate from methanol, crystallizes in the chiral space group P212121. Its crystal structure not only confirms the anticipated absolute configuration but also establishes a rather regular geometry for the ferrocene unit, devoid of any significant deformation due to the attached substituents. In the crystal, symmetry-related molecules are linked via weak C—H...O interactions.

  1. Genome Sequence of Streptomyces sp. Strain Tü6071▿


    Erxleben, Anika; Wunsch-Palasis, Julia; Grüning, Björn A.; Luzhetska, Marta; Bechthold, Andreas; Günther, Stefan


    Streptomyces sp. Tü6071 is a soil-dwelling bacterium which has a highly active isoprenoid biosynthesis. Isoprenoids are important precursors for biopharmaceutical molecules such as antibiotics or anticancer agents, e.g., landomycin. Streptomyces sp. Tü6071 produces the industrially important terpene glycosides phenalinolactones, which have antibacterial activity against several Gram-positive bacteria. The availability of the genome sequence of Streptomyces sp. Tü6071 allows for understanding ...

  2. Screening of biodiesel production from waste tuna oil (Thunnus sp.), seaweed Kappaphycus alvarezii and Gracilaria sp. (United States)

    Alamsjah, Mochammad Amin; Abdillah, Annur Ahadi; Mustikawati, Hutami; Atari, Suci Dwi Purnawa


    Biodiesel has several advantages over solar. Compared to solar, biodiesel has more eco-friendly characteristic and produces lower greenhouse gas emissions. Biodiesel that is made from animal fats can be produced from fish oil, while other alternative sources from vegetable oils are seaweed Kappaphycus alvarezii and Gracilaria sp. Waste tuna oil (Thunnus sp.) in Indonesia is commonly a side product of tuna canning industries known as tuna precook oil; on the other hand, seaweed Gracilaria sp. and Kappaphycus alvarezii are commonly found in Indonesia's seas. Seaweed waste that was used in the present study was 100 kg and in wet condition, and the waste oil was 10 liter. The seaweed was extracted with soxhletation method that used n-hexane as the solvent. To produce biodiesel, trans esterification was performed on the seaweed oil that was obtained from the soxhletation process and waste tuna oil. Biodiesel manufactured from seaweed K. alvarezii obtained the best score in flash point, freezing point, and viscosity test. However, according to level of manufacturing efficiency, biodiesel from waste tuna oil is more efficient and relatively easier compared to biodiesel from waste K. alvarezii and Gracilaria sp.


    Directory of Open Access Journals (Sweden)

    Juliana Jerásio Bianche

    Full Text Available ABSTRACT To evaluate the adhesive efficiency on the union of glued joints in a particular temperature and humidity conditions for a specified time the adhesive must be submitted to specific load tests, such as shear in the glue line. The objective of this study was to evaluate the shear strength in the glue line of Eucalyptus sp and Pinus sp.woods. Five adhesives (castor oil, sodium silicate, modified silicate, , PVA and resorcinol-formaldehyde, three weights (150 g/m2, 200 g/m2, and 250 g/m2 and two species (Eucalyptus sp. and Pinus sp. of wood were used. Twelve specimens were obtained from each repetition per treatment, corresponding to 108 specimens that were conditioned at a temperature of 23 ± 1°C and relative humidity of 50 ± 2%. The interaction between the weight and type of adhesive was significant for the shear strength in the glue line of eucalyptus wood. However, no interaction between the weight and the adhesive was found for pinus, only the isolated from the adhesive effect. Chemical bonds originated in the polymerization of resorcinol-formaldehyde adhesives and castor bi-component conferred upon these adhesives the greatest resistance in the glue line. Castor and resorcinol-formaldehyde adhesives showed the highest shear strength values in the line of glue and wood failure. Castor adhesive presented satisfactory performance for bonding of eucalyptus and pine woods.

  4. Genetic diversity in Fusarium oxysporum f.sp. dianthi and F. redolens f.sp. dianthi

    NARCIS (Netherlands)

    Baayen, R.P.; Dreven, van F.; Krijger, M.C.; Waalwijk, C.


    Pathogenic isolates were selected representing all known vegetative compatibility groups (VCGs) and races of Fusarium oxysporum sensu lato from Dianthus spp. On basis of differences in the internal transcribed spacer region of the ribosomal DNA, six VCGs were classified as F. oxysporum f.sp. dianthi

  5. Biodegradation of hexavalent chromium (Cr+6) in wastewater using Pseudomonas sp. and Bacillus sp. bacterial strains

    Energy Technology Data Exchange (ETDEWEB)

    Qasim, Muhammad [Department of Chemical Engineering, American University of Sharjah (United Arab Emirates)


    The recovery of toxic metal compounds is a deep concern in all industries. Hexavalent chromium is particularly worrying because of its toxic influence on human health. In this paper, biodegradation of hexavalent chromium (Cr+6) present in wastewater has been studied using two different bacterial strains; Pseudomonas sp. and Bacillus sp. A chemostat (with and without recycle of cells) with 10 L liquid culture volume was used to study the substrate and the biomass cell concentrations with time. Also, the degree of substrate conversion was studied by the varying the dilution rate as an independent parameter. The dilution rate (ratio of feed flow rate to the culture volume) was varied by varying the feed volumetric rate from 110-170 mL/h for inlet hexavalent chromium concentrations of 70 mg/dm3. The results show that a chemostat with recycle gives a better performance in terms of substrate conversion than a chemostat without a recycle. Moreover, the degree of substrate conversion decreases as the dilution rate is increased. Also, Bacillus sp. was found to give higher conversions compared to pseudomonas sp.

  6. Sp(2) covariant quantisation of general gauge theories

    International Nuclear Information System (INIS)

    Vazquez-Bello, J.L.


    The Sp(2) covariant quantization of gauge theories is studied. The geometrical interpretation of gauge theories in terms of quasi principal fibre bundles Q(M s , G s ) is reviewed. It is then described the Sp(2) algebra of ordinary Yang-Mills theory. A consistent formulation of covariant Lagrangian quantisation for general gauge theories based on Sp(2) BRST symmetry is established. The original N = 1, ten dimensional superparticle is considered as an example of infinitely reducible gauge algebras, and given explicitly its Sp(2) BRST invariant action. (author). 18 refs

  7. Lagenidium callinectes INFECTION ON ROTIFERS Brachionus sp.

    Directory of Open Access Journals (Sweden)

    Des Roza


    Full Text Available Milkfish, Chanos chanos and humpback grouper, Cromileptes altivelis hatcheries have developed at Gondol, Bali since 1995 and until now still rely on rotifers, the main natural food, supply. Recent problem on mass culture of rotifer, Brachionus sp. is harvest failure caused by fungus infection. Under light microscope, infected eggs and bodies of the rotifers was filled with numerous aseptate hyphae. Two isolates of fungi were isolated from rotifer eggs and carcass on June 21st, 2004 and on June 25th, 2004 obtained from milkfish and humpback grouper hatcheries at Gondol. Based on its morphological characteristics, the pathogenic fungus was identified as Lagenidium callinectes which grows optimally at 25°C and survives in 1.0%, 2.5%, and 5.0% NaCl as well as in 1.0% and 2.5% KCl. Both of the present isolates utilize only 8 out of 26 carbohydrates and derivatives tested as carbon, nutrition and energy sources. This finding is the first report on rotifer, Brachionus sp. infected with L. callinectes causing up to 100% mortality.

  8. Polyhydroxybutyrate by Streptomyces sp.: Production and characterization. (United States)

    Krishnan, Sivakumar; Chinnadurai, Gandhi Shree; Perumal, Palani


    A total number of 20 actinomycetes isolates were isolated from soil sediments obtained from Semmancheri coastal areas of Bay of Bengal, India and they were qualitatively screened for the production of polyhydroxybutyrate (PHB) on a medium containing Sudan black stain. Nine of the 20 isolates produced PHB and the quantity of PHB produced varied from 1.79 to 4.26g -L . Among the positive isolates an actinomycete isolate which was identified as Streptomyces sp. through 16S rRNA sequencing analysis (Accession No: KF667247) produced relatively higher PHB than other positive isolates. Subsequently, the growth conditions were optimized for the maximum PHB production by the chosen organism. Attempt was also made to utilize natural carbon sources such as paddy straw, wheat bran, rice bran, sugarcane molasses and oil cake for the production of PHB in an attempt to reduce the cost production of PHB. The purified PHB was analyzed by Solid-State 13 C NMR, Fourier Transformed Infrared spectroscopy, Powder X-ray diffraction, Thermogravimetric Analysis, Scanning and Transmission Electron Microscopic analyses to determine the structure, crystallinity, purity and thermal stability. The present investigation has revealed that Streptomyces sp. could be a potential source for the production of PHB with desirable characteristics and could also be exploited for the industrial production. Copyright © 2017. Published by Elsevier B.V.

  9. Fluorescence Properties of Chlorella sp. Algae

    Directory of Open Access Journals (Sweden)

    Tibor Teplicky


    Full Text Available Water quality and its fast and reliable monitoring is the challenge of the future. Design of appropriate biosensors that would be capable of non-invasive identification of water pollution is an important prerequisite for such challenge. Chlorophylls are pigments, naturally presented in all plants that absorb light. The main forms of chlorophyll in algae are chlorophyll a and chlorophyll b, other pigments include xantophylls and beta-carotenes. Our aim was to characterize endogenous fluorescence of the Chlorella sp. algae, present naturally in drinking water. We recorded spatial, spectral and lifetime fluorescence distribution in the native algae. We noted that the fluorescence was evenly distributed in the algae cytosol, but lacked in the nucleus and reached maximum at 680-690 nm. Fluorescence decay of chlorella sp. was double-exponential, and clearly shorter than that of its isolated pigments. For the first time, fluorescence lifetime image of the algae is presented. Study of the fluorescence properties of algae is aimed at the improvement of water supply contamination detection and cleaning.

  10. Karakterisasi protease Bacillus sp. UGM5

    Directory of Open Access Journals (Sweden)

    Titik Purwati Widowati


    Full Text Available The objective of this experiment is to indentify the characters of proetease produced by Bacillus sp.UGM5.the protease secreted by Bacillus sp.UGM5 was first isolated,purified and then charactirezed.The crude enzyme has spesific actifity of 1.14 U/mg,however,the spesific activity of purified enzyme was increased by 23.8 times fold and recovery was 33.69%.The Page of nondenatured crude enzymes showes two type of proreases,however ,the SDS-Page of denatured purified enzyme showed four protein-bends with molecular weights of 55.5 kDa,18kDa respecetively.The optimum pH and temperature for the enzyme acrivity are 8.5 and 420C and belongs to serin protease type,with Km 3 X 10-3mM and Vmax 0.0890mM/30 minutes.The activity is not inhibited by Ca+2,Fe+2 and EDTA.


    Directory of Open Access Journals (Sweden)

    C. I. De Campos


    Full Text Available Estudos sobre novos adesivos ou resinas para colagem de madeira e derivados estão sendo realizados com a intenção de diminuir o impacto ambiental sem alterar suas propriedades. Por este motivo, novas formulações de adesivos PVA (Acetato de Polivinila vêm sendo desenvolvidas. Este trabalho testou a utilização deste adesivo na produção de compensado de Eucalyptus sp. e Pinus sp., com tempo e temperatura de prensagem, respectivamente, de 10 minutos e90°C. Foram realizados os ensaios físicos de densidade, teor de umidade e absorção, e os ensaios mecânicos de flexão estática e de resistência ao cisalhamento na linha de cola, todos de acordo com as normas ABNT. Obtiveram-se bons resultados com relação à resistência ao cisalhamento na linha de cola, a qual foi superior para os adesivos PVA, se comparados com compensados produzidos com ureia-formaldeído e o fenol-formaldeído, enquanto que os resultados de MOE e MOR apresentaram-se inferiores em ambos os casos. 

  12. The Effect of Acupuncture to SP6 on Skin Temperature Changes of SP6 and SP10: An Observation of “Deqi”

    Directory of Open Access Journals (Sweden)

    Jia-Min Yang


    Full Text Available Background. Deqi sensation is a complex but an important component for acupuncture effect. In this study, we tried to observe the relationship between Deqi and skin temperature changes and whether there was some relativity between Deqi and needle stimulations on cold congealing and dysmenorrhea rat model. Thirty-two female Sprague Dawley (SD rats were randomly divided into four groups (Saline Control Group, Model Group, Group A with strong stimulation, and Group B with small stimulation. Group A and Group B were performed with different stimulations. We found that, compared with saline control group, model group, and Group B, Group A showed that the skin temperature changes on right acupoint SP6 and SP10 increased significantly at 5 min–10 min interval. The skin temperature changes on left SP6 decreased at instant–5 min interval. The skin temperature changes on right SP10 decreased significantly at instant–5 min interval and 10 min–20 min interval. Thermogenic action along Spleen Meridian of Foot Greater Yin was manifested as simultaneous skin temperature increase on right SP6 and SP10 at 5 min–10 min interval after needling SP6, which was helpful to illustrate the relationship between the characteristic of Deqi and needle stimulations.

  13. First report of Giardia sp. and Cryptosporidium sp. in fecal samples in blue macaw (Anodorhynchus hyacinthinus in southern Brazil

    Directory of Open Access Journals (Sweden)

    Matheus Hillard Farret


    Full Text Available This study reports the gastrointestinal parasitism by Giardia sp. and Cryptosporidium sp. in blue macaw (Anodorhynchus hyacinthinus in the southern region of Brazil. Fecal samples of two species kept in captivity in the state of Rio Grande do Sul were analyzed by the direct smear method, centrifugal flotation technique with zinc sulfate and Kinyoun staining technique for research of parasites. Mixed infection by eggs of Capillaria, cysts of Giardia sp. and oocysts of Cryptosporidium sp. was observed. This is the first report this protozoa in blue macaw.

  14. Integrative Gene Cloning and Expression System for Streptomyces sp. US 24 and Streptomyces sp. TN 58 Bioactive Molecule Producing Strains

    Directory of Open Access Journals (Sweden)

    Samiha Sioud


    Full Text Available Streptomyces sp. US 24 and Streptomyces sp. TN 58, two strains producing interesting bioactive molecules, were successfully transformed using E. coli ET12567 (pUZ8002, as a conjugal donor, carrying the integrative plasmid pSET152. For the Streptomyces sp. US 24 strain, two copies of this plasmid were tandemly integrated in the chromosome, whereas for Streptomyces sp. TN 58, the integration was in single copy at the attB site. Plasmid pSET152 was inherited every time for all analysed Streptomyces sp. US 24 and Streptomyces sp. TN 58 exconjugants under nonselective conditions. The growth, morphological differentiation, and active molecules production of all studied pSET152 integrated exconjugants were identical to those of wild type strains. Consequently, conjugal transfer using pSET152 integration system is a suitable means of genes transfer and expression for both studied strains. To validate the above gene transfer system, the glucose isomerase gene (xylA from Streptomyces sp. SK was expressed in strain Streptomyces sp. TN 58. Obtained results indicated that heterologous glucose isomerase could be expressed and folded effectively. Glucose isomerase activity of the constructed TN 58 recombinant strain is of about eighteenfold higher than that of the Streptomyces sp. SK strain. Such results are certainly of importance due to the potential use of improved strains in biotechnological process for the production of high-fructose syrup from starch.

  15. Microfungi on the Pandanaceae: Linocarpon lammiae sp. nov., L. siamensis sp. nov. and L. suthepensis sp. nov. are described with a key to Linocarpon species from the Pandanaceae. (United States)

    Thongkantha, S; Lumyong, S; Lumyong, P; Whitton, S R; McKenzie, E H C; Hyde, K D


    Linocarpon species are reported from Pandanaceae in Australia, Brunei, Hong Kong, Nepal, New Zealand, Philippines, Seychelles, Thailand and Vanuatu. Linocarpon lammiae sp. nov. were collected on decaying leaves of Pandanus tectorius in Hong Kong. Linocarpon siamensis sp. nov. and L. suthepensis sp. nov. were collected from decaying leaves of P. penetrans in Thailand. These taxa are described, illustrated and compared with Linocarpon species with similar ascospore morphology and dimensions. Included are a synoptic table, which compares the new species to similar known species, and a dichotomous key to species of Linocarpon known from members of the Pandanaceae.

  16. 75 FR 42411 - Orders Finding That the SP-15 Financial Day-Ahead LMP Peak Daily Contract; SP-15 Financial Day... (United States)


    ... COMMODITY FUTURES TRADING COMMISSION Orders Finding That the SP-15 Financial Day-Ahead LMP Peak Daily Contract; SP-15 Financial Day-Ahead LMP Off-Peak Daily Contract; SP-15 Financial Swap Real Time...-Peak Daily (``SQP'') contract; SP-15 Financial Swap Real Time LMP-Peak Daily (``SRP'') contract; NP-15...

  17. Kroyeria deetsi n.sp. (Kroyeriidae: Siphonostomatoida), a parasitic ...

    African Journals Online (AJOL)

    Kroyeria deetsi n.sp. (Kroyeriidae: Siphonostomatoida) is described from both sexes collected from the gills of spinner sharks, Carcharhinus brevipinna (Müller & Henle, 1839), captured in the Indian Ocean off the coast of South Africa. Kroyeria deetsi n.sp. can easily be distinguished from all of its congeners because the ...

  18. Evaluation of Cr (VI) remediation potential of Eichornia sp in ...

    African Journals Online (AJOL)

    Purpose: Evaluation of Cr (VI) removal by indigenous chromium resistant bacterial strains alone and in combination with Eichornia sp. Methods: Three chromium resistant bacterial strains S-4 Ochrobactrum grignonense, SF-5 Bacillus sp. and S-6 Ochrobactrum pseudogrignonenses were isolated from industrial effluent.

  19. Antibiotic Resistance in Salmonella sp and Escherichia coli Isolated ...

    African Journals Online (AJOL)

    Strains of Salmonella sp and E. coli isolated were significantly resistant to gentamicin, erythromycin, chloramphenicol, tetracycline, streptomycin, cefixine and ampicillin. Resistance to gentamicin was the least with 33-71% in Salmonella sp and 25-80% in E. coli. The level of drug resistance in these organisms is ascribed to ...

  20. Biochemical characterization of Fusarium oxysporum f . sp. cubense ...

    African Journals Online (AJOL)

    The Fusarium wilt caused by Fusarium oxyspoum f. sp. cubense (Foc) is a major biotic constraint for banana production. The characteristics of F. oxyspoum f. sp. cubense isolates were investigated using electrophoretic studies of isozyme and whole-cell protein. The morphological characteristics of the isolates were very ...


    LOCALIZATION OF SP22 ON HUMAN SPERM OF DIFFERING QUALITY. AE Lavers*1, GR Klinefelter2, DW Hamilton1, KP Roberts1, 1University of Minnesota, Minneapolis, MN and 2US EPA, Research Triangle Park, NC. SP22 is a sperm membrane protein that has been implicated in sperm function d...

  2. Biochemical characterization of Fusarium oxysporum f. sp. cubense ...

    African Journals Online (AJOL)



    Jan 25, 2010 ... Department of Studies in Biotechnology, University of Mysore, Manasagangotri, Mysore – 570 006, India. Accepted 24 November, 2009. The Fusarium wilt caused by Fusarium oxyspoum f. sp. cubense (Foc) is a major biotic constraint for banana production. The characteristics of F. oxyspoum f. sp. cubense ...

  3. Effects of phosphate solubilizing microorganisms and Rhizobium sp ...

    African Journals Online (AJOL)

    Effects of Phosphate solubilizing microorganisms ( Glomus intraradices, Pseudomonas putida, P. alcaligenes, P. aeruginosa (Pa28), A. awamori) and Rhizobium sp. was observed on the growth, nodulation yield and root-rot disease complex of chickpea under field condition. Inoculation of Rhizobium sp. caused a greater ...


    Capriotti, Augusto


    Capriotti, Augusto (l'Università di Perugia, Perugia, Italy). Hansenula wickerhamii sp. n., a new yeast from Finnish soil. J. Bacteriol. 82:259–360. 1961.—Hansenula wickerhamii sp. n. is described; it was isolated from a Finnish soil, and is named in honor of Lynferd J. Wickerham. Images PMID:13690638

  5. Linking surfactant protein SP-D and IL-13

    DEFF Research Database (Denmark)

    Qaseem, Asif S; Sonar, Sanchaita; Mahajan, Lakshna


    Surfactant protein D (SP-D) is an innate immune molecule that plays a protective role against lung infection, allergy, asthma and inflammation. In vivo experiments with murine models have shown that SP-D can protect against allergic challenge via a range of mechanisms including inhibition...

  6. Biofixation of carbon dioxide by Chlorococcum sp. in a ...

    African Journals Online (AJOL)

    In this study, Chlorococcum sp. was cultured in a photobioreactor with a polytetrafluoroethene membrane sparger (PTFE) to study CO2 biofixation and microalgae growth. Daily variations of dissolved oxygen (DO), pH and dissolved CO2 were analyzed during batch culture of Chlorococcum sp. in the photobioreactor.

  7. Production of mycelium and blastospores of sp. in submerged culture

    African Journals Online (AJOL)

    Hirsutella sp. was grown in four liquid media containing either casamino acids, corn steep liquor, collagen peptone or casein peptone. These media were inoculated with a 7 day-old culture of mycelia and blastospores of Hirsutella sp. and the cultures incubated with shaking at 250 rpm at 26°C. The media containing corn ...

  8. Brachystelma nallamalayana sp. Nov. (Apocynaceae: Asclepiadoideae: Ceropegieae from India

    Directory of Open Access Journals (Sweden)

    K. Prasad


    Full Text Available Brachystelma nallamalayana sp. nov., collected from Nallamalais, the Eastern Ghats of Andhra Pradesh, India is described and illustrated. The new species is compared to its closest species, Brachystelma maculatum Hook. f. Brachystelma nallamalayana, sp. nov. is distinct from other species of Brachystelma in having ca 80cm high glabrous stems, peduncled cymes, basally united calyx lobes and biseriate corona.

  9. Effects of phosphate solubilizing microorganisms and Rhizobium sp ...

    African Journals Online (AJOL)



    Aug 4, 2009 ... Effects of Phosphate solubilizing microorganisms (Glomus intraradices, Pseudomonas putida, P. alcaligenes, P. aeruginosa (Pa28), A. awamori) and Rhizobium sp. was observed on the growth, nodulation yield and root-rot disease complex of chickpea under field condition. Inoculation of. Rhizobium sp.

  10. Antioxidant activity of aqueous extract of a Tolypocladium sp ...

    African Journals Online (AJOL)

    Tolypocladium sp. Ts-1 was isolated from the fruiting body of a wild Cordyceps sinensis, one of the best known traditional Chinese medicine and health foods. The antioxidant activities of hot-water extracts from cultured mycelia of Tolypocladium sp. were assessed in different in vitro systems. The extracts showed ...

  11. Antioxidant activity of aqueous extract of a Tolypocladium sp. fungus ...

    African Journals Online (AJOL)



    Sep 3, 2008 ... Tolypocladium sp. Ts-1 was isolated from the fruiting body of a wild Cordyceps sinensis, one of the best known traditional Chinese medicine and health foods. The antioxidant activities of hot-water extracts from cultured mycelia of Tolypocladium sp. were assessed in different in vitro systems. The extracts ...

  12. Oncholaim~ jessicae n.sp. (Nematoda: Oncholaimidae) from fresh ...

    African Journals Online (AJOL)

    Oncholaim~ jessicae n.sp. (Nematoda: Oncholaimidae) from fresh water in the Transvaal. A. Coomans. Instituut voor Dierkunde, Rijksuniversiteit Gent, Gent, Belgium. J. Heyns. Department of Zoology, Rand Afrikaans University, Johannesburg. Oncholaimus jessicae n.sp. is described from several sites in the Blyde River ...

  13. Truncated recombinant human SP-D attenuates emphysema and type II cell changes in SP-D deficient mice

    Directory of Open Access Journals (Sweden)

    Mühlfeld Christian


    Full Text Available Abstract Background Surfactant protein D (SP-D deficient mice develop emphysema-like pathology associated with focal accumulations of foamy alveolar macrophages, an excess of surfactant phospholipids in the alveolar space and both hypertrophy and hyperplasia of alveolar type II cells. These findings are associated with a chronic inflammatory state. Treatment of SP-D deficient mice with a truncated recombinant fragment of human SP-D (rfhSP-D has been shown to decrease the lipidosis and alveolar macrophage accumulation as well as production of proinflammatory chemokines. The aim of this study was to investigate if rfhSP-D treatment reduces the structural abnormalities in parenchymal architecture and type II cells characteristic of SP-D deficiency. Methods SP-D knock-out mice, aged 3 weeks, 6 weeks and 9 weeks were treated with rfhSP-D for 9, 6 and 3 weeks, respectively. All mice were sacrificed at age 12 weeks and compared to both PBS treated SP-D deficient and wild-type groups. Lung structure was quantified by design-based stereology at the light and electron microscopic level. Emphasis was put on quantification of emphysema, type II cell changes and intracellular surfactant. Data were analysed with two sided non-parametric Mann-Whitney U-test. Main Results After 3 weeks of treatment, alveolar number was higher and mean alveolar size was smaller compared to saline-treated SP-D knock-out controls. There was no significant difference concerning these indices of pulmonary emphysema within rfhSP-D treated groups. Type II cell number and size were smaller as a consequence of treatment. The total volume of lamellar bodies per type II cell and per lung was smaller after 6 weeks of treatment. Conclusion Treatment of SP-D deficient mice with rfhSP-D leads to a reduction in the degree of emphysema and a correction of type II cell hyperplasia and hypertrophy. This supports the concept that rfhSP-D might become a therapeutic option in diseases that are

  14. Truncated recombinant human SP-D attenuates emphysema and type II cell changes in SP-D deficient mice. (United States)

    Knudsen, Lars; Ochs, Matthias; Mackay, Rosemarie; Townsend, Paul; Deb, Roona; Mühlfeld, Christian; Richter, Joachim; Gilbert, Fabian; Hawgood, Samuel; Reid, Kenneth; Clark, Howard


    Surfactant protein D (SP-D) deficient mice develop emphysema-like pathology associated with focal accumulations of foamy alveolar macrophages, an excess of surfactant phospholipids in the alveolar space and both hypertrophy and hyperplasia of alveolar type II cells. These findings are associated with a chronic inflammatory state. Treatment of SP-D deficient mice with a truncated recombinant fragment of human SP-D (rfhSP-D) has been shown to decrease the lipidosis and alveolar macrophage accumulation as well as production of proinflammatory chemokines. The aim of this study was to investigate if rfhSP-D treatment reduces the structural abnormalities in parenchymal architecture and type II cells characteristic of SP-D deficiency. SP-D knock-out mice, aged 3 weeks, 6 weeks and 9 weeks were treated with rfhSP-D for 9, 6 and 3 weeks, respectively. All mice were sacrificed at age 12 weeks and compared to both PBS treated SP-D deficient and wild-type groups. Lung structure was quantified by design-based stereology at the light and electron microscopic level. Emphasis was put on quantification of emphysema, type II cell changes and intracellular surfactant. Data were analysed with two sided non-parametric Mann-Whitney U-test. After 3 weeks of treatment, alveolar number was higher and mean alveolar size was smaller compared to saline-treated SP-D knock-out controls. There was no significant difference concerning these indices of pulmonary emphysema within rfhSP-D treated groups. Type II cell number and size were smaller as a consequence of treatment. The total volume of lamellar bodies per type II cell and per lung was smaller after 6 weeks of treatment. Treatment of SP-D deficient mice with rfhSP-D leads to a reduction in the degree of emphysema and a correction of type II cell hyperplasia and hypertrophy. This supports the concept that rfhSP-D might become a therapeutic option in diseases that are characterized by decreased SP-D levels in the lung.

  15. Post-neonatal drop in alveolar SP-A expression

    DEFF Research Database (Denmark)

    Stray-Pedersen, Arne; Vege, Ashild; Stray-Pedersen, Asbjorg


    BACKGROUND: Surfactant protein A (SP-A) is synthesized in the lung and is a part of the innate immune system. The aim of this study was to evaluate the expression of SP-A in lung tissue from fetuses, infants, children and adults with special regard to sudden infant death syndrome (SIDS). METHODS......: A total of 160 cases were studied; 19 fetuses and neonates, 59 SIDS and 49 explained infant deaths below 1 year of age, 19 toddlers and 14 adults. Immunohistochemical detection of SP-A using monoclonal antibodies was performed by microscopy of lung tissue specimens collected at autopsy. A scoring system...... was developed enabling semi-quantitative estimation of staining intensity and distribution. RESULTS: SP-A was detected in the terminal bronchioles and alveolar spaces of fetuses >35 weeks gestation. The intra-alveolar SP-A expression increased in the perinatal period followed by a marked drop in infants aged...

  16. SP-100 space reactor power system

    International Nuclear Information System (INIS)

    Kirpich, A.; Kruger, G.; Matteo, D.; Stephen, J.


    A generic flight system (GFS) design for a 100-kWe space reactor power (SP-100) system is presented. The design has evolved around issues such as the selection of a lithium liquid-metal-cooled reactor built of refractory metals and permitting operation in the range of 1300-1400 K; heat transport by lithium circulation using thermoelectrically driven liquid-metal pumps; thermoelectric power conversion; and waste heat rejection at approximately 800 K through lithium circulation to potassium heat pipe radiators. Various thermal-hydraulic analytical procedures have been utilized in the design of the reactor, ducting, hot-side and cold-side heat exchangers, circulating pumps, and heat pipe radiators. The physical and performance characteristics of the GFS and its power margins are estimated as a function of mission time

  17. Thermoelectric electromagnetic pump design for SP-100

    International Nuclear Information System (INIS)

    Collett, J.; Kugler, W.; Sinha, U.; Surjadi, T.


    This paper describes the design of the Thermoelectric Electromagnetic (TEM) pump used in the SP-100 space power system. The TEM pump is designed to pump liquid (molten) lithium (Li) coolant in the Primary Heat Transport Subsystem (PHTS) and Heat Rejection Subsystem (HRSS). The pump utilizes advanced Thermoelectric (TE) cells to generate electric current that induces magnetic flux in a Z-shaped magnetic structure. The electric current and magnetic flux pass through the liquid Li perpendicular to each other to create the pumping force. The TE cells are semiconductors located between rectangular ducts connected to the reactor hot PHTS piping and the cooler HRSS piping. The temperature difference (ΔT) across the TE cells generates the voltage to power the pump. The design provides a minimum mass, self-regulated pump, with no moving parts and self-powered by an internal temperature gradient

  18. SP-100 status and technology accomplishments

    International Nuclear Information System (INIS)

    Armijo, J.S.


    There are many space missions that require electric power in the 10-kW(electric) to 1-MW(electric) range. The SP-100 program will provide technology that demonstrates that a nuclear reactor heat source and passive thermoelectric conversion can reliably provide electrical power over this full range for 10 yr. Based on the generic flight system (GFS) design at 100 kW(electric), tests will be conducted to demonstrate that technologies required for the GFS have been validated. In addition, system-level tests will show that the GFS design and predictive capability to design at other power levels are well understood and meet an enveloping set of requirements. Technology and component testing has begun at General Electric (GE), its subcontractors, and several national laboratories. This paper reviews the significant progress made to date and major planned future tests with respect to the reference flight system, technology and component achievements, and nuclear assembly and integrated assembly tests

  19. Epitheliotropic lymphoma in a squirrel (Sciurus sp.). (United States)

    Honnold, Shelley P; Arun, Iyampillai; Saturday, Greg; McLeod, Charles


    A 12-yr-old, intact male squirrel (Sciurus sp.) presented with a 15 mm-by-20 mm area of alopecia and plaque-like dermal thickening over the left caudolateral thorax. Routine diagnostic tests ruled out more common conditions that result in alopecia, such as dermatophytosis and acariasis. A punch biopsy was obtained under anesthesia and submitted for histopathologic evaluation. The diagnosis of epitheliotropic lymphoma was made, and follow-up surgical excision was performed. Histopathologic features were consistent with epitheliotropic lymphoma, and immunohistochemistry confirmed a T-cell origin. There was no local recurrence, new lesions, or evidence of metastasis 10 mo after surgical excision. To our knowledge, to date, epitheliotropic lymphoma has not been described in a squirrel.

  20. Chitinase Production by Streptomyces sp. ANU 6277

    Directory of Open Access Journals (Sweden)

    Kolla J.P. Narayana


    Full Text Available Chitinase production by a terrestrial Streptomyces sp. ANU 6277 was studied under sub-merged fermentation. Chitinase production started after 24 h of incubation and reached maximum levels after 60 h of cultivation. A high level of chitinase activity was observed in the culture medium with pH 6 at 35ºC. Culture medium amended with 1% chitin was found to be suitable for maximum production of chitinase. An optimum concentration of colloidal chitin for chitinase production was determined. Studies on the influence of additional carbon and nitrogen sources on chitinase production revealed that starch and yeast extract served as good carbon and nitrogen sources to enhance chitinase yield.Chitinase was purified from crude enzyme extract by single step gel filtration by Sephadex G-100. Purified chitinase of the strain exhibited a distinct protein band near 45 kDa by means of SDS-PAGE.

  1. Kinerja probiotik Bacillus sp. pada pendederan benih ikan lele Clarias sp. yang diinfeksi Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    , Sukenda


    Full Text Available ABSTRACT This experiment was conducted to assess performance of Bacillus sp. probiotic on catfish juvenile Clarias sp. infected by Aeromonas hydrophila. The probiotic content in the diets were 0% (K+ and K-, 1%, and 2% in duplicates. This experiment used randomized design with four treatments and two replications. Juveniles with average body weight of 3.22±0.15 g/fish were reared in the 1.5×2.8×0.5 m3 pond with density of 800 fish/pond. Fish were reared for 30 days and fed three times a day at rate 8% of  total body weight. At day 31, catfish were challenged by A. hydrophila 0.1 mL (106 cfu/mL. Post infection observation was carried out ten days with density 10 fish/aquaria. The result showed that fish fed diet containing 2% probiotic gave the best probiotic performance with survival rate of catfish 83.33% after challenged, spesific growth rate 5.40%, and 0,75 of feed conversion ratio. The results of the blood profile showed significantly better results in the treatment of probiotics compared to the positive control after challenge test A. hydrophila. Probiotic Bacillus sp. has given as much as 2% on feed provides better performance on catfish juvenile. Keywords: probiotic, Bacillus sp., A. hydrophila, catfish juvenille, growth  ABSTRAK Penelitian ini bertujuan untuk menguji kinerja probiotik Bacillus sp. dalam pakan pada pendederan benih ikan lele Clarias sp. yang diinfeksi bakteri Aeromonas hydrophila. Penelitian ini menggunakan rancangan acak lengkap dengan empat perlakuan yaitu kandungan probiotik dalam pakan perlakuan yaitu 0% (K+ dan K-, 1%,  dan 2%, masing-masing dengan dua ulangan. Ikan lele yang digunakan memiliki bobot rata-rata 3,22±0,15 g/ekor, dipelihara dalam kolam terpal berukuran 1,5×2,8×0,5 m3 dengan kepadatan 800 ekor/kolam. Ikan dipelihara selama 30 hari dengan frekuensi pemberian pakan tiga kali sehari sebanyak 8% dari bobot tubuh ikan. Hari ke-31 benih lele diinjeksi bakteri A. hydrophila dosis 0,1 m

  2. Neorickettsia risticii, Rickettsia sp. and Bartonella sp. in Tadarida brasiliensis bats from Buenos Aires, Argentina. (United States)

    Cicuttin, Gabriel L; De Salvo, María N; La Rosa, Isabel; Dohmen, Federico E Gury


    Bats are potential reservoirs of many vector-borne bacterial pathogens. The aim of the present study was to detect species of Anaplasma, Ehrlichia, Neorickettsia, Rickettsia, Borrelia and Bartonella in Brazilian free-tailed bats (Tadarida brasiliensis, Molossidae) from Buenos Aires city, Argentina. Between 2012 and 2013, 61 T. brasiliensis from urban areas of Buenos Aires city were studied. The samples were molecularly screened by PCR and sequencing. Five bats (8.2%) were positive to Neorickettsia risticii, one (1.6%) was positive to Rickettsia sp. and three bats (4.9%) to Bartonella sp. For molecular characterization, the positive samples were subjected to amplification and sequencing of a fragment of p51 gene for N. risticii, a fragment of citrate synthase gene (gltA) for Rickettsia genus and a fragment of gltA for Bartonella genus. Phylogenetic tree was constructed using the maximum-likelihood method. Phylogenetic analysis of N. risticii detect in our study revealed that it relates to findings in the USA West Coast; Rickettsia sp. detected is phylogenetically within R. bellii group, which also includes many other Rickettsia endosymbionts of insects; and Bartonella sp. found is related to various Bartonella spp. described in Vespertilionidae bats, which are phylogenetically related to Molossidae. Our results are in accordance to previous findings, which demonstrate that insectivorous bats could be infected with vector-borne bacteria representing a potential risk to public health. Future research is necessary to clarify the circulation of these pathogens in bats from Buenos Aires. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. From spent graphite to amorphous sp2+sp3 carbon-coated sp2 graphite for high-performance lithium ion batteries (United States)

    Ma, Zhen; Zhuang, Yuchan; Deng, Yaoming; Song, Xiaona; Zuo, Xiaoxi; Xiao, Xin; Nan, Junmin


    Today, with the massive application of lithium ion batteries (LIBs) in the portable devices and electric vehicles, to supply the active materials with high-performances and then to recycle their wastes are two core issues for the development of LIBs. In this paper, the spent graphite (SG) in LIBs is used as raw materials to fabricate two comparative high-capacity graphite anode materials. Based on a microsurgery-like physical reconstruction, the reconstructed graphite (RG) with a sp2+sp3 carbon surface is prepared through a microwave exfoliation and subsequent spray drying process. In contrast, the neural-network-like amorphous sp2+sp3 carbon-coated graphite (AC@G) is synthesized using a self-reconfigurable chemical reaction strategy. Compared with SG and commercial graphite (CG), both RG and AC@G have enhanced specific capacities, from 311.2 mAh g-1 and 360.7 mAh g-1 to 409.7 mAh g-1 and 420.0 mAh g-1, at 0.1C after 100 cycles. In addition, they exhibit comparable cycling stability, rate capability, and voltage plateau with CG. Because the synthesis of RG and AC@G represents two typical physical and chemical methods for the recycling of SG, these results on the sp2+sp3 carbon layer coating bulk graphite also reveal an approach for the preparation of high-performance graphite anode materials derived from SG.

  4. Wnt-mediated down-regulation of Sp1 target genes by a transcriptional repressor Sp5

    Czech Academy of Sciences Publication Activity Database

    Fujimura, Naoko; Vacík, Tomáš; Machoň, Ondřej; Vlček, Čestmír; Scalabrin, S.; Speth, M.; Diep, D.; Krauss, S.; Kozmik, Zbyněk


    Roč. 282, č. 2 (2007), s. 1225-1237 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z50520514 Keywords : Wnt -mediated signaling * Sp5 transcription factor * Sp1 target genes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.581, year: 2007

  5. Desulfuromonas svalbardensis sp nov and Desulfuromusa ferrireducens sp nov., psychrophilic, Fe(III)-reducing bacteria isolated from Arctic sediments, Svalbard

    DEFF Research Database (Denmark)

    Vandieken, V.; Mussmann, M.; Niemann, Hans Henrik


    succinoxidans Gylac(T) (95.9%) within the Deltaproteobacteria. Strains 112(T) and 102(T) therefore represent novel species, for which the names Desulfuromonas svalbardensis sp. nov. (type strain 112(T) = DSM 16958(T) = JCM 12927(T)) and Desulfuromusa ferrireducens sp. nov. (type strain 102(T) = DSM 16956 (T...

  6. Elevated expression and potential roles of human Sp5, a member of Sp transcription factor family, in human cancers

    International Nuclear Information System (INIS)

    Chen Yongxin; Guo Yingqiu; Ge Xijin; Itoh, Hirotaka; Watanabe, Akira; Fujiwara, Takeshi; Kodama, Tatsuhiko; Aburatani, Hiroyuki


    In this report, we describe the expression and function of human Sp5, a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Our experiments employing Gal4-Sp5 fusion proteins reveal multiple transcriptional domains, including a N-terminal activity domain, an intrinsic repressive element, and a C-terminal synergistic domain. Elevated expression of Sp5 was noted in several human tumors including hepatocellular carcinoma, gastric cancer, and colon cancer. To study the effects of the Sp5 protein on growth properties of human cancer cells and facilitate the identification of its downstream genes, we combined an inducible gene expression system with microarray analysis to screen for its transcriptional targets. Transfer of Sp5 into MCF-7 cells that expressed no detectable endogenous Sp5 protein elicited significant growth promotion activity. Several of the constitutively deregulated genes have been associated with tumorigenesis (CDC25C, CEACAM6, TMPRSS2, XBP1, MYBL1, ABHD2, and CXCL12) and Wnt/β-Catenin signaling pathways (BAMBI, SIX1, IGFBP5, AES, and p21 WAF1 ). This information could be utilized for further mechanistic research and for devising optimized therapeutic strategies against human cancers

  7. Direct transesterification of Oedogonium sp. oil be using immobilized isolated novel Bacillus sp. lipase. (United States)

    Sivaramakrishnan, Ramachandran; Muthukumar, Karuppan


    This work emphasizes the potential of the isolated Bacillus sp. lipase for the production of fatty acid methyl ester by the direct transesterification of Oedogonium sp. of macroalgae. Dimethyl carbonate was used as the extraction solvent and also as the reactant. The effect of solvent/algae ratio, water addition, catalyst, temperature, stirring and time on the direct transesterification was studied. The highest fatty acid methyl ester yield obtained under optimum conditions (5 g Oedogonium sp. powder, 7.5 ml of solvent (dimethyl carbonate)/g of algae, 8% catalyst (%wt/wt of oil), distilled water 1% (wt/wt of algae), 36 h, 55°C and 180 rpm) was 82%. Final product was subjected to thermogravimetric analysis and (1)H NMR analysis. The results showed that the isolated enzyme has good potential in catalyzing the direct transesterification of algae, and the dimethyl carbonate did not affect the activity of the isolated lipase. Copyright © 2013 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.


    Directory of Open Access Journals (Sweden)



    Full Text Available The Use of Aglaophenia sp. Marine Biota Extract to Control Fusarium oxysporum f. sp. vanillae, a Pathogen of Vanilla Stem Rot The use of marine biota for organic fungicide material has enormous potential to be developed. The organic fungicide was directed to substitute synthetic fungicide for vanilla cultivation. Application of synthetic fungicide degraded environmental quality, therefore its applications does not support sustainable agriculture. The objective of this research was to know the potence of Aglaopheniain suppressing the growth of F. oxysporum f. sp.vanillae, the pathogen of vanilla stem rot. The research was done in green house in order to find the best substance for formulation of the extract. The substances screened were water, tween-80, and detergents with two different concentrations. Subsequently, two best formulas were chosen to apply in endemic area in Tabanan. The green house and field trial research used Randomized Completely Design with three and five replications respectively. Results showed that tween was the best substance used for formulation and concentration of 0.2% was better than other concentrations. The extract diluted in tween-80 on the concentration of 0.2% showed the lowest rot on stem, longest shoot, and the most leaves on vanilla shoot. Because of its significant performance, the 0.1% extract ofAglaopheniain 0.1% tween-80 was proposed to be the best formula to suppress the vanilla stem rot disease.

  9. Kinetics of petroleum oil biodegradation by a consortium of three protozoan isolates (Aspidisca sp., Trachelophyllum sp. and Peranema sp.

    Directory of Open Access Journals (Sweden)

    L. Kachieng’a


    Full Text Available Petroleum oil is a complex mixture of substances, the majority of which are hydrocarbons; the latter represent an extremely important and heterogeneous group of compounds that find their way into water resources by anthropogenic or natural ways. The majority of toxic hydrocarbon components of petroleum are biodegradable, where bioremediation using microbial species has become an integral process for the restoration of oil-polluted areas. In this study, three bioremediation processes, namely natural attenuation, nutrient supplementation by adding glucose and biostimulation by adding Tween® 80, were carried out in various petroleum hydrocarbon concentrations in polluted water media using a consortium of three protozoan isolates (Aspidisca sp., Trachelophyllum sp. and Peranema sp.. A first-order kinetics model was fitted to the biodegradation data to evaluate the biodegradation rate and to determine the corresponding half-life time. First-order kinetics satisfactorily described the biodegradation of the petroleum-based contaminants under abiotic conditions. The results showed an increase in the percentage removal of petroleum oil at the lower petroleum concentrations and a gradual percentage decrease in removing petroleum oil residues occurred when there was an increase in the initial concentrations of the petroleum oil: 39%, 27%, 22%, 12%, 10% for various petroleum oil concentrations of 50, 100, 150, 200, 250 mg/L, respectively. A similar trend was also observed in the glucose-supplemented culture media where the reduction was 45% and 78% for petroleum concentrations of 250 mg/L and 50 mg/L, respectively. Biodegradation of between 33 and 90% was achieved at a Tween® 80 concentration of between 50 mg/L and 250 mg/L. The degradation rate constants for the natural attenuation process ranged between ≥0 to ≤0.50, ≥0 to ≤0.35, ≥0 to ≤0.25, ≥0 to ≤ 0.14 and ≥ 0 to ≤0.11 for petroleum oil concentrations varying from 50, 100, 150

  10. A sp2+sp3 hybridized carbon allotrope transformed from AB stacking graphyne and THD-graphene

    Directory of Open Access Journals (Sweden)

    Yu Zhang


    Full Text Available New carbon allotropes can be designed by combining sp, sp2 and sp3 three hybridization states. And the hybridization states or coordination numbers of carbon atoms can be changed by applying high pressure on carbon materials. In this study, a common high pressure phase (named as TBBC transformed from AB-stacking graphyne or THD-graphene is predicted. Its kinetic stability is examined using finite displacement method. We find that the sp2 and sp3 hybridized carbon atoms behave different vibration features at high frequency region. Both graphene-like and diamond-like vibration peaks occurs. Phase transition energy barriers from both graphyne and THD-graphene to TBBC are estimated. Electronic structure calculations show that the TBBC is an indirect semiconductor with a bandgap of 0.66 eV. The ideal tensile strength of TBBC is high in [0001] and [11¯00] directions, but is weak along [12¯10] direction.

  11. A sp2+sp3 hybridized carbon allotrope transformed from AB stacking graphyne and THD-graphene (United States)

    Zhang, Yu; Shang, Jiacheng; Fu, Weida; Zeng, Li; Tang, Tao; Cai, Yingxiang


    New carbon allotropes can be designed by combining sp, sp2 and sp3 three hybridization states. And the hybridization states or coordination numbers of carbon atoms can be changed by applying high pressure on carbon materials. In this study, a common high pressure phase (named as TBBC) transformed from AB-stacking graphyne or THD-graphene is predicted. Its kinetic stability is examined using finite displacement method. We find that the sp2 and sp3 hybridized carbon atoms behave different vibration features at high frequency region. Both graphene-like and diamond-like vibration peaks occurs. Phase transition energy barriers from both graphyne and THD-graphene to TBBC are estimated. Electronic structure calculations show that the TBBC is an indirect semiconductor with a bandgap of 0.66 eV. The ideal tensile strength of TBBC is high in [0001] and [1 1 ¯ 00 ] directions, but is weak along [1 2 ¯ 10 ] direction.


    Directory of Open Access Journals (Sweden)

    Lili Sholichah


    Full Text Available Pemeliharaan ikan rainbow (Melanotaenia sp. di Balai Penelitian dan Pengembangan Budidaya Ikan Hias selalu terjadi kematian secara bertahap mulai calon induk hingga proses pemijahan. Hal ini terjadi berulang kali sehingga ketersediaan induk Melanotaenia sp. sangat terancam. Ikan ini berasal dari Papua yang diperoleh mengandalkan penangkapan di alam. Tujuan dari penelitian ini adalah untuk menginventarisir dan mengidentifikasi berbagai patogen (parasit, jamur, bakteri potensial yang menginfeksi ikan rainbow yang dipelihara di dalam akuarium berukuran 50 cm x 50 cm x 50 cm dengan sistem aliran air stagnan. Tiga jenis rainbow yang dipelihara yaitu: rainbow Sungai Salawati, asal Sungai Sawiat, dan asal Danau Kurumoi. Setiap ikan masing-masing berjumlah 100 ekor dipelihara di akuarium dengan penambahan batu karang dan tanpa penambahan karang (kontrol ke dalam akuarium. Ikan diberi pakan sekenyangnya berupa jentik nyamuk dan cacing rambut beku setiap pagi dan sore hari. Sampling dilakukan secara random sebulan sekali dan secara unrandom setiap ada kejadian ikan sakit. Gejala klinis ikan yang sakit sebagai berikut: ikan berenang di permukaan dan menggosok-gosokkan badan di dinding akuarium, nafsu makan berkurang, gerakan berputar-putar, warna memudar menjadi putih, penekanan warna hitam pada sirip punggung dan perut meningkat, pendarahan pada perut, lendir berlebihan dan sangat berbau, serta sisik berdiri/terbuka. Diagnosa dan deteksi penyakit awal berupa pengamatan parasit baik ektoparasit maupun endoparasit, pengamatan dan isolasi jamur pada media selektif jamur, dan isolasi bakteri dilakukan untuk mengetahui jenis-jenis patogen yang menginfeksi ketiga jenis ikan rainbow. Selanjutnya dilakukan uji histologi dan analisa DNA beberapa patogen. Hasil pengamatan diperoleh patogen berupa parasit (Ichthyophthirius sp., Dactylogyrus sp., Gyrodactylus sp., dan Trichodina sp. dan bakteri (Aeromonas hydrophila, Acinetobacter sp

  13. Genetic polymorphism of horse serum protein 3 (SP3). (United States)

    Juneja, R K; Sandberg, K; Kuryl, J; Gahne, B


    Two-dimensional agarose gel (pH 8.6)-horizontal polyacrylamide gel (pH 9.0) electrophoresis of horse serum samples, followed by general protein staining, revealed genetic polymorphism of an unidentified protein tentatively designated serum protein 3 (SP3). The SP3 fractions appeared distinctly when a 14% concentration of acrylamide was used in the separation gels. The 2-D mobilities of SP3 fractions were quite similar to that of albumin. Family data were consistent with the hypothesis that the observed SP3 phenotypes were controlled by four co-dominant, autosomal alleles (D, F, I, S). Evidence was provided that the F allele can be further divided into two alleles (F1 and F2); the mobilities of F1 and F2 variants were very similar. Each of the SP3 alleles gave rise to one fraction and each of the heterozygous types showed two fractions. More than 600 horses representing five different breeds (Swedish Trotter, North-Swedish Trotter, Thoroughbred, Arab and Polish Tarpan) were typed for SP3, and allele frequency estimates were calculated. SP3 was highly polymorphic in all breeds studied.

  14. Efektivitas Ovitrap Bambu terhadap Jumlah Jentik Aedes sp yang Terperangkap

    Directory of Open Access Journals (Sweden)

    Wiwit Aditama


    places of 10 subdistricts. Data of trapped Aedes sp larvae numbers was collected four times repeatedly within one week time-lapse. Analysis was conducted using the mean number of larvae in ovitraps and ovitrap index. The number of Aedes sp larvae trapped was 1,265. The most effective ovitrap is piece of bamboo, mean = 123, p value = 0.006, HI = 10.01% (16.66 26.67%, CI = 36.8% (336.06 - 39.74%, BI = 29.97% (73.33 - 103.3%. Health authorities should promote bamboo ovitrap, especially to public as an effort to control Aedes sp.

  15. Pengaruh Perbedaan Konsentrasi Ekstrak Sargassum sp. dan Lama Penyimpanan terhadap Oksidasi Lemak pada Fillet Ikan Patin (Pangasius sp.

    Directory of Open Access Journals (Sweden)

    Fatin Hidayati


    Full Text Available ABSTRAK Ikan patin merupakan ikan air tawar yang mengandung lemak dan protein tinggi sehingga apabila dilakukan penyimpanan rentan terjadi oksidasi yang mengakibatkan ketengikan. Sargassum sp. dengan kandungan fenol dan flavonoid mampu menghambat terjadinya oksidasi pada fillet ikan patin. Penelitian ini bertujuan untuk mengetahui pengaruh perbedaan ekstrak Sargassum sp. dan lama penyimpanan dalam menghambat terjadinya oksidasi pada fillet ikan patin. Materi yang digunakan dalam penelitian ini adalah ekstrak Sargassum sp. dan fillet ikan patin. Metode penelitian yang digunakan adalah experimental laboratories dengan menggunakan Rancangan Acak Lengkap (RAL faktorial dengan 2 faktor yaitu konsentrasi ekstrak Sargassum sp. (0%, 1%, 1,5% dan 2% dan lama penyimpanan (hari ke-0, hari ke-2, hari ke-4, dan hari ke-6. Hasil penelitian menunjukkan bahwa perbedaan penambahan konsentrasi ekstrak Sargassum sp. dan lama penyimpanan memberikan pengaruh nyata terhadap nilai PV, nilai TBA, kadar lemak, kadar protein, kadar air serta organoleptik (P < 0,05. Hasil penelitian tahap I didapatkan rendemen Sargassum sp. dengan pelarut etanol 96% sebesar 1,39%, kandungan fenol 1,813%, flavonoid 0,278% dan aktivitas antioksidan 99,1659 ppm (kuat. Hasil penelitian tahap II didapatkan nilai PV berkisar antara 2,03 - 19,82 meq/kg, nilai TBA 0,63 - 6,72 mg.mal/kg. Konsentrasi 1,5% merupakan konsentrasi terbaik ekstrak Sargassum sp. dalam menghambat oksidasi lemak pada fillet ikan patin selama penyimpanan. Kata kunci: Antioksidan, Ekstrak Sargassum sp., Lama Penyimpanan, Oksidasi lemak, Fillet Ikan patin ABSTRACT Catfish is a freshwater fish that contain high fat and protein so that if its stored it will susceptible to oxidation process which leads to rancidity. Sargassum sp. with its phenolic and flavonoid content are able to inhibit the oxidation process in catfish fillet. This research was aimed to know the effects of different concentrations of Sargassum sp. extracts and

  16. Description of Pristina armata n. sp. (Clitellata: Naididae: Pristininae) from a carnivorous plant (Nepenthes sp.) in Borneo, Indonesia. (United States)

    Schenková, Jana; Čermák, Václav


    A new clitellate species of Pristininae (Naididae), Pristina armata n. sp., found in the pitcher of the carnivorous plant Nepenthes sp., is reported from East Kalimantan, Indonesia. P. armata n. sp. is a very small clitellate, less than 1 mm long in fixed state, and without proboscis on the prostomium. Signs of reproduction by paratomy were observed, but the generic placement remains preliminary because sexually mature individuals were not found. P. armata n. sp. is characterized by giant hook-like dorsal chaetae at IV. The description of P. armata n. sp. was based on six fixed specimens of different size and stage of development. Noteworthy is the habitat of P. armata n. sp. in Nepenthes pitchers, this being the first clitellate species described from such a habitat. P. armata n. sp. may be a member of the nepenthebionts' community, realizing its life cycle inside the digestive fluid of the Nepenthes pitcher, or it belongs to nepenthephiles, species that commonly occur in this habitat but do not specialize on it.

  17. Plant growth promoting properties of Halobacillus sp. and Halomonas sp. in presence of salinity and heavy metals. (United States)

    Desale, Prithviraj; Patel, Bhargav; Singh, Sukrit; Malhotra, Aakshi; Nawani, Neelu


    Salinity and heavy metal stress are challenging problems in agriculture. Here we report the plant growth promoting ability of three moderate halophiles, Halobacillus sp. ADN1, Halomonas sp. MAN5, and Halobacillus sp. MAN6, in presence of both salinity and heavy metal stress. Halobacillus sp. ADN1, Halomonas sp. MAN5, and Halobacillus sp. MAN6 can tolerate 25, 21, and 29% NaCl, respectively and grow in presence of 1 mM cobalt, cadmium, and nickel and 0.04 mM mercury and 0.03 mM silver. Halobacillus sp. ADN1, Halomonas sp. MAN5, and Halobacillus sp. MAN6 produced 152.5, 95.3, and 167.3 µg/ml indole acetic acid (IAA) and could solubilize 61, 53, and 75 parts per million (ppm) phosphate, respectively in the presence of 15% NaCl. The production of IAA and solubilization of phosphate was well retained in the presence of salinity and heavy metals like 1 mM cadmium, 0.7 mM nickel, 0.04 mM mercury, and 0.03 mM silver. Besides, the strains showed amylase and protease activities and could produce hydrogen cyanide and ammonia in presence of salinity and heavy metals. A mixture of three strains enhanced the root growth of Sesuvium portulacastrum under saline and heavy metal stress, where the root length increased nearly 4.5 ± 0.6 times and root dry weight increased 5.4 ± 0.5 times as compared to control. These strains can thus be useful in microbial assisted phytoremediation of polluted saline soils. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Lactobacillus oeni sp. nov., from wine. (United States)

    Mañes-Lázaro, Rosario; Ferrer, Sergi; Rosselló-Mora, Ramón; Pardo, Isabel


    Ten Lactobacillus strains, previously isolated from different Bobal grape wines from the Utiel-Requena Origin Denomination of Spain, were characterized phylogenetically, genotypically and phenotypically. The 16S rRNA genes were sequenced and phylogenetic analysis showed that they form a tight phylogenetic clade that is closely related to reference strains Lactobacillus satsumensis NRIC 0604T, 'Lactobacillus uvarum' 8 and Lactobacillus mali DSM 20444T. DNA-DNA hybridization results confirmed the separation of the strains from other Lactobacillus species. Genotypically, the strains could be differentiated from their closest neighbours by 16S amplified rDNA restriction analysis and random amplified polymorphic DNA patterns. The strains were Gram-staining-positive, facultatively anaerobic rods that did not exhibit catalase activity. Phenotypically, they could be distinguished from their closest relatives by several traits such as their inabilities to grow at pH 3.3, to ferment sucrose, amygdalin and arbutin or to hydrolyse aesculin. The characteristics of the ten wine isolates suggest that they represent a novel species, for which the name Lactobacillus oeni sp. nov. is proposed. The type strain is 59bT (=CECT 7334T=DSM 19972T).

  19. Cellulomonas bogoriensis sp. nov., an alkaliphilic cellulomonad. (United States)

    Jones, Brian E; Grant, William D; Duckworth, A W; Schumann, Peter; Weiss, Norbert; Stackebrandt, Erko


    An alkaliphilic, slightly halotolerant, chemo-organotrophic, Gram-positive, rod-shaped bacterium, strain 69B4(T), was isolated from the sediment of the littoral zone of Lake Bogoria, Kenya. Phylogenetically, it is a member of the genus Cellulomonas, showing less than 97.5 % sequence similarity to the type strains of other Cellulomonas species. The highest level of similarity, albeit moderate, was found with respect to Cellulomonas cellasea DSM 20118(T). Chemotaxonomic properties confirm the 16S rRNA gene-based generic affiliation, i.e. a DNA G+C content of 71.5 mol%, anteiso-C(15:0) and C(16:0) as the major fatty acids, MK-9(H(4)) as the major isoprenoid quinone, a peptidoglycan containing L-ornithine as the diamino acid and D-aspartic acid in the interpeptide bridge and phosphatidylglycerol as the only identified main polar lipid. The strain is aerobic to facultatively anaerobic, being capable of growth under strictly anaerobic conditions. Optimal growth occurs between pH values 9.0 and 10.0. On the basis of its distinct phylogenetic position and metabolic properties, strain 69B4(T) represents a novel species of the genus Cellulomonas, for which the name Cellulomonas bogoriensis sp. nov. is proposed. The type strain is 69B4(T) (=DSM 16987(T)=CIP 108683(T)).

  20. Preliminary SP-100/Stirling heat exchanger designs

    International Nuclear Information System (INIS)

    Schmitz, P.; Tower, L.; Blue, B.; Dunn, P.


    Analytic modeling of several heat exchanger concepts to couple the SP-100 nuclear reactor lithium loop and the Space Stirling Power Convertor (SSPC) was performed. Four 25 kWe SSPC's are used to produce the required 100 kW of electrical power. This design work focused on the interface between a single SSPC and the primary lithium loop. Manifolding to separate and collect the four channel flow was not modeled. This work modeled two separate types of heat exchanger interfaces (conductive coupling and radiative coupling) to explore their relative advantages and disadvantages. The minimum mass design of the conductively coupled concepts was 18 kg or 0.73 kg/kWe for a single 25 kWe convertor. The minimum mass radiatively coupled concept was 41 kg or 1.64 kg/kWe. The direct conduction heat exchanger provides a lighter weight system because of its ability to operate the Stirling convertor evaporator at higher heat fluxes than those attainable by the radiatively coupled systems. Additionally the conductively coupled concepts had relatively small volumes and provide potentially simpler assembly. Their disadvantages were the tight tolerances and material joining problems associated with this refractory to superalloy interface. The advantages of the radiatively coupled designs were the minimal material interface problems

  1. Preliminary SP-100/Stirling heat exchanger designs

    International Nuclear Information System (INIS)

    Schmitz, P.; Tower, L.; Dawson, R.; Blue, B.; Dunn, P.


    Analytic modeling of several heat exchanger concepts to couple the SP-100 nuclear reactor primary lithium loop and the Space Stirling Power Convertor (SSPC) was performed. Four 25 kWe SSPC's are used to produce the required 100 kW of electrical power. This design work focused on the interface between a single SSPC and the primary lithium loop. Manifolding to separate and collect the four channel flow was not modeled. This work modeled two separate types of heat exchanger interfaces (conductive coupling and radiative coupling) to explore their relative advantages and disadvantages. The minimum mass design of the conductively coupled concepts was 18 kg or 0.73 kg/kWe for a single 25 kWe convertor. The minimum mass radiatively coupled concept was 41 kg or 1.64 kg/kWe. The direct conduction heat exchanger provides a lighter weight system because of its ability to operate the Stirling convertor evaporator at higher heat fluxes than those attainable by the radiatively coupled systems. Additionally the conductively coupled concepts had relatively small volumes and provide potentially simpler assembly. Their disadvantages were the tight tolerances and material joining problems associated with this refractory to superalloy interface. The advantages of the radiatively coupled designs were the minimal material interface problems

  2. Accomplishments and plans of SP-100 program

    International Nuclear Information System (INIS)

    Wright, W.E.


    The SP-100 program is proceeding toward concept definitions for a space nuclear reactor which is safe and suitable for civilian and military applications. The selection of a specific design and demonstration of the base technologies was scheduled for the end of 1985, to be followed by engineering development and ground testing in 1986. The main current uses/users thus far anticipated are communications satellites, both military and civilian, radar (and possibly laser) surveillance and remote sensing systems, and manufacturing and other extensions of a space station growth scenario. The reactor will weigh no more than 3000 kg and must fit into the Orbiter bay with a payload and OTV. Three concepts are still under evaluation: a lithium-cooled reactor with thermoelectrics; an in-core thermionic system with pumped sodium-potassium coolant; and a configuration with a Stirling engine to convert reactor heat into electricity. If the engineering analyses and base tests are successful, it is expected that the flight application phase can be reached by 1991 at the latest

  3. Phenotypic diversity of Xanthomonas sp. mangiferaeindicae. (United States)

    Pruvost, O; Couteau, A; Perrier, X; Luisetti, J


    Carbohydrate utilization profiles by means of the API (Appareils et Procédés d'Identification) system and sensitivity to antibiotics and heavy metal salts of 68 Xanthomonas sp. mangiferaeindicae strains isolated in nine countries from mango (Mangifera indica L.) and other genera of the Anacardiaceae were examined to assess the variability of the taxon. The strains could be separated into 10 groups according to Ward clustering. Apigmented strains isolated from the pepper tree [syn. Brazilian pepper] (Schinus terebenthifolius Raddi) could not be clearly differentiated from most apigmented strains isolated from mango. Yellow-pigmented strains isolated from mango in Brazil and Reunion Island, apigmented strains isolated from mango in Brazil and from ambarella in the French West Indies, clustered in distinct groups. The results are consistent with those of other studies, based on isozyme analysis of esterase, phosphoglucomutase and superoxide dismutase, and hrp-RFLP analysis; they indicate the need for a comprehensive taxonomic evaluation of xanthomonads associated with Anacardiaceae.

  4. Kribbella sindirgiensis sp. nov. isolated from soil. (United States)

    Ozdemir-Kocak, Fadime; Isik, Kamil; Saricaoglu, Salih; Saygin, Hayrettin; Inan-Bektas, Kadriye; Cetin, Demet; Guven, Kiymet; Sahin, Nevzat


    A Kribbella strain FSN23 T was isolated from soil sample which was collected from Caygoren Dam lakeside located in Sındırgı, Turkey. The isolate was investigated using a polyphasic approach consisting of numeric, chemotaxonomic and molecular analysis. The isolate indicated chemotaxonomic, morphological and phylogenetic properties associated with members of the genus Kribbella. Phylogenetic analysis based on the 16S rRNA sequence of the strain demonstrated that the strain forms a subclade with K. aluminosa HKI 0478 T and K. jejuensis HD9 T . The organism formed an extensively branched substrate and aerial hyphae which generated spiral chains of spores with smooth surfaces. The cell wall contained LL-diaminopimelic acid, and the whole cell sugars were glucose and ribose along with trace amounts of mannose. The polar lipids were identified as phosphatidylglycerol, diphosphatidylglycerol, four unidentified lipids and five unidentified polar lipids. The predominant menaquinone was MK-9(H 4 ). The major cellular fatty acids were anteiso-C 15:0 and iso-C 16:0 . Polyphasic taxonomy properties confirm that strain FSN23 T represents a novel Kribbella taxon distinguished from closely related type strains. Hence, strain FSN23 T (=KCTC 29220 T  = DSM 27082 T ) is proposed as the type strain of a novel species with the name Kribbella sindirgiensis sp. nov.

  5. Campylobacter iguaniorum sp. nov., isolated from reptiles. (United States)

    Gilbert, Maarten J; Kik, Marja; Miller, William G; Duim, Birgitta; Wagenaar, Jaap A


    During sampling of reptiles for members of the class Epsilonproteobacteria, strains representing a member of the genus Campylobacter not belonging to any of the established taxa were isolated from lizards and chelonians. Initial amplified fragment length polymorphism, PCR and 16S rRNA sequence analysis showed that these strains were most closely related to Campylobacter fetus and Campylobacter hyointestinalis. A polyphasic study was undertaken to determine the taxonomic position of five strains. The strains were characterized by 16S rRNA and atpA sequence analysis, matrix-assisted laser desorption ionization time-of-flight (MALDI-TOF) mass spectrometry and conventional phenotypic testing. Whole-genome sequences were determined for strains 1485E(T) and 2463D, and the average nucleotide and amino acid identities were determined for these strains. The strains formed a robust phylogenetic clade, divergent from all other species of the genus Campylobacter. In contrast to most currently known members of the genus Campylobacter, the strains showed growth at ambient temperatures, which might be an adaptation to their reptilian hosts. The results of this study clearly show that these strains isolated from reptiles represent a novel species within the genus Campylobacter, for which the name Campylobacter iguaniorum sp. nov. is proposed. The type strain is 1485E(T) ( = LMG 28143(T) = CCUG 66346(T)). © 2015 IUMS.

  6. Taxonomic study of bacteria isolated from plants: proposal of Sphingomonas rosa sp. nov., Sphingomonas pruni sp. nov., Sphingomonas asaccharolytica sp. nov., and Sphingomonas mali sp. nov. (United States)

    Takeuchi, M; Sakane, T; Yanagi, M; Yamasato, K; Hamana, K; Yokota, A


    The taxonomic positions of 10 strains of 3-ketolactose-forming bacteria which were isolated from the roots of plants (Rosa sp., Psychotria nairobiensis, Ardisia crispa, Prunus persica, and apple trees) were investigated. The DNA base compositions of these strains ranged from 64.0 to 65.7 mol%, the isoprenoid quinone of each strain was ubiquinone 10, 3-hydroxy fatty acids were lacking in the cellular fatty acids of these organisms, and all of the strains contained a sphingolipid with the long-chain base dihydrosphingosin. These are characteristics of the genus Sphingomonas. On the basis of morphological, physiological, and chemotaxonomic characteristics, together with DNA-DNA hybridization and 16S ribosomal DNA sequence comparison data, we propose the following four new species of the genus Sphingomonas: Sphingomonas rosa (type strain, IFO 15208) for the strains isolated from rose plants and formerly named [Agrobacterium rhizogenes]; Sphingomonas pruni (type strain, IFO 15498) for the strains isolated from Prunus persica; and Sphingomonas asaccharolytica (type strain, IFO 15499) and Sphingomonas mali (type strain, IFO 15500) for the strains isolated from apple trees. Two strains which were isolated from Psychotria nairobiensis and formerly named [Chromobacterium lividum] were identified as Sphingomonas yanoikuyae strains.

  7. Chryseobacterium solincola sp. nov., isolated from soil. (United States)

    Benmalek, Yam; Cayol, Jean-Luc; Bouanane, Nabila A; Hacene, Hocine; Fauque, Guy; Fardeau, Marie-Laure


    A Gram-staining-negative, yellow-pigmented, strictly aerobic bacterium, designated strain 1YB-R12T, was isolated from a soil sample in western Algeria. The novel isolate was heterotrophic, chemoorganotrophic, halotolerant and psychrotolerant. The temperature and pH optima for growth were 28-30 degrees C and pH 7.3-8. The bacterium tolerated up to 6% (w/v) NaCl. Cells were non-motile, non-gliding and non-spore-forming, and were characterized by a variable morphological cycle. Flexirubin-type pigments were not detected. 16S rRNA gene sequence analysis showed that strain 1YB-R12T occupied a distinct lineage within the genus Chryseobacterium and shared highest sequence similarity with Chryseobacterium haifense LMG 24029T (96.5%). The DNA G+C content of strain 1YB-R12T was 40.9 mol%. The predominant cellular fatty acids were anteiso-C15:0 (41.4%) and iso-C15:0 (14.4%). On the basis of phenotypic properties and phylogenetic distinctiveness, strain 1YB-R12T is considered to represent a novel species of the genus Chryseobacterium, for which the name Chryseobacterium solincola sp. nov. is proposed. The type strain is 1YB-R12T (=DSM 22468T=CCUG 55604T).

  8. Production of biodiesel from Coelastrella sp. microalgae (United States)

    Mansur, Dieni; Fitriady, Muhammad Arifuddin; Susilaningsih, Dwi; Simanungkalit, Sabar Pangihutan


    Microalgae have a wide area of usage and one of them it can be used for biodiesel production. In biodiesel production, lipids containing triglyceride or free fatty acid are converted into methyl ester through trans/esterification reactions. Lipids from microalgae can be extracted by acetone and dimethyl carbonate using homogenizer. Esterification of the lipids was investigated using various catalysts and source of methyl group. Activity of homogeneous catalyst such as HCl and H2SO4 and heterogeneous catalysts such as montmorillonit K-10 and ledgestone was investigated. Moreover, methanol and dimethyl carbonate as source of methyl group were also studied. Among of catalysts with methanol as source of methyl group, it was found that yield of crude biodiesel derived from Choelestrella Sp. microalgae was high over H2SO4 catalyst. On the other hand, over H2SO4 catalyst using dimethyl carbonate as source of methyl group, yield of crude biodiesel significant increase. However, FAME composition of crude biodiesel was high over HCl catalyst.

  9. Mycorrhizal dependency of laurel (Ocotea sp.)

    International Nuclear Information System (INIS)

    Sierra-Escobar, Jorge A; Castro Restrepo, Dagoberto; Osorio Vega, Walter


    A greenhouse experiment was carried out to determine the mycorrhizal dependency of laurel (>Ocotea sp.). In order to do this, a completely randomized experimental design was used, with six treatments in a factorial array of 3 x 2 and five repetitions. The treatments involved a combination of three Phosphorus (P) levels in soil solution (0.002, 0.02 and 0.2 mg L-1) and two levels of mycorrhizal inoculation, either inoculated or non-inoculated with Glomus aggregatum Schenck and Smith. The leaf P content as a function of time was used as an output variable. Shoot dry matter, shoot P content, mycorrhizal colonization of roots, and mycorrhizal dependence were measured at harvest. The results indicated that the leaf P content increased significantly when using the mycorrhizal inoculation in laurel at P level 0.2 mg L -1, but not in the other P levels, on some of the sampling days. Shoot dry weight and total plant P content did not increase at all levels of soil available P. Mycorrhizal dependency of laurel reached 28%, which allows this species to be classified as moderately dependent on mycorrhiza.

  10. The Growth of Monoraphidium sp. and Scenedesmus sp. Cells in the Presence of Thorium

    Directory of Open Access Journals (Sweden)

    Juliana Cristina de Queiroz


    Full Text Available Toxicity of thorium by Monoraphidium sp. and Scenedesmus sp. was studied. Microalgal cultures were inoculated in ASM-1 medium in presence and absence of thorium. Its effect was monitored by direct counting on Fuchs-Rosenthal chamber and with software. The toxicity of thorium over the species was observed for concentrations over 50.0 mg/L. After 30 days, Monoraphidium cells decreased their concentration from 4.23×106 to 4.27×105 and 8.57×105 cells/mL, in the presence of 50.0 and 100.0 mg/L of thorium, respectively. Scenedesmus sp. cells were more resistant to thorium: for an initial cell concentration of 7.65×104 cells/mL it was observed a change to 5.25×105 and 5.12×105 cells/mL, in the presence of thorium at 50.0 and 100.0 mg/L, respectively. This is an indication that low concentrations of the radionuclide favored the growth, and that Scenedesmus cells are more resistant to thorium than Monoraphidium cells. The software used for comparison with direct count method proved to be useful for the improvement of accuracy of the results obtained, a decrease in the uncertainty and allowed recording of the data. The presence of thorium suggests that low concentrations have a positive effect on the growth, due to the presence of the nitrate, indicating its potential for ecotoxicological studies.

  11. Aborto eqüino por Leptospira sp. Leptospira sp. as a cause of equine abortion

    Directory of Open Access Journals (Sweden)

    Caroline Argenta Pescador


    Full Text Available Descreve-se um caso de aborto eqüino por Leptospira sp. em um feto de 6 meses proveniente de um estabelecimento localizado próximo a Porto Alegre/RS. As lesões macroscópicas se caracterizaram por icterícia e hemorragias distribuídas difusamente sobre a pele, mucosa oral, tecido subcutâneo, pulmão, coração e sistema gastrintestinal. O fígado estava aumentado de tamanho, friável e de coloração amarelada. Os rins apresentavam hemorragias petequiais na superfície capsular e na superfície de corte observaram-se palidez da região cortical e medular. Cortes de rim e sistema nervoso central, corados por Warthin-Starry, revelaram a presença de espiroquetas nos túbulos, glomérulos e substância branca do encéfalo. Cultivo aeróbio de amostras de fígado e pulmão não revelaram crescimento bacteriano significativo. O teste de imunofluorescência direta para Leptospira sp. foi positivo e a sorologia fetal resultou numa titulação de 80 para o sorovar copenhageni e 40 para os sorovares icterohaemorragiae e pomona.This report describes an abortion on 6-month-old equine aborted fetus that has been caused by Leptospira sp. Main lesions included jaundice and hemorrhages diffusely scattered throughout the skin, oral mucosa, subcutaneous tissues, lungs, heart and gastrointestinal system. The liver was enlarged, pliable and yellow colored. The cortical and medullar of the kidneys were pale and petechial hemorrhages were present on the capsular surface. Warthin-Starry stained slices of the kidneys and central nervous system revealed the presence of spirochaetes within the tubules, glomeruli and white matter of the encephalo. Aerobic cultivation from samples of the liver and lungs were negative. The direct immunofluorescence test for Leptospira sp. was positive and the fetus’s serological test resulted titers of 80 against sorotype copenhageni and 40 against the sorotypes icterohaemorragiae and pomona.

  12. Microfibril-associated Protein 4 Binds to Surfactant Protein A (SP-A) and Colocalizes with SP-A in the Extracellular Matrix of the Lung

    DEFF Research Database (Denmark)

    Schlosser, Anders; Thomsen, Theresa H.; Shipley, J. Michael


    Pulmonary surfactant protein A (SP-A) is an oligomeric collectin that recognizes lipid and carbohydrate moieties present on broad range of micro-organisms, and mediates microbial lysis and clearance. SP-A also modulates multiple immune-related functions including cytokine production and chemotaxis......-A composed of the neck region and carbohydrate recognition domain of SP-A indicating that the interaction between MFAP4 and SP-A is mediated via the collagen domain of SP-A. Monoclonal antibodies directed against MFAP4 and SP-A were used for immunohistochemical analysis, which demonstrates that the two...

  13. In vitro micropropagation of orchid, Oncidium sp. (Dancing Dolls ...

    African Journals Online (AJOL)

    Oncidium sp.). In vitro regeneration multiplication and rooting of plantlets were achieved from the immature seeds on Murashige and Skoog's medium supplemented with BAP (2.0 mg/l). Rooted plantlets were then transferred to perforated ...

  14. 4-Dehydroecdysterone, a new ecdysteroid from the zoanthid Parazoanthus sp. (United States)

    Searle, P A; Molinski, T F


    A novel ecdysteroid, 4-dehydroecdysterone [3], has been isolated from the zoanthid Parazoanthus sp. collected from Port Phillip Bay, Australia. The known ecdysteroids ecdysterone [1] and ajugasterone C [2] were also isolated, together with the known alkaloid paragracine [4].

  15. Biomineralization of a calcifying ureolytic bacterium Microbacterium sp. GM-1

    Directory of Open Access Journals (Sweden)

    Guojing Xu


    Conclusions: The results of this research provide evidence that Microbacterium sp. GM-1 can biologically induce calcification and suggest that strain GM-1 may play a potential role in the synthesis of new biominerals and in bioremediation or biorecovery.

  16. Biotransformation of 6-deoxypseudoanisatin by Synechocystis sp. PCC6803

    Directory of Open Access Journals (Sweden)

    Zhi Wang


    Conclusion: Thus, the study appears to demonstrate that Synechocystis sp. PCC6803 can transform 6-deoxypseudoanisatin. The polarity of the converted product is less than that of 6-deoxypseudoanisatin.

  17. Volvatellin, caulerpenyne-related product fromt he sacoglossan Volvatella sp.

    Digital Repository Service at National Institute of Oceanography (India)

    Fontana, A; Ciavatta, M.L.; Mollo, E; Naik, C.G.; Wahidullah, S.; De; Cimino, G.

    Volvatellin (4) is a highly unstable terpene isolated from the extracts of the Indian opisthobranch mollusk Volvatella sp. The structure and the relative stereochemistry of 4 were determined by NMR methods. The paper also describes a hypothetical...

  18. Massarina armatispora sp. nov., a new intertidal ascomycete from mangroves

    Digital Repository Service at National Institute of Oceanography (India)

    Hyde, K.D.; Vrijmoed, L.L.P.; Chinnaraj, S.; Jones, E.B.G.

    Massarina armatispora sp. nov. is described from dead intertidal mangrove wood collected in India and Hong Kong. The new taxon is compared with other M. species, and its placement in the genus Massarina is discussed...

  19. Environmental interactions and the SP-100 power system

    International Nuclear Information System (INIS)

    Ferguson, D.C.


    The Civil Space Technology Initiative High-Capacity-Power Environmental Interactions Program has made great progress in defining and evaluating the interactions of the SP-100 power system with its expected ambient environments. The NASCAP/LEO and POLAR computer codes demonstrated that local electric fields at the user interface module are high. Therefore, particular attention must be paid to geometries and materials in this region to prevent arcing at conductor-insulator junctions in low Earth orbit. NASCAP/LEO and EPSAT computer models revealed that SP-100 payloads float about 100 V negative of the LEO plasma. In addition, ground tests and modeling done for the Space Station Freedom Electrical Grounding Tiger Team found that dielectric coatings often break down at such voltages in a plasma. Thus, surface coatings for SP-100 payloads should be carefully selected. Sputtering may also be a concern for long-duration missions in LEO at these voltages. Much work has been done on a sputtering model to evaluate surface material loss rates on SP-100 payloads. In ground plasma chamber tests of cables and cable insulators at SP-100 voltages, parasitic power losses due to the plasma current collected from possible pinholes or coating defects were quantified and shown to be small. Modeling revealed that the power loss from currents to other surfaces is also small. The atomic oxygen durability of SP-100 materials and coatings continues to be investigated in ground tests. In the upcoming Evaluation of Oxygen Interaction with Materials (EOIM-3) Shuttle flight experiment, a host of SP-100 materials will be evaluated for atomic oxygen durability in LEO. Finally, an evaluation of the interactions of the SP-100 power system with lunar and planetary environments has started. At a workshop on chemical and electrical interactions on Mars recently held at the NASA Lewis Research Center, many of primary interactions were identified

  20. Idiopathic granulomatous mastitis associated with corynebacterium sp. Infection. (United States)

    Stary, Creed Michael; Lee, Yun Sun; Balfour, John


    Idiopathic granulomatous mastitis (IGM) is a rare inflammatory condition of the breast. The etiology and treatments options of IGM remain controversial. Previous case reports have suggested that Corynebacterium sp., a gram-positive bacillus endogenous to the skin, may be associated with IGM. In the present report, we describe the first case of IGM with a positive culture for Corynebacterium sp. reported in the United States.

  1. Pigment Production from Immobilized Monascus sp. Utilizing Polymeric Resin Adsorption


    Evans, Patrick J.; Wang, Henry Y.


    Pigment production by the fungus Monascus sp. was studied to determine why Monascus sp. provides more pigment in solid culture than in submerged culture. Adding a sterilized nonionic polymeric adsorbent resin directly to the growing submerged culture did not enhance the pigment production, thus indicating that pigment extraction is probably not a factor. Monascus cells immobilized in hydrogel were studied and exhibited decreased pigment production as a result of immobilization. This result is...

  2. Candida spencermartinsiae sp. nov., Candida taylorii sp. nov. and Pseudozyma abaconensis sp. nov., novel yeasts from mangrove and coral reef ecosystems. (United States)

    Statzell-Tallman, Adele; Scorzetti, Gloria; Fell, Jack W


    Three species of yeasts are taxonomically described for strains isolated from marine environments. Candida spencermartinsiae sp. nov. (type strain CBS 10894T =NRRL Y-48663T) and Candida taylorii sp. nov. (type strain CBS 8508T =NRRL Y-27213T) are anamorphic ascomycetous yeasts in a phylogenetic cluster of marine yeasts in the Debaryomyces/Lodderomyces clade of the Saccharomycetales. The two species were isolated from multiple locations among coral reefs and mangrove habitats. Pseudozyma abaconensis sp. nov. (type strain CBS 8380T =NRRL Y-17380T) is an anamorphic basidiomycete that is related to the smut fungi of the genus Ustilago in the Ustilaginales. P. abaconensis was collected from waters adjacent to a coral reef.

  3. Uranium and thorium uptake by live and dead cells of Pseudomonas Sp

    International Nuclear Information System (INIS)

    Siva Prasath, C.S.; Manikandan, N.; Prakash, S.


    This study presents uptake of uranium (U) and thorium (Th) by live and dead cells of Pseudomonas Sp. Increasing concentration of U and Tb showed decrease in absorption by Pseudomonas Sp. Dead cells of Pseudomonas Sp. exhibited same or more uptake of U and Th than living cells. Increasing temperature promotes uptake of U and Th by Pseudomonas Sp. (author)

  4. Verrucosispora andamanensis sp. nov., isolated from a marine sponge. (United States)

    Supong, Khomsan; Suriyachadkun, Chanwit; Suwanborirux, Khanit; Pittayakhajonwut, Pattama; Thawai, Chitti


    An actinomycete strain, SP03-05(T), was isolated from a marine sponge sample (Xestospongia sp.) collected from Phuket Province of Thailand. The strain was aerobic, Gram-stain-positive and produced single spores at the tips of the substrate mycelium. Strain SP03-05(T) contained meso-diaminopimelic acid in the peptidoglycan; whole-cell sugars were arabinose, galactose, glucose, rhamnose, ribose and xylose. The polar lipid profile of strain SP03-05(T) consisted of phosphatidylethanolamine, diphosphatidylglycerol, phosphatidylinositol, phosphatidylinositol mannosides and unknown polar lipids. Morphological and chemotaxonomic characteristics of the strain identified it as a member of the family Micromonosporaceae. Phylogenetic analysis based on 16S rRNA gene sequences showed similarity of the strain to Verrucosispora lutea YIM 013(T) (96.90 %), Verrucosispora sediminis MS426(T) (96.90 %), Verrucosispora gifhornensis DSM 44337(T) (96.80 %), Verrucosispora maris AB-18-032(T) (96.80 %) and Verrucosispora qiuiae RtIII47(T) (95.40 %). The DNA G+C content was 72.4 mol%. The phenotypic, genotypic and DNA-DNA hybridization results supported the classification of this strain as a representative of a novel species in the genus Verrucosispora, for which the name Verrucosispora andamanensis sp. nov. is proposed. The type strain is SP03-05(T) ( = BCC 45620(T) = NBRC 109075(T)).

  5. Cellulomonas soli sp. nov. and Cellulomonas oligotrophica sp. nov., isolated from soil. (United States)

    Hatayama, Kouta; Esaki, Kouji; Ide, Teruhiko


    Two novel bacterial strains, designated Kc1(T) and Kc5(T), were isolated from soil in Japan. Cells of the novel strains were Gram-reaction-positive, aerobic or facultatively anaerobic, motile rods. Phylogenetic analyses based on 16S rRNA gene sequences indicated that both strains belonged to the genus Cellulomonas. The 16S rRNA gene sequences of strains Kc1(T) and Kc5(T) showed closest similarity to that of Cellulomonas terrae DB5(T) (98.1 % and 98.4 % similarity, respectively), and the 16S rRNA gene similarity between the two novel strains was 97.8 %. In both strains, the major menaquinone was MK-9(H(4)), the predominant polar lipids were diphosphatidylglycerol and phosphatidylinositol mannosides, and the peptidoglycan contained ornithine and glutamic acid. Cell-wall sugars were identified as rhamnose, galactose and mannose in strain Kc1(T) and rhamnose and glucose in strain Kc5(T). The DNA G+C contents of strains Kc1(T) and Kc5(T) were 73.6 mol% and 75.8 mol%, respectively. Based on the chemotaxonomic and physiological data and the results of DNA-DNA hybridizations, the two strains represent two novel species within the genus Cellulomonas, for which the names Cellulomonas soli sp. nov. (type strain Kc1(T) =DSM 24484(T) =JCM 17535(T)) and Cellulomonas oligotrophica sp. nov. (type strain Kc5(T) =DSM 24482(T) =JCM 17534(T)) are proposed.

  6. Halotolerant laccases from Chaetomium sp., Xylogone sphaerospora, and Coprinopsis sp. isolated from a Mediterranean coastal area. (United States)

    Qasemian, Leila; Billette, Christophe; Guiral, Daniel; Alazard, Emilie; Moinard, Magalie; Farnet, Anne-Marie


    Laccases (EC are phenoloxidases involved in the transformation of the recalcitrant fraction of organic matter in soil. These enzymes are also able to transform certain aromatic pollutants such as polycyclic aromatic hydrocarbons (PAHs) and are known to be inhibited by chloride ions. This study aims to test the potential of some fungal strains newly isolated from natural environments subjected to high osmotic pressure such as coastal ecosystems, to produce chloride tolerant laccases. Three strains were identified as Chaetomium sp., Xylogone sphaerospora (two Ascomycota), and Coprinopsis sp. (a Basidiomycota) and the laccases produced by these fungi were weakly inhibited by chloride ions compared with previous data from literature. Moreover, we tested their reactivity towards various PAHs which are widespread anthropic pollutants. They were able to transform anthracene to 9,10-anthraquinone and we determine 7.5 eV as the threshold of ionization potential for PAH oxidation by these laccases. Copyright © 2012 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  7. Description and phylogenetic relationships of Spumochlamys perforata n. sp. and Spumochlamys bryora n. sp. (Amoebozoa, Arcellinida). (United States)

    Kudryavtsev, Alexander; Pawlowski, Jan; Hausmann, Klaus


    Spumochlamys perforata n. sp. and Spumochlamys bryora n. sp. were isolated and described from dry epiphytic moss. The morphology and ultrastructure of both species clearly demonstrate that they belong to the genus Spumochlamys (family Microchlamyiidae). They differ from its only described member, Spumochlamys iliensis (as well as from species of Microchlamys), in the relief of the dorsal surface of the test, revealed by scanning electron microscopy, which can represent a good characteristic for species identification. They also differ in the structure of the dorsal part of the test wall (especially S. perforata). Small subunit ribosomal DNA-based molecular phylogenetic analyses show that Spumochlamys is a deeply branching lineage of the Arcellinida, without any close affinities. Actin gene sequence analysis places this genus within the Tubulinea, close to two other arcellinid lineages but without forming a monophyletic group with them. These data together strongly suggest that the lack of resolution in the arcellinid molecular phylogenies is due to serious undersampling of taxa, a limited number of sequence data, and high divergence rates in most of the species.

  8. Potencial de antagonismo de isolados de Trichoderma sp. contra o isolados de Fusarium sp., in vitro

    Directory of Open Access Journals (Sweden)

    Charles Anthony Hoffmann


    Full Text Available Resumo – O uso discriminado de agrotóxicos acarreta em uma grande prejuízo a saúdes das pessoas e do meio ambiente. O uso de novos métodos de combate a pragas se faz necessário para o equilíbrio da cadeia produtiva. A utilização de microrganismos no combate a pragas se faz como uma boa alternativa. O trabalho objetivou-se em avaliar o potencial de antagonismo de isolados de Trichoderma sp. contra o patógeno Fusarium sp. in vitro. Para isso foi utilizado os métodos de confronto direto, pareamento de culturas e de metabólitos voláteis. Os experimentos foram realizados na incubadora de empresas da Universidade Federal do Tocantins – UFT Campus de Gurupi, seguiram com três repetições. Foram testados 15 isolados do antagonista em confronto direto com o patógeno e os mesmos isolados e patógeno foram testados em metabólitos voláteis ambos utilizando o meio de cultura BDA. Todos os isolados apresentaram antagonismo in vitro contra o patógeno.

  9. Identification and production of bioflocculants by Enterobacter sp. and Bacillus sp. and their characterization studies. (United States)

    Muthulakshmi, L; Nellaiah, H; Kathiresan, T; Rajini, N; Christopher, Fenila


    In this work, two bioflocculants, namely, EB-EPS and B1-EPS, were derived from Enterobacter sp. and Bacillus sp., respectively, and analyzed with regard to their production and characterization. About 0.9 and 0.16 g of purified EB and B1 were obtained from I L of fermentation broth. Chemical analysis showed the contents of purified EB and B1 mainly as 88.7 and 92.8% (w/w) of carbohydrate, and 11.3 and 21.8% (w/w) protein, respectively. Fourier-transform infrared spectrometry analysis revealed the presence of hydroxyl, amide, and carboxyl groups in the identified bioflocculant. Thermogravimetric analysis (TGA) results exhibited enhanced thermal stability with a minimum mass loss of 50% while 25% were found to have occurred at higher temperatures (>400°C) for microbe-derived compounds EB and B1 leading to the possibility of using these compounds as fillers or for fabricating composite films for high-temperature applications. Further, the compounds from both the bacteria exhibited good antibacterial characteristics against pathogenic Escherichia coli. Degradability study of bioflocculant-embedded composite films shows the possibility of attaining eco-friendly bioremediation. Accordingly, experimental results revealed the suitability of developed composite films as a suitable alternative for food packaging and biomedical applications.

  10. Listeria booriae sp. nov. and Listeria newyorkensis sp. nov., from food processing environments in the USA. (United States)

    Weller, Daniel; Andrus, Alexis; Wiedmann, Martin; den Bakker, Henk C


    Sampling of seafood and dairy processing facilities in the north-eastern USA produced 18 isolates of Listeria spp. that could not be identified at the species-level using traditional phenotypic and genotypic identification methods. Results of phenotypic and genotypic analyses suggested that the isolates represent two novel species with an average nucleotide blast identity of less than 92% with previously described species of the genus Listeria. Phylogenetic analyses based on whole genome sequences, 16S rRNA gene and sigB gene sequences confirmed that the isolates represented by type strain FSL M6-0635(T) and FSL A5-0209 cluster phylogenetically with Listeria cornellensis. Phylogenetic analyses also showed that the isolates represented by type strain FSL A5-0281(T) cluster phylogenetically with Listeria riparia. The name Listeria booriae sp. nov. is proposed for the species represented by type strain FSL A5-0281(T) ( =DSM 28860(T) =LMG 28311(T)), and the name Listeria newyorkensis sp. nov. is proposed for the species represented by type strain FSL M6-0635(T) ( =DSM 28861(T) =LMG 28310(T)). Phenotypic and genotypic analyses suggest that neither species is pathogenic. © 2015 IUMS.

  11. Watery rot of pseudo-stem (Dickeya sp. management in banana (Musa sp. under greenhouse conditions

    Directory of Open Access Journals (Sweden)

    Joaquín Guillermo Ramírez


    Full Text Available This crop has serious constraints with diseases, including those caused by bacteria, such as Dickeya sp. This research aimed to evaluate the effect of 4 resistance inductors and 3 doses in Chlorine Dioxide in handling watery rot of pseudo-stem (Dickeya sp. in banana. Resistance inducers and their doses were Potassium Phosphite: 1.5 cm 3 .l -1 ; 3-Aminobutanoic Acid: 1.0 g.l -1 ; Methyl Jasmonate: 0.2 g.l -1 ; S-Methyl-Acibenzolar: 0.3 ml.l -1 , all by foliar application, while Chlorine Dioxide was injected into the pseudo-stem, in doses of 10, 20 and 30 mg.l -1 . The evaluated variables were: development of the disease, total biomass and quantification of the bacterium in the inoculated pseudo-stems. Applications of Chlorine Dioxide achieved a reduction of disease by 65.4, 91.99 and 61.5%, in addition to an inhibition of 100% of the pathogen, using 30 and 50 mg.l -1 doses. Meanwhile, the use of resistance inductors reduced up to 60.6% of the disease, but this effect failed to improve plant growth.

  12. Lactobacillus saniviri sp. nov. and Lactobacillus senioris sp. nov., isolated from human faeces. (United States)

    Oki, Kaihei; Kudo, Yuko; Watanabe, Koichi


    Two Gram-stain-positive strains, YIT 12363(T) and YIT 12364(T), were isolated from human faeces. They were rod-shaped, non-motile, asporogenous, facultatively anaerobic and did not exhibit catalase activity. Comparative analyses of 16S rRNA, pheS and rpoA gene sequences demonstrated that the novel strains were members of the genus Lactobacillus. On the basis of 16S rRNA gene sequence similarity, the type strains of Lactobacillus casei (95.3% similarity), Lactobacillus paracasei subsp. paracasei (95.6%), Lactobacillus paracasei subsp. tolerans (95.3%) and Lactobacillus rhamnosus (95.4%) were the closest neighbours to strain YIT 12363(T). For strain YIT 12364(T), the highest similarity values were observed with the type strains of Lactobacillus diolivorans, Lactobacillus parafarraginis and Lactobacillus rapi (95.8, 96.0 and 96.0%, respectively). Phenotypic and genotypic features demonstrated that these strains each represent a separate novel species of the genus Lactobacillus, and the names Lactobacillus saniviri sp. nov. (type strain YIT 12363(T)=JCM 17471(T)=DSM 24301(T)) and Lactobacillus senioris sp. nov. (type strain YIT 12364(T)=JCM 17472(T)=DSM 24302(T)), respectively, are proposed.

  13. Prevotella copri sp. nov. and Prevotella stercorea sp. nov., isolated from human faeces. (United States)

    Hayashi, Hidenori; Shibata, Kensaku; Sakamoto, Mitsuo; Tomita, Shinichi; Benno, Yoshimi


    Six strains (CB7(T), CB18, CB23, CB26, CB28 and CB35(T)) were isolated from human faeces. Based on phylogenetic analysis, phenotypic characteristics, cellular fatty acid profiles and menaquinone profiles, these strains could be included within the genus Prevotella and made up two clusters. 16S rRNA gene sequence analysis indicated that five strains were most closely related to Prevotella veroralis, sharing about 92 % sequence similarity; the remaining strain was most closely related to Prevotella shahii, sharing about 90 % sequence similarity. All six strains were obligately anaerobic, non-pigmented, non-spore-forming, non-motile, Gram-negative rods. The cellular fatty acid compositions of the six strains differed significantly from those of other Prevotella species. Five strains (CB7(T), CB18, CB23, CB26 and CB28) contained dimethyl acetals and the major menaquinones of these strains were MK-11, MK-12 and MK-13. The major menaquinones of CB35(T) were MK-12 and MK-13. Based on phenotypic and phylogenetic findings, two novel species, Prevotella copri sp. nov. and Prevotella stercorea sp. nov., are proposed, representing the two different strain clusters. The DNA G+C contents of strains CB7(T) and CB35(T) were 45.3 and 48.2 mol%, respectively. The type strains of P. copri and P. stercorea are CB7(T) (=JCM 13464(T)=DSM 18205(T)) and CB35(T) (=JCM 13469(T)=DSM 18206(T)), respectively.

  14. Lactobacillus plajomi sp. nov. and Lactobacillus modestisalitolerans sp. nov., isolated from traditional fermented foods. (United States)

    Miyashita, Mika; Yukphan, Pattaraporn; Chaipitakchonlatarn, Winai; Malimas, Taweesak; Sugimoto, Masako; Yoshino, Mayumi; Kamakura, Yuki; Potacharoen, Wanchern; Tanasupawat, Somboon; Tanaka, Naoto; Nakagawa, Yasuyoshi; Suzuki, Ken-ichiro


    Three Lactobacillus-like strains, NB53T, NB446T and NB702, were isolated from traditional fermented food in Thailand. Comparative 16S rRNA gene sequence analysis indicated that these strains belong to the Lactobacillus plantarum group. Phylogenetic analysis based on the dnaK, rpoA, pheS and recA gene sequences indicated that these three strains were distantly related to known species present in the L. plantarum group. DNA-DNA hybridization with closely related strains demonstrated that these strains represented two novel species; the novel strains could be differentiated based on chemotaxonomic and phenotypic characteristics. Therefore, two novel species of the genus Lactobacillus, Lactobacillus plajomi sp. nov. (NB53T) and Lactobacillus modestisalitolerans sp. nov. (NB446T and NB702), are proposed with the type strains NB53T ( = NBRC 107333T = BCC 38054T) and NB446T ( = NBRC 107235T = BCC 38191T), respectively.

  15. Streptococcus loxodontisalivarius sp. nov. and Streptococcus saliviloxodontae sp. nov., isolated from oral cavities of elephants. (United States)

    Saito, Masanori; Shinozaki-Kuwahara, Noriko; Hirasawa, Masatomo; Takada, Kazuko


    Four Gram-stain-positive, catalase-negative, coccoid-shaped organisms were isolated from elephant oral cavities. The isolates were tentatively identified as streptococcal species based on the results of biochemical tests. Comparative 16S rRNA gene sequencing studies confirmed the organisms to be members of the genus Streptococcus. Two isolates (NUM 6304(T) and NUM 6312) were related most closely to Streptococcus salivarius with 96.8 % and 93.1 % similarity based on the 16S rRNA gene and the RNA polymerase β subunit encoding gene (rpoB), respectively, and to Streptococcus vestibularis with 83.7 % similarity based on the 60 kDa heat-shock protein gene (groEL). The other two isolates (NUM 6306(T) and NUM 6318) were related most closely to S. vestibularis with 97.0 % and 82.9 % similarity based on the 16S rRNA and groEL genes, respectively, and to S. salivarius with 93.5 % similarity based on the rpoB gene. Based on phylogenetic and phenotypic evidence, these isolates are suggested to represent novel species of the genus Streptococcus, for which the names Streptococcus loxodontisalivarius sp. nov. (type strain NUM 6304(T) = JCM 19287(T) = DSM 27382(T)) and Streptococcus saliviloxodontae sp. nov. (type strain NUM 6306(T) = JCM 19288(T) = DSM 27513(T)) are proposed. © 2014 IUMS.

  16. Streptococcus moroccensis sp. nov. and Streptococcus rifensis sp. nov., isolated from raw camel milk. (United States)

    Kadri, Zaina; Amar, Mohamed; Ouadghiri, Mouna; Cnockaert, Margo; Aerts, Maarten; El Farricha, Omar; Vandamme, Peter


    Two catalase- and oxidase-negative Streptococcus-like strains, LMG 27682(T) and LMG 27684(T), were isolated from raw camel milk in Morocco. Comparative 16S rRNA gene sequencing assigned these bacteria to the genus Streptococcus with Streptococcus rupicaprae 2777-2-07(T) as their closest phylogenetic neighbour (95.9% and 95.7% similarity, respectively). 16S rRNA gene sequence similarity between the two strains was 96.7%. Although strains LMG 27682(T) and LMG 27684(T) shared a DNA-DNA hybridization value that corresponded to the threshold level for species delineation (68%), the two strains could be distinguished by multiple biochemical tests, sequence analysis of the phenylalanyl-tRNA synthase (pheS), RNA polymerase (rpoA) and ATP synthase (atpA) genes and by their MALDI-TOF MS profiles. On the basis of these considerable phenotypic and genotypic differences, we propose to classify both strains as novel species of the genus Streptococcus, for which the names Streptococcus moroccensis sp. nov. (type strain, LMG 27682(T)  = CCMM B831(T)) and Streptococcus rifensis sp. nov. (type strain, LMG 27684(T)  = CCMM B833(T)) are proposed. © 2014 IUMS.

  17. Optimization of Chlorella SP. Flour Fortification in the Processing of Nata


    Zulistiara, Juanidia; ', Syahrul; ', Sumarto


    This research aimed to study the effect of Chlorella sp.different weight and to find out the optimum weigth of Chlorella sp. flour fortified into the nata. The method used was experimental, that was fortification of Chlorella sp. flour in the processing of nata. The design used was a non-factorial completely randomized design, consisted of 4 weigth levels, namely: no Chlorella sp. flour added (N1), added with 2 gs Chlorella sp. Flour (N2), 4 gs Chlorella sp. flour (N3) and 6 gs Chlorella sp. ...

  18. Benefit Analysis of SPC Panel SP-7 Projects and Evaluation of SPC Panel SP-7 Management and Administration

    National Research Council Canada - National Science Library

    Robinson, Rodney A


    .... Projects that have provided important reference information have also been beneficial. This Task has also assessed the opinion of the shipyard using community on the administration and management of Panel SP-7 itself...

  19. Benefit Analysis of SPC Panel SP-4 Projects and Evaluation of SPC Panel SP-4 Management and Administration

    National Research Council Canada - National Science Library

    Robinson, Rodney A


    This Task has investigated the benefits derived from the projects sponsored during the past 12 years by SNAME Ship Production Committee Panel SP-4 on Design/Production Integration under the National...

  20. Benefit Analysis of SPC Panel SP-3 Projects and Evaluation of SPC Panel SP-3 Management and Administration

    National Research Council Canada - National Science Library

    Robinson, Rodney A


    This Task has investigated the benefits derived from the projects sponsored during the past 4 years by SNAME Ship Production Committee Panel SP-3 on Surface Preparation and Coatings under the National...

  1. Rhopalophthalmus constrictus sp. nov. and Australomysis reubeni sp. nov. (Crustacea-Mysidacea) from south-west Australian waters

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    Two new species of mysids are described, Rhopalophthalmus constrictus sp. nov. is in having a well-produced triangular rostral plate, pleural plates on the anterior five abdominal somites and prominent constriction at the distal end of the telson...

  2. Enhanced photocatalytic activity induced by sp 3 to sp 2 transition of carbon dopants in BiOCl crystals

    KAUST Repository

    Sun, Jianguo


    The insufficient light absorption and low quantum efficiency limit the photocatalytic performance of wide bandgap semiconductors. Here, we report a facile strategy to engineer the surface disordered defects of BiOCl nanosheets via carbon doping. The surface defects boost the light absorption and also the quantum yields, as the doped carbon atoms exhibit a transition from sp3 to sp2 hybridization at elevated temperature, corresponding to a change of assembly state from 3D cluster to 2D graphite-like structure. This transition results in an effective charge separation and thus one order of enhancement in photocatalytic activity toward phenol degradation under visible light. The current study opens an avenue to introduce sp3 to sp2 transition of carbon dopants for simultaneous increment of light absorption and quantum efficiency for application in photocatalysis and energy conversion.

  3. Growth kinetics and biodeterioration of polypropylene microplastics by Bacillus sp. and Rhodococcus sp. isolated from mangrove sediment. (United States)

    Auta, H S; Emenike, C U; Jayanthi, B; Fauziah, S H


    Interest in the biodegradation of microplastics is due to their ubiquitous distribution, availability, high persistence in the environment and deleterious impact on marine biota. The present study evaluates the growth response and mechanism of polypropylene (PP) degradation by Bacillus sp. strain 27 and Rhodococcus sp. strain 36 isolated from mangrove sediments upon exposure to PP microplastics. Both bacteria strains were able to utilise PP microplastic for growth as confirmed by the reduction of the polymer mass. The weight loss was 6.4% by Rhodococcus sp. strain 36 and 4.0% by Bacillus sp. strain 27 after 40days of incubation. PP biodegradation was further confirmed using Fourier-transform infrared spectroscopy and scanning electron microscopy analyses, which revealed structural and morphological changes in the PP microplastics with microbial treatment. These analyses showed that the isolates can colonise, modify and utilise PP microplastics as carbon source. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Planomonospora corallina sp. nov., isolated from soil. (United States)

    Suriyachadkun, Chanwit; Ngaemthao, Wipaporn; Chunhametha, Suwanee


    A novel actinomycete strain, A-T 11038T, was isolated from bamboo rhizospheric soil collected in Thailand. Based on a polyphasic approach, the novel strain was characterized as a member of the genus Planomonospora, which developed cylindrical to clavate sporangia containing a single motile spore on aerial mycelium. The 16S rRNA gene sequence and phylogenetic analysis indicated that strain A-T 11038T was closely related to Planomonospora sphaerica JCM 9374T (98.82 %), P.lanomonospora parontospora subsp. parontospora NBRC 13880T and P.parontospora subsp. antibiotica JCM 3094T (98.54 %), Planomonospora alba JCM 9373T (98.41 %) and Planomonospora venezuelensis JCM 3167T (97.51 %). The DNA-DNA relatedness values that distinguished strain A-T 11038T from the most closely related species were below 45 %. The novel strain contained meso-diaminopimelic acid in cell-wall hydrolysates, and rhamnose, ribose, madurose and glucose in whole-cell hydrolysates. The predominant menaquinone was MK-9(H2). The diagnostic phospholipids were diphosphatidylglycerol, phosphatidylmethylethanolamine, phosphatidylethanolamine, phosphatidylglycerol, phosphatidylinositol mannosides, phosphatidylinositol and aminophosphoglycolipids. The predominant cellular fatty acids were unsaturated fatty acids C17 : 1 and C16 : 1 and saturated fatty acid C16 : 0. The G+C content of the genomic DNA was 73.5 mol%. Following the evidence obtained using a polyphasic approach, the novel strain is proposed as a representative of a novel species to be named Planomonospora corallina sp. nov. The type strain is A-T 11038T (=BCC 67829T=TBRC 4489T=NBRC 110609T).

  5. Loktanella tamlensis sp. nov., isolated from seawater. (United States)

    Lee, Soon Dong


    An aerobic, Gram-reaction-negative, chemo-organotrophic bacterium, designated strain SSW-35(T), was isolated from seawater in Jeju, Republic of Korea. Cells were motile, short rods; colonies were circular, smooth, convex, translucent and beige in colour. No diffusible pigment formed on any of the media tested. The bacterium grew at 4-30 °C and pH 7.1-10.1. Phylogenetic analysis based on 16S rRNA gene sequences showed that the organism was related to members of the genus Loktanella, its closest recognized relatives being Loktanella rosea Fg36(T) (98.1% sequence similarity) and Loktanella maricola DSW-18(T) (97.8%). Levels of 16S rRNA gene similarity between strain SSW-35(T) and other recognized species of the genus Loktanella were all <97%. Polar lipid analysis revealed the presence of diphosphatidylglycerol, phosphatidylcholine, phosphatidylethanolamine, phosphatidylglycerol and an unknown lipid as major components, as well as small amounts of two unknown phospholipids. The predominant ubiquinone was Q-10. The major cellular fatty acid was C(18:1) (summed feature 7), and the 3-hydroxy fatty acids detected were C(12:1) 3-OH and C(10:0) 3-OH. The genomic DNA G+C content was 55.0 mol%. In DNA-DNA hybridization experiments, the relatedness values between strain SSW-35(T) and the type strains of the phylogenetically closest recognized species were all <11%. On the basis of the phenotypic and genotypic characteristics, phylogenetic analysis and DNA-DNA relatedness, a novel species, Loktanella tamlensis sp. nov., is proposed. The type strain is SSW-35(T) (=KCTC 12722(T)=JCM 14020(T)).

  6. Morfologia da laringe de cutia (Dasyprocta sp.

    Directory of Open Access Journals (Sweden)

    Andrezza B.S. Silva


    Full Text Available A cutia (Dasyprocta sp. é um roedor silvestre com distribuição mundial. Atualmente, além de importante papel ecológico que exerce, está sendo utilizada como modelo em experimento animal. Estudos sobre a morfologia destes animais são importantes porque podem ser uma alternativa para o estudo de diversos processos patológicos, além de contribuirem para a preservação da espécie. A laringe é um órgão localizado entre a faringe e a traqueia, no qual está envolvido nas funções de respiração, deglutição e fonação. O presente estudo propôs realizar uma descrição morfológica macroscópica e microscópica da laringe da cutia. Para tanto, foram utilizadas quinze cutias pertencentes ao Centro de Ciências Agrárias da Universidade Federal do Piauí e provenientes do Núcleo de Estudos e Preservação de Animais Silvestres com licença do IBAMA (Nº 02/08-618, CTF Nº 474064. Todos os animais foram identificados, promovida a sexagem e, posteriormente, a laringe acessada e dissecada sendo os fragmentos cartilagíneos encaminhados para rotina histológica e corados pelo método de hematoxilina-eosina. As lâminas obtidas foram visualizadas em microscopia óptica de luz e foto documentadas. A laringe da cutia apresenta cinco cartilagens, com ausência da cartilagem cuneiforme e presença da incisura caudal na cartilagem tireoide. O tecido epitelial da laringe varia de epitélio estratificado pavimentoso queratinizado à não queratinizado e ciliado com células caliciformes.

  7. Phycicoccus soli sp. nov., isolated from soil. (United States)

    Singh, Hina; Won, KyungHwa; Ngo, Hien T T; Du, Juan; Kook, MooChang; Yi, Tae-Hoo


    A Gram-stain-positive, non-motile, coccus-shaped bacterium, strain THG-a14T, was isolated from soil of Gyeyang mountain in Incheon, Republic of Korea. The isolate grew optimally at 28 °C, at pH 6.5-7.5 and with 0-3 % (w/v) NaCl. Based on 16S rRNA gene sequence comparisons, strain THG-a14T was closely related to Phycicoccus aerophilus 5516T-20T (97.7 %), P. ginsenosidimutans BXN5-13T (97.6 %), 'P. ochangensis' L1b-b9 (97.4 %) and P. bigeumensis MSL-03 (97.2 %). The DNA G+C content of strain THG-a14T was 71.6 mol%. In DNA-DNA hybridization, the DNA-DNA relatedness between strain THG-a14T and its closest phylogenetically neighbours was below 50.0 %. Strain THG-a14T was characterized chemotaxonomically as having meso-diaminopimelic acid in the cell-wall peptidoglycan. Strain THG-a14T contained glucose and ribose as whole-cell-wall sugars and menaquinone MK-8(H4) as the major isoprenoid quinone. Polar lipids in strain THG-a14T consisted of diphosphatidylglycerol, phosphatidylglycerol, phosphatidylinositol, phosphoaminoglycolipids, unidentified phospholipids and unidentified lipids. The major fatty acids were iso-C16:0, iso-C15:0 and C17:1ω8c. On the basis of our polyphasic taxonomy study, strain THG-a14T represents a novel species within the genus Phycicoccus, for which the name Phycicoccussoli sp. nov. is proposed. The type strain is THG-a14T ( = KACC 17892T = JCM 19837T).

  8. Tsukamurella soli sp. nov., isolated from soil. (United States)

    Weon, Hang-Yeon; Yoo, Seung-Hee; Anandham, Rangasamy; Schumann, Peter; Kroppenstedt, Reiner M; Kwon, Soon-Wo; Stackebrandt, Erko


    A Gram-positive, rod-shaped, catalase-positive, oxidase-negative, white-coloured bacterium, designated strain JS18-1(T), was isolated from a soil sample collected from Halla mountain, Jeju island, Korea. 16S rRNA gene sequence analysis revealed that the strain was most closely related to members of the genus Tsukamurella with levels of sequence similarity of 95.4-96.5 %. Strain JS18-1(T) shared highest 16S rRNA gene sequence similarity with Tsukamurella strandjordii DSM 44573(T) (96.5 %), Tsukamurella carboxydivorans Y2(T) (96.4 %) and Tsukamurella tyrosinosolvens DSM 44234(T) (96.4 %). The G+C content of the total DNA of strain JS18-1(T) was 70 mol%. The cell-wall peptidoglycan type was A1gamma and mycolic acids were also detected. The predominant polar lipids were diphosphatidylglycerol, phosphatidylethanolamine and phosphatidylinositol. The major quinone was menaquinone-9 (MK-9) and major cell-wall sugars were arabinose, ribose and glucose. The major fatty acids (>10 % of the total fatty acids) were C(16 : 0), C(18 : 1)omega9c, C(18 : 0) 10-methyl and summed feature 3 (C(16 : 1)omega7c and/or iso-C(15 : 0) 2-OH). Phylogenetic analysis based on 16S rRNA gene sequences and chemotaxonomic, biochemical and physiological characteristics indicate that strain JS18-1(T) represents a novel species of the genus Tsukamurella, for which the name Tsukamurella soli sp. nov. is proposed. The type strain is JS18-1(T) (=KACC 20764(T)=DSM 45046(T)).

  9. Impact of serum SP-A and SP-D levels on comparison and prognosis of idiopathic pulmonary fibrosis (United States)

    Wang, Kai; Ju, Qing; Cao, Jing; Tang, Wenze; Zhang, Jian


    Abstract Background and objective: Idiopathic pulmonary fibrosis (IPF) has a poor prognosis in general; however, it is heterogeneous to detect relative biomarkers for predicting the disease progression. Serum biomarkers can be conveniently collected to detect and help to differentially diagnose IPF and predict IPF prognosis. This meta-analysis aimed to evaluate the use of serum surfactant proteins A and D (SP-A and SP-D) for differential diagnosis and prognosis of IPF. Methods: Relevant articles were searched in PubMed, Embase, and Chinese National Knowledge Infrastructure databases and reviewed by 2 independent readers. Standard mean difference (SMD) and 95% confidence interval (CI) were calculated to assess the difference in serum levels of SP-A/D among patients with IPF, when compared to patients with non-IPF interstitial lung disease (ILD), pulmonary infection, and healthy control. Hazard ratio (HR) and 95% CI were used to compare the relative risk of mortality. Results: Twenty-one articles (totalling 1289 IPF patients) were included in final meta-analysis. Serum SP-A levels were significantly higher in patients with IPF than in patients with non-IPF ILD (SMD: 1.108 [0.584, 1.632], P infection (SMD: 1.320 [0.999, 1.640], P SMD: 2.802 [1.901, 3.702], P SMD: 0.459 [−0.000, 0.919], P = .050). Serum SP-D levels were significantly higher in patients with IPF than in patients with pulmonary infection (SMD: 1.308 [0.813, 1.803], P SMD: 2.235 [1.739, 2.731], P < .001). Risk of death in patients with IPF and elevated serum SP-A was increased 39% compared to patients with low SP-A groups. Elevated SP-D increased risk by 111% when compared to low SP-D. In acute exacerbation of IPF, serum SP-A/D were higher than those in stable stage. The comparisons and prognosis might be different in Asian and Caucasian patients. Conclusions: Serum SP-A/D detection might be useful for differential diagnosis and prediction of survival in patients with IPF. PMID:28591049

  10. Modular Stereoselective Synthesis of (1 -> 2)-C-Glycosides based on the sp(2)-sp(3) Suzuki-Miyaura Reaction

    Czech Academy of Sciences Publication Activity Database

    Oroszová, B.; Choutka, J.; Pohl, Radek; Parkan, K.


    Roč. 21, č. 19 (2015), s. 7043-7047 ISSN 0947-6539 Grant - others:GA ČR(CZ) GPP207/12/P713; GA ČR(CZ) GA15-17572S Institutional support: RVO:61388963 Keywords : C-disaccharides * C-glycosides * diastereoselectivity * Mitsunobu reaction * sp(2)-sp(3) coupling Subject RIV: CC - Organic Chemistry Impact factor: 5.771, year: 2015

  11. Impact of serum SP-A and SP-D levels on comparison and prognosis of idiopathic pulmonary fibrosis


    Wang, Kai; Ju, Qing; Cao, Jing; Tang, Wenze; Zhang, Jian


    Abstract Background and objective: Idiopathic pulmonary fibrosis (IPF) has a poor prognosis in general; however, it is heterogeneous to detect relative biomarkers for predicting the disease progression. Serum biomarkers can be conveniently collected to detect and help to differentially diagnose IPF and predict IPF prognosis. This meta-analysis aimed to evaluate the use of serum surfactant proteins A and D (SP-A and SP-D) for differential diagnosis and prognosis of IPF. Methods: Relevant artic...

  12. Ion irradiation-induced, localized sp2 to sp3 hybridized carbon transformation in walls of multiwalled carbon nanotubes (United States)

    Kumari, Reetu; Singh, Fouran; Yadav, Brajesh S.; Kotnala, Ravinder K.; Peta, Koteswara Rao; Tyagi, Pawan K.; Kumar, Sanjeev; Puri, Nitin K.


    In this report, ion irradiation-induced localized sp2 to sp3 hybridized carbon transformation in multiwalled carbon nanotubes (MWCNTs) was observed after irradiating MWCNTs with high-energy Au+8 ions (100 MeV). The used MWCNTs were grown using cobaltocene and benzene as catalyst and carbon source, respectively by the thermal CVD technique and consist of both unfilled and Co-filled tubes. Prior to irradiation, the MWCNT sample was characterized using scanning electron microscope and micro-Raman and photoluminescence spectrometers. The effect of ion fluence on MWCNT walls and transformation of sp2 to sp3 sites was analyzed by Raman spectroscopy, X-ray photoelectron spectroscopy, and high-resolution transmission electron microscopy. We found that as the fluence increased, the localized transformation from sp2 to sp3 sites occurred in the walls of MWCNTs, which was evident by the emergence of peak at approximately 1543 cm-1 associated with the G peak in tetrahedral amorphous carbon (ta-C) and the vanishing of 2D band (2700 cm-1). Furthermore, we observed broadening in D and G, with slight shift in their positions and consistent decrease in 2D band intensity, as fluence increased.

  13. Botanical pesticides effect from shells of bean’s cashew nut on biological agents of trichoderma sp. and gliocladium sp. (United States)

    Bande, L. O. S.; Mariadi; Gusnawaty, HS; Nuriadi; Trisulpa, L.; Rahmania


    A shell of cashew nut (Anacardium occidentanle) has contained Cashew Nut Shell Liquid (CNSL) that is used as botanical pesticides. CNSL oil consists of active substance such as anacardat acid, cardol and cardanol. Utilization of the pesticides from shells of cashew nut to control pests and diseases of plants would be affected on biological agents. The objective of this research was to investigate pesticides inhibition on the increase of mycelium Trichoderma sp. and Gliocladium sp. by in vitro method. The tested concentration sample consisted of 0.0% (control), 2.5%, 7.5% and 10.0% in PDA media. The results of this research showed that 2.5% botanical pesticides concentration could minimize mycelium of Trichoderma sp. and Gliocladium sp. 22.73% and 21.04% respectively and also the increase shells of cashew extract could be affected the increase of mycelium inhibition. The extract with 2.5% concentration was the recommended concentration to control of fruit rot diseases and if concentration was 10.0% then its inhibition become 54.98% and 49.35%, respectively. The results proved that uncontrolled utilization of the pesticides could be affected on decrease of Trichoderma sp. and Gliocladium sp. growth.

  14. Characterization of Ethanolic Extract of Streptomyces sp. as a Pancreatic Lipase Inhibitors Produced by Endophytic Streptomyces sp. AEBg12

    Directory of Open Access Journals (Sweden)

    Lenni Fitri


    Full Text Available Endophytic Streptomyces sp. AEBg12 isolated from Zingiber cassumunar (Bangle is known to produce pancreatic lipase inhibitory compound. However, the characteristics of this active compound has not been reported yet. This study aimed to determine the characteristics of pancreatics inhibitory compound produced by Streptomyces sp. AEBg12 and to assess the role of endophytic actinobacteria in producing pancreatic lipase inhibitor using endophytic-free bangle tissue culture, wild bangle and compared with the activity of Streptomyces sp. AEBg12 endophytes. Supernatant of Streptomyces sp. AEBg12 was extracted using ethanol, ethyl acetate, and n-hexane solvents. Toxicity test was performed using larvae of shrimp Artemia salina. The results showed that the best solvent to obtain pancreatic lipase inhibitor compounds was ethanol. Phytochemical analysis showed that ethanolic extract of endophytic Streptomyces sp. AEBg12 contained flavonoids. IC50 value of ethanol extract was 180.83 µg/ml. The result of TLC showed that ethanolic extract of Streptomyces AEBg12 had a blue luminescence band indicated that there were either flavone, flavanones, flavonols or isoflavones. Inhibitory activity of Streptomyces sp. AEBg12 was higher than wild bangle and bangle tissue culture. The information from this study can be be used as a basic data for further characterization of the active compound, which might be developed as an antiobesity agent through its pancreatic lipase inhibitory activity.

  15. Using SP and SF to Lower Cement Content

    Directory of Open Access Journals (Sweden)

    Yassen A. Saleh


    Full Text Available In the present research, using different percents of superplasticizer (SP and silica fume (SF to improve the characteristics of concrete is performed. SP and SF are added to two types of  normal concrete, the first is of mixing ratio (1:2:4 and the second is of mixing ratio (1:1.5:3.28The results show that adding SF lead to increase compressive strength for first mix by about 45.3% and 47.7% while adding SP lead to increase the compressive strength by about 43% and 41%  compared to reference mix at 7 and 28 day respectively. The corresponding values for second mix are 46.7% , 49%, 44% and 43% respectively.The maximum compressive strength when SP and SF used together can be attained when the percents of SF and SP are 5% and 3% respectively. The increase in compressive strength is about 49.3% and 48.4%  for first mix, while the corresponding values for second mix are 52.4% and 51.2% as they compared to reference mix at 7 and 28 day respectively.For Tensile strength, adding SP lead to increase it by about 29.2% and 31.6% for first and second mix respectively, while the corresponding values when adding SF are 38.1% and 40.3%. The effect of using SP and SF together on increase tensile strength is more than the effect of using each one separately. The maximum tensile strength can be attained when the percents of SF and SP are 5% and 3% respectively as they increase the tensile strength by about 38.9% and 40.7% for first and second mix.The effect of using admixtures on cement content can be noted clearly as the maximum reduction percents are about 8.7% and 9.35% for first and second mix respectively when the percent of SP is 3%. The corresponding values are 9.4% and 11.26% when the percent of SF is 5%. Using SP and SF together at percents 3% and 5% respectively lead to reduce cement content by about 10.15% and 13.54% for first and second mix respectively.


    Directory of Open Access Journals (Sweden)

    Lina Herlina


    Full Text Available AbstrakMikroorganisme tanah seperti Gliocladium sp dapat bertindak sebagai dekomposer dan juga sebagai agen pengendali hayati patogen tanaman hal ini memberikan harapan untuk mengurangi penggunaan pupuk dan fungisida sintetik. Tujuan penelitian untuk menguji potensi biofertililzer Gliocladium sp terhadap pertumbuhan dan produksi buah tomat. Variabel bebas yaitu bioferlizer Gliocladium sp  dengan dosis (g/tanaman 0,50, 100, 150, dan 200 .Variabel tergantung adalah pertumbuhan dan produksi tanaman tomat. Parameter pertumbuhan yang diukur adalah  tinggi tanaman, kandungan klorofil a dan b. Parameter hasil tanaman yang diukur adalah berat buah setelah panen. Hasil uji Anava satu jalan menunjukkan bahwa pemberian Gliocladium sp perpengaruh terhadap tinggi tanaman, kandungan klorofil a dan klorofil b, berat tomat  . Hasil uji lanjut Duncan menunjukkan bahwa dosis 100, g 150 g dan 200 g tidak berbeda signifikan terhadap tinggi tanaman, dosis 150g dan 200 g tidak berbedan nyata dalam pembentukan klorofil a dan klorofil b. Pemberian Gliocladium dosis 150g paling tinggi terhadap berat buah. Simpulan dalam penelitian ini bahwa pemberian Gliokompos sp berpengaruh terhadap pertumbuhan dan produksi buah tomat. AbstractSoil microorganisms such as Gliocladium sp. can play role in the decomposition and can also become the biological control of pathogenic plants. The animal is potentially reduce the use of fertilizers and synthetic fungidid. The aim of the study was to test the potential effect of biofertililzer Gliocladium sp. on the growth and production of tomatoes. The independent variables was biofertilizer Gliocladium sp. at various dosages (g/plant of 0, 50, 100, 150, dan 200. The dependent variables were the growth and the production of tomatoes. The growth parameter measured were plant height, as well as a and b chlorophyl contents.  The crop parameter was the fruit weight post-harvest.  A one-way anova showed that Gliocladium sp. affected the

  17. On the fourth Diadema species (Diadema-sp from Japan.

    Directory of Open Access Journals (Sweden)

    Seinen Chow

    Full Text Available Four long-spined sea urchin species in the genus Diadema are known to occur around the Japanese Archipelago. Three species (D. savignyi, D. setosum, and D. paucispinum are widely distributed in the Indo-Pacific Ocean. The fourth species was detected by DNA analysis among samples originally collected as D. savignyi or D. setosum in Japan and the Marshall Islands and tentatively designated as Diadema-sp, remaining an undescribed species. We analyzed nucleotide sequences of the cytochrome oxidase I (COI gene in the "D. savignyi-like" samples, and found all 17 individuals collected in the mainland of Japan (Sagami Bay and Kyushu to be Diadema-sp, but all nine in the Ryukyu Archipelago (Okinawa and Ishigaki Islands to be D. savignyi, with large nucleotide sequence difference between them (11.0%±1.7 SE. Diadema-sp and D. savignyi shared Y-shaped blue lines of iridophores along the interambulacrals, but individuals of Diadema-sp typically exhibited a conspicuous white streak at the fork of the Y-shaped blue iridophore lines, while this feature was absent in D. savignyi. Also, the central axis of the Y-shaped blue lines of iridophores was approximately twice as long as the V-component in D. savignyi whereas it was of similar length in Diadema-sp. Two parallel lines were observed to constitute the central axis of the Y-shaped blue lines in both species, but these were considerably narrower in Diadema-sp. Despite marked morphological and genetic differences, it appears that Diadema-sp has been mis-identified as D. savignyi for more than half a century.

  18. Development of Streptomyces sp. FR-008 as an emerging chassis

    Directory of Open Access Journals (Sweden)

    Qian Liu


    Full Text Available Microbial-derived natural products are important in both the pharmaceutical industry and academic research. As the metabolic potential of original producer especially Streptomyces is often limited by slow growth rate, complicated cultivation profile, and unfeasible genetic manipulation, so exploring a Streptomyces as a super industrial chassis is valuable and urgent. Streptomyces sp. FR-008 is a fast-growing microorganism and can also produce a considerable amount of macrolide candicidin via modular polyketide synthase. In this study, we evaluated Streptomyces sp. FR-008 as a potential industrial-production chassis. First, PacBio sequencing and transcriptome analyses indicated that the Streptomyces sp. FR-008 genome size is 7.26 Mb, which represents one of the smallest of currently sequenced Streptomyces genomes. In addition, we simplified the conjugation procedure without heat-shock and pre-germination treatments but with high conjugation efficiency, suggesting it is inherently capable of accepting heterologous DNA. In addition, a series of promoters selected from literatures was assessed based on GusA activity in Streptomyces sp. FR-008. Compared with the common used promoter ermE*-p, the strength of these promoters comprise a library with a constitutive range of 60–860%, thus providing the useful regulatory elements for future genetic engineering purpose. In order to minimum the genome, we also target deleted three endogenous polyketide synthase (PKS gene clusters to generate a mutant LQ3. LQ3 is thus an “updated” version of Streptomyces sp. FR-008, producing fewer secondary metabolites profiles than Streptomyces sp. FR-008. We believe this work could facilitate further development of Streptomyces sp. FR-008 for use in biotechnological applications.

  19. Actinophytocola timorensis sp. nov. and Actinophytocola corallina sp. nov., isolated from soil. (United States)

    Otoguro, Misa; Yamamura, Hideki; Tamura, Tomohiko; Irzaldi, Rohmatussolihat; Ratnakomala, Shanti; Ridwan, Roni; Kartina, Gina; Triana, Evi; Nurkanto, Arif; Lestari, Yulin; Lisdiyanti, Puspita; Widyastuti, Yantyati; Ando, Katsuhiko


    Two actinomycete strains, ID05-A0653(T) and ID06-A0464(T), were isolated from soils of West Timor and Lombok island, respectively, in Indonesia. 16S rRNA gene sequence analysis clearly demonstrated that the isolates belonged to the family Pseudonocardiaceae and were closely related to the genus Actinophytocola. Strains ID05-A0653(T) and ID06-A0464(T) exhibited 98.1 and 98.2 % 16S rRNA gene sequence similarity, respectively, with Actinophytocola oryzae GMKU 367(T). The isolates grew well on ISP media and produced white aerial mycelium. Short spore chains were formed directly on the substrate mycelium. The isolates contained meso-diaminopimelic acid, arabinose and galactose as cell-wall components, MK-9(H(4)) as the sole isoprenoid quinone, iso-C(16 : 0) as the major cellular fatty acid and phosphatidylethanolamine as the diagnostic polar lipid. The DNA G+C contents of strains ID05-A0653(T) and ID06-A0464(T) were 69.7 and 71.2 mol%, respectively. On the basis of phenotypic characteristics, DNA-DNA relatedness and 16S rRNA gene sequence comparisons, strains ID05-A0653(T) and ID06-A0464(T) each represent a novel species of the genus Actinophytocola, for which the names Actinophytocola timorensis sp. nov. (type strain ID05-A0653(T)  = BTCC B-673(T)  = NBRC 105524(T)) and Actinophytocola corallina sp. nov. (type strain ID06-A0464(T)  = BTCC B-674(T)  = NBRC 105525(T)) are proposed.

  20. Two novel species of rapidly growing mycobacteria: Mycobacterium lehmannii sp. nov. and Mycobacterium neumannii sp. nov. (United States)

    Nouioui, Imen; Sangal, Vartul; Carro, Lorena; Teramoto, Kanae; Jando, Marlen; Montero-Calasanz, Maria Del Carmen; Igual, José Mariano; Sutcliffe, Iain; Goodfellow, Michael; Klenk, Hans-Peter


    Two rapidly growing mycobacteria with identical 16S rRNA gene sequences were the subject of a polyphasic taxonomic study. The strains formed a well-supported subclade in the mycobacterial 16S rRNA gene tree and were most closely associated with the type strain of Mycobacterium novocastrense. Single and multilocus sequence analyses based on hsp65, rpoB and 16S rRNA gene sequences showed that strains SN 1900 T and SN 1904 T are phylogenetically distinct but share several chemotaxonomic and phenotypic features that are are consistent with their classification in the genus Mycobacterium. The two strains were distinguished by their different fatty acid and mycolic acid profiles, and by a combination of phenotypic features. The digital DNA-DNA hybridization (dDDH) and average nucleotide identity (ANI) values for strains SN 1900 T and SN 1904 T were 61.0 % and 94.7 %, respectively; in turn, the corresponding dDDH and ANI values with M. novocastrense DSM 44203 T were 41.4 % and 42.8 % and 89.3 % and 89.5 %, respectively. These results show that strains SN1900 T and SN 1904 T form new centres of taxonomic variation within the genus Mycobacterium. Consequently, strains SN 1900 T (40 T =CECT 8763 T =DSM 43219 T ) and SN 1904 T (2409 T =CECT 8766 T =DSM 43532 T ) are considered to represent novel species, for which the names Mycobacteriumlehmannii sp. nov. and Mycobacteriumneumannii sp. nov. are proposed. A strain designated as 'Mycobacteriumacapulsensis' was shown to be a bona fide member of the putative novel species, M. lehmannii.

  1. Mycobacterium sarraceniae sp. nov. and Mycobacterium helvum sp. nov., isolated from the pitcher plant Sarracenia purpurea. (United States)

    Tran, Phuong M; Dahl, John L


    Several fast- to intermediate-growing, acid-fast, scotochromogenic bacteria were isolated from Sarracenia purpurea pitcher waters in Minnesota sphagnum peat bogs. Two strains (DL734T and DL739T) were among these isolates. On the basis of 16S rRNA gene sequences, the phylogenetic positions of both strains is in the genus Mycobacterium with no obvious relation to any characterized type strains of mycobacteria. Phenotypic characterization revealed that neither strain was similar to the type strains of known species of the genus Mycobacterium in the collective properties of growth, pigmentation or fatty acid composition. Strain DL734T grew at temperatures between 28 and 32 °C, was positive for 3-day arylsulfatase production, and was negative for Tween 80 hydrolysis, urease and nitrate reduction. Strain DL739T grew at temperatures between 28 and 37 °C, and was positive for Tween 80 hydrolysis, urea, nitrate reduction and 3-day arylsulfatase production. Both strains were catalase-negative while only DL739T grew with 5 % NaCl. Fatty acid methyl ester profiles were unique for each strain. DL739T showed an ability to survive at 8 °C with little to no cellular replication and is thus considered to be psychrotolerant. Therefore, strains DL734T and DL739T represent two novel species of the genus Mycobacterium with the proposed names Mycobacterium sarraceniae sp. nov. and Mycobacterium helvum sp. nov., respectively. The type strains are DL734T (=JCM 30395T=NCCB 100519T) and DL739T (=JCM 30396T=NCCB 100520T), respectively.

  2. Serratia myotis sp. nov. and Serratia vespertilionis sp. nov., isolated from bats hibernating in caves. (United States)

    García-Fraile, P; Chudíčková, M; Benada, O; Pikula, J; Kolařík, M


    During the study of bacteria associated with bats affected by white-nose syndrome hibernating in caves in the Czech Republic, we isolated two facultatively anaerobic, Gram-stain-negative bacteria, designated strains 12(T) and 52(T). Strains 12(T) and 52(T) were motile, rod-like bacteria (0.5-0.6 µm in diameter; 1-1.3 µm long), with optimal growth at 20-35 °C and pH 6-8. On the basis of the almost complete sequence of their 16S rRNA genes they should be classified within the genus Serratia; the closest relatives to strains 12(T) and 52(T) were Serratia quinivorans DSM 4597(T) (99.5 % similarity in 16S rRNA gene sequences) and Serratia ficaria DSM 4569(T) (99.5% similarity in 16S rRNA gene sequences), respectively. DNA-DNA relatedness between strain 12(T) and S. quinivorans DSM 4597(T) was only 37.1% and between strain 52(T) and S. ficaria DSM 4569(T) was only 56.2%. Both values are far below the 70% threshold value for species delineation. In view of these data, we propose the inclusion of the two isolates in the genus Serratia as representatives of Serratia myotis sp. nov. (type strain 12(T) =CECT 8594(T) =DSM 28726(T)) and Serratia vespertilionis sp. nov. (type strain 52(T) =CECT 8595(T) =DSM 28727(T)). © 2015 IUMS.

  3. Loktanella agnita sp. nov. and Loktanella rosea sp. nov., from the north-west Pacific Ocean. (United States)

    Ivanova, Elena P; Zhukova, Natalia V; Lysenko, Anatoly M; Gorshkova, Nataliya M; Sergeev, Alexander F; Mikhailov, Valery V; Bowman, John P


    One whitish and four pinkish strains of Gram-negative, non-motile, aerobic bacteria were isolated from sea-water and sediment samples collected in Chazhma Bay (Sea of Japan, Pacific Ocean). Analysis of 16S rRNA gene sequences revealed that these strains belonged to the 'Alphaproteobacteria', having highest sequence similarity of about 94-97% with species of the genus Loktanella. None of the strains degraded gelatin, casein, chitin, agar, DNA or starch and they had limited ability to utilize carbon sources. The four pinkish strains, Fg36(T), Fg1, Fg116 and Fg117, degraded Tween 80. Sea-water strain R10SW5(T) grew at 3-6% NaCl and a temperature range of 8-35 degrees C, whilst strains Fg36(T), Fg1, Fg116 and Fg117 grew at NaCl concentrations of 1-12% and a temperature range of 4-35 degrees C. Phosphatidylglycerol (58/79%), diphosphatidylglycerol (11/6%) and phosphatidylcholine (28/22%) were the major phospholipids. The predominant fatty acids were 16:0 (12.2/8.6%) and 18:1omega7 (76.6/68.4%). The DNA G+C content of strain R10SW5(T) was 59.1 mol% and those of the four pinkish strains ranged from 60.5 to 61.8 mol%. Based on the results of phenotypic, genotypic, chemotaxonomic and phylogenetic investigation, two novel species, Loktanella agnita sp. nov. and Loktanella rosea sp. nov., are proposed. The type strains are R10SW5(T) (=KMM 3788(T)=CIP 107883(T)) and Fg36(T) (=KMM 6003(T)=CIP 107851(T)=LMG 22534(T)), respectively.

  4. Vibrio variabilis sp. nov. and Vibrio maritimus sp. nov., isolated from Palythoa caribaeorum. (United States)

    Chimetto, Luciane A; Cleenwerck, Ilse; Moreira, Ana Paula B; Brocchi, Marcelo; Willems, Anne; De Vos, Paul; Thompson, Fabiano L


    Two novel vibrio isolates (R-40492(T) and R-40493(T)) originating from the zoanthid Palythoa caribaeorum in Brazil in 2005 were taxonomically characterized by means of a polyphasic approach comprising multilocus sequence analysis (MLSA), DNA-DNA hybridization (DDH), ΔT(m) analysis and phenotypic characterization. Phylogenetic analysis based on 16S rRNA gene sequences showed that R-40492(T) and R-40493(T) fell within the genus Vibrio and were most closely related to each other with 99% similarity; similarities of these two novel isolates towards Vibrio neptunius LMG 20536(T), Vibrio coralliilyticus LMG 20984(T), Vibrio nigripulchritudo LMG 3896(T), Vibrio sinaloensis LMG 25238(T) and Vibrio brasiliensis LMG 20546(T) varied between 97.1 and 98.5%. DDH experiments showed that the two isolates had less than 15% relatedness to the phylogenetically most closely related Vibrio species. R-40492(T) and R-40493(T) had 55-57% relatedness to each other. The ΔT(m) between R-40492(T) and R-40493(T) was 6.12 °C. In addition, MLSA of concatenated sequences (16S rRNA, ftsZ, gyrB, recA, rpoA, topA, pyrH and mreB; 6035 bp in length) showed that the two novel isolates formed a separate branch with less than 92% concatenated gene sequence similarity towards known species of vibrios. Two novel species are proposed to accommodate these novel isolates, namely Vibrio variabilis sp. nov. (type strain, R-40492(T)=LMG 25438(T)=CAIM 1454(T)) and Vibrio maritimus sp. nov. (type strain, R-40493(T)=LMG 25439(T)=CAIM 1455(T)).

  5. Analysis of polyhydroxyalkanoates granuales in bacillus Sp. MFD11 and enterobacter Sp. SEL2

    International Nuclear Information System (INIS)

    Naheed, N.; Jamil, N.


    Bacillus sp. MFD11 (JF901809) and Enterobacter sp. SEL2 (JF901810) were isolated from agriculture waste contaminated sites. When fed with 2% glucose as a carbon source, these bacteria produced 75.26±0.45% and 76.61±0.28% PHA of their wet weight respectively. The accumulated PHA was extracted by direct addition of sodium dodysyl sulphate in the culture medium, which yielded 52.3±0.56 micro g/l and 136.21±0.45 micro g/l PHA respectively when assayed with Crotonic acid. The PHA detection medium (PDM) provided nutrient limitation condition which favored accumulation of PHA granules. A tremendous increase in cell size was observed when strain MFD11 was grown in PDM. The size of the granules as revealed by TEM micrographs spanned from 0.1 to 1.5 micro m which is quite large as compared to the size reported in the literature 0.2 to 0.5 micro m 18). (PHA polymer was analyzed by FTIR, GC/MS and proton Nuclear magnetic resonance. The intense absorption band in the spectrum at 1724-1740 cm -1 and 1215 cm -1 to 1280 corresponding to C=O and C-O stretching group, respectively, indicated that the both strains were PHA producers. GC/MS analysis indicated that the polymer produced were copolymers of PHB-co-PHV. NMR also suggested that the extracted PHA was not a homopolymer but was the blend of copolymers with 3HV in lower abundance. Differential calorimetric thermal analysis showed melting temperature of 163 and 169 degree C for PHA produced by both strains, respectively. However, the observed melting temperature was found to be lower than the standard PHB (Signa-aldrich). (author)

  6. Acidovorax lacteus sp. nov., isolated from a culture of a bloom-forming cyanobacterium (Microcystis sp.). (United States)

    Chun, Seong-Jun; Cui, Yingshun; Ko, So-Ra; Lee, Hyung-Gwan; Srivastava, Ankita; Oh, Hee-Mock; Ahn, Chi-Yong


    A novel Gram-negative, rod-shaped and motile bacterial strain, designated strain M36 T , was isolated from a culture of a bloom-forming cyanobacterium, Microcystis sp., collected from a eutrophic lake in Korea. Its taxonomic position was investigated by using a polyphasic taxonomic approach. The isolate was found to grow aerobically at 15-42 °C (optimum 25 °C), pH 7.0-11.0 (optimum pH 8.0) and in the presence of 0-1.0% (w/v) NaCl (optimum 0% NaCl) on R2A medium. The phylogenetic analysis based on 16S rRNA gene sequences revealed that the strain M36 T is closely related to Acidovorax anthurii DSM 16745 T (98.1%), Acidovorax konjaci DSM 7481 T (97.7%) and Acidovorax avenae DSM 7227 T (97.0%) and also formed a clear phylogenetic lineage with other Acidovorax species. DNA-DNA relatedness between strain M36 T and the closely related species of the genus Acidovorax was <30%. The major fatty acid components identified included summed feature 3 (C 16:1 ω7c and/or C 16:1 ω6c), C 16:0 and summed feature 8 (C 18:0 ω7c and/or C 18:0 ω6c). The DNA G+C content of strain M36 T was determined to be 66.8 mol%. Based on above polyphasic evidence, strain M36 T is concluded to represent a new species of genus Acidovorax, for which the name Acidovorax lacteus sp. nov. is proposed. The type strain is M36 T (=KCTC 52220 T  = JCM 31890 T ).

  7. Bacillus swezeyi sp. nov. and Bacillus haynesii sp. nov., isolated from desert soil. (United States)

    Dunlap, Christopher A; Schisler, David A; Perry, Elizabeth B; Connor, Nora; Cohan, Frederick M; Rooney, Alejandro P


    Two isolates of Gram-reaction-positive, facultatively anaerobic, motile, rod-shaped, endospore-forming bacteria were identified during a survey of the diversity of strains belonging to the genus Bacillus deposited in the Agriculture Research Service Culture Collection. These strains were originally isolated from soil in Evolution Canyon III (Israel) in a survey of ecological diversification. Phylogenetic analysis of the 16S rRNA gene of strains NRRL B-41294T and NRRL B-41327T determined they were closely related to members of the Bacillus licheniformis clade. The genome of each strain was sequenced, and further analysis indicated that the strains represented unique species based on in silico DNA-DNA hybridization analyses. A phylogenomic analysis revealed that NRRL B-41294T and NRRL B-41327T were closely related to the group that includes B. licheniformis. In phenotypic characterization, both NRRL B-41294T and NRRL B-41327T were found to grow at temperatures of between 15 and 60 °C and tolerated up to 12 % NaCl (w/v). The predominant cellular fatty acids were anteiso-C15 : 0 and iso-C15 : 0, and peptidoglycan from cell walls contained meso-diaminopimelic acid. The DNA G+C content was 45.7 and 44.3 mol% for NRRL B-41327T and NRRL B-41294T, respectively. Furthermore, each strain had a unique carbon utilization pattern that distinguished it from its nearest phylogenetic neighbours. Based upon the consensus of phylogenetic and phenotypic analyses, we conclude that these strains represent two novel species within the genus Bacillus, for which the name Bacillus swezeyi sp. nov. is proposed, with type strain NRRL B-41294T (=CCUG 70177T), and the name Bacillus haynesii sp. nov. is proposed, with type strain NRRL B-41327T (=CCUG 70178T).

  8. Description of Bacillus kexueae sp. nov. and Bacillus manusensis sp. nov., isolated from hydrothermal sediments. (United States)

    Sun, Qing-Lei; Yu, Chao; Luan, Zhen-Dong; Lian, Chao; Hu, Yong-Hua; Sun, Li


    Two Gram-staining-positive, strictly aerobic bacilli, designated as strains Ma50-5 T and Ma50-6 T , were isolated from the hydrothermal sediments of Manus Basin in the western Pacific Ocean. Based on 16S rRNA gene sequence, strains Ma50-5 T and Ma50-6 T were most closely related to Bacillus alveayuensis (97.0 and 97.2 % identity, respectively). The 16S rRNA gene sequence identity between strains Ma50-5 T and Ma50-6 T was 97.4 %. The identities between strains Ma50-5 T and Ma50-6 T and other closely related organisms were below 97.0 %. The G+C contents of the genomic DNA of strains Ma50-5 T and Ma50-6 T were 43.4 and 47.6 mol%, respectively. The major fatty acids (>10 %) of both strains were iso-C15 : 0 and iso-C17 : 0. The predominant isoprenoid quinone detected in both strains was menaquinone-7. Phylogenetic, physiological, biochemical and morphological analyses suggested that strains Ma50-5 T and Ma50-6 T represent two novel species of the genus Bacillus, for which the names Bacillus kexueae sp. nov. (type strain Ma50-5 T =KCTC 33881 T =CCTCC AB 2017020 T ) and Bacillus manusensis sp. nov. (type strain Ma50-6 T =KCTC 33882 T =CCTCC AB 2017019 T ), respectively, are proposed.

  9. Rhodococcus cerastii sp. nov. and Rhodococcus trifolii sp. nov., two novel species isolated from leaf surfaces. (United States)

    Kämpfer, P; Wellner, S; Lohse, K; Lodders, N; Martin, K


    Two Gram-positive, non-endospore-forming rods, strains C5(T) and T8(T), were isolated from the phyllospheres of Cerastium holosteoides and Trifolium repens, respectively, and were studied in detail for their taxonomic position. 16S rRNA gene sequence analysis allocated both isolates clearly to the genus Rhodococcus. Isolate C5(T) was most closely related to Rhodococcus fascians and Rhodococcus yunnanensis, showing 99.2 % gene sequence similarity to both species. Strain T8(T) revealed the highest 16S rRNA gene sequence similarity to Rhodococcus corynebacterioides (98.8 %) and Rhodococcus kroppenstedtii (98.6 %). The quinone system of both strains was composed of dihydrogenated menaquinones with eight (major amount) as well as nine, seven and six isoprenoid units (MK-8H2, MK-9H2 MK-7H2 MK-6H2).The polar lipid profiles of strains C5(T) and T8(T) consisted of diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylglycerol, phosphatidylinositol, phosphatidylinositol mannoside and one unknown phospholipid. Additionally, strain C5(T) contained one unknown glycolipid, and strain T8(T) three unknown aminolipids. The fatty acid profiles contained major amounts of C16 : 0, C18 : 1ω9c and 10-methyl C18 : 0, which supported the grouping of the two isolates in the genus Rhodococcus. Physiological/biochemical characterization and DNA-DNA hybridizations with the type strains of the most closely related species allowed a clear phenotypic and genotypic differentiation of both strains. For this reason, we propose strain C5(T) ( = LMG 26203(T)  = CCM 7906(T)) as the type strain of a novel species with the name Rhodococcus cerastii sp. nov., and strain T8(T) ( = LMG 26204(T)  = CCM 7905(T)) as the type strain of a second novel species with the name Rhodococcus trifolii sp. nov.

  10. CULTIVO EXPERIMENTAL DEL CLADOCERO Moina sp ALIMENTADO CON Ankistrodesmus sp y Saccharomyces cereviseae

    Directory of Open Access Journals (Sweden)

    Martha Prieto


    Full Text Available Saccharomyces cereviseae. Materiales y métodos. Fueron realizados cultivos experimentales de la cepade cladóceros Moina sp en el laboratorio de Alimento Vivo de la Universidad de Córdoba, bajo condicionescontroladas de temperatura (22oC, pH (7.6, intensidad lumínica (2000 lux y aireación. Se emplearondos dietas de alimento como tratamiento (Ankistrodesmus y Ankistrodesmus mas Saccharomyces cereviseaeen concentración de 40 x 105 cada uno, para determinar su efecto sobre el desempeño de lapoblación. Diariamente se registró la densidad poblacional y celular. Resultados. Se obtuvieron diferenciassignificativas para el efecto de las dietas sobre el crecimiento poblacional de los cladóceros, los individuosalimentados con Ankistrodesmus sp + Saccharomyces cereviseae alcanzaron una densidad de 12.3a±0.30 org/ml-1 presentando mayor tasa instantánea de crecimiento (K 0.36 ± 0.002, el menor tiempode duplicación (td 1.94 ± 0.012 y el mayor rendimiento (r 1,1 ± 0.07ía-1. Conclusión. Loscladóceros por sus características de crecimiento en cultivo, presentan adaptación favorable a lascondiciones de manejo para la producción de biomasas potencialmente útiles como partícula nutritivacon fines acuícolas.

  11. Pseudomonas helleri sp. nov. and Pseudomonas weihenstephanensis sp. nov., isolated from raw cow's milk. (United States)

    von Neubeck, M; Huptas, C; Glück, C; Krewinkel, M; Stoeckel, M; Stressler, T; Fischer, L; Hinrichs, J; Scherer, S; Wenning, M


    Analysis of the microbiota of raw cow's milk and semi-finished milk products yielded seven isolates assigned to the genus Pseudomonas that formed two individual groups in a phylogenetic analysis based on partial rpoD and 16S rRNA gene sequences. The two groups could be differentiated from each other and also from their closest relatives as well as from the type species Pseudomonas aeruginosa by phenotypic and chemotaxonomic characterization and average nucleotide identity (ANIb) values calculated from draft genome assemblies. ANIb values within the groups were higher than 97.3 %, whereas similarity values to the closest relatives were 85 % or less. The major cellular lipids of strains WS4917T and WS4993T were phosphatidylethanolamine, phosphatidylglycerol and diphosphatidylglycerol; the major quinone was Q-9 in both strains, with small amounts of Q-8 in strain WS4917T. The DNA G+C contents of strains WS4917T and WS4993T were 58.08 and 57.30 mol%, respectively. Based on these data, strains WS4917T, WS4995 ( = DSM 29141 = LMG 28434), WS4999, WS5001 and WS5002 should be considered as representatives of a novel species of the genus Pseudomonas, for which the name Pseudomonas helleri sp. nov. is proposed. The type strain of Pseudomonas helleri is strain WS4917T ( = DSM 29165T = LMG 28433T). Strains WS4993T and WS4994 ( = DSM 29140 = LMG 28438) should be recognized as representing a second novel species of the genus Pseudomonas, for which the name Pseudomonas weihenstephanensis sp. nov. is proposed. The type strain of Pseudomonas weihenstephanensis is strain WS4993T ( = DSM 29166T = LMG 28437T).

  12. Pseudomonas lactis sp. nov. and Pseudomonas paralactis sp. nov., isolated from bovine raw milk. (United States)

    von Neubeck, Mario; Huptas, Christopher; Glück, Claudia; Krewinkel, Manuel; Stoeckel, Marina; Stressler, Timo; Fischer, Lutz; Hinrichs, Jörg; Scherer, Siegfried; Wenning, Mareike


    Five strains, designated WS 4672T, WS 4998, WS 4992T, WS 4997 and WS 5000, isolated from bovine raw milk formed two individual groups in a phylogenetic analysis. The most similar species on the basis of 16S rRNA gene sequences were Pseudomonas azotoformans IAM 1603T, Pseudomonas gessardii CIP 105469T and Pseudomonas libanensis CIP 105460T showing 99.7-99.6 % similarity. Using rpoD gene sequences Pseudomonas veronii LMG 17761T (93.3 %) was most closely related to strain WS 4672T and Pseudomonas libanensis CIP 105460T to strain WS 4992T (93.3 %). The five strains could be differentiated from their closest relatives and from each other by phenotypic and chemotaxonomic characterization and ANIb values calculated from draft genome assemblies. ANIb values of strains WS 4992T and WS4671T to the closest relatives are lower than 90 %. The major cellular polar lipids of both strains are phosphatidylethanolamine, phosphatidylglycerol, a phospholipid and diphosphatidylglycerol, and their major quinone is Q-9. The DNA G+C content of strains WS 4992T and WS 4672T were 60.0  and 59.7  mol%, respectively. Based on these genotypic and phenotypic traits two novel species of the genus Pseudomonas are proposed: Pseudomonas lactis sp. nov. [with type strain WS 4992T (=DSM 29167T=LMG 28435T) and the additional strains WS 4997 and WS 5000], and Pseudomonasparalactis sp. nov. [with type strain WS 4672T (=DSM 29164T=LMG 28439T) and additional strain WS 4998].


    Directory of Open Access Journals (Sweden)

    Néstor Leopoldo Tarazona Meza


    Full Text Available El objetivo de esta investigación fue evaluar la capacidad antagónica de ocho hongos celulolíticos nativos frente a los hongos fitopatógenos Fusarium sp. y Macrophomina sp. En primera instancia se determinó la cepa promisoria del hongo celulolítico, para lo cual, en caja Petri se colocó un disco de agar de 4 mm de diámetro con micelio de una cepa antagonista y en el extremo opuesto, a una distancia de cinco centímetros aproximadamente, otro disco de 4 mm con micelio de un patógeno. La capacidad antagónica se determinó por el grado de micoparasitismo y la competencia por nutrientes y espacios, registrando el porcentaje de inhibición del crecimiento radial. Con la cepa del hongo celulolítico que tuvo el mejor comportamiento antagonista se realizó un cocultivo independiente con cada patógeno, aquí se evalúo las UFC, crecidas en medio PDA. También se inoculó junto a las cepas fitopatógenas en plantas de pimiento para conocer el nivel de antagonismo en macetas. En la evaluación cualitativa, la cepa A.O-5 mostró una invasión y esporulación total en la superficie en ambos patógenos; mientras que en el cocultivo inhibe el crecimiento de los patógenos a las 96 h. Igualmente demostró su acción antagonista frente a Fusarium y Macrophomina en las plántulas de pimiento. Por lo encontrado, se estima que la cepa A.O-5 es un potencial agente antagonista de los fitopatógenos evaluados.

  14. Alistipes inops sp. nov. and Coprobacter secundus sp. nov., isolated from human faeces. (United States)

    Shkoporov, Andrei N; Chaplin, Andrei V; Khokhlova, Ekaterina V; Shcherbakova, Victoria A; Motuzova, Oksana V; Bozhenko, Vladimir K; Kafarskaia, Lyudmila I; Efimov, Boris A


    Culture-based study of the faecal microbiome in two adult female subjects revealed the presence of two obligately anaerobic, non-spore-forming, rod-shaped, non-motile, Gram-negative bacterial strains that represent novel species. The first strain, designated 627T, was a fastidious, slow-growing, indole-positive bacterium with a non-fermentative type of metabolism.The strain was characterized by the production of acetic and succinic acids as metabolic end products, the prevalence of iso-C15 : 0 fatty acid and the presence of menaquinones MK-10 and MK-11. The DNA G+C content was found to be 56.6 mol%. The second strain, designated 177T, was capable of fermenting a rich collection of carbohydrate substrates, producing acetic acid as a terminal product. The strain was indole-negative and resistant to bile. The major cellular fatty acids were iso-C15 : 0 and anteiso-C15 : 0 (in a 1 : 1 ratio) and the predominant menaquinone was MK-11.The DNA G+C content was 37.8 mol%. A phylogenomic analysis of the draft genomes of strains 627T and 177T placed these bacteria in the genera Alistipes(family Rikenellaceae) and Coprobacter (family Porphyromonadaceae), respectively.On the basis of the phenotypic and genotypic properties of strains 627T and 177T, we conclude that these strains from human faeces represent two novel bacterial species, for which the names Alistipes inops sp. nov. (type strain 627T5DSM 28863T5VKM B-2859T) and Coprobacter secundus sp. nov. (type strain 177T=DSM 28864T=VKM B-2857T) are proposed.

  15. Methylobacterium haplocladii sp. nov. and Methylobacterium brachythecii sp. nov., isolated from bryophytes. (United States)

    Tani, Akio; Sahin, Nurettin


    Pink-pigmented, facultatively methylotrophic bacteria, strains 87e(T) and 99b(T), were isolated from the bryophytes Haplocladium microphyllum and Brachythecium plumosum, respectively. The cells of both strains were Gram-reaction-negative, motile, non-spore-forming rods. On the basis of 16S rRNA gene sequence similarity, strains 87e(T) and 99b(T) were found to be related to Methylobacterium organophilum ATCC 27886(T) (97.1% and 97.7%, respectively). Strains 87e(T) and 99b(T) showed highest 16S rRNA gene similarity to Methylobacterium gnaphalii 23e(T) (98.3 and 99.0%, respectively). The phylogenetic similarities to all other species of the genus Methylobacterium with validly published names were less than 97%. Major cellular fatty acids of both strains were C(18:1)ω7c and C(18:0). The results of DNA-DNA hybridization, phylogenetic analyses based on 16S rRNA and cpn60 gene sequences, fatty acid profiles, whole-cell matrix-assisted, laser-desorption/ionization time-of-flight mass spectrometry (MALDI-TOF/MS) analysis, and physiological and biochemical tests allowed genotypic and phenotypic differentiation of strains 87e(T) and 99b(T) from their phylogenetically closest relatives. We propose that strains 87e(T) and 99b(T) represent novel species within the genus Methylobacterium, for which the names Methylobacterium haplocladii sp. nov. (type strain 87e(T) =DSM 24195(T) =NBRC 107714(T)) and Methylobacterium brachythecii sp. nov. (type strain 99b(T) =DSM 24105(T) =NBRC 107710(T)) are proposed.

  16. Occurrence of Pyemotes sp. on Tuta absoluta (Meyrick

    Directory of Open Access Journals (Sweden)

    Carlos Romero Ferreira de Oliveira


    Full Text Available The aim of this work was to study the population reduction of the tomato leafminer moth, Tuta absoluta (Meyrick, by Pyemotes sp. in the laboratory. The mite became greenish when fed on caterpillars, pupae, and adults of T. absoluta. The caterpillars and adults of T. absoluta were quickly paralyzed by the mite venom. A single T. absoluta could host many Pyemotes sp, physogastric females, which were allowed to grow on the moth. Pyemotes sp. can be a new alternative for the biological control of T. absoluta. However, this possibility must be better understood before it could be recommended, because Pyemotes sp. could also cause dermatitis in the humans.O ácaro Pyemotes sp. (Acari: Pyemotidae é um parasita de várias espécies de insetos e exibe o processo de fisogastria na reprodução. É registrada a ocorrência de Pyemotes sp. sobre a traça-do-tomateiro, Tuta absoluta (Meyrick, que sofreu redução considerável de suas populações em condições de laboratório. Este ácaro foi observado parasitando larvas, pupas e adultos de T. absoluta e suas fêmeas fisogástricas apresentaram coloração esverdeada. As larvas e adultos de T. absoluta atacados por Pyemotes sp. exibiram paralisia em poucos minutos, devido à injeção de toxinas por parte do ácaro. Observou-se que um único indivíduo de T. absoluta pode suportar muitas fêmeas fisogástricas de Pyemotes sp., permitindo que outra geração do ácaro continuasse a se reproduzir. O ácaro Pyemotes sp. surge como uma possibilidade para o controle biológico de T. absoluta, mas sua utilização deve ser melhor avaliada já que é uma espécie causadora de dermatites em humanos.

  17. Biodegradation of organophosphate pesticide quinalphos by Ochrobactrum sp. strain HZM. (United States)

    Talwar, M P; Mulla, S I; Ninnekar, H Z


    Isolation and identification of bacteria capable of degrading organophosphate pesticide quinalphos and elucidation of its biodegradative pathway. A bacterium capable of degrading organophosphate pesticides was isolated from the pesticide-contaminated soil samples by selective enrichment on quinalphos (QP) as a sole source of carbon and energy. The bacterial strain was identified as Ochrobactrum sp. strain HZM on the basis of its morphological and biochemical characteristics and by phylogenetic analysis based on 16S rRNA gene sequences. The organism utilized various organophosphate pesticides such as quinalphos, profenofos, parathion-methyl and chlorpyrifos as growth substrates. Response surface methodology (RSM) showed optimum conditions for quinalphos degradation at pH 7 and 27°C. 2-Hydroxyquinoxaline and diethyl phosphate were identified as metabolites of quinalphos degradation by HPLC and GC-MS analysis. Cell-free extract of Ochrobactrum sp. strain HZM grown on quinalphos contained the quinalphos hydrolase activity. A bacterial strain capable of degrading quinalphos was isolated and identified as Ochrobactrum sp. strain HZM. The organism utilized organophosphate pesticides quinalphos, profenofos, parathion-methyl and chlorpyrifos as carbon sources. The organism degraded quinalphos by hydrolysis to yield 2-hydroxyquinoxaline and diethyl phosphate which were further utilized as carbon sources. The isolated bacterium Ochrobactrum sp. strain HZM was versatile in degrading various organophosphate pesticides. There was complete mineralization of quinalphos by Ochrobactrum sp. This strain could potentially be useful in the bioremediation of soil and water contaminated with toxic organophosphate pesticides. © 2014 The Society for Applied Microbiology.

  18. The SP Theory of Intelligence: Benefits and Applications

    Directory of Open Access Journals (Sweden)

    J. Gerard Wolff


    Full Text Available This article describes existing and expected benefits of the SP theory ofintelligence, and some potential applications. The theory aims to simplify and integrate ideasacross artificial intelligence, mainstream computing, and human perception and cognition,with information compression as a unifying theme. It combines conceptual simplicitywith descriptive and explanatory power across several areas of computing and cognition.In the SP machine—an expression of the SP theory which is currently realized in theform of a computer model—there is potential for an overall simplification of computingsystems, including software. The SP theory promises deeper insights and better solutions inseveral areas of application including, most notably, unsupervised learning, natural languageprocessing, autonomous robots, computer vision, intelligent databases, software engineering,information compression, medical diagnosis and big data. There is also potential inareas such as the semantic web, bioinformatics, structuring of documents, the detection ofcomputer viruses, data fusion, new kinds of computer, and the development of scientifictheories. The theory promises seamless integration of structures and functions within andbetween different areas of application. The potential value, worldwide, of these benefits andapplications is at least $190 billion each year. Further development would be facilitatedby the creation of a high-parallel, open-source version of the SP machine, available toresearchers everywhere.


    Directory of Open Access Journals (Sweden)

    - Suharlina


    Full Text Available Indigofera    sp. is a leguminous plant which has varoius species, wide spread in tropical regions and adapted to a wide range of environmental condition. Indigofera sp. has many benefits in agricultural and industrial sector. It is widely used in agriculture as forage because its  high protein content, easily cultivated, high adaptability, and high biomass production (I. zollingeriana, I. hirsuta, I. pilosa, I. schimperi Syn,    I.    oblongifolia,    I.    spicata,    I. subulata Syn, and I. trita. Over the last 5 years Indigofera sp has been explored as forage feed for the goats. As cover crops, Indigofera is used to prevent erosion and nutrient leaching in the soil surface (I. hirsuta and I. Trita and it is also used as green manure, mulch, erosion control and ornamental plants (I. australis. In industrial sector, Indigofera sp. widely used as dyes and traditional medicine. Indigofera is used as a natural dye (I. tinctoria because it contains an excellent pigment called ‘indigo’ to dye silk material. Indigofera sp is also used as traditional medicine because it contains phytochemical substance which roles as antipyretic, laxative, diuretic, and useful against snakes attack, bees and insect bites. Using Indigofera    spp. as traditional medicine should be considered to avoid causing poisoning.

  20. Surfactant proteins SP-B and SP-C and their precursors in bronchoalveolar lavages from children with acute and chronic inflammatory airway disease

    Directory of Open Access Journals (Sweden)

    Winter Tobias


    Full Text Available Abstract Background The surfactant proteins B (SP-B and C (SP-C are important for the stability and function of the alveolar surfactant film. Their involvement and down-regulation in inflammatory processes has recently been proposed, but their level during neutrophilic human airway diseases are not yet known. Methods We used 1D-electrophoresis and Western blotting to determine the concentrations and molecular forms of SP-B and SP-C in bronchoalveolar lavage (BAL fluid of children with different inflammatory airway diseases. 21 children with cystic fibrosis, 15 with chronic bronchitis and 14 with pneumonia were included and compared to 14 healthy control children. Results SP-B was detected in BAL of all 64 patients, whereas SP-C was found in BAL of all but 3 children; those three BAL fluids had more than 80% neutrophils, and in two patients, who were re-lavaged later, SP-C was then present and the neutrophil count was lower. SP-B was mainly present as a dimer, SP-C as a monomer. For both qualitative and quantitative measures of SP-C and SP-B, no significant differences were observed between the four evaluated patient groups. Conclusion Concentration or molecular form of SP-B and SP-C is not altered in BAL of children with different acute and chronic inflammatory lung diseases. We conclude that there is no down-regulation of SP-B and SP-C at the protein level in inflammatory processes of neutrophilic airway disease.

  1. Surfactant proteins SP-B and SP-C and their precursors in bronchoalveolar lavages from children with acute and chronic inflammatory airway disease. (United States)

    Tafel, Oliver; Latzin, Philipp; Paul, Karl; Winter, Tobias; Woischnik, Markus; Griese, Matthias


    The surfactant proteins B (SP-B) and C (SP-C) are important for the stability and function of the alveolar surfactant film. Their involvement and down-regulation in inflammatory processes has recently been proposed, but their level during neutrophilic human airway diseases are not yet known. We used 1D-electrophoresis and Western blotting to determine the concentrations and molecular forms of SP-B and SP-C in bronchoalveolar lavage (BAL) fluid of children with different inflammatory airway diseases. 21 children with cystic fibrosis, 15 with chronic bronchitis and 14 with pneumonia were included and compared to 14 healthy control children. SP-B was detected in BAL of all 64 patients, whereas SP-C was found in BAL of all but 3 children; those three BAL fluids had more than 80% neutrophils, and in two patients, who were re-lavaged later, SP-C was then present and the neutrophil count was lower. SP-B was mainly present as a dimer, SP-C as a monomer. For both qualitative and quantitative measures of SP-C and SP-B, no significant differences were observed between the four evaluated patient groups. Concentration or molecular form of SP-B and SP-C is not altered in BAL of children with different acute and chronic inflammatory lung diseases. We conclude that there is no down-regulation of SP-B and SP-C at the protein level in inflammatory processes of neutrophilic airway disease.

  2. Molecular prevalence of Bartonella, Babesia, and hemotropic Mycoplasma sp. in dogs with splenic disease. (United States)

    Varanat, M; Maggi, R G; Linder, K E; Breitschwerdt, E B


    Among diseases that cause splenomegaly in dogs, lymphoid nodular hyperplasia (LNH), splenic hemangiosarcoma (HSA), and fibrohistiocytic nodules (FHN) are common diagnoses. The spleen plays an important role in the immunologic control or elimination of vector-transmitted, blood-borne pathogens, including Bartonella sp., Babesia sp., and hemotropic Mycoplasma sp. To compare the prevalence of Bartonella sp., Babesia sp., and hemotropic Mycoplasma sp. DNA in spleens from dogs with LNH, HSA, and FHN. Paraffin-embedded, surgically obtained biopsy tissues from LNH (N = 50), HSA (N = 50), and FHN (N = 37) were collected from the anatomic pathology archives. Spleens from specific pathogen-free (SPF) dogs (N = 8) were used as controls. Bartonella sp., Babesia sp., and Mycoplasma sp. DNA was amplified by PCR, followed by DNA sequencing. Bartonella sp. DNA was more prevalent in FHN (29.7%) and HSA (26%) as compared to LNH (10%) (P = .019, .0373, respectively) or control spleens (0.0%). The prevalence of Babesia sp. and hemotropic Mycoplasma sp. DNA was significantly lower than Bartonella sp. DNA in HSA (P = .0005, .006, respectively) and FHN (P = .003, .0004, respectively). There was no statistically significant difference in DNA prevalence among the 3 genera in the LNH group. The higher prevalence of Bartonella sp. in FHN and HSA warrants future investigations to determine if this bacterium plays a role in the development of these splenic diseases. Copyright © 2011 by the American College of Veterinary Internal Medicine.

  3. SP-R210 (Myo18A Isoforms as Intrinsic Modulators of Macrophage Priming and Activation.

    Directory of Open Access Journals (Sweden)

    Linlin Yang

    Full Text Available The surfactant protein (SP-A receptor SP-R210 has been shown to increase phagocytosis of SP-A-bound pathogens and to modulate cytokine secretion by immune cells. SP-A plays an important role in pulmonary immunity by enhancing opsonization and clearance of pathogens and by modulating macrophage inflammatory responses. Alternative splicing of the Myo18A gene results in two isoforms: SP-R210S and SP-R210L, with the latter predominantly expressed in alveolar macrophages. In this study we show that SP-A is required for optimal expression of SP-R210L on alveolar macrophages. Interestingly, pre-treatment with SP-A prepared by different methods either enhances or suppresses responsiveness to LPS, possibly due to differential co-isolation of SP-B or other proteins. We also report that dominant negative disruption of SP-R210L augments expression of receptors including SR-A, CD14, and CD36, and enhances macrophages' inflammatory response to TLR stimulation. Finally, because SP-A is known to modulate CD14, we used a variety of techniques to investigate how SP-R210 mediates the effect of SP-A on CD14. These studies revealed a novel physical association between SP-R210S, CD14, and SR-A leading to an enhanced response to LPS, and found that SP-R210L and SP-R210S regulate internalization of CD14 via distinct macropinocytosis-like mechanisms. Together, our findings support a model in which SP-R210 isoforms differentially regulate trafficking, expression, and activation of innate immune receptors on macrophages.

  4. Streptomyces sp. 173, an insecticidal micro-organism from marine. (United States)

    Xiong, L; Li, J; Kong, F


    To find new insecticidal antibiotics from marine micro-organisms. Strains isolated from seawater and sea sediments from Beidiahe and Dagang of the east coast of China were screened for their insecticidal qualities. The screening was carried out using bioassay of brine shrimp and the insect pest Helicoverpa armigera. The fermentation, preliminary extraction and isolation of Streptomyces sp.173 were carried out. In total 331 isolates were examined through bioassay of brine shrimp and 40 isolates (12.08%) showed potential insecticidal activities. Of the 40 isolates, one isolate, designated Streptomyces sp.173, was found to have strong insecticidal activity against both brine shrimp and H. armigera, similar to that of avermectin B1. The isolated Streptomyces sp.173 has great insecticidal potency. This work indicated that marine micro-organisms could be an important source of insecticidal antibiotics and the improved anti-brine shrimp bioassay is suitable for primary screening.

  5. Micetoma pulmonar por Scedosporium sp, reporte de dos casos

    Directory of Open Access Journals (Sweden)

    José G. Somocurcio


    Full Text Available Se reporta los dos primeros casos de micetoma pulmonar por Scedosporium sp, en el Perú, tratados quirúrgicamente en el Hospital Nacional Hipólito Unanue. Se practicó resección pulmonar debido a micetoma pulmonar de donde se tomó muestras que fueron enviadas a microbiología y anatomía patológica para cultivo y estudio histopatológico. Se identificó el moho Scedosporium sp en dos pacientes con secuelas cavitarias por tuberculosis, quienes presentaron tos y hemoptisis de dos meses y tres años de evolución, respectivamente. Radiológicamente las cavidades estaban ocupadas por una "bola fúngica". La histopatología indicó presencia de abundantes hifas, indistinguibles de las de Aspergillus sp, mientras que la inmunodifusión para Aspergillus fue negativa.

  6. Vitreoscilla hemoglobin promotes Salecan production by Agrobacterium sp. ZX09. (United States)

    Chen, Yun-mei; Xu, Hai-yang; Wang, Yang; Zhang, Jian-fa; Wang, Shi-ming


    Salecan is a novel exopolysaccharide produced by the strain Agrobacterium sp. ZX09, and it is composed of only glucose monomers. The unique chemical composition and excellent physicochemical properties make Salecan a promising material for applications in coagulation, lubrication, protection against acute liver injury, and alleviating constipation. In this study, we cloned the Vitreoscilla hemoglobin gene into a broad-host-range plasmid pCM158. Without antibiotic selection, there was negligible loss of the plasmid in the host Agrobacterium sp. ZX09 after one passage of cultivation. The expression of Vitreoscilla hemoglobin was demonstrated by carbon monoxide (CO) difference spectrum. The engineered strain Agrobacterium sp. ZX09 increased Salecan yield by 30%. The other physiological changes included its elevated respiration rate and cellular invertase activity.

  7. Symbiotic properties of Bradyrhizobium sp. (Lupinus assayed on serradella plants

    Directory of Open Access Journals (Sweden)

    Mieczysława Deryło


    Full Text Available Physiological and symbiotic properties of Bradyrhizobium sp. (Lupinus nodule isolates were compared to the standard slow-growing Bradyrhizobium sp. (Lupinus strain USDA 3045. Lupine nodules isolates showed typical characteristics for bradyrhizobial strains and nodulated small seed legume, serradella (Ornithopus sativus, in tube test. We observed a permanent physiological segregation of the effective (Fix' and ineffective (Fix- symbiotic phenotype for all tested bradyrhizobial strains during the growth of serradella in plant tube test. The ultrastructural differences between Fix* and Fix serradella nodules were observed. Rapid and visible nodulation as well as easy assay of the reduction of acetylene make serradella a convenient system for studies of Bradyrhizobium sp. (Lupinus strains in laboratory conditions.

  8. Ballastfritt spår : Förslag till dimensioneringsmetoder


    Hagman, Olle; Berhane, Henok


    Ballastfria spår har på senare tid börjat byggas i allt större utsträckning. En anledning till detta är höjda krav på järnvägstransporter. Ett ballastfritt spår är ofta utformat som en långsträckt betongplatta på mark som för ned lasten från rälerna till underbyggnaden. I nuläget saknar Sverige dimensioneringsprinciper för ballastfria spår. Principerna är redan etablerade i andra länder men behöver inordnas för svenska förhållanden. År 2012 gjorde regeringen bedömningen att en ny stambana för...

  9. Microbial succession during thermophilic digestion: the potential of Methanosarcina sp.

    Directory of Open Access Journals (Sweden)

    Paul Illmer

    Full Text Available A distinct succession from a hydrolytic to a hydrogeno- and acetotrophic community was well documented by DGGE (denaturing gradient gel electrophoresis and dHPLC (denaturing high performance liquid chromatography, and confirmed by qPCR (quantitative PCR measurements and DNA sequence analyses. We could prove that Methanosarcina thermophila has been the most important key player during the investigated anaerobic digestion process. This organism was able to terminate a stagnation phase, most probable caused by a decreased pH and accumulated acetic acid following an initial hydrolytic stage. The lack in Methanosarcina sp. could not be compensated by high numbers of Methanothermobacter sp. or Methanoculleus sp., which were predominant during the initial or during the stagnation phase of the fermentation, respectively.

  10. Green Decision Making: Sustainable Transport and Systemic Planning (SP)

    DEFF Research Database (Denmark)

    Leleur, Steen

    interests as regards the outcome represented by different group members. The process is guided by a facilitator and is assisted by an analyst, with the analyst providing ongoing, interactive modelling. This collective (man/machine) learning aims to lead to a final decision (or decision recommendation) about......) and soft (qualitative) operations research (OR) methods; especially the latter have a function as regards knowledge generation that relates to obtaining systemic insights. Furthermore, SP applies a process that drives group-based learning forward. The group should be formed with the different stakeholder...... the best alternative or course of action for the actual strategic planning problem. The flexibility of SP makes it adaptable to different problem types. The paper is disposed as follows: After the Introduction about green decision making, Section 2 presents five SP-perspectives, where each perspective...

  11. Effectivity of the Earthworms Pheretima hupiensis, Eudrellus sp. and Lumbricus sp. on the Organic Matter Decomposition Process

    Directory of Open Access Journals (Sweden)

    Ea Kosman Anwar


    Full Text Available The earthworms are the one of soil fauna component in soil ecosystem have an important role in organic matter decomposition procces. The earthworm feed plant leaf and plant matter up to apart and dissolved. Earthworm metabolisms produce like faeces that mixed with decomposed organic matter mean vermicompost. The vermicompost fertility varies because of some kind of earthworm differ in “niche” and attitude. The experiment was to study the effectivity of earthworm on organic matter decomposition which has been conducted in Soil Biological and Healthy Laboratory and Green House of Soil Research Institute Bogor, during 2006 Budget Year. The three kind of earthworms i.e Pheretima hupiensis, Lumbricus sp. and Eudrellus sp. combined with three kind of organic matter sources i.e rice straw, trash and palm oil plant waste (compost heap. The result shows that the Lumbricus sp. are the most effective decomposer compared to Pheretima hupiensis and Eudrellus sp. and the organic matter decomposed by Lumbricus sp. as followed: market waste was decomposed of 100%, palm oil empty fruit bunch (compost heap 95.8 % and rice straw 84.9%, respectively. Earthworm effectively decreased Fe, Al, Mn, Cu dan Zn.

  12. A comprehensive survey of Aeromonas sp. and Vibrio sp. in seabirds from southeastern Brazil: outcomes for public health. (United States)

    Cardoso, M D; Lemos, L S; Roges, E M; de Moura, J F; Tavares, D C; Matias, C A R; Rodrigues, D P; Siciliano, S


    To perform a microbiological survey regarding the presence, prevalence and characterization of Aeromonas sp. and Vibrio sp. in debilitated wrecked marine birds recovered from the centre-north coast of the state of Rio de Janeiro, Brazil. Swabs obtained from 116 alive and debilitated wrecked marine birds, comprising 19 species, from the study area were evaluated by biochemical methods. Antimicrobial susceptibility tests and pathogenicity gene screening were performed for bacterial strains of public health importance. Vibrio sp. and Aeromonas sp. were identified, as well as certain pathogenic genes and resistance to selected antimicrobials. This study demonstrates that the identified bacteria, mainly Vibrio sp., are fairly prevalent and widespread among several species of seabirds and highlights the importance of migratory birds in bacterial dispersion. In addition, it demonstrates the importance of the bacterial strains regarding their pathogenic potential. Therefore, seabirds can act as bacterial reservoirs, and their monitoring is of the utmost importance in a public health context. The study comprehensively evaluates the importance of seabirds as bacteria of public health importance reservoirs, since birds comprising several pathogenic bacterial species were evaluated. © 2018 The Society for Applied Microbiology.

  13. sp sup 2 and sp sup 3 bonding configurations in low nitrogen content a-CN sub x thin films

    CERN Document Server

    Mezzasalma, A M; Neri, F; Trusso, S


    The results of an electron spectroscopy study carried out on a set of pulsed laser deposited CN sub x films are reported. A progressive degree of graphitization, deduced from the continuous increase in the sp sup 2 bond fraction, has been found for x values up to 25%. The mass density values, deduced by a proper treating of both the x-ray photoelectron spectroscopy and reflection electron energy loss spectroscopy data, are consistent with a material made up by two phases, namely a sp sup 2 threefold (graphite-like) and a sp sup 3 fourfold (diamond-like) coordinated one. The behaviour of the density of the samples as a function of the N content does not show any abrupt change in going from lower to higher nitrogen concentrations as found by other authors, this certainly being due to differences in the starting sp sup 3 /sp sup 2 ratio of the films at zero N concentration and to their different preparation parameters.

  14. Ozone Technology for Pathogenic Bacteria of Shrimp (Vibrio sp.) Disinfection (United States)

    Wulansarie, Ria; Dyah Pita Rengga, Wara; Rustamadji


    One of important marine commodities in Indonesia, shrimps are susceptible with Vibrio sp bacteria infection. That infection must be cleared. One of the technologies for disinfecting Vibrio sp. is ozone technology. In this research, Vibrio sp. is a pathogenic bacterium which infects Penaeus vannamei. Ozone technology is applied for threatening Vibrio sp. In this research, ozonation was performed in different pH. Those are neutral, acid (pH=4), and base (pH=9). The sample was water from shrimp embankment from Balai Besar Perikanan Budidaya Air Payau (BBPBAP) located in Jepara. That water was the habitat of Penaeus vannamei shrimp. The brand of ozonator used in this research was “AQUATIC”. The used ozonator in this research had 0,0325 g/hour concentration. The flow rate of sample used in this research was 2 L/minute. The ozonation process was performed in continuous system. A tank, pipe, pump, which was connected with microfilter, flowmeter and ozone generator were the main tools in this research. It used flowmeter and valve to set the flow rate scalable as desired. The first step was the insert of 5 L sample into the receptacle. Then, by using a pump, a sample supplied to the microfilter to be filtered and passed into the flow meter. The flow rate was set to 2 LPM. Furthermore, gas from ozonator passed to the flow for the disinfection of bacteria and then was recycled to the tank and the process run continuously. Samples of the results of ozonation were taken periodically from time 0, 3, 7, 12, 18, 24 to 30 minutes. The samples of the research were analyzed using Total Plate Count (TPC) test in BBPBAP Jepara to determine the number of Vibrio sp. bacteria. The result of this research was the optimal condition for pathogenic bacteria of shrimp (Vibrio sp.) ozonation was in neutral condition.

  15. Multimeric and trimeric subunit SP-D are interconvertible structures with distinct ligand interaction

    DEFF Research Database (Denmark)

    Sørensen, Grith Lykke; Hoegh, Silje V; Leth-Larsen, Rikke


    -D compared to Met11 SP-D. Multimerization has proven important for enhancement of microbial phagocytosis. In the present study defined multimeric forms of Met11Thr SP-D were isolated from human amniotic fluid. Implementation of ManNAc-affinity chromatography allowed high recovery of natural trimeric SP......-D multimers. Trimeric SP-D subunits also showed greater binding to endogenous lipoproteins: LDL, oxLDL, and HDL, than multimeric SP-D. In conclusion, purified trimeric and multimeric SP-D represent separate and only partly interconvertible molecular populations with distinct biochemical properties....

  16. Azospirillum sp. strain B510 enhances rice growth and yield. (United States)

    Isawa, Tsuyoshi; Yasuda, Michiko; Awazaki, Hirotoshi; Minamisawa, Kiwamu; Shinozaki, Satoshi; Nakashita, Hideo


    Inoculation experiments with the endophytic bacterium Azospirillum sp. strain B510, an isolate from surface-sterilized stems of field-grown rice, were conducted in pots in a greenhouse, and in paddy fields in Hokkaido, Japan. B510 significantly enhanced the growth of newly generated leaves and shoot biomass under greenhouse conditions. When rice seedlings were treated with 1×10(8) CFU ml(-1), then transplanted to paddy fields, tiller numbers and seed yield significantly increased. Azospirillum sp. strain B510 is a promising bacterial inoculant for plant growth promotion and agricultural practices.

  17. Profil des examens radiographiques spéciaux conventionnels dans ...

    African Journals Online (AJOL)

    But : Montrer l'apport des examens spéciaux dans la démarche diagnostique Méthodologie : Il s'agit d'une étude rétrospective qui a porté sur les résultats de 249 examens spéciaux colligés dans le service de radiologie du CHU- Tokoin de Lomé du 1er mars 2003 au 1er mars 2004. Résultats : L'âge de nos patients varie ...

  18. Induced adaptation of Bacillus sp. to antimicrobial nanosilver. (United States)

    Gunawan, Cindy; Teoh, Wey Yang; Marquis, Christopher P; Amal, Rose


    The natural ability of Bacillus sp. to adapt to nanosilver cytotoxicity upon prolonged exposure is reported for the first time. The combined adaptive effects of nanosilver resistance and enhanced growth are induced under various intensities of nanosilver-stimulated cellular oxidative stress, ranging from only minimal cellular redox imbalance to the lethal levels of cellular ROS stimulation. An important implication of the present work is that such adaptive effects lead to the ultimate domination of nanosilver-resistant Bacillus sp. in the microbiota, to which nanosilver cytotoxicity is continuously applied. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.



    Santillana-Villanueva, Nery; Universidad Nacional Agraria La Molina (Perú).


    Con el objetivo de producir biofertilizantes utilizando 3 cepas de Pseudomonas sp., se realizaron tres experimentos: el primero, para encontrar un medio de cultivo apropiado para la multiplicación de las bacterias; el segundo, para determinar la sobrevivencia de las cepas de Pseudomonas sp en los biofertilizantes y el tercero para determinar la dosis eficiente de aplicación del biofertilizante en frijol, maíz, papa y tomate, en condiciones de invernadero. Al evaluar los resultados, se determi...

  20. Sistema de gerencia de pavimentos do DER/SP


    Luiz Antonio da Silva


    Resumo: Este trabalho versa sobre métodos de levantamento de defeitos e avaliação das condições estruturais, funcionais e de segurança dos pavimentos asfálticos nas estradas estaduais sob a jurisdição do Departamento de Estradas de Rodagem do Estado de São Paulo - DER/SP. Aborda também alguns aspectos administrativos da Autarquia Estadual, aonde atuo como engenheiro de carreira na área de planejamento e de projeto. O DER/SP tem como missão administrar o sistema rodoviário estadual, sua integr...

  1. SP-100 advanced radiator designs for thermoelectric and Stirling applications

    International Nuclear Information System (INIS)

    Moriarty, M.P.; Determan, W.R.


    The authors advanced radiator designs employing carbon-carbon liquid metal heat pipe technology which can significantly reduce the mass of the heat rejection subsystem for high temperature space technology systems such as the SP-100. This technology is being developed to address the need for lightweight heat transfer components and structures for space applications. Heat pipe and subsystem designs were optimized for thermoelectric and Stirling engine bases SP-100 system designs. A multiple, deployed petal radiator concept was selected for the heat rejection subsystem design based upon minimum mass. Radiator stowage in the Space Transportation System cargo bay and deployment schemes were investigated for each of these optimized designs

  2. Mycelium characterization of the Amauroderma sp collected from Royal Belum

    International Nuclear Information System (INIS)

    Hassan Hamdani Mutaat; Mat Rasol Awang; Fauzi Daud; Rosnani Rashid; Meswan Maskom; Arfah Sumeri


    Etnobotanical study carried on the native community in the Royal Belum Forest areas had identified many potentially valuable spices that could be further explored for its medicinal and health purposes. The mushrooms, Amauroderma sp. was one of the resources that had been screened and collected for further investigation. In this works, the mycelium characterization of the mushroom was carried out in order to develop suitable seed or spawn for cultivation. The Amauroderma sp. mycelium, cultured from the fruit body tissue was found to grow well on the PDA plate. While on the potato extract liquid medium the mushroom could grow and produce stalk like fruit body. (author)

  3. A comparative study on phyllosphere nitrogen fixation by newly isolated Corynebacterium sp. & Flavobacterium sp. and their potentialities as biofertilizer. (United States)

    Giri, S; Pati, B R


    A number of nitrogen fixing bacteria has been isolated from forest phyllosphere on the basis of nitrogenase activity. Among them two best isolates are selected and identified as Corynebacterium sp. AN1 & Flavobacterium sp. TK2 able to reduce 88 and 132 n mol of acetylene (10(8)cells(-1)h(-1)) respectively. They were grown in large amount and sprayed on the phyllosphere of maize plants as a substitute for nitrogenous fertilizer. Marked improvements in growth and total nitrogen content of the plant have been observed by the application of these nitrogen-fixing bacteria. An average 30-37% increase in yield was obtained, which is nearer to chemical fertilizer treatment. Comparatively better effect was obtained by application of Flavobacterium sp.

  4. Halobacillus dabanensis sp. nov. and Halobacillus aidingensis sp. nov., isolated from salt lakes in Xinjiang, China. (United States)

    Liu, W Y; Zeng, J; Wang, L; Dou, Y T; Yang, S S


    Two moderately halophilic spore-forming bacteria were isolated from salt lakes in the Xinjiang region of China. The two strains, designated AD-6(T) and D-8(T), were aerobic, Gram-positive, rod-shaped and motile by means of peritrichous flagella. Strains AD-6(T) and D-8(T) grew in the presence of 0.5-20% and 0.5-25% (w/v) NaCl in complex medium, respectively. Their cell-wall peptidoglycan was of the L-Orn-D-Asp type. The major menaquinone found in both strains was menaquinone-7 (MK-7). The fatty acid profile contained a large amount of branched fatty acids; the main fatty acids were anteiso-C(15:0), anteiso-C(17:0), iso-C(15:0) and iso-C(16:0). The DNA G+C content of strains D-8(T) and AD-6(T) was 41.4 and 42.2 mol%, respectively. Phylogenetic analysis based on 16S rRNA gene sequences revealed that strains D-8(T) and AD-6(T) were located in the genus Halobacillus. Levels of 16S rRNA gene sequence similarity between the isolated strains and the type strains of Halobacillus species were in the range 96.2-99.5%. DNA-DNA relatedness values of 17.0-52.2% were found between the two strains and other Halobacillus species. The DNA-DNA relatedness value between D-8(T) and AD-6(T) was 50.6%. On the basis of phenotypic and chemotaxonomic properties, phylogenetic analysis and genomic distinctiveness, strains D-8(T) and AD-6(T) should be placed in the genus Halobacillus as two novel species, for which the names Halobacillus dabanensis sp. nov. (type strain=JCM 12772(T)=CGMCC 1.3704(T)) and Halobacillus aidingensis sp. nov. (type strain=JCM 12771(T)=CGMCC 1.3703(T)) are proposed, respectively.

  5. Lysobacter fragariae sp. nov. and Lysobacter rhizosphaerae sp. nov. isolated from rhizosphere of strawberry plant. (United States)

    Singh, Hina; Du, Juan; Ngo, Hien T T; Won, KyungHwa; Yang, Jung-Eun; Kim, Ki-Young; Yi, Tae-Hoo


    Two bacterial strains, designated THG-DN8.7(T) and THG-DN8.3(T), were isolated from the rhizosphere of a strawberry plant in Gyeryong Mountain, South Korea. Cells of both isolates were observed to be Gram-negative, yellow-coloured and rod-shaped. Comparative 16S rRNA gene sequence analysis showed that strain THG-DN8.7(T) had highest sequence similarities to Lysobacter yangpyeongensis KACC 11407(T) (97.2 %), Lysobacter niabensis KACC 11587(T) (97.0 %) and Lysobacter oryzae KCTC 22249(T) (96.9 %), while strain THG-DN8.3(T) had closely similarity with L. niabensis KACC 11587(T) (98.1 %), L. oryzae KCTC 22249(T) (97.1 %) and L. yangpyeongensis KACC 11407(T) (96.1 %). DNA-DNA relatedness values between strains THG-DN8.7(T) and THG-DN8.3(T) and their closest phylogenetically neighbours were below 30.0 %, which indicates that strains THG-DN8.7(T) and THG-DN8.3(T) represent distinct species within the genus Lysobacter. Both strains were found to contain iso-C15:0, iso-C16:0 and iso-C17:1 ω9c as predominant fatty acids and ubiquinone-8 as major isoprenoid quinone. The major polar lipids were identified as phosphatidylethanolamine, phosphatidyl-N-methylethanolamine, phosphatidylglycerol and diphosphatidylglycerol. The DNA G+C content of strains THG-DN8.7(T) and THG-DN8.3(T) were determined to be 66.9 and 67.8 mol%, respectively. These data are consistent with the affiliation of the two new species represented by THG-DN8.7(T) and THG-DN8.3(T) to the genus Lysobacter. The names Lysobacter fragariae sp. nov. and Lysobacter rhizosphaerae sp. nov. are proposed for these species with the type strains THG-DN8.7(T) (=KCTC 42236(T) = JCM 30322(T)) and THG-DN8.3(T) (=KCTC 42237(T) = JCM 30321(T)), respectively.

  6. Lactobacillus silagincola sp. nov. and Lactobacillus pentosiphilus sp. nov., isolated from silage. (United States)

    Tohno, Masanori; Tanizawa, Yasuhiro; Irisawa, Tomohiro; Masuda, Takaharu; Sakamoto, Mitsuo; Arita, Masanori; Ohkuma, Moriya; Kobayashi, Hisami


    Three Gram-stain positive, non-motile, non-spore-forming, catalase-negative and rod-shaped bacterial strains (IWT5T, IWT25T and IWT140), isolated from silage, were investigated by using a polyphasic taxonomic approach. Strains IWT5T and IWT25T grew at 10-37 °C and 30-37 °C, and at pH 4.0-7.5 and 4.0-7.0, respectively. The G+C contents of genomic DNA of strains IWT5T and IWT25T were 43.2 and 44.4 mol%, respectively. Strains IWT5T and IWT25T contained C16 : 0, C18 : 1 ω9c and summed feature 7 (unknown 18.846/C19 : 1 ω6c/C19 : 0cyclo ω10c) as the major fatty acids. Strain IWT5T was most closely related to the type strains of Lactobacillus mixtipabuli (99.9 % 16S rRNA gene sequence similarity) and Lactobacillus silagei (99.5 %). For IWT25T, the 16S rRNA gene sequence similarities with the closely related neighbour type strains L. mixtipabuli and L. silagei were 99.5 and 99.5 %, respectively. The 16S rRNA gene sequence similarities among the three novel isolates were 99.5-99.9 %. The average nucleotide identities of strains IWT5T and IWT25T to other neighbours of the genus Lactobacillus were less than 82 % and the genomes of IWT25T and IWT140 shared 97.3 % average nucleotide identity, demonstrating that the three strains were allocated to two different novel species of the genus Lactobacillus. Together with multilocus sequence analysis, phenotypic and chemotaxonomic characteristics, strains IWT5T (=JCM 31144T=DSM 102973T) and IWT25T (=JCM 31145T=DSM 102974T) are proposed as the type strains of novel species of the genus Lactobacillus, with the names Lactobacillus silagincola sp. nov. and Lactobacillus pentosiphilus sp. nov., respectively.

  7. Growth performance and proximate composition of mixed cultures of marine microalgae (Nannochloropsis sp. & Tetraselmis sp. with monocultures

    Directory of Open Access Journals (Sweden)

    Wasana Arkronrat


    Full Text Available The growth performance and proximate composition of two marine microalgae, Nannochloropsis sp. and Tetraselmis sp., in monoculture and mixed culture of both species under laboratory conditions were compared. Microalgae were cultured in enriched seawater (28 ppt in 8 L plastic bottles using Conway medium. Microalgae were grown in a temperature-controlled room (25°C under continuous illumination at a light intensity of about 3,000 Lux for 240 hours (10 days. Results showed that maximum cell density and growth rate of both species (45.06±2.67×105 cells ml-1 and 0.43±0.02 day-1, reps. in mixed culture had a significantly higher than Tetraselmis sp. (5.09±0.99×105 cells ml-1 and 0.16±0.03 day-1, reps., but not significantly different with Nannochloropsis sp. (29.25±22.70×105 cells ml-1 and 0.37±0.14 day-1, reps. in monoculture. For proximate composition, protein content of both species in mixed culture and Nannochloropsis sp. in monoculture was significantly higher than for Tetraselmis sp. in monoculture after 120 and 240 hours of cultivation. Carbohydrate and lipid contents of each treatment were found to be significantly different after 120 hours of cultivation but not significantly different after 240 hours of cultivation. Therefore, this study indicates that an alternative option for commercial microalgal production is to use a mixed culture to obtain higher production.

  8. Fusarium euwallaceae sp. nov.--a symbiotic fungus of Euwallacea sp., an invasive ambrosia beetle in Israel and California. (United States)

    Freeman, S; Sharon, M; Maymon, M; Mendel, Z; Protasov, A; Aoki, T; Eskalen, A; O'Donnell, K


    The invasive Asian ambrosia beetle Euwallacea sp. (Coleoptera, Scolytinae, Xyleborini) and a novel Fusarium sp. that it farms in its galleries as a source of nutrition causes serious damage to more than 20 species of live trees and pose a serious threat to avocado production (Persea americana) in Israel and California. Adult female beetles are equipped with mandibular mycangia in which its fungal symbiont is transported within and from the natal galleries. Damage caused to the xylem is associated with disease symptoms that include sugar or gum exudates, dieback, wilt and ultimately host tree mortality. In 2012 the beetle was recorded on more than 200 and 20 different urban landscape species in southern California and Israel respectively. Euwallacea sp. and its symbiont are closely related to the tea shot-hole borer (E. fornicatus) and its obligate symbiont, F. ambrosium occurring in Sri Lanka and India. To distinguish these beetles, hereafter the unnamed xyleborine in Israel and California will be referred to as Euwallacea sp. IS/CA. Both fusaria exhibit distinctive ecologies and produce clavate macroconidia, which we think might represent an adaption to the species-specific beetle partner. Both fusaria comprise a genealogically exclusive lineage within Clade 3 of the Fusarium solani species complex (FSSC) that can be differentiated with arbitrarily primed PCR. Currently these fusaria can be distinguished only phenotypically by the abundant production of blue to brownish macroconidia in the symbiont of Euwallacea sp. IS/CA and their rarity or absence in F. ambrosium. We speculate that obligate symbiosis of Euwallacea and Fusarium, might have driven ecological speciation in these mutualists. Thus, the purpose of this paper is to describe and illustrate the novel, economically destructive avocado pathogen as Fusarium euwallaceae sp. nov. S. Freeman et al.


    Directory of Open Access Journals (Sweden)

    Adriano Bonfim Carregaro


    Full Text Available Este estudo avaliou o parasitismo gastrintestinal por protozoários em bugios (Alouatta sp. mantidos em cativeiro no município de Santa Maria, RS. Foram analisadas amostras de fezes de oito macacos das espécies Alouatta caraya e Alouatta guariba, pelo método de centrífugo-flutuação com sulfato de zinco. Observaram-se oocistos de Cryptosporidium spp. nas fezes de todos os animais pesquisados, sendo que em três deles havia infecção mista com cistos de Giardia spp. Analisando a água oferecida aos primatas detectou-se a presença elevada de oocistos de Cryptosporidium sp. e raros oocistos de outro coccidio. Conclui-se que os macacos A. caraya e A. guariba, mantidos em cativeiro, são hospedeiros dos gêneros Giardia e Cryptosporidium.

    PALAVRAS-CHAVES: Alouatta sp., bugio, Cryptosporidium spp., Giardia spp.

    This study evaluated the gastrointestinal parasitism by protozoa in captive howler monkeys (Alouatta sp. in the city of Santa Maria, RS. Fecal samples from eight monkeys of the Alouatta caraya and Alouatta guariba species were analyzed by the zinc sulfate centrifugal flotation method. Cryptosporidium spp. oocysts were observed in the feces of all the studied animals, three of which having mixed infection with Giardia spp. cysts. Analyzing the water offered to the primates it was detected elevated presence of Cryptosporidium sp. oocysts and rare oocysts of other coccidium. In conclusion, A. caraya and A. guariba monkeys, kept in captivity, are hosts for Giardia and Cryptosporidium genus.

    KEY WORDS:  Alouatta sp., Cryptosporidium spp., Giardia spp., howler monkey.

  10. [Study on the Visualization of the Biomass of Chlorella sp., Isochrysis galbana, and Spirulina sp. Based on Hyperspectral Imaging Technique]. (United States)

    Jiang, Lu-lu; Wet, Xuan; Zhao, Yan-ru; Shao, Yong-ni; Qiu, Zheng-jun; He, Yong


    Effective cultivation of the microalgae is the key issue for microalgal bio-energy utilization. In nutrient rich culture conditions, the microalge have a fast growth rate, but they are more susceptible to environmental pollution and influence. So to monitor the the growth process of microalgae is significant during cultivating. Hyperspectral imaging has the advantages of both spectra and image analysis. The spectra contain abundant material quality signal and the image contains abundant spatial information of the material about the chemical distribution. It can achieve the rapid information acquisition and access a large amount of data. In this paper, the authors collected the hyperspectral images of forty-five samples of Chlorella sp., Isochrysis galbana, and Spirulina sp., respectively. The average spectra of the region of interest (ROI) were extracted. After applying successive projection algorithm (SPA), the authors established the multiple linear regression (MLR) model with the spectra and corresponding biomass of 30 samples, 15 samples were used as the prediction set. For Chlorella sp., Isochrysis galbana, and Spirulina sp., the correlation coefficient of prediction (r(pre)) are 0.950, 0.969 and 0.961, the root mean square error of prediction (RMSEP) for 0.010 2, 0.010 7 and 0.007 1, respectively. Finally, the authors used the MLR model to predict biomass for each pixel in the images of prediction set; images displayed in different colors for visualization based on pseudo-color images with the help of a Matlab program. The results show that using hyperspectral imaging technique to predict the biomass of Chlorella sp. and Spirulina sp. were better, but for the Isochrysis galbana visualization needs to be further improved. This research set the basis for rapidly detecting the growth of microalgae and using the microalgae as the bio-energy.

  11. Low SP1 expression differentially affects intestinal-type compared with diffuse-type gastric adenocarcinoma.

    Directory of Open Access Journals (Sweden)

    Hun Seok Lee

    Full Text Available Specificity protein 1 (SP1 is an essential transcription factor that regulates multiple cancer-related genes. Because aberrant expression of SP1 is related to cancer development and progression, we focused on SP1 expression in gastric carcinoma and its correlation with disease outcomes. Although patient survival decreased as SP1 expression increased (P<0.05 in diffuse-type gastric cancer, the lack of SP1 expression in intestinal-type gastric cancer was significantly correlated with poor survival (P<0.05. The knockdown of SP1 in a high SP1-expressing intestinal-type gastric cell line, MKN28, increased migration and invasion but decreased proliferation. Microarray data in SP1 siRNA-transfected MKN28 revealed that the genes inhibiting migration were downregulated, whereas the genes negatively facilitating proliferation were increased. However, both migration and invasion were decreased by forced SP1 expression in a low SP1-expressing intestinal-type gastric cell line, AGS. Unlike the intestinal-type, in a high SP1-expressing diffuse-type gastric cell line, SNU484, migration and invasion were decreased by SP1 siRNA. In contrast to previous studies that did not identify differences between the 2 histological types, our results reveal that low expression of SP1 is involved in cancer progression and metastasis and differentially affects intestinal-type compared with diffuse-type gastric adenocarcinoma.

  12. Re-examination of the genus Acetobacter, with descriptions of Acetobacter cerevisiae sp. nov. and Acetobacter malorum sp. nov. (United States)

    Cleenwerck, I; Vandemeulebroecke, K; Janssens, D; Swings, J


    Thirty-four Acetobacter strains, representing Acetobacter aceti, Acetobacter pasteurianus, Acetobacter pomorum, Acetobacter peroxydans, Acetobacter lovaniensis, Acetobacter estunensis, Acetobacter orleanensis, Acetobacter indonesiensis and Acetobacter tropicalis, were subjected to a polyphasic study that included DNA-DNA hybridizations, DNA base ratio determinations, 16S rDNA sequence analysis and phenotypic characterization. Two novel species are proposed, Acetobacter cerevisiae sp. nov. and Acetobacter malorum sp. nov. The type strains of these species are respectively LMG 1625T (= DSM 14362T = NCIB 8894T = ATCC 23765T) and LMG 1746T (= DSM 14337T).

  13. Helicotylenchus oleae n. sp. and H. neopaxilli n. sp. (Hoplolaimidae), Two New Spiral Nematodes Parasitic on Olive Trees in Italy. (United States)

    Inserra, R N; Vovlas, N; Golden, A M


    Helicotylenchus oleae n. sp. and H. neopaxilli n. sp., from olive roots and soil in Italy, are described and illustrated. Helicotylenchus oleae can be distinguished from the related species H. canadensis and H. tunisiensis especially by the smaller styler, its distinctive tail shape, and a tail longer than one anal body width. Helicotylenchus neopaxilli differs from the close species H. paxilli by having a conical, anteriorly truncated labial region, shorter stylet, and phasmids always anterior to level of anus. Also illustrated and discussed are histopathological changes within feeder roots of olive caused by the feeding activity of the semi-endoparasitic H. oleae.

  14. Ocorrência de Babesia sp em pequenos roedores no Brasil Occurrence of Babesia sp in small rodents in Brazil


    G.S. Gazeta; R.W. Carvalho; R.F. Avelar; M. Amorim; A.E. Aboud-Dutra


    Foi analisada a ocorrência de babesiose em pequenos roedores nos municípios de Silva Jardim e Nova lguaçu, Estado do Rio de Janeiro. Foram capturados 44 roedores de seis espécies diferentes e entre eles a prevalência da infecção foi de 27,3%. Rattus norvegicus foi considerado o principal reservatório (50,0%) e Oligoryzomys nigripes como novo hospedeiro para Babesia sp. Este foi o primeiro relato de Babesia sp. em roedores no Brasil. A freqüência de roedores positivos e o risco de infecção dos...

  15. Rhizobium calliandrae sp. nov., Rhizobium mayense sp. nov. and Rhizobium jaguaris sp. nov., rhizobial species nodulating the medicinal legume Calliandra grandiflora. (United States)

    Rincón-Rosales, Reiner; Villalobos-Escobedo, José M; Rogel, Marco A; Martinez, Julio; Ormeño-Orrillo, Ernesto; Martínez-Romero, Esperanza


    Calliandra grandiflora has been used as a medicinal plant for thousands of years in Mexico. Rhizobial strains were obtained from root nodules of C. grandiflora collected from different geographical regions in Chiapas and characterized by BOX-PCR, amplified rDNA restriction analysis (ARDRA) and 16S rRNA gene sequence analysis. Most isolates corresponded to members of the genus Rhizobium and those not related to species with validly published names were further characterized by recA, atpD, rpoB and nifH gene phylogenies, phenotypic and DNA-DNA hybridization analyses. Three novel related species of the genus Rhizobium within the 'Rhizobium tropici group' share the same symbiovar that may be named sv. calliandrae. The names proposed for the three novel species are Rhizobium calliandrae sp. nov. (type strain, CCGE524(T) =ATCC BAA-2435(T) =CIP 110456(T) =LBP2-1(T)), Rhizobium mayense sp. nov. (type strain, CCGE526(T) =ATCC BAA-2446(T) = CIP 110454(T) =NSJP1-1(T)) and Rhizobium jaguaris sp. nov. (type strain, CCGE525(T) =ATCC BAA-2445(T) =CIP 110453(T) =SJP1-2(T)).

  16. Metschnikowia chrysoperlae sp. nov., Candida picachoensis sp. nov. and Candida pimensis sp. nov., isolated from the green lacewings Chrysoperla comanche and Chrysoperla carnea (Neuroptera: Chrysopidae). (United States)

    Suh, Sung-Oui; Gibson, Cara M; Blackwell, Meredith


    Fourteen yeast isolates comprising three taxa were cultured from digestive tracts of adult Chrysoperla species (Neuroptera: Chrysopidae) and their eggs. The yeast taxa were distinguished based on an estimated molecular phylogeny, DNA sequences and traditional taxonomic criteria. The new yeasts are closely related to Metschnikowia pulcherrima but are sufficiently distinguished by sequence comparison of rRNA gene sequences to consider them as novel species. Here, three novel species are described and their relationships with other taxa in the Saccharomycetes are discussed. Metschnikowia chrysoperlae sp. nov. (type strain, NRRL Y-27615T = CBS 9803T) produced needle-shaped ascospores and was the only teleomorph found. Large numbers of chlamydospores similar to those observed in M. pulcherrima were also produced. The other two novel species are asexual yeasts, Candida picachoensis sp. nov. (type strain, NRRL Y-27607T = CBS 9804T) and Candida pimensis sp. nov. (type strain, NRRL Y-27619T = CBS 9805T), sister taxa of M. chrysoperlae and M. pulcherrima. A specialized relationship between yeasts and lacewing hosts may exist, because the yeasts were isolated consistently from lacewings only. Although M. chrysoperlae was isolated from eggs and adult lacewings, suggesting the possibility of vertical transmission, no yeast was isolated from larvae.

  17. Elevation of three subspecies of Lonsdalea quercina to species level: Lonsdalea britannica sp. nov., Lonsdalea iberica sp. nov. and Lonsdalea populi sp. nov. (United States)

    Li, Yong; Xue, Han; Guo, Li-Min; Koltay, András; Palacio-Bielsa, Ana; Chang, Jupu; Xie, Shoujiang; Yang, Xuqi


    Four subspecies of Lonsdalea quercina (L. quercina subsp. quercina, L. quercina subsp. britannica, L. quercina subsp. iberica and L. quercina subsp. populi) were studied by genome sequence-derived average nucleotide identity (ANI), phylogenetic analysis based on 16S rRNA gene sequences, multilocus sequence analysis (MLSA) and phenotypic characteristics. In phylogenetic trees, based on 16S rRNA gene sequences, and in MLSA data, the four subspecies were divided into four subclusters in the Lonsdalea clade with high boot strap support. The ANI values between the four subspecies were 88.71-93.38 %, respectively, lower than the proposed species boundary ANI cut-off (95-96 %) that is considered the most important criterion to reclassify these subspecies at the species level. It is proposed that three subspecies be elevated to the species level as Lonsdalea britannica sp. nov. (type strain R-43280 T =LMG 26267 T =NCPPB 4481 T =CFCC 10822 T ), Lonsdalea iberica sp. nov. (type strain R-44166 T =LMG 26264 T =NCPPB 4490 T =CFCC 10824 T ) and Lonsdalea populi sp. nov. (type strain NY060 T =DSM 25466 T =NCAIM B 02483 T =LMG 27349 T =CFCC 13125 T ).

  18. Halomonas saccharevitans sp. nov., Halomonas arcis sp. nov. and Halomonas subterranea sp. nov., halophilic bacteria isolated from hypersaline environments of China. (United States)

    Xu, Xue-Wei; Wu, Yue-Hong; Zhou, Zhen; Wang, Chun-Sheng; Zhou, Yu-Guang; Zhang, Hui-Bin; Wang, Yong; Wu, Min


    Three strains of Gram-negative, aerobic, neutrophilic and halophilic bacteria were isolated from samples of a salt lake on the Qinghai-Tibet Plateau and a subterranean saline well in the Si-Chuan Basin of China. These isolates, designated AJ275(T), AJ282(T) and ZG16(T), were investigated using a polyphasic approach. Based on 16S rRNA gene sequence analysis, the isolates could be affiliated to the genus Halomonas. Genomic DNA G+C contents were 65.9 mol% for AJ275(T), 56.7 mol% for AJ282(T) and 57.6 mol% for ZG16(T). The results of DNA-DNA hybridizations, fatty acid analysis and physiological and biochemical tests allowed the isolates to be differentiated genotypically and phenotypically from closely related species. It is proposed that strains AJ275(T) (=CGMCC 1.6493(T)=JCM 14606(T)=LMG 23976(T)), AJ282(T) (=CGMCC 1.6494(T)=JCM 14607(T)=LMG 23978(T)) and ZG16(T) (=CGMCC 1.6495(T)=JCM 14608(T)=LMG 23977(T)) represent the type strains of three novel species in the genus Halomonas: Halomonas saccharevitans sp. nov., Halomonas arcis sp. nov. and Halomonas subterranea sp. nov., respectively.

  19. Synthetic surfactant based on analogues of SP-B and SP-C is superior to single-peptide surfactants in ventilated premature rabbits. (United States)

    Almlén, Andreas; Walther, Frans J; Waring, Alan J; Robertson, Bengt; Johansson, Jan; Curstedt, Tore


    Respiratory distress syndrome (RDS) is currently treated with surfactant preparations obtained from natural sources and attempts to develop equally active synthetic surfactants have been unsuccessful. One difference in composition is that naturally derived surfactants contain the two hydrophobic proteins SP-B and SP-C while synthetic preparations contain analogues of either SP-B or SP-C. It was recently shown that both SP-B and SP-C (or SP-C33, an SP-C analogue) are necessary to establish alveolar stability at end-expiration in a rabbit RDS model, as reflected by high lung gas volumes without application of positive end-expiratory pressure. To study the efficacy of fully synthetic surfactants containing analogues of both SP-B and SP-C compared to surfactants with only one protein analogue. Premature newborn rabbits, treated with synthetic surfactants, were ventilated for 30 min without positive end-expiratory pressure. Tidal volumes as well as lung gas volumes at end-expiration were determined. Treatment with 2% Mini-B (a short-cut version of SP-B) and 2% SP-C33, or its C-terminally truncated form SP-C30, in 1,2-dipalmitoyl-sn-glycero-3-phosphocholine/1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol, 68:31 (w/w) resulted in median lung gas volumes of 8-9 ml/kg body weight, while animals treated with 2% Mini-B surfactant or 2% SP-C33/SP-C30 surfactant had lung gas volumes of 3-4 ml/kg, and those treated with Curosurf, a porcine surfactant, 15-17 ml/kg. In contrast, mixing SP-C33 with peptides with different distributions of positively charged and hydrophobic residues did not improve lung gas volumes. The data indicate that synthetic surfactants containing analogues of both SP-B and SP-C might be superior to single-peptide surfactants in the treatment of RDS.

  20. Cytosporones O, P and Q from an endophytic Cytospora sp

    DEFF Research Database (Denmark)

    Abreu, L.M.; Phipps, Richard Kerry; Pfenning, L.H.


    Cytosporones O, P and Q, together with the known compounds cytosporones B, C, D, E and dothiorelones A, 13, C. and H were isolated from the ascomycete fungus Cytospora sp. during a chemotaxonomic study Of fungal endophytes belonging to the related genera Cytospora and Phomopsis from Brazil...

  1. Effects of oxygen concentration on the growth of Nannochloropsis sp.

    NARCIS (Netherlands)

    Raso, S.


    ANannochloropsissp. is a promising microalgal resource for production of food, feed and bio-based commodities, as it can grow relatively fast and combines high lipid content with high content of poly-unsaturated fatty acids. High productivity with constant product quality can be

  2. Genome sequencing and annotation of Cellulomonas sp. HZM


    Chua, Patric; Har, Zi Mei; Austin, Christopher M.; Yule, Catherine M.; Dykes, Gary A.; Lee, Sui Mae


    We report the draft genome sequence of Cellulomonas sp. HZM, isolated from a tropical peat swamp forest. The draft genome size is 3,559,280 bp with a G + C content of 73% and contains 3 rRNA sequences (single copies of 5S, 16S and 23S rRNA).

  3. Genome sequencing and annotation of Cellulomonas sp. HZM. (United States)

    Chua, Patric; Har, Zi Mei; Austin, Christopher M; Yule, Catherine M; Dykes, Gary A; Lee, Sui Mae


    We report the draft genome sequence of Cellulomonas sp. HZM, isolated from a tropical peat swamp forest. The draft genome size is 3,559,280 bp with a G + C content of 73% and contains 3 rRNA sequences (single copies of 5S, 16S and 23S rRNA).

  4. Genome sequencing and annotation of Cellulomonas sp. HZM

    Directory of Open Access Journals (Sweden)

    Patric Chua


    Full Text Available We report the draft genome sequence of Cellulomonas sp. HZM, isolated from a tropical peat swamp forest. The draft genome size is 3,559,280 bp with a G + C content of 73% and contains 3 rRNA sequences (single copies of 5S, 16S and 23S rRNA.

  5. Report of the first human case of Caulobacter sp. infection

    DEFF Research Database (Denmark)

    Justesen, Ulrik S; Holt, Hanne M; Thiesson, Helle


    A Caulobacter sp. isolate was recovered from the dialysis fluid of a patient undergoing peritoneal dialysis. Bacterial identification included electron microscopy and 16S rDNA sequencing. To our knowledge, this is the first report of human Caulobacter infection. Special growth requirements sugges...

  6. Cellulase production by Trichoderma sp . on apple pomace under ...

    African Journals Online (AJOL)

    The feasibility of using apple pomace for cellulase production by Trichoderma sp. under solid state fermentation was evaluated in this study. Our results indicated that initial moisture level of the medium, incubation temperature and inoculum size influenced the cellulase production greatly. The optimum initial moisture level ...

  7. ERRATUM Electron field emission from sp -induced insulating to ...

    Indian Academy of Sciences (India)


    Electron field emission from sp. 2. -induced insulating to metallic behaviour of amorphous carbon (a-C) films. Pitamber Mahanandia, P N Viswakarma, Prasad Vishnu Bhotla, S V Subramanyam and Karuna Kar Nanda. 2010 Bull. Mater. Sci. 33 pp 215–220. The MS received date should be read as “MS received 20 October ...

  8. Characterization of Fusarium oxysporum F. sp. elaeidis (Fofse ...

    African Journals Online (AJOL)

    Characterization of Fusarium oxysporum F. sp. elaeidis (Fofse) causal agent of vascular wilt disease of oil palm. SMA Tagoe, PNL Lamptey, KA Oduro. Abstract. No Abstract. Ghana Journal of Agricultural Science No. 1, 2005: 181-185. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...

  9. Beta-Glucan Synthase Gene Expression in Pleurotus sp

    International Nuclear Information System (INIS)

    Azhar Mohamad; Nie, H.J.


    Pleurotus sp. is a popular edible mushroom, containing various functional component, in particular, Beta-glucan. Beta-glucans is a part of glucan family of polysaccharides and supposedly contribute to medicinal and nutritional value of Pleurotus.sp. In order to understand the distribution of Beta-glucan in Pleurotus.sp, the Beta-glucan synthase gene expression was determined and compared in different part of Pleurotus, namely mycelium, stripe and cap. The Pleurotus.sp RNA was extracted using commercial kit, employing Tissuelyser ll (Qiagen, USA) to disrupt the cell walls. Then the RNA was quantified by Nano drop (Thermo Fisher, USA) and visualized using denaturing agarose gel. RNA with good OD 260.280 reading (∼2.0) was chosen and converted to cDNA. Using Laccase synthase gene as home keeping gene, Beta-glucan synthase gene expression was quantified using CFX 96 Real Time PCR detection system (Biorad, USA). Preliminary result shows that Beta-glucan synthase was relatively expressed the most in stripe, followed by mycelium and barely in cap. (author)

  10. Enhancement of clavulanic acid production by Streptomyces sp MU ...

    African Journals Online (AJOL)

    Purpose: To enhance clavulanic acid production using UV-mutagenesis on Streptomyces sp. NRC77. Methods: UV-mutagenesis was used .... Maxima® Hot Start PCR Master Mix (2X) in a. 50μL reaction mixture as follows: activation of ..... Planning toward the application of large scale production of CA in a bioreactor by the ...

  11. Degradation of morpholine by Mycobacterium sp. isolated from ...

    African Journals Online (AJOL)

    The biodegradation of morpholine has attracted much interest because morpholine causes environmental pollution. Ten species belonging to nine genera were tested for their abilities to degrade morpholine in mineral salts medium containing morpholine (1 g/l). Mycobacterium sp. isolated from polluted water sample ...

  12. Acanthamoeba Sp. S-11 phagocytotic activity on Mycobacterium ...

    African Journals Online (AJOL)

    Background: Mycobacterium leprae (M. leprae) is a pathogenic bacterium that causes leprosy. The presence of M. leprae in the environment is supported by microorganisms that act as the new host for M. leprae. Acanthamoeba's potential to be a host of M. leprae in the environment. Acanthamoeba sp. is Free Living ...

  13. Phellinus artemisiae sp. nov. (Basidiomycota, Hymenochaetaceae), from western USA

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Josef; Vlasák, J.


    Roč. 303, č. 1 (2017), s. 93-96 ISSN 1179-3155 Institutional support: RVO:60077344 Keywords : chaparral Fungi * Phellinus artemisiae sp. nov. * molecular taxonomy * Fungi Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.240, year: 2016

  14. Papposphaera heldalii sp nov (Haptophyta, Papposphaeraceae) from Svalbard

    DEFF Research Database (Denmark)

    Thomsen, Helge Abildhauge; Egge, Jorun Karin


    In an attempt to establish a taxonomy for the polar contingent of lightly calcified coccolithophores, we are currently dealing with species of Papposphaera. Here we describe a new species, Papposphaera heldalii sp. nov., based on material from Svalbard. The species is unique in terms of calyx...

  15. Characteristics of DMSP-lyase in Phaeocystis sp (Prymnesiophyceae)

    NARCIS (Netherlands)

    Stefels, J.; Dijkhuizen, L.

    The marine phytoplankton species Phaeocystis sp, is one of the few microalgae known to be able to convert dimethylsulfoniopropionate (DMSP) enzymatically into dimethyl sulfide (DMS) and acrylic acid. The function of this enzymatic process for the organism is not known. From experiments with crude


    Toxicologic studies designed to identify chemical-induced alterations in the structure and function of the epididymis, particularly the acquisition of fertility by proximal cauda epididymal sperm, have lead to the discovery of a novel sperm protein (SP22) that is well correlated ...

  17. Isozyme-based genetic fingerprinting of Manihot sp

    African Journals Online (AJOL)

    Prof. Ogunji


    Jun 22, 1973 ... Isozyme-based genetic fingerprinting of Manihot sp. Efisue, A. A.. Development of Crop & Soil Science, University of Port Harcourt P.M.B. 5323 Choba, Port Harcourt,. Rivers State, Nigeria. (Received 29:10:13, Accepted 20:12:13). Abstract. Many cassava varieties have been released into farmers' fields in ...

  18. Aspects of the biology of Platorchestia fayetta sp. nov. (Crustacea ...

    African Journals Online (AJOL)

    Amphipods form an important component of coastal fauna and this study is focused on the biology of semi-terres- trial Platorchestia fayetta sp. nov. inhabiting sand and wave-cast algae on the north-eastern coast at Poste La Fayette, Mauritius. The population structure, size class variation, sex ratio and female reproductive ...

  19. Formation water resistivity (R w )determination: The SP method ...

    African Journals Online (AJOL)

    uncontaminated by drilling mud) that saturates the porous formation. It is also referred to as connate water or interstitial water. Its resistivity can be determined by a number of methods, one of which is by the SP curve discussed in this work. Analysis of ...

  20. Tannin Acyl Hydrolase Production by Citrobacter sp. isolated from ...

    African Journals Online (AJOL)

    Bacterial isolate, Citrobacter sp., from tannery effluent loaded sites has proved as a potent producer of tannase. Production of tannase was compared in solid-state and submerged fermentation using tamarind seed as sole carbon source. Two times increase in tannase activity was seen in solid-state fermentation (90 U) than ...

  1. Optimization of cholesterol oxidase production by Brevibacterium sp ...

    African Journals Online (AJOL)

    An ultrasound-assisted emulsification as a pretreatment for cholesterol oxidase production by submerge fermentation using Brevibacterium sp. in a batch system was studied. Medium improvement for the production employing response surface methodology (RSM) was optimized in this paper. The concentration of ...

  2. Molecular characterization of Fusarium oxysporum f. sp. ciceri ...

    African Journals Online (AJOL)

    Thirty isolates of Fusarium oxysporum f. sp. ciceri were isolated from rhizosphere soil of chickpea from different locations in Northern India. The amount of genetic variation was evaluated by polymerase chain reaction (PCR) amplification with a set of 40 RAPD primers and 2 IGS primers. Less than 10% of the amplified ...

  3. The astaxanthin dideoxyglycoside biosynthesis pathway in Sphingomonas sp. PB304

    DEFF Research Database (Denmark)

    Kim, Se Hyeuk; Kim, Jin Ho; Lee, Bun Yeol


    libraries using degenerate probes that harbor highly conserved sequences from the Sphigomonas elodea-derived crtI and Nostoc sp. PCC 7120-dervied crtW genes. Selected positive gene clusters were fully sequenced and annotated, revealing genes encoding six putative carotenogenic enzymes: phytoene synthase...

  4. Biochemical characterization of Fusarium oxysporum f. sp. cubense ...

    African Journals Online (AJOL)



    Jan 25, 2010 ... The characteristics of F. oxyspoum f. sp. cubense isolates were investigated using ... use in evolutionary and population studies of phyto- .... SDS-PAGE. The protein profile of different isolates showed common protein band of 53 kDa in all Foc isolates except isolate 6 and also it could be differentiated by ...

  5. Anaerobic Co-Digestion of the Microalgae Scenedesmus Sp.

    Energy Technology Data Exchange (ETDEWEB)

    Ramos-Suarez, J. L.; Carreras, N.


    Microalgae biomass has been widely studied for biogas production over the last years and results show that anaerobic digestion is often limited by the low C/N ratio of this type of biomass. Therefore, codigestion with substrates of high C/N ratio is necessary. The objectives of this study are to set up an experimental method that ease reproducibility and control of anaerobic digestion processes in laboratory conditions and to determine the biodegradability and biogas production potential of the co-digestion process of microalgae Scenedesmus sp. and energy crop Opuntia ficus indica (L.) Miller. Results obtained showed that higher C/N ratios are preferred in order to maximize methane production. Highest methane yield obtained was 0.252m3CH4/Kg VS and degradability expressed as percentage COD reduced is around 30% for the ideal mixture found, made up of 75% O. ficus-indica and 25% Scenedesmus sp. in VS basis. A laboratory setup using MicroOxymax respirometer, after its adaptation to work under anaerobic conditions, can be used for the monitoring of anaerobic digestion processes. Scenedesmus sp. as sole substrate for anaerobic digestion does not give good results due to low C/N ratio. However, when codigesting it with O. ficus-indica methane production is satisfactory. Best mixture was made up of 75% O. ficus-indica and 25% Scenedesmus sp. in VS basis. (Author)

  6. Archaeperidinium saanichi sp. nov

    DEFF Research Database (Denmark)

    Mertens, Kenneth Neil; Yamaguchi, Aika; Kawami, Hisae


    In this paper we describe a new species, Archaeperidinium saanichi sp. nov. within the Archaeperidinium minutum Jörgensen 1912 species complex. We examined the morphological variation of the cyst and motile stage by incubation experiments from sediment samples collected in coastal British Columbia...

  7. Production and optimization of L-asparaginase by Bacillus sp ...

    African Journals Online (AJOL)

    L-Asparaginase (L-asparagine amido hydrolase, E.C. is an important enzyme which has antitumor properties. This paper describes the production and optimization of L-asparaginase by Bacillus sp. KK2S4 utilization of ground corn cob waste as substrate to reduce and manage the waste in our environment.

  8. Medium optimization for acarbose production by Actinoplanes sp ...

    African Journals Online (AJOL)

    In order to improve the production of acarbose, the fermentation medium of acarbose-producing strain Actinoplanes sp. A56 was optimized in this paper. Firstly, fractional factorial design was employed to investigate the influences of glucose, maltose, corn steep liquor, soy bean flour and monosodium glutamate on ...

  9. Nematoproctus kubani sp. nov. (Insecta, Diptera, Dolichopodidae) from Laos

    Czech Academy of Sciences Publication Activity Database

    Olejníček, Jiří


    Roč. 87, - (2002), s. 67-70 ISSN 1211-8788 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6022909 Keywords : Dolichopodidae * Nematoproctus kubani sp.nov. * Oriental region Subject RIV: EG - Zoology

  10. Culture characteristics of Candida sp in waste conversion ...

    African Journals Online (AJOL)

    A strain of Candida sp. was isolated from ripe banana pulp during the preliminary phase of a process for the production of a protein-enriched feed supplement. Morphological and biochemical tests demonstrated that the strain, which was bipolar and elongated, was not capable of growth at 37ºC but grew at room ...

  11. Biological characterisation of Haliclona (?gellius) sp.: sponge and associated microorganisms.

    NARCIS (Netherlands)

    Sipkema, D.; Holmes, B.; Nichols, S.A.; Blanch, H.W.


    We have characterised the northern Pacific undescribed sponge Haliclona (?gellius) sp. based on rDNA of the sponge and its associated microorganisms. The sponge is closely related to Amphimedon queenslandica from the Great Barrier Reef as the near-complete 18S rDNA sequences of both sponges were

  12. Single-Particle Soot Photometer (SP2) Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Sedlacek, Arthur [Brookhaven National Lab. (BNL), Upton, NY (United States)


    The SP2 is an instrument that measures, in situ, the time-dependent scattering and incandescence signals produced by individual BC-containing particles as they travel through a continuous-wave laser beam. Any particle traversing the laser beam will scatter light, and the BC component of a BC-containing particle will absorb some of the laser energy until its temperature is raised to the point at which it incandesces (hereafter we adopt the standard terminology of the SP2 community and denote any substance determined by the SP2 to be BC as refractory black carbon (rBC)). The amplitude of the rBC incandescence signal is related to the amount of refractory material contained in the illuminated particle. By binning the individual incandescence signals per unit sample volume, the mass concentration [ng/m3] of rBC can be derived. By binning the individual signals by volume equivalent diameter the size distribution (dN/dlogDVED) per unit time can be derived. The rBC mass loading per unit time and the rBC size distribution unit time are the core data products produced by the SP2. Additionally, the scattering channel can be used to provide information on the rBC particle population-based mixing states within ambient aerosols. However, this data product is produced on a requested-basis since additional detailed analysis and QC/QA must be conducted.

  13. Calibration of PIXE-SP system of elementary analysis

    International Nuclear Information System (INIS)

    Tabacniks, M.H.


    The set-up and calibration of the PIXE-SP System of Elementary Analysis located at the Institute of Physics of the University of Sao Paulo is described. The PIXE-SP, that operates with 8 MeV alpha beam, has been calibrated for elements with Z >= 11, by means of homemade evaporated standard targets of Al, Si, Bacl 2 , K 2 CrO 4 , Ti, Cr, Mn, Fe, Cu, Ge, Ag, Sn, and Au. Those targets are thin, homogeneous, and have been calbrated on a microbalance within an average precision of 6%. The overall precision of the PIXE-SP System is estimated in 10% for elements with 16 2 thick, irradiated with a 10 μC electric charge, shows a minimum of about 0,1 ng (approximated 4 ppm) for Mn. The PIXE-SP System has also been intercalibrated with the PIXE located at University of Gent, Belgium, by means of 12 atmospheric aerosol targets collected on two Batelle Cascade Impactors. The analyzed masses of elements with 16 [pt

  14. Comparative study of Aspergillus niger and Penicillium sp. in the ...

    African Journals Online (AJOL)



    Jun 14, 2010 ... The comparative study of Aspergillus niger and Penicillium sp. in the biodegradation of automotive gas oil (AGO) and premium motor spirit (PMS) was carried out to ascertain the effectiveness of using these microorganisms in cleaning and restoring the ecosystem when polluted by petroleum products.

  15. Comparative study of Aspergillus niger and Penicillium sp. in the ...

    African Journals Online (AJOL)

    The comparative study of Aspergillus niger and Penicillium sp. in the biodegradation of automotive gas oil (AGO) and premium motor spirit (PMS) was carried out to ascertain the effectiveness of using these microorganisms in cleaning and restoring the ecosystem when polluted by petroleum products. These fungi were ...

  16. Optimization of lipase production by Staphylococcus sp. Lp12 ...

    African Journals Online (AJOL)

    A bacterial strain isolated from an oil contaminated soil, identified as Staphylococcus sp. Lp12 was screened for lipase activity on tributyrin agar and spirit blue agar medium. Maximum lipase production was observed at 48 h of growth (3.5 Eu/ml). Peptone was found to be as an ideal nitrogen source for production at a ...

  17. Biscalitheca suzanneana, N. Sp., from the uppermost Pennsylvanian of Texas (United States)

    Mamay, S.H.


    Biscalitheca suzanneana, n. sp., is described from specimens found in an uppermost Pennsylvanian deposit in north-central Texas. The genus was identified primarily on the basis of impressions of the unique sporangial annuli. The occurrence establishes for Biscalitheca a stratigraphic range equivalent to nearly the entire Upper Pennsylvanian Series. ?? 1972.

  18. Paraconcinnum leirsi n.sp. (Trematoda: Dicrocoeliidae) from rodents ...

    African Journals Online (AJOL)

    The trematode Paraconcinnum leirsi n.sp. (Dicrocoeliidae) is described from two rodent species, the African gerbil, Gerbilliscus vicinus, and the spiny mouse, Acomys spinosissimus, from Tanzania. It differs from the description of P. hylomisci found in the Stella wood mouse, Hylomyscus stella, in the Democratic Republic of ...

  19. Telosticta fugispinosa sp. nov. from Sabah (Odonata: Zygoptera: Platystictidae). (United States)

    Dow, Rory A; Afendy, Aqilah; Rahman, Homathevi


    Telosticta fugispinosa sp. nov. (holotype male, from Borneo, Sabah, West Coast division, Crocker Range National Park, Inobong, Kimamabang waterfall stream system, 21 ix 2012, deposited in RMNH) is described from Kinabalu National Park and Crocker Range National Park in Sabah, Malaysian Borneo. It is distinguished from all other species of Telosticta by the form of the male anal appendages.

  20. Bioaccumulation of platinum group metals in dolphins, Stenella sp ...

    African Journals Online (AJOL)

    Platinum group metals (PGMs) concentrations were measured in the tissues= of dolphins (Stenella sp.) caught along the Ghanaian coastline. Tissues from specimens caught by fishermen from Dixcove, western Ghana, were analysed in 2006 for palladium (Pd), platinum (Pt) and rhodium (Rh) using the Neutron Activation ...

  1. Reproductive status of opisthoteuthis sp . Over an annual cycle ...

    African Journals Online (AJOL)

    The reproductive biology of deepwater cephalopods has received relatively little attention. The cirrate octopus Opisthoteuthis sp. is a regular bycatch in deep benthic trawls from 800 to 1 200 m deep west of Scotland. Specimens were sampled throughout the seasonal cycle. Mature females occurred over a broad size range ...

  2. Occurrence of Anatrichosoma sp. in a Nigerian feral cat | Ohiolei ...

    African Journals Online (AJOL)

    This is a report of the presence of an embryonated egg with distinct morphological features consistent with those of Anatrichosoma sp., in cat faeces from Ibadan, Nigeria. This is important because detailed information about this parasite's clinical pattern, epidemiology and host range is just being gradually unravelled.

  3. Complete genome sequence of Paenibacillus sp. strain JDR-2 (United States)

    Virginia Chow; Guang Nong; Franz J. St. John; John D. Rice; Ellen Dickstein; Olga Chertkov; David Bruce; Chris Detter; Thomas Brettin; James Han; Tanja Woyke; Sam Pitluck; Matt Nolan; Amrita Pati; Joel Martin; Alex Copeland; Miriam L. Land; Lynne Goodwin; Jeffrey B. Jones; Lonnie O. Ingram; Keelnathan T. Shanmugam; James F. Preston


    Paenibacillus sp. strain JDR-2, an aggressively xylanolytic bacterium isolated from sweetgum (Liquidambar styraciflua) wood, is able to efficiently depolymerize, assimilate and metabolize 4-O-methylglucuronoxylan, the predominant structural component of hardwood hemicelluloses. A basis for this capability was first supported by...

  4. Electron field emission from sp -induced insulating to metallic ...

    Indian Academy of Sciences (India)


    possible applications as semiconductor materials (Silva et al 1998) and as potential field emission cathode ... Though post treatment and annealing results in higher sp. 2 content cluster sizes, graphitization of the ... The samples were prepared by a simple pyrolysis method at different temperatures (700, 800 and 900°C) ...

  5. Antibacterial secondary metabolites from the cave sponge Xestospongia sp. (United States)

    Ankisetty, Sridevi; Slattery, Marc


    Chemical investigation of the cave sponge Xestospongia sp. resulted in the isolation of three new polyacetylenic long chain compounds along with two known metabolites. The structures of the new metabolites were established by NMR and MS analyses. The antibacterial activity of the new metabolites was also evaluated.

  6. Antibacterial Secondary Metabolites from the Cave Sponge Xestospongia sp


    Ankisetty, Sridevi; Slattery, Marc


    Chemical investigation of the cave sponge Xestospongia sp. resulted in the isolation of three new polyacetylenic long chain compounds along with two known metabolites. The structures of the new metabolites were established by NMR and MS analyses. The antibacterial activity of the new metabolites was also evaluated.

  7. Two new alkaloids from Xestospongia sp., a New Caledonian sponge. (United States)

    Quirion, J C; Sevenet, T; Husson, H P; Weniger, B; Debitus, C


    Five alkaloids have been isolated from a New Caledonian sponge Xestospongia sp. These include three known xestospongin derivatives, the new demethylxestospongin B (1) and a tetrahydrocarboline derivative 5. The structures of the new compounds 1 and 5 have been established by nmr studies and comparison with previously described products.

  8. Amplified Fragment Length Polymorphism of Puccinia graminis f. sp ...

    African Journals Online (AJOL)

    in its continued effort to minimize the impact of stem rust on wheat in Ethiopia. Keywords: AFLP, wheat, stem rust, ... as the main causes of crop losses in wheat. Of these, stem rust caused by Puccinia graminis f. sp. tritici (Pgt) is the main ..... estimated losses in major food and cash crops. Amsterdam: Elsevier, 808 p. Ordonez ...

  9. Radiotoxicological analysis at IPEN-CNEN/SP-Brazil

    International Nuclear Information System (INIS)

    Duarte, C.L.; Gaburo, J.; Bellintani, S.A.


    The methodology of control of internal contamination of handlers of radioactive materials is briefly described. The aim of IPEN-CNEN/SP-Brazil is the evaluation of occupational exposure of compounds of uranium, tritium, iodine-131, lead and fluorine among other ones. (M.A.C.) [pt

  10. Procamacolaimus Dorylaimus Sp. Nov. (Nematoda: Leptolaimidae) from the southern atlantic

    NARCIS (Netherlands)

    Holovachov, O.V.


    Procamacolaimus dorylaimus sp. nov. is described from the Southern Atlantic (South Shetland Islands, Antarctica). The species is characterised by 3.4-3.5 mm long body; coarsely annulated cuticle without lateral field, epidermal glands and body pores absent, somatic setae present; labial sensilla

  11. Identification and antifungal activity of Streptomyces sp. S72 isolated ...

    African Journals Online (AJOL)

    The test of antifungal activity for several pathogens fungi causing invasive aspergillosis and systemic candidiasis revealed that the Streptomyces sp. S72 was a good moderate antifungal compound producer against Aspergillus fumigatus and Candida albicans, and had no activity against Aspergillus flavus, Aspergillus ...

  12. Phenotyping and molecular characterization of Lysinibacillus sp. P ...

    African Journals Online (AJOL)

    The bacterial strain Lysinibacillus sp. (P-011) was isolated from the midgut of the Drosophila melanogaster larvae. The bacteria were gram positive, spore forming, rod shaped ranging from 1.86 to 2.5µm in length and 0.50 to 0.67 µm in diameter, positive for catalase, indole, oxidase, nitrate reduction, starch and gelatin ...

  13. Polydactyly in the central pacific gecko, Lepidodactylus sp. (Squamata: Gekkonidae) (United States)

    Bauer, A.M.; Hathaway, S.A.; Fisher, R.N.


    We report the first known case of naturally occurring polydactyly in a gekkotan lizard. A single individual from Palmyra Atoll exhibited a triplication of digit III of the m hand. No obvious teratogenic sources are present on the atoll and the causal factors of polydactyly in Lepidodactylus sp. remain unknown.

  14. Isolation and identification of Staphylococcus sp. in powdered infant milk (United States)

    Palilu, Prayolga Toban; Budiarso, Tri Yahya


    Staphylococcus sp. is one of the most dangerous bacteria that could cause food poisoning. It is a pathogenic bacterium which is able to produce enterotoxin in foods. Milk is an ideal growth medium for Staphylococcus sp., that may cause problem if it is to be consumed, especially by infant. It is the objective of this research to detect the presence of Staphylococcus sp. in powdered infant milk. As many as 14 samples obtained from market were used as samples for bacterial isolation. The isolation were done by employing enrichment step on BHI-broth, continued with Baird-Parker Agar which will produce a typical colony. It is then picked and grown on Mannitol Salt Agar, and gram staining, coagulase assay, and fermentation tests. The confirmation step was done by using API-Staph which gives the identification of Staphylococcus hemoliticus, Staphylococcus aureus and Staphylococcus epidermidis, with a percentage of identity ranging from 65.9-97.7%. Two isolates with the highest identification similarity values were then picked for molecular detection. A PCR primer pair targeting gene coding for enterotoxin A was used, and it gives positive result for the two isolates being tested. It is then concluded that the two isolates belong to Staphylococcus sp., and further research need to be done to correctly identify these isolates.

  15. Mucilaginibacter terrae sp nov., isolated from Antarctic soil

    Czech Academy of Sciences Publication Activity Database

    Sedláček, I.; Pantůček, R.; Králová, S.; Mašlaňová, I.; Holochová, P.; Staňková, E.; Sobotka, Roman; Barták, M.; Busse, H.-J.; Švec, P.


    Roč. 67, č. 10 (2017), s. 4002-4007 ISSN 1466-5026 R&D Projects: GA MŠk(CZ) LO1416 Institutional support: RVO:61388971 Keywords : Mucilaginibacter terrae sp nov. * James ross island * Antarctic Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.134, year: 2016

  16. Biodegradation of Polyethylene by Bacillus sp. Indigenous to the ...

    African Journals Online (AJOL)

    Prof. Ogunji

    Available online at Biodegradation of Polyethylene by Bacillus sp. Indigenous to the. Niger Delta Mangrove Swamp. Ibiene, A. A., Stanley, H. O., Immanuel, O. M.. Department of Microbiology, Faculty of Biological Sciences, College of Applied and Natural Sciences,. University of Port Harcourt, ...

  17. Evaluation of xylanases from Aspergillus niger and Trichoderma sp ...

    African Journals Online (AJOL)

    Despite being present in relatively low amounts, pentosans and hemicelluloses play an important role in dough rheology and bread properties. The aim of this work is to understand how the xylanases from Aspergillus niger and Trichoderma sp. influence dough rheology, such as elasticity, extensibility, strength and stability.

  18. An Acetylenic Alkaloid from the Calcareous Sponge Leucetta sp.

    Directory of Open Access Journals (Sweden)

    Nicole J. de Voogd


    Full Text Available A new acetylenic alkaloid was isolated from the sponge Leucetta sp. The structure was established by analyzing spectroscopic data. The alkaloid showed cytotoxicity IC50 2.5 mg/mL against NBT-T2 cells.

  19. Micropropagation of some Malaysian banana and plantain (Musa sp ...

    African Journals Online (AJOL)



    Apr 19, 2010 ... 1Department of Biochemistry, Universiti Putra Malaysia, 43400 UPM Serdang, Selangor Darul Ehsan, Malaysia. 2Department of Cell ... of people, especially in South East Asia (FAOstat, 2005). As one of the origins of ... After emergence at 10 weeks old, male flower bunches were collected from Musa sp. cv.

  20. Drepanosticta rahmani sp. nov., from Kedah, Malaysia (Odonata: Zygoptera: Platystictidae). (United States)

    Dow, Rory A; Choong, Chee Yen; Ng, Yong Foo


    Drepanosticta rahmani sp. nov. (holotype ♂, steep tributary to stream in hills between Baling and Gulai, north west Kedah, Malaysia, 15 xi 2016, leg. R.A. Dow, to be deposited in the Natural History Museum, London) is described from both sexes.

  1. ε-Caprolactam Utilization by Proteus sp. and Bordetella sp. Isolated From Solid Waste Dumpsites in Lagos State, Nigeria, First Report. (United States)

    Sanuth, Hassan Adeyemi; Yadav, Amit; Fagade, Obasola Ezekiel; Shouche, Yogesh


    The ε-caprolactam is the monomer of the synthetic non-degradable nylon-6 and often found as nonreactive component of nylon-6 manufacturing waste effluent. Environmental consequences of its toxicity to natural habitats and humans pose a global public concern. Soil samples were collected from three designated solid waste dumpsites, namely, Abule-Egba, Olusosun and Isheri-Igando in Lagos State, Nigeria. Sixteen bacteria isolated from these samples were found to utilize the ε-caprolactam as a sole source of carbon and nitrogen at concentration of ≤20 g l(-1). The isolates were characterized using their 16S rRNA gene sequence and showed similarity with Pseudomonas sp., Proteus sp., Providencia sp., Corynebacterium sp., Lysinibacillus sp., Leucobacter sp., Alcaligenes sp. and Bordetella sp. Their optimal growth conditions were found to be at temperature range of 30 to 35 °C and pH range of 7.0-7.5. High Performance liquid chromatography analysis of the ε-caprolactam from supernatant of growth medium revealed that these isolates have potential to remove 31.6-95.7 % of ε-caprolactam. To the best of our knowledge, this study is first to report the ability of Proteus sp. and Bordetella sp. for ε-caprolactam utilization.

  2. Revaluation of the film test as a screening test for' Eurytrema sp infection in cattle


    Pacífico Antonio Diniz Belém; Mauro Rodrigues de Oliveira; Carlos Roberto Padovani


    Film test was performed in fecal samples of Eurytrema sp infected and non infected cattle but both groups showed similar results. So, it was concluded that film test is an unreliable one for screening Eurytrema sp infection in cattle.



    Aniskina M. V.; Volobueva E. S.; Petenko A. I.; Volkova S. A.


    The article presents the materials of the study of the features of cultivation of Lactobacillus sp. on different culture medium. We have made a comparison of standard culture medium for cultivation Lactobacillus sp. and determined the most optimal culture medium

  4. Babesia peircei sp. nov. from the jackass penguin | Earlé | African ...

    African Journals Online (AJOL)

    An avian piroplasm, Babesia peircei sp. nov. is described from the jackass penguin Spheniscus demersus. Morphological differences between Babesia peircei sp. nov. and the other valid Babesia spp. are discussed together with the possible vectors.

  5. Multitasking Immune Sp185/333 Protein, rSpTransformer-E1, and Its Recombinant Fragments Undergo Secondary Structural Transformation upon Binding Targets. (United States)

    Lun, Cheng Man; Bishop, Barney M; Smith, L Courtney


    The purple sea urchin, Strongylocentrotus purpuratus , expresses a diverse immune response protein family called Sp185/333. A recombinant Sp185/333 protein, previously called rSp0032, shows multitasking antipathogen binding ability, suggesting that the protein family mediates a flexible and effective immune response to multiple foreign cells. Bioinformatic analysis predicts that rSp0032 is intrinsically disordered, and its multiple binding characteristic suggests structural flexibility to adopt different conformations depending on the characteristics of the target. To address the flexibility and structural shifting hypothesis, circular dichroism analysis of rSp0032 suggests that it transforms from disordered (random coil) to α helical structure. This structural transformation may be the basis for the strong affinity between rSp0032 and several pathogen-associated molecular patterns. The N-terminal Gly-rich fragment of rSp0032 and the C-terminal His-rich fragment show unique transformations by either intensifying the α helical structure or changing from α helical to β strand depending on the solvents and molecules added to the buffer. Based on these results, we propose a name change from rSp0032 to rSpTransformer-E1 to represent its flexible structural conformations and its E1 element pattern. Given that rSpTransformer-E1 shifts its conformation in the presence of solvents and binding targets and that all Sp185/333 proteins are predicted to be disordered, many or all of these proteins may undergo structural transformation to enable multitasking binding activity toward a wide range of targets. Consequently, we also propose an overarching name change for the entire family from Sp185/333 proteins to SpTransformer proteins. Copyright © 2017 by The American Association of Immunologists, Inc.

  6. Resistance to Puccinia graminis f. sp. avenae in Barley Is Associated with the Rpg5 Locus. (United States)

    Dracatos, Peter; Singh, Davinder; Fetch, Tom; Park, Robert


    In barley, gene Rpg5 was first identified for providing resistance to the rye stem rust pathogen (Puccinia graminis f. sp. secalis). A subsequent study determined that Rpg5 is required for rpg4-mediated resistance to the wheat stem rust pathogen (P. graminis f. sp. tritici) including pathotype TTKSK ("Ug99"), which poses a major threat to global wheat and barley production. Based on the effectiveness of Rpg5 against P. graminis f. sp. tritici and P. graminis f. sp. secalis, we assessed whether it also conferred resistance to the oat stem rust pathogen (P. graminis f. sp. avenae). A barley F8 recombinant inbred line (RIL) population was produced by crossing 'Q21861' (Rpg1 and Rpg5) with '73-G1' (Rpg1), which is susceptible to P. graminis f. sp. avenae, P. graminis f. sp. secalis, and some pathotypes of P. graminis f. sp. tritici. Seedling tests were performed on the F8 RIL population using Australian pathotypes of P. graminis f. sp. tritici, P. graminis f. sp. secalis, P. graminis f. sp. avenae, and a putative somatic hybrid between P. graminis f. sp. tritici and P. graminis f. sp. secalis known as the 'Scabrum' rust. Segregation in the responses to all rust isolates for the RILs was identical (50 resistant: 52 susceptible), and fitted a 1:1 ratio (X2=0.039, P=0.843), indicating that resistance to all isolates was monogenetically inherited. Screening of the RILs and the parental lines with perfect markers for the functional Rpg1 and Rpg5 resistance alleles indicated that Rpg1 was fixed, while Rpg5 was positive in all resistant lines and negative in all susceptible lines. This suggests that different formae speciales of P. graminis may share common effectors, and that the Rpg5 locus confers resistance to both P. graminis f. sp. tritici and P. graminis f. sp. secalis and the heterologous formae speciales of P. graminis, P. graminis f. sp. avenae.

  7. Molecular evidence of a new Babesia sp. in goats. (United States)

    Ozubek, Sezayi; Aktas, Munir


    In this study, a novel Babesia sp. infecting goats was detected and its phylogenetic relationship to related species was determined. A total of 200 blood samples collected from sheep (n=78) and goats (n=122) were examined in the study. The V4 hypervariable region of the 18S rRNA gene of the novel Babesia sp. was amplified by PCR and analysed using a reverse line blot hybridization assay adapted for small ruminants. Samples from seven goats hybridized to Theileria/Babesia catch-all and Babesia catch-all probes and did not hybridize to any species-specific probe tested, suggesting the presence of an unrecognized Babesia species or genotype. Sequencing results showed the isolate to clearly differ from ovine Babesia species and genotypes currently available in the GenBank database. The isolate showed 90.9%, 93.5%, and 93.4% identity to B. ovis, B. motasi, and B. crassa, respectively and 91-93% similarity to Babesia genotypes recently described in small ruminants. The highest homology (∼96-97%) observed was with Babesia odocoilei, Babesia sp. EU1, and Babesia divergens. The new isolate was provisionally designated Babesia sp. The study contributes to better insight into the distribution and phylogenetic diversity of piroplasms in small ruminants. The survey indicated a high prevalence of piroplasms in small ruminants (21.5%). Of those detected, T. ovis was the most prevalent (17%), followed by Babesia sp. (3.5%), and B. ovis (2%). Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Sp1/Sp3 and DNA-methylation contribute to basal transcriptional activation of human podoplanin in MG63 versus Saos-2 osteoblastic cells

    Directory of Open Access Journals (Sweden)

    Puri Christina


    Full Text Available Abstract Background Podoplanin is a membrane mucin that, among a series of tissues, is expressed on late osteoblasts and osteocytes. Since recent findings have focussed on podoplanin's potential role as a tumour progression factor, we aimed at identifying regulatory elements conferring PDPN promoter activity. Here, we characterized the molecular mechanism controlling basal PDPN transcription in human osteoblast-like MG63 versus Saos-2 cells. Results We cloned and sequenced 2056 nucleotides from the 5'-flanking region of the PDPN gene and a computational search revealed that the TATA and CAAT box-lacking promoter possesses features of a growth-related gene, such as a GC-rich 5' region and the presence of multiple putative Sp1, AP-4 and NF-1 sites. Reporter gene assays demonstrated a functional promoter in MG63 cells exhibiting 30-fold more activity than in Saos-2 cells. In vitro DNase I footprinting revealed eight protected regions flanked by DNaseI hypersensitive sites within the region bp -728 to -39 present in MG63, but not in Saos-2 cells. Among these regions, mutation and supershift electrophoretic mobility shift assays (EMSA identified four Sp1/Sp3 binding sites and two binding sites for yet unknown transcription factors. Deletion studies demonstrated the functional importance of two Sp1/Sp3 sites for PDPN promoter activity. Overexpression of Sp1 and Sp3 independently increased the stimulatory effect of the promoter and podoplanin mRNA levels in MG63 and Saos-2 cells. In SL2 cells, Sp3 functioned as a repressor, while Sp1 and Sp3 acted positively synergistic. Weak PDPN promoter activity of Saos-2 cells correlated with low Sp1/Sp3 nuclear levels, which was confirmed by Sp1/Sp3 chromatin immunoprecipitations in vivo. Moreover, methylation-sensitive Southern blot analyses and bisulfite sequencing detected strong methylation of CpG sites upstream of bp -464 in MG63 cells, but hypomethylation of these sites in Saos-2 cells. Concomitantly

  9. Hydrolysis of surimi wastewater for production of transglutaminase by Enterobacter sp. C2361 and Providencia sp. C1112. (United States)

    H-Kittikun, Aran; Bourneow, Chaiwut; Benjakul, Soottawat


    Surimi wastewater (SWW) is an industrial wastewater, released during the washing step of surimi preparation from minced fish, that causes environmental problem. In this study, SWW produced from ornate threadfin bream (Nemipterus hexodon) was hydrolysed and used to cultivate Enterobacter sp. C2361 and Providencia sp. C1112 for the production of microbial transglutaminase (MTGase, EC The SWW was repeatedly used to wash the fish mince that gained a final protein content of 3.20% (w/v). The commercial protease, Delvolase was the most appropriate protease used to produce fish protein hydrolysate (FPH) from SWW. The FPH at 40% degree of hydrolysis was used instead of a peptone portion in the SPY medium (3.0% starch, 2.0% peptone, 0.2% yeast extract, 0.2% MgSO(4), 0.2% K(2)HPO(4) and 0.2% KH(2)HPO(4), pH 7.0) to cultivate the tested strains at 37°C, shaking speed at 150rpm. Providencia sp. C1112 produced higher MTGase activity (1.78±0.05U/ml) than Streptoverticillium mobaraense (1.61±0.02U/ml) at 18h of cultivation in FPH medium. On the other hand, the Enterobacter sp. C2361 produced lower MTGase activity (1.18±0.03U/ml). Copyright © 2012 Elsevier Ltd. All rights reserved.

  10. Antifungal Activity of Jasminum sambac against Malassezia sp. and Non-Malassezia sp. Isolated from Human Skin Samples

    Directory of Open Access Journals (Sweden)

    Jacinta Santhanam


    Full Text Available Malassezia sp. causes skin diseases such as pityriasis versicolor, folliculitis, and atopic dermatitis. The present study aims to evaluate the antifungal activity of J. sambac or Arabian jasmine, a flowering plant abundant in the Southeast Asia against Malassezia sp. using disc diffusion and broth microdilution method. The methanol extract and essential oil from the flowers and leaves of J. sambac were, respectively, prepared using solvent extraction and hydrodistillation process. Skin samples from individuals with dandruff were cultured on Sabouraud dextrose agar overlaid with olive oil. The fungi that grew were observed microscopically, tested with Tween assimilation test, and cultured on CHROMagar (the chromogenic media pioneer to identify Malassezia sp. Out of 5 skin samples, only 2 Malassezia sp. isolates were identified based on morphology and their ability to assimilate Tween. The inhibition zones of methanol extract of flowers and leaves of J. sambac and essential oil of flowers showed potential for antifungal activity with inhibition zones of 11.10 ± 1.92, 12.90 ± 1.68, and 13.06 ± 0.26 mm, respectively, and minimum inhibitory concentration (MIC values of 80 mg/mL to 160 mg/mL and 50%, respectively. In conclusion, J. sambac may be used as an alternative treatment against Malassezia-associated skin infections.

  11. SP-A-enriched surfactant for treatment of rat lung transplants with SP-A deficiency after storage and reperfusion

    NARCIS (Netherlands)

    Erasmus, ME; Hofstede, GJH; Petersen, AH; Batenburg, JJ; Haagsman, HP; Oetomo, SB; Prop, J


    Background. The function of pulmonary surfactant is affected by lung transplantation, contributing to impaired lung transplant function. A decreased amount of surfactant protein-A (SP-A) after reperfusion is believed to contribute to the impaired surfactant function. Surfactant treatment has been

  12. Effect of Indigenous Pseudomonas sp. and Bacillus sp. Strains on Yield and Main Chemical Growth Parameters of Radicchio

    Directory of Open Access Journals (Sweden)

    Stanojković-Sebić Aleksandra


    Full Text Available Pseudomonas sp. and Bacillus sp. belong to plant growth promoting rhizobacteria which are able to colonize the plants roots and stimulate growth. In this study, the effect of two indigenous plant growth promoting rhizobacterial strains Pseudomonas sp. Q4 and Bacillus sp. Q10 and their mixture (mix Q4+Q10 on content of the main chemical growth parameters (nitrogen, phosphorus, potassium, calcium and magnesium and the yield of dry biomass of radicchio (Cichorium spp. var. rossa di treviso aerial parts and root, was investigated. The study was carried out with stagnosol type of soil in pot experiments under semi-controlled conditions in the Institute of Soil Science (Belgrade, in the period from July to October in 2013. Phosphorus was determined by spectrophotometer, potassium - by flame emission photometry and total nitrogen and carbon - using elemental CNS analyzer, while calcium and magnesium were determined by AAS. The data on yield of both aerial parts and root dry biomass of radicchio showed that its treatment with Q4 and Q10 strains, as well as with their mixture, caused noticeably increase in this parameter in relation to the control, whereby the strain Q4 was more effective for aerial parts, while mix Q4+Q10 - for roots. The obtained data on the studied chemical parameters of radicchio root and aerial parts were in total accordance with their yield. Concluding, studied strains have a potential in promoting the biomass yield and main chemical growth parameters of both aerial parts and root of radicchio.

  13. Evaluation of Culture Conditions to Obtain Fatty Acids from Saline Microalgae Species: Dunaliella salina, Sinecosyfis sp., and Chroomonas sp.

    Directory of Open Access Journals (Sweden)

    D. A. Castilla Casadiego


    Full Text Available The use of the saline microalgae, Dunaliella salina, Sinecosyfis sp., and Chroomonas sp., was explored as an alternative source for the production of fatty acids using fertilizer and glycerol as culture media. The nutrient medium used contained “Nutrifoliar,” a commercial fertilizer, and/or glycerol, in natural sea water. The microalgae were placed in cultures with different conditions. The parameters that favored the largest production of fatty acids were 24 hours of agitation and illumination, 1620 L/day of air supply, 2.25 L of air/min, and a temperature of 32°C using “Nutrifoliar” as the culture media. Results indicated that, from 3 g of microalgae in wet base of Chroomonas sp., 54.43 mg of oil was produced. The chromatographic characterization of oil obtained revealed the presence of essential fatty acids such as 9,12,15-octadecatrienoic acid (omega-3 and 4,7,10-hexadecatrienoic acid (omega-6 from the species Dunaliella salina. On the other hand, 9,12-octadecadienoic acid (omega-6 and cis-11-eicosenoic acid (omega-9 were identified from the species Chroomonas sp. The temperature variations played an important role in the velocity of growth or the production of the algae biomass, the amount of oil, and the ability to produce fatty acids.

  14. Ocorrência de Babesia sp em pequenos roedores no Brasil Occurrence of Babesia sp in small rodents in Brazil

    Directory of Open Access Journals (Sweden)

    G.S. Gazeta


    Full Text Available Foi analisada a ocorrência de babesiose em pequenos roedores nos municípios de Silva Jardim e Nova lguaçu, Estado do Rio de Janeiro. Foram capturados 44 roedores de seis espécies diferentes e entre eles a prevalência da infecção foi de 27,3%. Rattus norvegicus foi considerado o principal reservatório (50,0% e Oligoryzomys nigripes como novo hospedeiro para Babesia sp. Este foi o primeiro relato de Babesia sp. em roedores no Brasil. A freqüência de roedores positivos e o risco de infecção dos roedores não diferiram entre as áreas estudadas.The occurrence of babesiosis was studied in 44 small rodents of six species captured in Silva Jardim and Nova lguaçu counties, State of Rio de Janeiro, Brazil. The prevalence of injection was 27.3%. Rattus norvegicus was considered as the main reservoir and Oligoryzomys nigripes as a new host to Babesia sp. The frequency and the risk of rodent infection were considered equal among the studied areas. This is the first report of Babesia sp in small rodents in Brazil.

  15. Serum-surfactant SP-D correlates inversely to lung function in cystic fibrosis

    DEFF Research Database (Denmark)

    Olesen, Hanne Vebert; Holmskov, Uffe; Schiøtz, Peter Oluf


    BACKGROUND: Cystic fibrosis (CF) affects the lungs causing infections and inflammation. Surfactant protein D (SP-D) is an innate defense lectin primarily secreted in the lungs. We investigated the influence of the SP-D Met11Thr polymorphism on CF lung function; and serum SP-D as a marker for CF...

  16. Symbiotic Hydrogenase Activity in Bradyrhizobium sp. (Vigna) Increases Nitrogen Content in Vigna unguiculata Plants (United States)

    Baginsky, Cecilia; Brito, Belén; Imperial, Juan; Ruiz-Argüeso, Tomás; Palacios, Jose M.


    Bradyrhizobium sp. (Lupinus) and Bradyrhizobium sp. (Vigna) mutants in which hydrogenase (hup) activity was affected were constructed and analyzed. Vigna unguiculata plants inoculated with the Bradyrhizobium sp. (Vigna) hup mutant showed reduced nitrogenase activity and also a significant decrease in nitrogen content, suggesting a relevant contribution of hydrogenase activity to plant yield. PMID:16269797

  17. Sphyrna gilberti sp. nov., a new hammerhead shark (Carcharhiniformes, Sphyrnidae) from the western Atlantic Ocean. (United States)

    Quattro, Joseph M; Driggers, William B; Grady, James M; Ulrich, Glenn F; Roberts, Mark A


    Sphyrna gilberti sp. nov. is described based on 54 specimens collected in the coastal waters of South Carolina, U.S.A. Morphologically, S. gilberti sp. nov. is separable from S. lewini (Griffith & Smith 1834) only in the number of precaudal vertebrae. Due to rarity of specimens and the highly migratory behavior of most sphyrnids, the range of S. gilberti sp. nov. is unknown.

  18. Major metabolites from Monostroma sp. and Porphyra vietnamensis Tan. et. Ho

    Digital Repository Service at National Institute of Oceanography (India)

    Jagtap, T.G.

    in Monostroma sp. Total calorific value of P. vietnamensis was observed to be 3164 cal/g (ash free dry weight) while that of Monostroma sp. was 1941 cal/g (ash free dry weight). C:N ratio was found lower (13.7) in P. vietnamensis than in Monostroma sp. (16.6%)...

  19. The dynamics of the fungal aerospores Alternaria sp. and Cladosporium sp. in Parisian atmospheric air, in France (United States)

    Brezoczki, V. M.


    The bioallergens occurring naturally in the atmospheric air are microorganisms, pollen grains, plant seeds, leaf and stem scrap, or their protein molecules. The presence of various airborne fungal spores determines a high allergenic potential for public health. This effect is due to the high number of produced spores, which under favourable meteorological conditions (dry weather and wind) reach the surrounding air. This paper traces the dynamics of two types of fungi, Alternaria sp and Cladosporium sp, fungi which can be found outdoors, in the surrounding air, as well as indoors, inside houses (especially the conidia of Cladosporium sp). The effects of these fungal spores on human health are varies, ranging from seasonal allergies (hay fever, rhinitis, sinusitis etc.) to sever afflictions of the respiratory system, onset of asthma, disfunctionalities of the nervous systems, of the immune system, zymoses etc. The monitoring of the dynamics of the aerospores Alternaria sp and Cladosporium sp was carried out between 2010 and 2013, over a period of 42 weeks during one calendar year, from February to the end of September, in the surrounding air in the French capital, Paris. The regional and global climate and meteorological conditions are directly involved in the occurrence and development of fungi colonies, the transportation and dispersion of fungal spores in the atmospheric air, as well as in the creation of the environment required for the interaction of chemical and biological components in the air. Knowledge of the dynamics of the studied fungal aerospores, coupled with climate and meteorological changes, offers a series of information on the magnitude of the allergenic potential these airborne spores can determine. Legal regulations in this domain set the allergen risk threshold for the Alternaria sp aerospores at 3500 ÷ 7000 spores/m3 air/week, and for the Cladosporium sp aerospores at 56,000 spores/m3 air/week. Besides these regulations there exist a series of

  20. Marinobacter salarius sp. nov. and Marinobacter similis sp. nov., isolated from sea water.

    Directory of Open Access Journals (Sweden)

    Hooi Jun Ng

    Full Text Available Two non-pigmented, motile, Gram-negative marine bacteria designated R9SW1T and A3d10T were isolated from sea water samples collected from Chazhma Bay, Gulf of Peter the Great, Sea of Japan, Pacific Ocean, Russia and St. Kilda Beach, Port Phillip Bay, the Tasman Sea, Pacific Ocean, respectively. Both organisms were found to grow between 4 °C and 40 °C, between pH 6 to 9, and are moderately halophilic, tolerating up to 20% (w/v NaCl. Both strains were found to be able to degrade Tween 40 and 80, but only strain R9SW1T was found to be able to degrade starch. The major fatty acids were characteristic for the genus Marinobacter including C16:0, C16:1ω7c, C18:1ω9c and C18:1ω7c. The G+C content of the DNA for strains R9SW1T and A3d10T were determined to be 57.1 mol% and 57.6 mol%, respectively. The two new strains share 97.6% of their 16S rRNA gene sequences, with 82.3% similarity in the average nucleotide identity (ANI, 19.8% similarity in the in silico genome-to-genome distance (GGD, 68.1% similarity in the average amino acid identity (AAI of all conserved protein-coding genes, and 31 of the Karlin's genomic signature dissimilarity. A phylogenetic analysis showed that R9SW1T clusters with M. algicola DG893T sharing 99.40%, and A3d10T clusters with M. sediminum R65T sharing 99.53% of 16S rRNA gene sequence similarities. The results of the genomic and polyphasic taxonomic study, including genomic, genetic, phenotypic, chemotaxonomic and phylogenetic analyses based on the 16S rRNA, gyrB and rpoD gene sequence similarities, the analysis of the protein profiles generated using MALDI-TOF mass spectrometry, and DNA-DNA relatedness data, indicated that strains R9SW1T and A3d10(T represent two novel species of the genus Marinobacter. The names Marinobacter salarius sp. nov., with the type strain R9SW1(T ( =  LMG 27497(T  =  JCM 19399(T  =  CIP 110588(T  =  KMM 7502(T and Marinobacter similis sp. nov., with the type strain A3d10(T (

  1. Population-based laboratory surveillance for Giardia sp. and Cryptosporidium sp. infections in a large Canadian health region

    Directory of Open Access Journals (Sweden)

    Laupland Kevin B


    Full Text Available Abstract Background Giardia lamblia (intestinalis and Cryptosporidium parvum are the two most important intestinal parasites infecting North Americans but there is a paucity of active population-based surveillance data from Canada. This study determined the incidence of and demographic risk factors for developing Giardia sp. and Cryptosporidium sp. infections in a general Canadian population. Methods Population-based laboratory surveillance was conducted among all residents of the Calgary Health Region (CHR; population ≅ 1 million during May 1, 1999 and April 30, 2002. Results Giardia sp. infection occurred at a rate of 19.6 per 100,000 populations per year. Although the yearly incidence was stable, a significant seasonal variation was observed with a peak in late summer to early fall. Males were at higher risk for development of this infection as compared to females (21.2 vs. 17.9 per 100,000/yr; relative risk (RR 1.19; 95% confidence interval (CI, 1.00–1.40, p = 0.047, and there was a significant decrease in risk associated with an increasing age. Cryptosporidium sp. infection occurred at an overall rate of 6.0 per 100,000 populations per year although a large outbreak of Cryptosporidium sp. infections occurred in the second half of the summer of 2001. During August and September of 2001, the incidence of cryptosporidiosis was 55.1 per 100,000 per year as compared to 3.1 per 100,000 per year for the remainder of the surveillance period (p Conclusion This study provides important information on the occurrence and demographic risk groups for acquisition of giardiasis and cryptosporidiosis in a non-selected Canadian population.

  2. Rhipidocotyle gibsoni n. sp. from a Brazilian Freshwater Fish and Rhipidocotyle froesi n.sp. for r. baculum (linton, 1905 of Eckmann (1932 (Bucephalidae; Digenea

    Directory of Open Access Journals (Sweden)

    Anna Kohn


    Full Text Available Rhipidocotyle gibsoni n.sp. is described from Acestrorhynchus lacustris from Paraná River, brazil. It is most closely related to r. froesi n. sp. and to R. eckmanni in the shape of the cephalic hood, differing in the extent of the uterus, in the position of the vitelline follicles and in that the host is a freshwater fish. Rhipidocotyle froesi n. sp. is proposed for the marine specimens described by Eckmann (1932 as R. baculum (Linton, 1905.

  3. Sp1 is essential for p16 expression in human diploid fibroblasts during senescence.

    Directory of Open Access Journals (Sweden)

    Junfeng Wu

    Full Text Available BACKGROUND: p16(INK4a tumor suppressor protein has been widely proposed to mediate entrance of the cells into the senescent stage. Promoter of p16(INK4a gene contains at least five putative GC boxes, named GC-I to V, respectively. Our previous data showed that a potential Sp1 binding site, within the promoter region from -466 to -451, acts as a positive transcription regulatory element. These results led us to examine how Sp1 and/or Sp3 act on these GC boxes during aging in cultured human diploid fibroblasts. METHODOLOGY/PRINCIPAL FINDINGS: Mutagenesis studies revealed that GC-I, II and IV, especially GC-II, are essential for p16(INK4a gene expression in senescent cells. Electrophoretic mobility shift assays (EMSA and ChIP assays demonstrated that both Sp1 and Sp3 bind to these elements and the binding activity is enhanced in senescent cells. Ectopic overexpression of Sp1, but not Sp3, induced the transcription of p16(INK4a. Both Sp1 RNAi and Mithramycin, a DNA intercalating agent that interferes with Sp1 and Sp3 binding activities, reduced p16(INK4a gene expression. In addition, the enhanced binding of Sp1 to p16(INK4a promoter during cellular senescence appeared to be the result of increased Sp1 binding affinity, not an alteration in Sp1 protein level. CONCLUSIONS/SIGNIFICANCE: All these results suggest that GC- II is the key site for Sp1 binding and increase of Sp1 binding activity rather than protein levels contributes to the induction of p16(INK4a expression during cell aging.


    Guliy, O I; Karavaeva, O A; Velikov, V A; Sokolov, O I; Pavily, S A; Larionova, O S; Burov, A M; Ignatov, O V


    The bacteriophage ΦAb-Sp7 was isolated from the cells of the Azospirillum brasilense Sp7. The morphology, size of the gram-negative colonies, and range of lytic activity against other strains and species of the genus Azospirillum was tested. The isolated phage DNA was examined using electrophoretic and restriction analysis, and the size of the genome were established. The electron microscopy. resuIts show that the phage (capsid) has a strand-like form. The electron microscopy study of the bacteriophage ΦAb-Sp7 adsorption on the A. brasilense Sp7 bacterial surface was performed.

  5. Effect of Mycobacterium sp. strain CH1 and mycobacterium sp. strain CH2 on the degradation of four-ring creosote compounds. (United States)

    Harper, Jennifer Paige; Churchill, Perry F; Lokey-Flippo, Laura; Lalor, Melinda M


    The influence of nutrients, Mycobacterium sp. strain CH1 and Mycobacterium sp. strain CH2 on the degradation of aged creosote hydrocarbon contaminants was investigated. The Mycobacterium sp. strain CH2 showed the highest positive influence on the degradation of three- and four-ring PAH compounds. The addition of Mycobacterium sp. strain CH1 had the second highest measured positive influence on the degradation of four-ring compounds. Soluble nitrogen and phosphorus also increased the degradation of aged creosote compounds in the contaminated soil. The addition of bacteria decreased the number of measured bacterial species, indicating competition for limited nutrients in the soil.

  6. Average nucleotide identity of genome sequences supports the description of Rhizobium lentis sp. nov., Rhizobium bangladeshense sp. nov. and Rhizobium binae sp. nov. from lentil (Lens culinaris) nodules. (United States)

    Rashid, M Harun-or; Young, J Peter W; Everall, Isobel; Clercx, Pia; Willems, Anne; Santhosh Braun, Markus; Wink, Michael


    Rhizobial strains isolated from effective root nodules of field-grown lentil (Lens culinaris) from different parts of Bangladesh were previously analysed using sequences of the 16S rRNA gene, three housekeeping genes (recA, atpD and glnII) and three nodulation genes (nodA, nodC and nodD), DNA fingerprinting and phenotypic characterization. Analysis of housekeeping gene sequences and DNA fingerprints indicated that the strains belonged to three novel clades in the genus Rhizobium. In present study, a representative strain from each clade was further characterized by determination of cellular fatty acid compositions, carbon substrate utilization patterns and DNA-DNA hybridization and average nucleotide identity (ANI) analyses from whole-genome sequences. DNA-DNA hybridization showed 50-62% relatedness to their closest relatives (the type strains of Rhizobium etli and Rhizobium phaseoli) and 50-60% relatedness to each other. These results were further supported by ANI values, based on genome sequencing, which were 87-92% with their close relatives and 88-89% with each other. On the basis of these results, three novel species, Rhizobium lentis sp. nov. (type strain BLR27(T) = LMG 28441(T) = DSM 29286(T)), Rhizobium bangladeshense sp. nov. (type strain BLR175(T) = LMG 28442(T) = DSM 29287(T)) and Rhizobium binae sp. nov. (type strain BLR195(T) = LMG 28443(T) = DSM 29288(T)), are proposed. These species share common nodulation genes (nodA, nodC and nodD) that are similar to those of the symbiovar viciae.

  7. Identification of Acetobacter strains isolated from Indonesian sources, and proposals of Acetobacter syzygii sp. nov., Acetobacter cibinongensis sp. nov., and Acetobacter orientalis sp. nov. (United States)

    Lisdiyanti, Puspita; Kawasaki, Hiroko; Seki, Tatsuji; Yamada, Yuzo; Uchimura, Tai; Komagata, Kazuo


    Forty-six strains of acetic acid bacteria newly isolated from flowers, fruits, and fermented foods collected in Indonesia were taxonomically studied. They were Gram-negative rods, produced acetic acid from ethanol, oxidized acetate and lactate to CO(2) and H(2)O, and had Q-9 as the major ubiquinone system. On the basis of DNA-DNA similarity, all strains studied, including type strains and reference strains of the genus Acetobacter, were separated into eleven groups (Groups I to XI). Of the 46 isolates, two isolates were included in Group II and identified as Acetobacter pasteurianus, five in Group IV as A. orleanensis, 16 in Group V as A. lovaniensis, five in Group VII as A. indonesiensis, and three in Group VIII as A. tropicalis. The remaining 15 isolates constituted three new groups based on DNA-DNA similarity; four isolates were included in Group IX, two in Group X, and nine in Group XI. No isolates were identified as A. aceti (Group I), A. peroxydans (Group III), and A. estunensis (Group VI). Phylogenetic analysis based on 16S rDNA sequences of representative strains of the Groups indicated belonging to the strains of the genus Acetobacter. On the basis of DNA base composition, DNA-DNA similarity, and 16S rDNA sequences, three new species of the genus Acetobacter are proposed: Acetobacter syzygii sp. nov. for Group IX, Acetobacter cibinongensis sp. nov. for Group X, and Acetobacter orientalis sp. nov. for Group XI. The distribution of Acetobacter strains in Indonesia is discussed in light of isolation sources.

  8. Acetobacter okinawensis sp. nov., Acetobacter papayae sp. nov., and Acetobacter persicus sp. nov.; novel acetic acid bacteria isolated from stems of sugarcane, fruits, and a flower in Japan. (United States)

    Iino, Takao; Suzuki, Rei; Kosako, Yoshimasa; Ohkuma, Moriya; Komagata, Kazuo; Uchimura, Tai


    Eleven strains of acetic acid bacteria were isolated from stems of sugarcane, fruits, and a flower in Japan. The isolates were separated into three groups, Groups I, II, and III, in the genus Acetobacter according to phylogenetic analysis based on 16S rRNA sequences. The isolates had sequence similarities of 99.8-100% within the Group, 99.3-99.6% to those of the type strains of each related Acetobacter species, and less than 98.4% to those of the type strains of other Acetobacter species. Genomic DNA G+C contents of Groups I, II, and III were 59.2-59.4, 60.5-60.7, and 58.7-58.9 mol%, respectively. The isolates in the Group showed high values of DNA-DNA relatedness to each other, but low values less than 46% to the type strains of related Acetobacter species. A good correlation was found between the three Groups and groups based on DNA G+C contents and DNA-DNA relatedness. All the strains had Q-9 as the main component, and Q-8 and Q-10 as minor components. The isolates in the three Groups did not completely match with any Acetobacter species on catalase reaction, the production of ketogluconic acids from D-glucose, growth on ammoniac nitrogen with ethanol (Hoyer-Frateur medium and Frateur modified Hoyer medium), growth on 30% (w/v) D-glucose, growth in 10% (v/v) ethanol, or DNA G+C contents. On the basis of phylogenetic relationships in the genus Acetobacter and chemosystematic and phenotypic characteristics, the three Groups were regarded as novel species in the genus Acetobacter. Acetobacter okinawensis sp. nov. is proposed for Group I, Acetobacter papayae sp. nov. for Group II, and Acetobacter persicus sp. nov. for Group III.

  9. Adsorption of procion red and congo red dyes using microalgae Spirulina sp

    Directory of Open Access Journals (Sweden)

    Risfidian Mohadi


    Full Text Available Adsorption of procion red and congo red dyes using microalgae Spirulina sp was conducted. Spirulina sp was obtained by cultivation and production in laboratory scale. Spirulina sp was used as adsorbent for adsorption of dyes. Adsorption process was studied by kinetic and thermodynamic in order to know the adsorption phenomena. The results showed that kinetically congo red is reactive than procion red on Spirulina sp. On the other hand, thermodynamically procion red was stable than congo red on Spirulina sp which was indicated by adsorption capacity, enthalpy, and entropy.

  10. Molecular Phylogeny and Surface Morphology of Thiriotia hyperdolphinae n. sp. and Cephaloidophora oradareae n. sp. (Gregarinasina, Apicomplexa) Isolated from a Deep Sea Oradarea sp. (Amphipoda) in the West Pacific. (United States)

    Wakeman, Kevin C; Yabuki, Akinori; Fujikura, Katsunori; Tomikawa, Ko; Horiguchi, Takeo


    In an effort to broaden our understanding of the biodiversity and distribution of gregarines infecting crustaceans, this study describes two new species of gregarines, Thiriotia hyperdolphinae n. sp. and Cephaloidophora oradareae n. sp., parasitizing a deep sea amphipod (Oradarea sp.). Amphipods were collected using the ROV Hyper-Dolphin at a depth of 855 m while on a cruise in Sagami Bay, Japan. Gregarine trophozoites and gamonts were isolated from the gut of the amphipod and studied with light and scanning electron microscopy, and phylogenetic analysis of 18S rDNA. Thiriotia hyperdolphinae n. sp. was distinguished from existing species based on morphology, phylogenetic position, as well as host niche and geographic locality. Cephaloidophora oradareae n. sp. distinguished itself from existing Cephaloidophora, based on a difference in host (Oradarea sp.), geographic location, and to a certain extent morphology. We established this latter new species with the understanding that a more comprehensive examination of diversity at the molecular level is necessary within Cephaloidophora. Results from the 18S rDNA molecular phylogeny showed that T. hyperdolphinae n. sp. was positioned within a clade consisting of Thiriotia spp., while C. oradareae n. sp. grouped within the Cephaloidophoridae. Still, supplemental genetic information from gregarines infecting crustaceans will be needed to better understand relationships within this group of apicomplexans. © 2017 The Author(s) Journal of Eukaryotic Microbiology © 2017 International Society of Protistologists.

  11. Preparation of {sup 99m}Tc labeled substance P (SP)

    Energy Technology Data Exchange (ETDEWEB)

    Ozker, S.K. E-mail:; Hellman, Robert S.; Krasnow, Arthur Z


    Substance P (SP) is an ll-amino acid neuropeptide of the tachykinin family. This study investigated the preparation of an SP analog labeled with {sup 99m}Tc for imaging SP receptor positive tissue (inflammatory diseases and neoplasms with increased expression of SP receptors). High specific activity {sup 99m}Tc-SP was prepared using the 1-imino-4-mercaptobutyl (IMB) group as a bifunctional chelator. Biological distribution in mice showed increased {sup 99m}Tc-SP uptake in the salivary glands (which have a high concentration of SP receptors), but this activity was displaced in animals pre-treated with excess non-radioactive SP. These data show that the uptake of {sup 99m}Tc-SP is receptor specific. IMB derivatization at the N-terminal location is suitable for labeling of SP analogues with {sup 99m}Tc. Synthetic analogues of SP labeled with {sup 99m}Tc may be an attractive alternative to {sup 111}In labeled molecules and merit further investigation.

  12. Characterization of diazotrophic bacteria non-symbiotic associated with eucalyptus (eucalyptus sp.) in Codazzi, Cesar (Colombia)

    International Nuclear Information System (INIS)

    Obando Castellanos, Dolly Melissa; Burgos Zabala, Ludy Beatriz; Rivera Botia, Diego Mauricio; Rubiano Garrido, Maria Fernanda; Divan Baldini, Vera Lucia; Bonilla Buitrago, Ruth Rebeca


    The effect of climatic seasons (rainy and dry) and the stratum sample (rhizospheric soil, roots and leaves) the population of the genera Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter and Burkholderia in soil rhizosphere, roots and leaves of eucalyptus (eucalyptus sp.). It also assesses their ability to produce indoles compounds as plant growth promoters and their acetylene reduction activity as an indicator of biological fixation of nitrogen. The results showed no statistically significant differences in the Duncan test (p ≤ 0.05) in the population with respect to the climate epoch, suggesting that these bacteria are able to tolerate stress conditions by different physiological mechanisms. With respect to the stratum sample isolates attempts of Herbaspirillum sp. and Azospirillum sp. significant differences in rhizospheric soil and roots. we obtained 44 isolates of which were grouped by phenotypic characterization as 14 suspected of Beijerinckia sp., 12 Azotobacter sp., 8 Derxia sp., 4 Herbaspirillum sp., 5 Azospirillum sp., 1 Gluconacetobacter sp. and 1 Burkholderia sp. due to their high potential were selected isolates C27, C26 and C25. These four strains present the best values of efficiency in vitro, exceeding production values of the reference strains used (A. chroococcum (AC1) and a. brasilense (SP7)).

  13. Novel cyclohexane monooxygenase from Acidovorax sp. CHX100. (United States)

    Salamanca, Diego; Karande, Rohan; Schmid, Andreas; Dobslaw, Daniel


    Acidovorax sp. CHX100 has a remarkable ability for growth on short cycloalkanes (C5-C8) as a sole source of carbon and energy under aerobic conditions via an uncharacterized mechanism. Transposon mutagenesis of Acidovorax sp. CHX100 revealed a novel cytochrome P450 monooxygenase (CYP450chx) which catalyzed the transformation of cyclohexane to cyclohexanol. Primer walking methods categorized CYP450chx as cytochrome P450 class I taking into account its operon structure: monooxygenase, FAD oxidoreductase, and ferredoxin. CYP450chx was successfully cloned and expressed in Escherichia coli JM109. The activity of CYP450chx was demonstrated by means of the indole co-oxidation. Biotransformation capability of CYP450chx was confirmed through the catalysis of cycloalkanes (C5-C8) to their respective cyclic alcohols.

  14. Primary loop simulation of the SP-100 space nuclear reactor

    Energy Technology Data Exchange (ETDEWEB)

    Borges, Eduardo M.; Braz Filho, Francisco A.; Guimaraes, Lamartine N.F., E-mail: eduardo@ieav.cta.b, E-mail: fbraz@ieav.cta.b, E-mail: guimarae@ieav.cta.b [Instituto de Estudos Avancados (IEAv/DCTA) Sao Jose dos Campos, SP (Brazil)


    Between 1983 and 1992 the SP-100 space nuclear reactor development project for electric power generation in a range of 100 to 1000 kWh was conducted in the USA. Several configurations were studied to satisfy different mission objectives and power systems. In this reactor the heat is generated in a compact core and refrigerated by liquid lithium, the primary loops flow are controlled by thermoelectric electromagnetic pumps (EMTE), and thermoelectric converters produce direct current energy. To define the system operation point for an operating nominal power, it is necessary the simulation of the thermal-hydraulic components of the space nuclear reactor. In this paper the BEMTE-3 computer code is used to EMTE pump design performance evaluation to a thermalhydraulic primary loop configuration, and comparison of the system operation points of SP-100 reactor to two thermal powers, with satisfactory results. (author)

  15. Algoritmi un heiristikas spēlei Rendzju


    Firjans, Aleksandrs


    Šī darba mērķis ir Mākslīga Intelekta nodaļas divu spēlētāju spēles pētīšana Rendzju piemērā. Darbā ir aprakstīti alfa-beta un uzvārējošas bīstamības secības meklēšanas algoritms un dažādas heiristikas , lai paātrināt algoritmu darbību un novērtēt pozīciju. Šie algoritmi ir realizēti manā programmā.

  16. Transformation of 3-chlorodibenzofuran by Pseudomonas sp. HH69. (United States)

    Harms, H; Wilkes, H; Sinnwell, V; Wittich, R M; Figge, K; Francke, W; Fortnagel, P


    The dibenzofuran-degrading bacterial strain Pseudomonas sp. HH69 showed high oxidative activity towards 3-chlorodibenzofuran (3CDF). During the co-metabolic turnover of 3CDF large amounts of 4-chlorosalicylate and temporarily small amounts of salicylate were excreted. Simultaneously a yellow colour appeared due to the excretion of two polar products. Conversion of 3CDF by a mutant, derived from Pseudomonas sp. HH69 and defective in 2,3-dihydroxybiphenyl-1,2-dioxygenase led to the formation of equal quantities of 4'-chloro-2,2',3-trihydroxybiphenyl (4'CTHBP) and 4-chloro-2,2',3-trihydroxybiphenyl (4CTHBP). Crude extracts of the wild type transformed 4'CTHBP to 4-chlorosalicylate, whilst 4CTHBP was transformed to salicylate. Hence, we propose a non-selective initial attack on both aromatic rings of 3CDF and a degradative pathway for the resulting chlorotrihydroxybiphenyls.

  17. Complete genome sequence of Paenibacillus sp. strain JDR-2 (United States)

    Chow, Virginia; Nong, Guang; St. John, Franz J.; Rice, John D.; Dickstein, Ellen; Chertkov, Olga; Bruce, David; Detter, Chris; Brettin, Thomas; Han, James; Woyke, Tanja; Pitluck, Sam; Nolan, Matt; Pati, Amrita; Martin, Joel; Copeland, Alex; Land, Miriam L.; Goodwin, Lynne; Jones, Jeffrey B.; Ingram, Lonnie O.; Shanmugam, Keelnathan T.; Preston, James F.


    Paenibacillus sp. strain JDR-2, an aggressively xylanolytic bacterium isolated from sweetgum (Liquidambar styraciflua) wood, is able to efficiently depolymerize, assimilate and metabolize 4-O-methylglucuronoxylan, the predominant structural component of hardwood hemicelluloses. A basis for this capability was first supported by the identification of genes and characterization of encoded enzymes and has been further defined by the sequencing and annotation of the complete genome, which we describe. In addition to genes implicated in the utilization of β-1,4-xylan, genes have also been identified for the utilization of other hemicellulosic polysaccharides. The genome of Paenibacillus sp. JDR-2 contains 7,184,930 bp in a single replicon with 6,288 protein-coding and 122 RNA genes. Uniquely prominent are 874 genes encoding proteins involved in carbohydrate transport and metabolism. The prevalence and organization of these genes support a metabolic potential for bioprocessing of hemicellulose fractions derived from lignocellulosic resources. PMID:22675593

  18. Professional ASPNET 35 SP1 Edition In C# and VB

    CERN Document Server

    Evjen, Bill; Rader, Devin


    Professional ASP.NET 3.5 SP1 In C# and VB. ASP.NET 3.5 brings the power of Visual Studio® 2008 along with the multitude of language improvements in C# 2008 and Visual Basic® 2008 as well as powerful new technology called LINQ, together with the ASP.NET 2.0 Framework you already know and love. Packed with valuable coverage of ASP.NET 3.5 SP1, this essential resource offers both C# and VB examples throughout the book, and shares new and updated content on the ADO.NET Entity Framework, ADO.NET Dynamic Data, and ADO.NET Data Services. While ASP.NET 3.5 boasts server controls like the ListView and

  19. Primary loop simulation of the SP-100 space nuclear reactor

    International Nuclear Information System (INIS)

    Borges, Eduardo M.; Braz Filho, Francisco A.; Guimaraes, Lamartine N.F.


    Between 1983 and 1992 the SP-100 space nuclear reactor development project for electric power generation in a range of 100 to 1000 kWh was conducted in the USA. Several configurations were studied to satisfy different mission objectives and power systems. In this reactor the heat is generated in a compact core and refrigerated by liquid lithium, the primary loops flow are controlled by thermoelectric electromagnetic pumps (EMTE), and thermoelectric converters produce direct current energy. To define the system operation point for an operating nominal power, it is necessary the simulation of the thermal-hydraulic components of the space nuclear reactor. In this paper the BEMTE-3 computer code is used to EMTE pump design performance evaluation to a thermalhydraulic primary loop configuration, and comparison of the system operation points of SP-100 reactor to two thermal powers, with satisfactory results. (author)

  20. Complete genome sequence of Paenibacillus sp. strain JDR-2

    Energy Technology Data Exchange (ETDEWEB)

    Chow, Virginia [University of Florida; Nong, Guang [University of Florida; St. John, Franz J. [US Forest Service, Forest Products Laboratory, Madison, Wisconsin, USA; Dickstein, Ellen [University of Florida; Chertkov, Olga [Los Alamos National Laboratory (LANL); Bruce, David [Los Alamos National Laboratory (LANL); Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Brettin, Thomas S [ORNL; Han, James [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Martin, Joel [U.S. Department of Energy, Joint Genome Institute; Copeland, A [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Jones, Jeffrey B. [University of Florida; Ingram, Lonnie O. [University of Florida; Shanmugam, Keelnathan T. [University of Florida; Preston, James F. [University of Florida


    Paenibacillus sp. strain JDR-2, an aggressively xylanolytic bacterium isolated from sweetgum (Liquidambar styraciflua) wood, is able to efficiently depolymerize, assimilate and metabolize 4-O-methylglucuronoxylan, the predominant structural component of hardwood hemicelluloses. A basis for this capability was first supported by the identification of genes and characterization of encoded enzymes and has been further defined by the sequencing and annotation of the complete genome, which we describe. In addition to genes implicated in the utilization of -1,4-xylan, genes have also been identified for the utilization of other hemicellulosic polysaccharides. The genome of Paenibacillus sp. JDR-2 contains 7,184,930 bp in a single replicon with 6,288 protein-coding and 122 RNA genes. Uniquely prominent are 874 genes encoding proteins involved in carbohydrate transport and metabolism. The prevalence and organization of these genes support a metabolic potential for bioprocessing of hemicellulose fractions derived from lignocellulosic resources.

  1. Complete genome sequence of Paenibacillus sp. strain JDR-2. (United States)

    Chow, Virginia; Nong, Guang; St John, Franz J; Rice, John D; Dickstein, Ellen; Chertkov, Olga; Bruce, David; Detter, Chris; Brettin, Thomas; Han, James; Woyke, Tanja; Pitluck, Sam; Nolan, Matt; Pati, Amrita; Martin, Joel; Copeland, Alex; Land, Miriam L; Goodwin, Lynne; Jones, Jeffrey B; Ingram, Lonnie O; Shanmugam, Keelnathan T; Preston, James F


    Paenibacillus sp. strain JDR-2, an aggressively xylanolytic bacterium isolated from sweetgum (Liquidambar styraciflua) wood, is able to efficiently depolymerize, assimilate and metabolize 4-O-methylglucuronoxylan, the predominant structural component of hardwood hemicelluloses. A basis for this capability was first supported by the identification of genes and characterization of encoded enzymes and has been further defined by the sequencing and annotation of the complete genome, which we describe. In addition to genes implicated in the utilization of β-1,4-xylan, genes have also been identified for the utilization of other hemicellulosic polysaccharides. The genome of Paenibacillus sp. JDR-2 contains 7,184,930 bp in a single replicon with 6,288 protein-coding and 122 RNA genes. Uniquely prominent are 874 genes encoding proteins involved in carbohydrate transport and metabolism. The prevalence and organization of these genes support a metabolic potential for bioprocessing of hemicellulose fractions derived from lignocellulosic resources.

  2. Sodium pumps in the Malpighian tubule of Rhodnius sp.

    Directory of Open Access Journals (Sweden)



    Full Text Available Malpighian tubule of Rhodnius sp. express two sodium pumps: the classical ouabain-sensitive (Na+ + K+ATPase and an ouabain-insensitive, furosemide-sensitive Na+-ATPase. In insects, 5-hydroxitryptamine is a diuretic hormone released during meals. It inhibits the (Na+ + K+ATPase and Na+ -ATPase activities indicating that these enzymes are involved in fluid secretion. Furthermore, in Rhodnius neglectus, proximal cells of Malpighian tubule exposed to hyperosmotic medium, regulate their volume through a mechanism called regulatory volume increase. This regulatory response involves inhibition of the (Na+ + K+ATPase activity that could lead to accumulation of active osmotic solute inside the cell, influx of water and return to the normal cell volume. Adenosine, a compound produced in stress conditions, also inhibits the (Na+ + K+ATPase activity. Taken together these data indicate that (Na+ + K+ATPase is a target of the regulatory mechanisms of water and ions transport responsible for homeostasis in Rhodnius sp.

  3. The karyotype of Cathorops sp, a marine catfish from Brazil

    Directory of Open Access Journals (Sweden)

    Vicente Gomes


    Full Text Available Cathorops sp has the diploid number of 54 chromosomes. The karyotype comprises lm + sm, 6m, 6sm and 14st pairs. This result is compared with those of other species of Ariidae, mainly Ariopsis felis and Arius dussumieri, found in literature.Foram realizados estudos cromossômicos em 25 espécimens de Cathorops sp pelo método de air-drying. O número modal diplóide encontrado foi de 54 cromossomos sendo 1 par m + sm, 6 pares m, 6 pares sm e 14 pares st. Os resultados são comparados com dados da literatura referentes a cromossomos de outros ariídeos, principalmente de Ariopsis felis e Arius dussumieri.

  4. Pseudomonas matsuisoli sp. nov., isolated from a soil sample. (United States)

    Lin, Shih-Yao; Hameed, Asif; Hung, Mei-Hua; Liu, You-Cheng; Hsu, Yi-Han; Young, Li-Sen; Young, Chiu-Chung


    An aerobic, Gram-stain-negative, rod-shaped and polar-flagellated bacterium, designated strain CC-MHH0089(T), was isolated from a soil sample taken on Matsu Island (Taiwan). Strain CC-MHH0089(T) grew at 15-30 °C and pH 5.0-10.0 and tolerated ≤8 % (w/v) NaCl. 16S rRNA gene sequence analysis showed high pairwise sequence similarity to Pseudomonas azotifigens 6H33b(T) (97.3 %) and Pseudomonas balearica SP1402(T) (96.7 %) and lower sequence similarity to other strains (Pseudomonas, for which the name Pseudomonas matsuisoli sp. nov. is proposed. The type strain is CC-MHH0089(T) ( = BCRC 80771(T) = JCM 30078(T)). © 2015 IUMS.

  5. Mitochondrial genome of Boleophthalmus sp. nov. (Osteichthyes: Gobiidae). (United States)

    Zhang, Jie; Takita, Toru; Muchtar, Agusnimar; Chen, Changmao; Ishimatsu, Atsushi


    Boleophthalmus is a genus that consists of six valid species and possesses a number of specializations in terms of amphibious life. The complete mtDNA sequence of Boleophthalmus sp. nov. (17,113 bp in length) has 13 protein-coding genes, 22 tRNA genes, two rRNA genes (12S and 16 S rRNA), and one control region. By comparing the COI sequences, Boleophthalmus sp. nov. is closely related of B. pectinirostris but exhibits 8.93% genetic distance with B. pectinirostris and 13.26% with B. boddarti. This finding may fill some gaps remaining on the taxonomy and biodiversity of this taxon and contribute to the understanding of the phylogeographic relationships between the continental coast and Southeast Asia.

  6. Tongue adhesion in the horned frog Ceratophrys sp. (United States)

    Kleinteich, Thomas; Gorb, Stanislav N.


    Frogs are well-known to capture elusive prey with their protrusible and adhesive tongues. However, the adhesive performance of frog tongues and the mechanism of the contact formation with the prey item remain unknown. Here we measured for the first time adhesive forces and tongue contact areas in living individuals of a horned frog (Ceratophrys sp.) against glass. We found that Ceratophrys sp. generates adhesive forces well beyond its own body weight. Surprisingly, we found that the tongues adhered stronger in feeding trials in which the coverage of the tongue contact area with mucus was relatively low. Thus, besides the presence of mucus, other features of the frog tongue (surface profile, material properties) are important to generate sufficient adhesive forces. Overall, the experimental data shows that frog tongues can be best compared to pressure sensitive adhesives (PSAs) that are of common technical use as adhesive tapes or labels.

  7. Bioactive Compounds of Edible Purple Laver Porphyra sp. (Nori). (United States)

    Bito, Tomohiro; Teng, Fei; Watanabe, Fumio


    Porphyra sp. (nori) is widely cultivated as an important marine crop. Dried nori contains numerous nutrients, including vitamin B 12 , which is the only vitamin absent from plant-derived food sources. Vegetarian diets are low in iron and vitamin B 12 ; depletion of both causes severe anemia. Nori also contains large amounts of iron compared with other plant-derived foods and eicosapentaenoic acid, which is an important fatty acid found in fish oils. In nori, there are also many bioactive compounds that exhibit various pharmacological activities, such as immunomodulation, anticancer, antihyperlipidemic, and antioxidative activities, indicating that consumption of nori is beneficial to human health. However, Porphyra sp. contains toxic metals (arsenic and cadmiun) and/or amphipod allergens, the levels of which vary significantly among nori products. Further evidence from human studies of such beneficial or adverse effects of nori consumption is required.

  8. Genome sequence and description of Anaerosalibacter massiliensis sp. nov.

    Directory of Open Access Journals (Sweden)

    N. Dione


    Full Text Available Anaerosalibacter massiliensis sp. nov. strain ND1T (= CSUR P762 = DSM 27308 is the type strain of A. massiliensis sp. nov., a new species within the genus Anaerosalibacter. This strain, the genome of which is described here, was isolated from the faecal flora of a 49-year-old healthy Brazilian man. Anaerosalibacter massiliensis is a Gram-positive, obligate anaerobic rod and member of the family Clostridiaceae. With the complete genome sequence and annotation, we describe here the features of this organism. The 3 197 911 bp long genome (one chromosome but no plasmid contains 3271 protein-coding and 62 RNA genes, including six rRNA genes.

  9. The noncompact portion of Sp(4, R) via quaternions

    Energy Technology Data Exchange (ETDEWEB)

    Ansari, Yassmin R; Ramakrishna, Viswanath [Department of Mathematical Sciences and Center for Signals, Systems and Communications, University of Texas at Dallas, PO Box 830688, Richardson, TX 75083 (United States)], E-mail:


    This work provides a quaternionic representation for real symplectic matrices in dimension four, analogous to that for the orthogonal group. This is achieved by characterizing positive definite symplectic matrices via quaternions. It also provides a technique to compute the polar decomposition for Sp(4, R) which requires no diagonalization, but relies only on the solution of a 2 x 2 linear system. This constructive technique to compute the 'non-compact portion' of Sp(4, R) is then used to compute the smallest eigenvalue of the noise (covariance) matrix of the so-called Gaussian two-mode systems. Other applications where this non-compact portion is relevant are also discussed.

  10. Influence of copper on Euplotes sp. and associated bacterial population

    Directory of Open Access Journals (Sweden)

    Guilherme Oliveira Andrade da Silva


    Full Text Available The influence of copper on the ciliate Euplotes sp. and associated bacteria isolated from sediment samples of Guanabara Bay were investigated in bioassays. This region is highly affected by heavy metals such as copper, from solid waste constantly dumped in the bay and other sources such as industrial effluents, antifouling paints, atmospheric deposition and urban drainage, and even today there are few data on the metal toxicity to the ecosystem of the Bay of Guanabara. Bioassays were conducted to estimate the LC50-24 h of copper, in order to determine the concentration of metal bearing 50% of the population mortality. The results indicated that the concentrations of 0.05 and 0.009 mg L-1 presented no toxicity to Euplotes sp. The associated bacteria are tolerant to copper concentrations used in bioassays, and suggest that they could be used as a potential agent in the bioremediation of areas affected by copper.

  11. Microbiological Quality of Panicum maximum Grass Silage with Addition of Lactobacillus sp. as Starter (United States)

    Sumarsih, S.; Sulistiyanto, B.; Utama, C. S.


    The aim of the research was to evaluate microbiological quality of Panicum maximum grass silage with addition Lactobacillus sp as starter. The completely randomized design was been used on this research with 4 treaments and 3 replications. The treatments were P0 ( Panicum maximum grass silage without addition Lactobacillus sp ), P1 ( Panicum maximum grass silage with 2% addition Lactobacillus sp), P2 (Panicum maximum grass silage with 4% addition Lactobacillus sp) and P3 (Panicum maximum grass silage with 6% addition Lactobacillus sp).The parameters were microbial populations of Panicum maximum grass silage (total lactic acid bacteria, total bacteria, total fungi, and Coliform bacteria. The data obtained were analyzed variance (ANOVA) and further tests performed Duncan’s Multiple Areas. The population of lactic acid bacteria was higher (PMicrobiological quality of Panicum maximum grass silage with addition Lactobacillus sp was better than no addition Lactobacillus sp.

  12. A Verhulst model for microalgae Botryococcus sp. growth and nutrient removal in wastewater (United States)

    Jamaian, Siti Suhana; Bakeri, Noorhadila Mohd; Sunar, Norshuhaila Mohamed; Gani, Paran


    Microalgae Botryococcus sp. is a colonial green alga found in lakes and reservoirs in Malaysia. Previous studies reported that the potential of Botryococcus sp. photosynthesis as a source of fuel. The Botryococcus sp. contains hydrocarbon up to 75% of dry weight, which can be converted into petrol, diesel or turbine fuel or other liquid or gaseous hydrocarbons. Recently, an experimental study was conducted on phycoremediation technology for wastewater using Botryococcus sp. The phycoremediation technology is useful to remove the excess of nutrients such as nitrogen, phosphorus and also have the ability to remove various pollutants from wastewater. This research implements the Verhulst model to estimate the nutrient removal by microalgae Botryococcus sp. from the wastewater. This model has been validated with the experiments of microalgae Botryococcus sp. grown in domestic and palm oil wastewater. The results suggested that microalgae Botryococcus sp. could be cultured in domestic and palm oil wastewater while nutrients are reduced from these wastewaters.

  13. Siphateles (Gila) sp. and Catostomus sp. from the Pleistocene OIS-6 Lake Gale, Panamint Valley, Owens River system, California (United States)

    Jayko, A. S.; Forester, R. M.; Smith, G. R.


    Panamint Valley lies within the Owens River system which linked southeastern Sierra Nevada basins between Mono Lake and Death Valley during glacial-pluvial times. Previous work indicates that late Pleistocene glacial-pluvial Lake Gale, Panamint Valley was an open system during OIS-6, a closed ground water supported shallow lake during OIS-4, and the terminal lake basin for the Owens River system during OIS-2. We here report the first occurrence of fossil fish from the Plio-Pleistocene Panamint basin. Fish remains are present in late Pleistocene OIS-6 nearshore deposits associated with a highstand that was spillway limited at Wingate Wash. The deposits contain small minnow-sized remains from both Siphateles or Gila sp. (chubs) and Catostomus sp. (suckers) from at least four locations widely dispersed in the basin. Siphateles or Gila sp. and Catostomus are indigenous to the Pleistocene and modern Owens River system, in particular to the historic Owens Lake area. Cyprinodon (pupfish) and Rhinichthys (dace) are known from the modern Amargosa River and from Plio-Pleistocene deposits in Death Valley to the east. The late Pleistocene OIS-6 to OIS-2 lacustrine and paleohydrologic record in Panamint basin is interpreted from ostracod assemblages, relative abundance of Artemia sp. pellets, shallow water indicators including tufa fragments, ruppia sp. fragments and the relative abundance of charophyte gyrogonites obtained from archived core, as well as faunal assemblages from paleoshoreline and nearshore deposits. The OIS-4 groundwater supported shallow saline lake had sufficiently low ratios of alkalinity to calcium (alk/Ca) to support the occurrence of exotic Elphidium sp. (?) foraminfera which are not observed in either OIS-2 or OIS-6 lacustrine deposits. The arrival of Owens River surface water into Panamint Basin during OIS-2 is recorded by the first appearance of the ostracod Limnocythere sappaensis at ~27 m depth in an ~100 m archived core (Smith and Pratt, 1957) which

  14. Natural transformation of Thermotoga sp. strain RQ7. (United States)

    Han, Dongmei; Xu, Hui; Puranik, Rutika; Xu, Zhaohui


    Thermotoga species are organisms of enormous interest from a biotechnological as well as evolutionary point of view. Genetic modifications of Thermotoga spp. are often desired in order to fully release their multifarious potentials. Effective transformation of recombinant DNA into these bacteria constitutes a critical step of such efforts. This study aims to establish natural competency in Thermotoga spp. and to provide a convenient method to transform these organisms. Foreign DNA was found to be relatively stable in the supernatant of a Thermotoga culture for up to 6 hours. Adding donor DNA to T. sp. strain RQ7 at its early exponential growth phase (OD600 0.18 ~ 0.20) resulted in direct acquisition of the DNA by the cells. Both T. neapolitana chromosomal DNA and Thermotoga-E. coli shuttle vectors effectively transformed T. sp. strain RQ7, rendering the cells resistance to kanamycin. The kan gene carried by the shuttle vector pDH10 was detected by PCR from the plasmid extract of the transformants, and the amplicons were verified by restriction digestions. A procedure for natural transformation of Thermotoga spp. was established and optimized. With the optimized method, T. sp. strain RQ7 sustained a transformation frequency in the order of 10⁻⁷ with both genomic and plasmid DNA. T. sp. strain RQ7 cells are naturally transformable during their early exponential phase. They acquire DNA from both closely and distantly related species. Both chromosomal DNA and plasmid DNA serve as suitable substrates for transformation. Our findings lend a convenient technical tool for the genetic engineering of Thermotoga spp.

  15. Paediatric SpRs' experiences of breaking bad news. (United States)

    Horwitz, N; Ellis, J


    To ascertain the level of support and training available to paediatric specialist registrars (SpRs) in breaking bad news and their self-reported confidence in this task. A questionnaire-based survey. Paediatric SpRs working in North Thames region. Specialist registrars (n = 206) were sent a questionnaire relating to the level of support and training available to them in breaking bad news and their attitudes to this task. A repeat questionnaire was sent out 2 weeks later. The response rate was 54.9%. The study sample included 78 females and 34 males. The median year of qualification was 1995 [interquartile range (IQR) 1993-1997] and the median year of Calman training was Year 3 (IQR 2-4). Only 15.9% of participants had guidelines where they worked and 91.2% had received training in breaking bad news. Median self-perceived confidence in breaking bad news was rated as 4 out of 5. Only 21.2% of all respondents had both disclosed a diagnosis of Down syndrome and received feedback on their performance from their seniors. Few SpRs were able to adhere to all evidence-based recommendations for breaking bad news. Most SpRs had received training in breaking bad news and self-reported confidence in this skill was high, although their hands-on experience was limited. Recent research shows, however, that parental dissatisfaction with the way in which bad news is broken remains high. The potential discrepancy between self-reported confidence and actual competence casts doubt on the value of self-evaluation.

  16. Effet de la fraction oligosaccharidique de Fusarium oxysporum f. sp ...

    African Journals Online (AJOL)

    La fusariose, causée par Fusarium oxysporum f. sp. vasinfectum (FOV), provoque plus de dégâts dans les cotonneraies.La recherche de méthodes alternatives est donc nécessaire. Le but de cette étude est de montrer l'effet de la fraction oligosaccharidique de FOV en tant qu'éliciteur des défenses naturelles du cotonnier.

  17. Chemical Constituents of the Lichens Cladonia multiformis and Cryptothecia sp

    International Nuclear Information System (INIS)

    Hasliza Yusof; Husna Azahar; Laily Din; Nazlina Ibrahim


    Two depsides (atranorin 1 and evernic acid 4), an aromatic compound (methyl β-orcinolcarboxylate 2) and one cleavage product of depside (everninic acid 3) were isolated from two lichens, Cladonia multiformis (1 and 2) and Cryptothecia sp. (3 and 4). The identification of the four compounds was carried out by comparison of the recorded NMR data with that of the reported. Compounds 1 and 4 showed antibacterial activity against Bacillus subtilis and Enterobacter aerogenes. (author)

  18. SP-100 reactor disassembly remote handling test program

    International Nuclear Information System (INIS)

    Wilson, C.E.; Potter, J.D.; Maiden, G.E.; Vader, D.P.


    This paper is presented as an overview of the remote handling equipment validation testing, which will be conducted before installation and use in the ground engineering test facility. This equipment will be used to defuel the SP-100 reactor core after removing it from the Test Assembly following nuclear testing. A series of full scale mock-up operational tests will be conducted at a Hanford Site facility to verify equipment design, operation, and capabilities

  19. Studies on Mucopolysaccharidases from Oral Bacteroides sp., especially on Heparinase


    谷口, 裕朗; 藤村, 節夫; 中村, 武


    Mucopolysaccharide lyases in the cell extract from a oral strain of Bacteroides sp. produced △4, 5-unsaturated disaccharides from the several substrates including, heparan sulfate, chondroitin sulfate A (ChS-A), chondroitin sulfate C (ChS-C), hyaluronic acid and chondroitin by the elimination reaction. However this enzyme preparation did not degrade chondroitin sulfate B (ChS-B). As for production of heparinase, the presence of heparin in the culture medium was essential. These enzymes were s...

  20. Sp(2) BRST invariant quantization of strings: The harmonic gauge

    International Nuclear Information System (INIS)

    Latorre, J.I.; Massachusetts Inst. of Tech., Cambridge


    We analyze the mixed algebra of local diffeomorphisms and Weyl transformations for bosonic strings. BRST and anti-BRST operators are then constructed keeping a manifest Sp(2) invariance. The harmonic gauge arises as a natural gauge choice. All this work is redone in the presence of a two-dimensional background metric. We manage to write down a simple action, to compute the stress tensor and to work out the critical dimensions. (orig.)

  1. Phytochemical characterization of wild edible Boletus sp. from Northeast Portugal


    Heleno, Sandrina A.; Barros, Lillian; Martins, Anabela; Sousa, Maria João; Ferreira, Isabel C.F.R.


    Our research has been focused on the documentation of nutritional composition and nutraceutical potential of wild mushrooms, making the information available for a better management and conservation of these species and related habitats. In the present work, the chemical composition and bioactivity of three wild edible Boletus sp. (Boletus aereus, Boletus edulis, Boletus reticulatus) from Northeast Portugal were evaluated, in order to valorise these species as sources of important...

  2. A new dimeric anthraquinone from endophytic Talaromyces sp. YE3016. (United States)

    Xie, Xiao-Song; Fang, Xiao-Wei; Huang, Rong; Zhang, Shou-Peng; Wei, Hong-Xia; Wu, Shao-Hua


    A new unsymmetrical dimeric anthraquinone, 3-demethyl-3-(2-hydroxypropyl)-skyrin (1) was isolated from the solid-state fermentation extract of an endophytic fungal strain Talaromyces sp. YE 3016, together with five known compounds, skyrin (2), oxyskyrin (3), emodin (4), 1,3,6-trihydroxy-8-methyl-anthraquinone (5) and ergosterol (6). The structure of the new compound was elucidated on the basis of spectroscopic analysis. Compounds 1-3 exhibited moderate cytotoxic activities against MCF-7 cell line.

  3. Genome sequencing and annotation of Stenotrophomonas sp. SAM8

    Directory of Open Access Journals (Sweden)

    Samy Selim


    Full Text Available We report draft genome sequence of Stenotrophomonas sp. strain SAM8, isolated from environmental water. The draft genome size is 3,665,538 bp with a G + C content of 67.2% and contains 6 rRNA sequence (single copies of 5S, 16S & 23S rRNA. The genome sequence can be accessed at DDBJ/EMBL/GenBank under the accession no. LDAV00000000.

  4. Fully substituted unsaturated lactones from endophytic Myrothecium sp. (United States)

    Xu, Hao; Jiang, Nan; Guo, Ye; Jiao, Rui-Hua; Cui, Jiang-Tao; Song, Yong-Chun; Tan, Ren-Xiang


    Two new α,β-unsaturated γ-lactones, myrolactones A (1) and B (2), were characterized from the culture broth of the Myrothecium sp. IFB-E106 isolated from the roots of Vatica mangachapoi Blauco. The absolute configuration was determined by the computational electronic circular dichroism approach. Myolactone B showed neuraminidase inhibitory activity with the IC(50) value of 13.95 μM.

  5. Novel Adociaquinone Derivatives from the Indonesian Sponge Xestospongia sp.


    He, Fei; Mai, Linh H.; Longeon, Arlette; Copp, Brent R.; Loa?c, Nad?ge; Bescond, Amandine; Meijer, Laurent; Bourguet-Kondracki, Marie-Lise


    Seven new adociaquinone derivatives, xestoadociaquinones A (1a), B (1b), 14-carboxy-xestoquinol sulfate (2) and xestoadociaminals A–D (3a, 3c, 4a, 4c), together with seven known compounds (5–11) were isolated from an Indonesian marine sponge Xestospongia sp. Their structures were elucidated by extensive 1D and 2D NMR and mass spectrometric data. All the compounds were evaluated for their potential inhibitory activity against eight different protein kinases involved in cell proliferation, can...

  6. Intestinal immune response to human Cryptosporidium sp. infection (United States)


    Guerrant. 2007. Heavy cryptosporidial infections in children in northeast Brazil: comparison of Cryptosporidium hominis and Cryptosporidium parvum...Asgharpour, C. T. Ng, D. P. Calfee, R. L. Guerrant, V. Maro, S. Ole-Nguyaine, and J. F. Shao. 2005. Short report: asymptomatic Cryptosporidium hominis ...JAN 2008 2. REPORT TYPE N/A 3. DATES COVERED - 4. TITLE AND SUBTITLE Intestinal immune response to human Cryptosporidium sp. infection 5a

  7. Current State in the Diagnosis of Blood Parasite Babesia SP


    Suteky, Tatik


    Babesiosis merupakan penyakit parasit yang disebabkan oleh Babesia sp tidak hanya menyerang berbagai spesies hewan tetapi juga pada manusia. Kasus babesiosis pada orang yang disebabkan oleh Babesia microti telah dilaporkan diberbagai negara. Diagnosis untuk Babesia biasanya dilakukan secara mikroskopis dengan preparat apus darah, namun dengan metode ini sering tidak menunjukkan hasil akurat sehingga metode lain perlu dikembangkan. Metode seperti sub inokulasi pada hewan percobaan dan Quantita...

  8. First record of Babesia sp. in Antarctic penguins. (United States)

    Montero, Estrella; González, Luis Miguel; Chaparro, Alberto; Benzal, Jesús; Bertellotti, Marcelo; Masero, José A; Colominas-Ciuró, Roger; Vidal, Virginia; Barbosa, Andrés


    This is the first reported case of Babesia sp. in Antarctic penguins, specifically a population of Chinstrap penguins (Pygoscelis antarctica) in the Vapour Col penguin rookery in Deception Island, South Shetlands, Antarctica. We collected peripheral blood from 50 adult and 30 chick Chinstrap penguins. Examination of the samples by microscopy showed intraerythrocytic forms morphologically similar to other avian Babesia species in 12 Chinstrap penguin adults and seven chicks. The estimated parasitaemias ranged from 0.25×10(-2)% to 0.75×10(-2)%. Despite the low number of parasites found in blood smears, semi-nested PCR assays yielded a 274 bp fragment in 12 of the 19 positive blood samples found by microscopy. Sequencing revealed that the fragment was 97% similar to Babesia sp. 18S rRNA from Australian Little Penguins (Eudyptula minor) confirming presence of the parasite. Parasite prevalence estimated by microscopy in adults and chicks was higher (24% vs. 23.3%, respectively) than found by semi-nested PCR (16% vs. 13.3% respectively). Although sampled penguins were apparently healthy, the effect of Babesia infection in these penguins is unknown. The identification of Babesia sp. in Antarctic penguins is an important finding. Ixodes uriae, as the only tick species present in the Antarctic Peninsula, is the key to understanding the natural history of this parasite. Future work should address the transmission dynamics and pathogenicity of Babesia sp. in Chinstrap penguin as well as in other penguin species, such as Gentoo penguin (Pygoscelis papua) and Adélie penguin (Pygoscelis adeliae), present within the tick distribution range in the Antarctic Peninsula. Copyright © 2016 Elsevier GmbH. All rights reserved.

  9. Toxic effect of high concentration of sonochemically synthesized polyvinylpyrrolidone-coated silver nanoparticles on Citrobacter sp. A1 and Enterococcus sp. C1. (United States)

    Lau, Chew Ping; Abdul-Wahab, Mohd Firdaus; Jaafar, Jafariah; Chan, Giek Far; Abdul Rashid, Noor Aini


    Currently, silver nanoparticles (AgNPs) have gained importance in various industrial applications. However, their impact upon release into the environment on microorganisms remains unclear. The aim of this study was to analyze the effect of polyvinylpyrrolidone-capped AgNPs synthesized in this laboratory on two bacterial strains isolated from the environment, Gram-negative Citrobacter sp. A1 and Gram-positive Enterococcus sp. C1. Polyvinylpyrrolidone-capped AgNPs were synthesized by ultrasound-assisted chemical reduction. Characterization of the AgNPs involved UV-visible spectroscopy, Fourier transform infrared spectroscopy, X-ray diffraction, transmission electron microscopy, and energy dispersive X-ray spectroscopy. Citrobacter sp. A1 and Enterococcus sp. C1 were exposed to varying concentrations of AgNPs, and cell viability was determined. Scanning electron microscopy was performed to evaluate the morphological alteration of both species upon exposure to AgNPs at 1000 mg/L. The synthesized AgNPs were spherical in shape, with an average particle size of 15 nm. The AgNPs had different but prominent effects on either Citrobacter sp. A1 or Enterococcus sp. C1. At an AgNP concentration of 1000 mg/L, Citrobacter sp. A1 retained viability for 6 hours, while Enterococcus sp. C1 retained viability only for 3 hours. Citrobacter sp. A1 appeared to be more resistant to AgNPs than Enterococcus sp. C1. The cell wall of both strains was found to be morphologically altered at that concentration. Minute and spherical AgNPs significantly affected the viability of the two bacterial strains selected from the environment. Enterococcus sp. C1 was more vulnerable to AgNPs, probably due to its cell wall architecture and the absence of silver resistance-related genes. Copyright © 2015. Published by Elsevier B.V.

  10. Extraction of antioxidants from Chlorella sp. using subcritical water treatment (United States)

    Zakaria, S. M.; Mustapa Kamal, S. M.; Harun, M. R.; Omar, R.; Siajam, S. I.


    Chlorella sp. microalgae is one of the main source of natural bioactive compounds used in the food and pharmaceutical industries. Subcritical water extraction is the technique that offers an efficient, non-toxic, and environmental-friendly method to obtain natural ingredients. In this work, the extracts of Chlorella sp. microalgae was evaluated in terms of: chemical composition, extraction (polysaccharides) yield and antioxidant activity, using subcritical water extraction. Extractions were performed at temperatures ranging from 100°C to 300°C. The results show that by using subcritical water, the highest yield of polysaccharides is 23.6 that obtained at 150°C. Analysis on the polysaccharides yield show that the contents were highly influenced by the extraction temperature. The individual antioxidant activity were evaluated by in vitro assay using a free radical method. In general, the antioxidant activity of the extracts obtained at different water temperatures was high, with values of 31.08-54.29 . The results indicated that extraction by subcritical water was effective and Chlorella sp. can be a useful source of natural antioxidants.

  11. Network Analysis of Plasmidomes: The Azospirillum brasilense Sp245 Case (United States)

    Fondi, Marco


    Azospirillum brasilense is a nitrogen-fixing bacterium living in association with plant roots. The genome of the strain Sp245, isolated in Brazil from wheat roots, consists of one chromosome and six plasmids. In this work, the A. brasilense Sp245 plasmids were analyzed in order to shed some light on the evolutionary pathways they followed over time. To this purpose, a similarity network approach was applied in order to identify the evolutionary relationships among all the A. brasilense plasmids encoded proteins; in this context a computational pipeline specifically devoted to the analysis and the visualization of the network-like evolutionary relationships among different plasmids molecules was developed. This information was supplemented with a detailed (in silico) functional characterization of both the connected (i.e., sharing homology with other sequences in the dataset) and the unconnected (i.e., not sharing homology) components of the network. Furthermore, the most likely source organism for each of the genes encoded by A. brasilense plasmids was checked, allowing the identification of possible trends of gene loss/gain in this microorganism. Data obtained provided a detailed description of the evolutionary landscape of the plasmids of A. brasilense Sp245, suggesting some of the molecular mechanisms responsible for the present-day structure of these molecules. PMID:25610702

  12. Isolation and Characterization of a Cyclohexane-Metabolizing Xanthobacter sp. (United States)

    Trower, M K; Buckland, R M; Higgins, R; Griffin, M


    An unusual Xanthobacter sp., capable of independent growth on cyclohexane as the sole source of carbon and energy, has been isolated from soil by using classical enrichment techniques. The mean generation time for growth on cyclohexane was 6 h. The microorganism showed a limited ability to utilize hydrocarbons, with only alicyclic hydrocarbons closely related to cyclohexane supporting growth. Ultrastructural studies indicated the presence of electron-transparent vesicles in the cyclohexane-grown Xanthobacter sp., but the presence of complex intracytoplasmic membranes could not be identified. A soluble inducible enzyme capable of oxidizing cyclohexane was identified in cell extracts. This enzyme had a pH optimum of 6.5, an absolute specificity for NADPH, and a stoichiometric requirement for molecular O(2) which was consistent with the formation of cyclohexanol. The enzyme showed no activity towards straight chain alkanes and only a limited activity towards unsaturated ring compounds. Enzymatic studies with cell extracts have indicated the main route of metabolism of cyclohexane by this Xanthobacter sp. to proceed via cyclohexane --> cyclohexanol --> cyclohexanone --> 1-oxa-2-oxocycloheptane (epsilon-caprolactone) --> 6-hydroxyhexanoate (6-hydroxycaproate) --> --> adipic acid. Alternative routes involving initial double hydroxylation of the cyclohexane ring may operate fortuituously but are unlikely to represent major pathways for the dissimilation of cyclohexane by this microorganism.

  13. Lepidasthenia loboi sp. n. from Puerto Madryn, Argentina (Polychaeta, Polynoidae). (United States)

    Salazar-Vallejo, Sergio I; González, Norma Emilia; Salazar-Silva, Patricia


    Among polychaetes, polynoids have the highest number of symbiotic species found living with a wide variety of marine invertebrates, including other polychaetes. Lepidasthenia Malmgren, 1867 and Lepidametria Webster, 1879 were regarded as synonyms but belong to different subfamilies, although both have species associated with thelepodid or terebellid polychaetes. In this contribution Lepidasthenia loboi sp. n. is described from several specimens associated with the thelepodid Thelepus antarcticus Kinberg, 1867, collected on a rocky shore near Puerto Madryn, Argentina. Lepidasthenia loboi sp. n. can be confused with Lepidasthenia esbelta Amaral & Nonato, 1982 because both live with Thelepus, are of similar sizes with similar pigmentation patterns, and have giant neurochaetae. However, in Lepidasthenia loboi sp. n. all eyes are of the same size, cephalic and parapodial cirri are tapered and mucronate, the second pair of elytra is larger than the third, the ventral cirri arise at the base of parapodia such that they do not reach chaetal lobe tips, and neuraciculae are tapered. On the contrary, in Lepidasthenia esbelta the posterior eyes are larger than anterior ones, cephalic and parapodial appendages are swollen subdistally, the second and third pairs of elytra are of the same size, the ventral cirri arise medially such that their tips reach the neurochaetal lobe tips, and the neuraciculae have falcate tips. Some comments about other genera in the Lepidastheniinae, a simplified key to its genera, and a key to Lepidasthenia species with giant neurochaetae are also included.

  14. Aktivitas Antioksidan Padina sp. pada Berbagai Suhu dan Lama Pengeringan

    Directory of Open Access Journals (Sweden)

    Amir Husni


    Full Text Available Penelitian ini bertujuan untuk mengetahui pengaruh suhu dan lama pengeringan dalam oven terhadap aktivitas antioksidan Padina sp. Pengeringan dilakukan pada suhu 50, 55, dan 60 °C masing-masing selama 4, 6, dan 8 jam. Sebagai pembanding dilakukan pengeringan di bawah sinar matahari selama 8 jam. Parameter yang diamati meliputi rendemen, kadar air, aktivitas antioksidan, total fenol, dan uji fitokimia. Hasil penelitian menunjukkan bahwa rendemen Padina sp. berkisar antara 12,86–18,28%, kadar air 14,52–21,80%, IC50 antioksidan 37,68–48,03 ppm, total fenol 0,18–0,35 mg PGE/mg, dan hasil uji fitokimia menunjukkan bahwa Padina sp. mengandung senyawa fenol. Pengeringan oven bersuhu 50 °C selama 4 jam menghasilkan aktivitas antioksidan dan total fenol tertinggi, dengan nilai IC50 37,68 ppm dan total fenol 0,35 mg PGE/mg.

  15. Extraction methods of Amaranthus sp. grain oil isolation. (United States)

    Krulj, Jelena; Brlek, Tea; Pezo, Lato; Brkljača, Jovana; Popović, Sanja; Zeković, Zoran; Bodroža Solarov, Marija


    Amaranthus sp. is a fast-growing crop with well-known beneficial nutritional values (rich in protein, fat, dietary fiber, ash, and minerals, especially calcium and sodium, and containing a higher amount of lysine than conventional cereals). Amaranthus sp. is an underexploited plant source of squalene, a compound of high importance in the food, cosmetic and pharmaceutical industries. This paper has examined the effects of the different extraction methods (Soxhlet, supercritical fluid and accelerated solvent extraction) on the oil and squalene yield of three genotypes of Amaranthus sp. grain. The highest yield of the extracted oil (78.1 g kg(-1) ) and squalene (4.7 g kg(-1) ) in grain was obtained by accelerated solvent extraction (ASE) in genotype 16. Post hoc Tukey's HSD test at 95% confidence limit showed significant differences between observed samples. Principal component analysis (PCA) and cluster analysis (CA) were used for assessing the effect of different genotypes and extraction methods on oil and squalene yield, and also the fatty acid composition profile. Using coupled PCA and CA of observed samples, possible directions for improving the quality of product can be realized. The results of this study indicate that it is very important to choose both the right genotype and the right method of extraction for optimal oil and squalene yield. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  16. Network Analysis of Plasmidomes: The Azospirillum brasilense Sp245 Case

    Directory of Open Access Journals (Sweden)

    Valerio Orlandini


    Full Text Available Azospirillum brasilense is a nitrogen-fixing bacterium living in association with plant roots. The genome of the strain Sp245, isolated in Brazil from wheat roots, consists of one chromosome and six plasmids. In this work, the A. brasilense Sp245 plasmids were analyzed in order to shed some light on the evolutionary pathways they followed over time. To this purpose, a similarity network approach was applied in order to identify the evolutionary relationships among all the A. brasilense plasmids encoded proteins; in this context a computational pipeline specifically devoted to the analysis and the visualization of the network-like evolutionary relationships among different plasmids molecules was developed. This information was supplemented with a detailed (in silico functional characterization of both the connected (i.e., sharing homology with other sequences in the dataset and the unconnected (i.e., not sharing homology components of the network. Furthermore, the most likely source organism for each of the genes encoded by A. brasilense plasmids was checked, allowing the identification of possible trends of gene loss/gain in this microorganism. Data obtained provided a detailed description of the evolutionary landscape of the plasmids of A. brasilense Sp245, suggesting some of the molecular mechanisms responsible for the present-day structure of these molecules.

  17. FastSP: linear time calculation of alignment accuracy. (United States)

    Mirarab, Siavash; Warnow, Tandy


    Multiple sequence alignment is a basic part of much biological research, including phylogeny estimation and protein structure and function prediction. Different alignments on the same set of unaligned sequences are often compared, sometimes in order to assess the accuracy of alignment methods or to infer a consensus alignment from a set of estimated alignments. Three of the standard techniques for comparing alignments, Developer, Modeler and Total Column (TC) scores can be derived through calculations of the set of homologies that the alignments share. However, the brute-force technique for calculating this set is quadratic in the input size. The remaining standard technique, Cline Shift Score, inherently requires quadratic time. In this article, we prove that each of these scores can be computed in linear time, and we present FastSP, a linear-time algorithm for calculating these scores. Even on the largest alignments we explored (one with 50 000 sequences), FastSP completed method whose empirical running time is approximately the same as FastSP when given sufficient memory (at least 8 GB), but whose asymptotic running time has never been theoretically established. In addition, for comparisons of large alignments under lower memory conditions (at most 4 GB of main memory), qscore uses substantial memory (up to 10 GB for the datasets we studied), took more time and failed to analyze the largest datasets. The open-source software and executables are available online at

  18. Alkaline protease from Thermoactinomyces sp. RS1 mitigates industrial pollution. (United States)

    Verma, Amit; Ansari, Mohammad W; Anwar, Mohmmad S; Agrawal, Ruchi; Agrawal, Sanjeev


    Proteases have found a wide application in the several industrial processes, such as laundry detergents, protein recovery or solubilization, prion degradation, meat tenderizations, and in bating of hides and skins in leather industries. But the main hurdle in industrial application of proteases is their economical production on a large scale. The present investigation aimed to exploit the locally available inexpensive agricultural and household wastes for alkaline protease production using Thermoactinomyces sp. RS1 via solid-state fermentation (SSF) technique. The alkaline enzyme is potentially useful as an additive in commercial detergents to mitigate pollution load due to extensive use of caustic soda-based detergents. Thermoactinomyces sp. RS1 showed good protease production under SSF conditions of 55 °C, pH 9, and 50 % moisture content with potato peels as solid substrate. The presented findings revealed that crude alkaline protease produced by Thermoactinomyces sp. RS1 via SSF is of potential application in silver recovery from used X-ray films.

  19. Transcriptional Regulation of Frizzled-1 in Human Osteoblasts by Sp1.

    Directory of Open Access Journals (Sweden)

    Shibing Yu

    Full Text Available The wingless pathway has a powerful influence on bone metabolism and is a therapeutic target in skeletal disorders. Wingless signaling is mediated in part through the Frizzled (FZD receptor family. FZD transcriptional regulation is poorly understood. Herein we tested the hypothesis that Sp1 plays an important role in the transcriptional regulation of FZD1 expression in osteoblasts and osteoblast mineralization. To test this hypothesis, we conducted FZD1 promoter assays in Saos2 cells with and without Sp1 overexpression. We found that Sp1 significantly up-regulates FZD1 promoter activity in Saos2 cells. Chromatin immunoprecipitation (ChIP and electrophoretic mobility shift (EMSA assays identified a novel and functional Sp1 binding site at -44 to -40 from the translation start site in the FZD1 promoter. The Sp1-dependent activation of the FZD1 promoter was abolished by mithramycin A (MMA, an antibiotic affecting both Sp1 binding and Sp1 protein levels in Saos2 cells. Similarly, down-regulation of Sp1 in hFOB cells resulted in less FZD1 expression and lower alkaline phosphatase activity. Moreover, over-expression of Sp1 increased FZD1 expression and Saos2 cell mineralization while MMA decreased Sp1 and FZD1 expression and Saos2 cell mineralization. Knockdown of FZD1 prior to Sp1 overexpression partially abolished Sp1 stimulation of osteoblast differentiation markers. Taken together, our results suggest that Sp1 plays a role in human osteoblast differentiation and mineralization, which is at least partially mediated by Sp1-dependent transactivation of FZD1.

  20. Structural studies of the polysaccharides from the lipopolysaccharides of Azospirillum brasilense Sp246 and SpBr14. (United States)

    Sigida, Elena N; Fedonenko, Yuliya P; Shashkov, Alexander S; Grinev, Vyacheslav S; Zdorovenko, Evelina L; Konnova, Svetlana A; Ignatov, Vladimir V; Knirel, Yuriy A


    Lipopolysaccharides from closely related Azospirillum brasilense strains, Sp246 and SpBr14, were obtained by phenol-water extraction. Mild acid hydrolysis of the lipopolysaccharides followed by GPC on Sephadex G-50 resulted in polysaccharide mixtures. On the basis of sugar and methylation analyses, Smith degradation and (1)H and (13)C NMR spectroscopy data, it was concluded that both bacteria possess the same two distinct polysaccharides having structures 1 and 2: [structure: see text]. Structure 1 has been reported earlier for a polysaccharide of A. brasilense 54 [Fedonenko et al., 2011] whereas to our knowledge structure 2 has not been hitherto found in bacterial polysaccharides. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Revision of the family Carabodidae (Acari, Oribatida XII. Yoshiobodes camerunensis sp. n. and Rugocepheus costaricensis sp. n.

    Directory of Open Access Journals (Sweden)

    Nestor Fernandez


    Full Text Available Yoshiobodes camerunensis sp. n., collected in Cameroon, is the first species of this genus reported from the Afrotropical region. Diagnostic characters include lamellae terminating in a bridge and not in lamellar tips; cup-shaped bothridia, bothridial ring present; rostral setae cochleariform, smooth; lamellar setae slightly lanceolate, barbate; fifteen pairs of notogastral setae; c3 lanceolate, rounded end, with longitudinal shallow grooves; other notogastral setae curved lanceolate-cochleariform. Rugocepheus costaricensis sp. n. is the third species of the genus to be described, and the first collected outside the African region. Prodorsum presents a Y-shaped structure; elevated interlamellar process, superior flat zone; lamellae lacking lamellar tips; fourteen pairs of notogastral setae; four notogastral furrows, and an unpaired elevated central area devoid of setae. Both species are described and illustrated based on adult specimens, studied by means of optical and SEM microscopy.

  2. Revision of the family Carabodidae (Acari, Oribatida) XII. Yoshiobodes camerunensis sp. n. and Rugocepheus costaricensis sp. n. (United States)

    Fernandez, Nestor; Theron, Pieter; Leiva, Sergio; Tiedt, Louwrens


    Yoshiobodes camerunensis sp. n. , collected in Cameroon, is the first species of this genus reported from the Afrotropical region. Diagnostic characters include lamellae terminating in a bridge and not in lamellar tips; cup-shaped bothridia, bothridial ring present; rostral setae cochleariform, smooth; lamellar setae slightly lanceolate, barbate; fifteen pairs of notogastral setae; c 3 lanceolate, rounded end, with longitudinal shallow grooves; other notogastral setae curved lanceolate-cochleariform. Rugocepheus costaricensis sp. n. is the third species of the genus to be described, and the first collected outside the African region. Prodorsum presents a Y-shaped structure; elevated interlamellar process, superior flat zone; lamellae lacking lamellar tips; fourteen pairs of notogastral setae; four notogastral furrows, and an unpaired elevated central area devoid of setae. Both species are described and illustrated based on adult specimens, studied by means of optical and SEM microscopy.

  3. Lipid Profile Remodeling in Response to Nitrogen Deprivation in the Microalgae Chlorella sp. (Trebouxiophyceae) and Nannochloropsis sp. (Eustigmatophyceae) (United States)

    Olmstead, Ian L. D.; Bergamin, Amanda; Shears, Melanie J.; Dias, Daniel A.; Kentish, Sandra E.; Scales, Peter J.; Botté, Cyrille Y.; Callahan, Damien L.


    Many species of microalgae produce greatly enhanced amounts of triacylglycerides (TAGs), the key product for biodiesel production, in response to specific environmental stresses. Improvement of TAG production by microalgae through optimization of growth regimes is of great interest. This relies on understanding microalgal lipid metabolism in relation to stress response in particular the deprivation of nutrients that can induce enhanced TAG synthesis. In this study, a detailed investigation of changes in lipid composition in Chlorella sp. and Nannochloropsis sp. in response to nitrogen deprivation (N-deprivation) was performed to provide novel mechanistic insights into the lipidome during stress. As expected, an increase in TAGs and an overall decrease in polar lipids were observed. However, while most membrane lipid classes (phosphoglycerolipids and glycolipids) were found to decrease, the non-nitrogen containing phosphatidylglycerol levels increased considerably in both algae from initially low levels. Of particular significance, it was observed that the acyl composition of TAGs in Nannochloropsis sp. remain relatively constant, whereas Chlorella sp. showed greater variability following N-deprivation. In both algae the overall fatty acid profiles of the polar lipid classes were largely unaffected by N-deprivation, suggesting a specific FA profile for each compartment is maintained to enable continued function despite considerable reductions in the amount of these lipids. The changes observed in the overall fatty acid profile were due primarily to the decrease in proportion of polar lipids to TAGs. This study provides the most detailed lipidomic information on two different microalgae with utility in biodiesel production and nutraceutical industries and proposes the mechanisms for this rearrangement. This research also highlights the usefulness of the latest MS-based approaches for microalgae lipid research. PMID:25171084

  4. Lipid profile remodeling in response to nitrogen deprivation in the microalgae Chlorella sp. (Trebouxiophyceae and Nannochloropsis sp. (Eustigmatophyceae.

    Directory of Open Access Journals (Sweden)

    Gregory J O Martin

    Full Text Available Many species of microalgae produce greatly enhanced amounts of triacylglycerides (TAGs, the key product for biodiesel production, in response to specific environmental stresses. Improvement of TAG production by microalgae through optimization of growth regimes is of great interest. This relies on understanding microalgal lipid metabolism in relation to stress response in particular the deprivation of nutrients that can induce enhanced TAG synthesis. In this study, a detailed investigation of changes in lipid composition in Chlorella sp. and Nannochloropsis sp. in response to nitrogen deprivation (N-deprivation was performed to provide novel mechanistic insights into the lipidome during stress. As expected, an increase in TAGs and an overall decrease in polar lipids were observed. However, while most membrane lipid classes (phosphoglycerolipids and glycolipids were found to decrease, the non-nitrogen containing phosphatidylglycerol levels increased considerably in both algae from initially low levels. Of particular significance, it was observed that the acyl composition of TAGs in Nannochloropsis sp. remain relatively constant, whereas Chlorella sp. showed greater variability following N-deprivation. In both algae the overall fatty acid profiles of the polar lipid classes were largely unaffected by N-deprivation, suggesting a specific FA profile for each compartment is maintained to enable continued function despite considerable reductions in the amount of these lipids. The changes observed in the overall fatty acid profile were due primarily to the decrease in proportion of polar lipids to TAGs. This study provides the most detailed lipidomic information on two different microalgae with utility in biodiesel production and nutraceutical industries and proposes the mechanisms for this rearrangement. This research also highlights the usefulness of the latest MS-based approaches for microalgae lipid research.

  5. Spermatozoal ultrastructure in four genera of Homolidae (crustacea, decapoda): Exemplified by Homologenus sp., Latreillopsis sp., Homolomannia sibogae and Paromolosis boasi (United States)

    Jamieson, B. G. M.; Guinot, D.; Forges, B. Richer De


    The spermatozoa of Homologenus sp., Latreillopsis sp., Homolomannia sibogae and Paromolopsis boasi confirm characteristics of a distinctive homolid spermatozoon previously established for Homola sp., Paromola sp. and Paromola petterdi. Homolid features are (1) moderate anteroposterior depression of the acrosome (ratio of length: width 0.4 0.6) as in lyreidine raninids (0.5), depression being greater in dromiids and dynomenids (both 0.3); (2) the capitate form of the perforatorium, shared with dromiids, dynomenids and lyreidine raninids; (3)the autapomorphic spiked-wheel form of the anterior expansion of the perforatorium; (4) horizontal zonation of the acrosome is possibly a unique synapomorphy of homolids with dromiids and dynomenids, and therefore an autapomorphy of the dromioid-homolid assemblage. In dromiids the posterior zone is proportionately the larger, while in homolids the anterior zone is the larger. The anterior zone is complexly subdivided in dynomenids; (5) the autapomorphic presence of numerous radial arranged extension of the acrosomal operculum into the perforatorium; (6) presence of nuclear arms, a symplesiomorphy of all investigated crabs, but small or questionably sometimes absent in Dromiidae; (7) absence of microtubules from the nuclear arms, as in dromiids, raninids, higher heterotremes and thoracotremes; (8) transient presence of a posterior median process of the nucleus. The process is not seen in dromiids but occurs in anomurans and lower heterotremes; (9) apical perforation of the operculum, also seen, apparently symplesiomorphically, in dromiids, raninids, and lower heterotreme families; (10) absence of an acrosome ray zone, probably homoplasic with absence in raninids; (11) location of most of the cytoplasm, including tortuous membranes and degenerating mitochondria, below the acrosome, also seen in Lyreidus; (12) presence, in at least some species, of centrioles, unknown in dromiids and raninids and variable in occurrence in

  6. Integrated Bacillus sp. immobilized cell reactor and Synechocystis sp. algal reactor for the treatment of tannery wastewater. (United States)

    Sekaran, G; Karthikeyan, S; Nagalakshmi, C; Mandal, A B


    The wastewater discharged from leather industries lack biodegradability due to the presence of xenobiotic compounds. The primary clarification and aerobic treatment in Bacillus sp. immobilized Chemo Autotrophic Activated Carbon Oxidation (CAACO) reactor removed considerable amount of pollution parameters. The residual untreated organics in the wastewater was further treated in algal batch reactor inoculated with Synechocystis sp. Sodium nitrate, K(2)HPO(4), MgSO(4).7H(2)O, NH(4)Cl, CaCl(2)·2H(2)O, FeCl(3) (anhydrous), and thiamine hydrochloride, rice husk based activated carbon (RHAC), immobilization of Bacillus sp. in mesoporous activated carbon, sand filter of dimensions diameter, 6 cm and height, 30 cm; and the CAACO reactor of dimensions diameter, 5.5 cm and height, 30 cm with total volume 720 ml, and working volume of 356 ml. In the present investigation, the CAACO treated tannery wastewater was applied to Synechocystis sp. inoculated algal batch reactor of hydraulic residence time 24 h. The BOD(5), COD, and TOC of treated wastewater from algal batch reactor were 20 ± 7, 167 ± 29, and 78 ± 16 mg/l respectively. The integrated CAACO system and Algal batch reactor was operated for 30 days and they accomplished a cumulative removal of BOD(5),COD, TOC, VFA and sulphide as 98 %, 95 %, 93 %, 86 %, and 100 %, respectively. The biokinetic constants for the growth of algae in the batch reactor were specific growth rate, 0.095(day(-1)) and yield coefficient, 3.15 mg of algal biomass/mg of COD destructed. The degradation of xenobiotic compounds in the algal batch reactor was confirmed through HPLC and FT-IR techniques. The integrated CAACO-Algal reactor system established a credible reduction in pollution parameters in the tannery wastewater. The removal mechanism is mainly due to co-metabolism between algae and bacterial species and the organics were completely metabolized rather than by adsorption.

  7. [Prevalence of Cyclospora sp., Cryptosporidium sp, microsporidia and fecal coliform determination in fresh fruit and vegetables consumed in Costa Rica]. (United States)

    Calvo, Melvin; Carazo, Melissa; Arias, Maria Laura; Chaves, Carolina; Monge, Rafael; Chinchilla, Misael


    The presence of Cyclospora sp., Cryptosporidium sp. and microsporidia and the levels of fecal coliforms were determined in lettuce, parsley, cilantro, strawberries and blackberries acquired in local agricultural markets of the Central Valley of Costa Rica, in order to establish the possible transmission risk of these microorganisms and other pathogens from the consumption of these raw products. During the second semester of 2001 and the first of 2002, 50 different samples of each product, 25 taken in the dry season and 25 in the rainy season and coming from five different local agricultural markets were evaluated. The fecal coliforms count was done according to the technique recommended by Vanderzant & Splittstoesser. The parasite determination was done using Zielh Nielsen and Weber staining techniques from a sediment obtained through the rinse of the mentioned products, using sterile peptonated water 0.1% and centrifuging at 900 G for 15 min. One hundred per cent of vegetable samples had fecal coliforms and the greatest prevalence was obtained during the rainy season. Although all vegetables presented fecal coliforms in high concentrations, lettuce and cilantro presented statistical difference between rainy and dry season, being greater during the rainy season. Fecal coliforms were not detected in strawberries and blackberries probablydue to its low pH. All products evaluated presented, at least once, Cryptosporidium sp., Cyclospora sp. and microsporidia, showing the risk they represent to Public Health. Cryptosporidium was present in all products but strawberries. Microsporidia was present in all products except blackberries and Cyclospora was only isolated from lettuce during the dry season. These results show the importance of introducing in the country Good Agricultural Practices, especially due to the resistance of Cryptosporidium and Cyclospora to disinfecting agents.

  8. The SpTransformer Gene Family (Formerly Sp185/333 in the Purple Sea Urchin and the Functional Diversity of the Anti-Pathogen rSpTransformer-E1 Protein

    Directory of Open Access Journals (Sweden)

    L. Courtney Smith


    Full Text Available The complex innate immune system of sea urchins is underpinned by several multigene families including the SpTransformer family (SpTrf; formerly Sp185/333 with estimates of ~50 members, although the family size is likely variable among individuals of Strongylocentrotus purpuratus. The genes are small with similar structure, are tightly clustered, and have several types of repeats in the second of two exons and that surround each gene. The density of repeats suggests that the genes are positioned within regions of genomic instability, which may be required to drive sequence diversification. The second exon encodes the mature protein and is composed of blocks of sequence called elements that are present in mosaics of defined element patterns and are the major source of sequence diversity. The SpTrf genes respond swiftly to immune challenge, but only a single gene is expressed per phagocyte. Many of the mRNAs appear to be edited and encode proteins with altered and/or missense sequence that are often truncated, of which some may be functional. The standard SpTrf protein structure is an N-terminal glycine-rich region, a central RGD motif, a histidine-rich region, and a C-terminal region. Function is predicted from a recombinant protein, rSpTransformer-E1 (rSpTrf-E1, which binds to Vibrio and Saccharomyces, but not to Bacillus, and binds tightly to lipopolysaccharide, β-1,3-glucan, and flagellin, but not to peptidoglycan. rSpTrf-E1 is intrinsically disordered but transforms to α helical structure in the presence of binding targets including lipopolysaccharide, which may underpin the characteristics of binding to multiple targets. SpTrf proteins associate with coelomocyte membranes, and rSpTrf-E1 binds specifically to phosphatidic acid (PA. When rSpTrf-E1 is bound to PA in liposome membranes, it induces morphological changes in liposomes that correlate with PA clustering and leakage of luminal contents, and it extracts or removes PA from the bilayer

  9. TheSpTransformerGene Family (FormerlySp185/333) in the Purple Sea Urchin and the Functional Diversity of the Anti-Pathogen rSpTransformer-E1 Protein. (United States)

    Smith, L Courtney; Lun, Cheng Man


    The complex innate immune system of sea urchins is underpinned by several multigene families including the SpTransformer family ( SpTrf ; formerly Sp185/333 ) with estimates of ~50 members, although the family size is likely variable among individuals of Strongylocentrotus purpuratus . The genes are small with similar structure, are tightly clustered, and have several types of repeats in the second of two exons and that surround each gene. The density of repeats suggests that the genes are positioned within regions of genomic instability, which may be required to drive sequence diversification. The second exon encodes the mature protein and is composed of blocks of sequence called elements that are present in mosaics of defined element patterns and are the major source of sequence diversity. The SpTrf genes respond swiftly to immune challenge, but only a single gene is expressed per phagocyte. Many of the mRNAs appear to be edited and encode proteins with altered and/or missense sequence that are often truncated, of which some may be functional. The standard SpTrf protein structure is an N-terminal glycine-rich region, a central RGD motif, a histidine-rich region, and a C-terminal region. Function is predicted from a recombinant protein, rSpTransformer-E1 (rSpTrf-E1), which binds to Vibrio and Saccharomyces , but not to Bacillus , and binds tightly to lipopolysaccharide, β-1,3-glucan, and flagellin, but not to peptidoglycan. rSpTrf-E1 is intrinsically disordered but transforms to α helical structure in the presence of binding targets including lipopolysaccharide, which may underpin the characteristics of binding to multiple targets. SpTrf proteins associate with coelomocyte membranes, and rSpTrf-E1 binds specifically to phosphatidic acid (PA). When rSpTrf-E1 is bound to PA in liposome membranes, it induces morphological changes in liposomes that correlate with PA clustering and leakage of luminal contents, and it extracts or removes PA from the bilayer. The

  10. The SpTransformer Gene Family (Formerly Sp185/333) in the Purple Sea Urchin and the Functional Diversity of the Anti-Pathogen rSpTransformer-E1 Protein (United States)

    Smith, L. Courtney; Lun, Cheng Man


    The complex innate immune system of sea urchins is underpinned by several multigene families including the SpTransformer family (SpTrf; formerly Sp185/333) with estimates of ~50 members, although the family size is likely variable among individuals of Strongylocentrotus purpuratus. The genes are small with similar structure, are tightly clustered, and have several types of repeats in the second of two exons and that surround each gene. The density of repeats suggests that the genes are positioned within regions of genomic instability, which may be required to drive sequence diversification. The second exon encodes the mature protein and is composed of blocks of sequence called elements that are present in mosaics of defined element patterns and are the major source of sequence diversity. The SpTrf genes respond swiftly to immune challenge, but only a single gene is expressed per phagocyte. Many of the mRNAs appear to be edited and encode proteins with altered and/or missense sequence that are often truncated, of which some may be functional. The standard SpTrf protein structure is an N-terminal glycine-rich region, a central RGD motif, a histidine-rich region, and a C-terminal region. Function is predicted from a recombinant protein, rSpTransformer-E1 (rSpTrf-E1), which binds to Vibrio and Saccharomyces, but not to Bacillus, and binds tightly to lipopolysaccharide, β-1,3-glucan, and flagellin, but not to peptidoglycan. rSpTrf-E1 is intrinsically disordered but transforms to α helical structure in the presence of binding targets including lipopolysaccharide, which may underpin the characteristics of binding to multiple targets. SpTrf proteins associate with coelomocyte membranes, and rSpTrf-E1 binds specifically to phosphatidic acid (PA). When rSpTrf-E1 is bound to PA in liposome membranes, it induces morphological changes in liposomes that correlate with PA clustering and leakage of luminal contents, and it extracts or removes PA from the bilayer. The

  11. .i.Aspergillus baeticus./i. sp. nov. and .i.Aspergillus thesauricus./i. sp. nov., two species in section .i.Usti./i. from Spanish caves

    Czech Academy of Sciences Publication Activity Database

    Nováková, Alena; Hubka, Vít; Saiz-Jimenez, C.; Kolařík, Miroslav


    Roč. 62, November (2012), s. 2778-2785 ISSN 1466-5026 Grant - others:GAUK(CZ) 607812 Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z50200510 Keywords : Aspergillus baeticus sp. nov. * Aspergillus thesauricus sp.nov. * Spanish caves Subject RIV: EH - Ecology, Behaviour Impact factor: 2.112, year: 2012

  12. Babesia bicornis sp. nov. and Theileria bicornis sp. nov.: Tick-Borne Parasites Associated with Mortality in the Black Rhinoceros (Diceros bicornis) (United States)

    Nijhof, Ard M.; Penzhorn, Banie L.; Lynen, Godelieve; Mollel, Johnson O.; Morkel, Pete; Bekker, Cornelis P. J.; Jongejan, Frans


    A novel Babesia species, designated Babesia bicornis sp. nov., was identified in three black rhinoceroses (Diceros bicornis) that died in wildlife areas in Tanzania and South Africa. Screening of black rhinoceroses in South Africa revealed, in addition to B. bicornis, a second parasite, designated Theileria bicornis sp. nov. PMID:12734294

  13. ‘Prevotella ihumii’ sp. nov. and ‘Varibaculum timonense’ sp. nov., two new bacterial species isolated from a fresh human stool specimen

    Directory of Open Access Journals (Sweden)

    E. Guilhot


    Full Text Available Here we report the main characteristics of ‘Prevotella ihumii’ sp. nov., CSUR-P3385T and ‘Varibaculum timonense’ sp. nov., CSUR-P3369T isolated in September 2016 from a fresh stool sample of healthy French volunteer woman.

  14. Description of two smallest field crickets from South America, Laureopsis nauta Jaiswara gen. nov., sp. nov. and Perugryllus estiron Jaiswara gen. nov., sp. nov. (Orthoptera, Grylloidea, Gryllidae, Gryllinae). (United States)

    Jaiswara, Ranjana; Desutter-Grandcolas, Laure


    Gryllinae are one of the most diverse and widely distributed cricket groups. However, in South America they are known only from 10 genera. We update this list by describing two new genera and species of field crickets i.e. Laureopsis nauta Jaiswara gen. nov., sp. nov. and Perugryllus estiron Jaiswara gen. nov., sp. nov. from Peru.

  15. Comparative study on the degradation of dibutyl phthalate by two newly isolated Pseudomonas sp. V21b and Comamonas sp. 51F

    Directory of Open Access Journals (Sweden)

    Vinay Kumar


    Full Text Available Dibutyl phthalate is (DBP the top priority toxicant responsible for carcinogenicity, teratogenicity and endocrine disruption. This study demonstrates the DBP degradation capability of the two newly isolated bacteria from municipal solid waste leachate samples. The isolated bacteria were designated as Pseudomonas sp. V21b and Comamonas sp. 51F after scanning electron microscopy, transmission electron microscopy, Gram-staining, antibiotic sensitivity tests, biochemical characterization, 16S-rRNA gene identification and phylogenetic studies. They were able to grow on DBP, benzyl butyl phthalate, monobutyl phthalate, diisodecyl phthalate, dioctyl phthalate, and protocatechuate. It was observed that Pseudomonas sp. V21b was more efficient in DBP degradation when compared with Comamonas sp. 51F. It degraded 57% and 76% of the initial DBP in minimal salt medium and in DBP contaminated samples respectively. Kinetics for the effects of DBP concentration on Pseudomonas sp. V21b and Comamonas sp. 51F growth was also evaluated. Stoichiometry for DBP degradation and biomass formation were compared for both the isolates. Two major metabolites diethyl phthalate and monobutyl phthalates were identified using GC–MS in the extracts. Key genes were amplified from the genomes of Pseudomonas sp. V21b and Comamonas sp. 51F. DBP degradation pathway was also proposed.

  16. Surfactant protein D (SP-D) deficiency is attenuated in humanised mice expressing the Met(11)Thr short nucleotide polymorphism of SP-D

    DEFF Research Database (Denmark)

    Knudsen, Lars; Ochs, Katharina; Boxler, Laura


    Surfactant protein D (SP-D) is part of the innate immune system involved in lung homeostasis. SP-D knockout mice show accumulations of foamy alveolar macrophages, alveolar lipoproteinosis and pulmonary emphysema. Three single nucleotide polymorphisms (SNPs) have been described in the coding...

  17. Optimization of Culture Medium for the Growth of Candida sp. and Blastobotrys sp. as Starter Culture in Fermentation of Cocoa Beans (Theobroma cacao) Using Response Surface Methodology (RSM). (United States)

    Mahazar, N H; Zakuan, Z; Norhayati, H; MeorHussin, A S; Rukayadi, Y


    Inoculation of starter culture in cocoa bean fermentation produces consistent, predictable and high quality of fermented cocoa beans. It is important to produce healthy inoculum in cocoa bean fermentation for better fermented products. Inoculum could minimize the length of the lag phase in fermentation. The purpose of this study was to optimize the component of culture medium for the maximum cultivation of Candida sp. and Blastobotrys sp. Molasses and yeast extract were chosen as medium composition and Response Surface Methodology (RSM) was then employed to optimize the molasses and yeast extract. Maximum growth of Candida sp. (7.63 log CFU mL-1) and Blastobotrys sp. (8.30 log CFU mL-1) were obtained from the fermentation. Optimum culture media for the growth of Candida sp., consist of 10% (w/v) molasses and 2% (w/v) yeast extract, while for Blastobotrys sp., were 1.94% (w/v) molasses and 2% (w/v) yeast extract. This study shows that culture medium consists of molasses and yeast extract were able to produce maximum growth of Candida sp. and Blastobotrys sp., as a starter culture for cocoa bean fermentation.

  18. Production of Induced Secondary Metabolites by a Co-Culture of Sponge-Associated Actinomycetes, Actinokineospora sp. EG49 and Nocardiopsis sp. RV163

    Directory of Open Access Journals (Sweden)

    Yousef Dashti


    Full Text Available Two sponge-derived actinomycetes, Actinokineospora sp. EG49 and Nocardiopsis sp. RV163, were grown in co-culture and the presence of induced metabolites monitored by 1H NMR. Ten known compounds, including angucycline, diketopiperazine and β-carboline derivatives 1–10, were isolated from the EtOAc extracts of Actinokineospora sp. EG49 and Nocardiopsis sp. RV163. Co-cultivation of Actinokineospora sp. EG49 and Nocardiopsis sp. RV163 induced the biosynthesis of three natural products that were not detected in the single culture of either microorganism, namely N-(2-hydroxyphenyl-acetamide (11, 1,6-dihydroxyphenazine (12 and 5a,6,11a,12-tetrahydro-5a,11a-dimethyl[1,4]benzoxazino[3,2-b][1,4]benzoxazine (13a. When tested for biological activity against a range of bacteria and parasites, only the phenazine 12 was active against Bacillus sp. P25, Trypanosoma brucei and interestingly, against Actinokineospora sp. EG49. These findings highlight the co-cultivation approach as an effective strategy to access the bioactive secondary metabolites hidden in the genomes of marine actinomycetes.

  19. Zur Systematik der Stygocarididae (Crustacea, Syncardia) und beschreibung zweier neuer Arten (Stygocarella pleotelson Gen. n., Sp. n. und Stygocaris giselae Sp. n.)

    NARCIS (Netherlands)

    Schminke, Horst Kurt


    Two species of Stygocarididae are described: Stygocaris giselae sp. n. from Australia (Victoria) and Stygocarella pleotelson gen. n., sp. n. from New Zealand (Westland). A list is given of all known localities of Stygocarididae in New Zealand. The genus Oncostygocaris gen. n. is erected for

  20. Babesia bicornis sp. nov. and Theileria bicornis sp. nov.: Tick-Borne Parasites Associated with Mortality in the Black Rhinoceros (Diceros bicornis)


    Nijhof, Ard M.; Penzhorn, Banie L.; Lynen, Godelieve; Mollel, Johnson O.; Morkel, Pete; Bekker, Cornelis P. J.; Jongejan, Frans


    A novel Babesia species, designated Babesia bicornis sp. nov., was identified in three black rhinoceroses (Diceros bicornis) that died in wildlife areas in Tanzania and South Africa. Screening of black rhinoceroses in South Africa revealed, in addition to B. bicornis, a second parasite, designated Theileria bicornis sp. nov.

  1. Isolation of Paenibacillus sp. and Variovorax sp. strains from decaying woods and characterization of their potential for cellulose deconstruction. (United States)

    Ghio, Silvina; Lorenzo, Gonzalo Sabarís Di; Lia, Verónica; Talia, Paola; Cataldi, Angel; Grasso, Daniel; Campos, Eleonora


    Prospection of cellulose-degrading bacteria in natural environments allows the identification of novel cellulases and hemicellulases that could be useful in second-generation bioethanol production. In this work, cellulolytic bacteria were isolated from decaying native forest soils by enrichment on cellulose as sole carbon source. There was a predominance of Gram positive isolates that belonged to the phyla Proteobacteria and Firmicutes. Many primary isolates with cellulolytic activity were not pure cultures. From these consortia, isolation of pure constituents was attempted in order to test the hypothesis whether microbial consortia are needed for full degradation of complex substrates. Two isolates, CB1-2-A-5 and VG-4-A-2, were obtained as the pure constituents of CB1-2 and VG-4 consortia, respectively. Based on 16S RNA sequence, they could be classified as Variovorax paradoxus and Paenibacillus alvei. Noteworthy, only VG-4 consortium showed measurable xylan degrading capacity and signs of filter paper degradation. However, no xylan or filter paper degrading capacities were observed for the pure cultures isolated from it, suggesting that other members of this consortium were necessary for these hydrolyzing activities. Our results indicated that Paenibacillus sp. and Variovorax sp. as well as VG-4 consortium, might be a useful source of hydrolytic enzymes. Moreover, although Variovorax sp. had been previously identified in metagenomic studies of cellulolytic communities, this is the first report on the isolation and characterization of this microorganism as a cellulolytic genus.

  2. Transcriptional regulation of HIV-1 host factor COMMD1 by the Sp family. (United States)

    Kudo, Eriko; Taura, Manabu; Suico, Mary Ann; Goto, Hiroki; Kai, Hirofumi; Okada, Seiji


    Copper metabolism Murr1 domain containing 1 (COMMD1) has multiple functions in the regulation of protein stability at the plasma membrane and in the cytoplasm. However, the regulation of COMMD1 transcriptional has remained to be elucidated. In the present study, the 5'‑flanking region (‑1,192/+83 bp) of the human COMMD1 gene was cloned. It was observed that the COMMD1 promoter region contains GC‑rich region that has 7 putative Sp1‑binding sites via in silico analysis. The proximal promoter region at ‑289/+83 bp was required for COMMD1 basal promoter activity by deletion constructs of COMMD1 promoter. Moreover, Sp1 inhibitor, mithramycin A, suppressed basal COMMD1 promoter activity. The Sp1‑binding site (‑11/‑1 bp) in the proximal promoter region was a critical site for COMMD1 gene regulation by Sp1 and Sp3. Sp1 upregulated COMMD1 promoter activity, whereas Sp3 suppressed it. Endogenous Sp1 and Sp3 bound to the proximal promoter region of COMMD1. Taken together, Sp1 constitutively regulates the basal expression of the COMMD1 gene in human epithelial cell lines.

  3. Ligand structure-dependent activation of estrogen receptor alpha/Sp by estrogens and xenoestrogens. (United States)

    Wu, Fei; Khan, Shaheen; Wu, Qian; Barhoumi, Rola; Burghardt, Robert; Safe, Stephen


    This study investigated the effects of E2, diethylstilbestrol (DES), antiestrogens, the phytoestrogen resveratrol, and the xenoestrogens octylphenol (OP), nonylphenol (NP), endosulfan, kepone, 2,3,4,5-tetrachlorobiphenyl-4-ol (HO-PCB-Cl(4)), bisphenol-A (BPA), and 2,2-bis-(p-hydroxyphenyl)-1,1,1-trichloroethane (HPTE) on induction of luciferase activity in breast cancer cells transfected with a construct (pSp1(3)) containing three tandem GC-rich Sp binding sites linked to luciferase and wild-type or variant ERalpha. The results showed that induction of luciferase activity was highly structure-dependent in both MCF-7 and MDA-MB-231 cells. Moreover, RNA interference assays using small inhibitory RNAs for Sp1, Sp3 and Sp4 also demonstrated structure-dependent differences in activation of ERalpha/Sp1, ERalpha/Sp3 and ERalpha/Sp4. These results demonstrate for the first time that various structural classes of ER ligands differentially activate wild-type and variant ERalpha/Sp-dependent transactivation, selectively use different Sp proteins, and exhibit selective ER modulator (SERM)-like activity.


    Wu, Fei; Khan, Shaheen; Wu, Qian; Barhoumi, Rola; Burghardt, Robert; Safe, Stephen


    This study investigated the effects of E2, diethylstilbestrol (DES), antiestrogens, the phytoestrogen resveratrol, and the xenoestrogens octylphenol (OP), nonylphenol (NP), endosulfan, kepone, 2,3,4,5-tetrachlorobiphenyl-4-ol (HO-PCB-Cl4), bisphenol-A(BPA), and 2,2-bis-(p-hydroxyphenyl)-1,1,1-trichloroethane (HPTE) on induction of luciferase activity in breast cancer cells transfected with a construct (pSp13) containing three tandem GC-rich Sp binding sites linked to luciferase and wild-type or variant ERα. The results showed that induction of luciferase activity was highly structure-dependent in both MCF-7 and MDA-MB-231 cells. Moreover, RNA interference assays using small inhibitory RNAs for Sp1, Sp3 and Sp4 also demonstrated structure-dependent differences in activation of ERα/Sp1, ERα/Sp3 and ERα/Sp4. These results demonstrate for the first time that various structural classes of ER ligands differentially activate wild-type and variant ERα/Sp-dependent transactivation, selectively use different Sp proteins, and exhibit selective ER modulator (SERM)-like activity. PMID:18400491

  5. Inhibition of Sp1 functions by its sequestration into PML nuclear bodies.

    Directory of Open Access Journals (Sweden)

    June Li

    Full Text Available Promyelocytic leukemia nuclear bodies (PML NBs are comprised of PML and a striking variety of its associated proteins. Various cellular functions have been attributed to PML NBs, including the regulation of gene expression. We report here that induced expression of PML recruits Sp1 into PML NBs, leading to the reduction of Sp1 transactivation function. Specifically, Chromatin immunoprecipitation (ChIP assay demonstrated that induced expression of PML significantly diminishes the amount of Sp1 binding to its target gene promoter, immunofluorescence staining showed dramatic increase in the co-localization between PML and Sp1 upon induction of PML expression, moreover, PML and Sp1 co-fractionated in the core nuclear matrix. Our study further showed that PML promotes SUMOylation of Sp1 in a RING-motif-dependent manner, SUMOylation of Sp1 facilitates physical interaction between Sp1 and PML and recruitment of Sp1 into the PML NBs, the SUMO binding motif of PML was also important for its interaction with Sp1. The results of this study demonstrate a novel mechanism by which PML regulates gene expression through sequestration of the transcription factor into PML NBs.

  6. Bioremediation of crude oil waste contaminated soil using petrophilic consortium and Azotobacter sp.

    Directory of Open Access Journals (Sweden)

    M. Fauzi


    Full Text Available This study was aimed to determine the effect Petrophilic and Azotobacter sp. consortium on the rate of degradation of hydrocarbons, Azotobacter growth, and Petrophilic fungi growth in an Inceptisol contaminated with crude oil waste originating from Balongan refinery, one of Pertamina (Indonesia’s largest state-owned oil and gas company units in Indramayu – West Java. This study was conducted from March to April 2014 in the glasshouse of research station of the Faculty of Agriculture, Padjadjaran University at Ciparanje, Jatinangor District, Sumedang Regency of West Java. This study used a factorial completely randomized design with two treatments. The first treatment factor was Petrophilic microbes (A consisting of four levels (without treatment, 2% Petrophilic fungi, 2% Petrophilic bacteria, and the 2% Petrophilic consortium, and Azotobacter sp. The second treatment factor was Azotobacter sp. (B consisting of four levels (without treatment, 0.5%, Azotobacter sp., 1% Azotobacter sp., and 1.5% Azotobacter sp. The results demonstrated interaction between Petrophilic microbes and Azotobacter sp. towards hydrocarbon degradation rate, but no interaction was found towards the growth rate of Azotobacter sp. and Petrophilic fungi. Treatments of a1b3 (2% consortium of Petrophilic fungi with 1.5% Azotobacter sp. and a3b3 (2% Petrophilic consortium and 1.5% Azotobacter sp. had hydrocarbon degradation rate at 0.22 ppm/day for each treatment, showing the highest hydrocarbon degradation rate.

  7. Transcriptional activation of REST by Sp1 in Huntington's disease models.

    Directory of Open Access Journals (Sweden)

    Myriam Ravache


    Full Text Available In Huntington's disease (HD, mutant huntingtin (mHtt disrupts the normal transcriptional program of disease neurons by altering the function of several gene expression regulators such as Sp1. REST (Repressor Element-1 Silencing Transcription Factor, a key regulator of neuronal differentiation, is also aberrantly activated in HD by a mechanism that remains unclear. Here, we show that the level of REST mRNA is increased in HD mice and in NG108 cells differentiated into neuronal-like cells and expressing a toxic mHtt fragment. Using luciferase reporter gene assay, we delimited the REST promoter regions essential for mHtt-mediated REST upregulation and found that they contain Sp factor binding sites. We provide evidence that Sp1 and Sp3 bind REST promoter and interplay to fine-tune REST transcription. In undifferentiated NG108 cells, Sp1 and Sp3 have antagonistic effect, Sp1 acting as an activator and Sp3 as a repressor. Upon neuronal differentiation, we show that the amount and ratio of Sp1/Sp3 proteins decline, as does REST expression, and that the transcriptional role of Sp3 shifts toward a weak activator. Therefore, our results provide new molecular information to the transcriptional regulation of REST during neuronal differentiation. Importantly, specific knockdown of Sp1 abolishes REST upregulation in NG108 neuronal-like cells expressing mHtt. Our data together with earlier reports suggest that mHtt triggers a pathogenic cascade involving Sp1 activation, which leads to REST upregulation and repression of neuronal genes.

  8. PML nuclear body component Sp140 is a novel autoantigen in primary biliary cirrhosis. (United States)

    Granito, Alessandro; Yang, Wei-Hong; Muratori, Luigi; Lim, Mark J; Nakajima, Ayako; Ferri, Silvia; Pappas, Georgios; Quarneti, Chiara; Bianchi, Francesco B; Bloch, Donald B; Muratori, Paolo


    Some patients with primary biliary cirrhosis (PBC) have antinuclear antibodies (ANAs). These ANAs include the "multiple nuclear dots" (MND) staining pattern, targeting promyelocytic leukemia protein (PML) nuclear body (NB) components, such as "speckled 100-kD" protein (Sp100) and PML. A new PML NB protein, designated as Sp140, was identified using serum from a PBC patient. The aim of this study was to analyze the immune response against Sp140 protein in PBC patients. We studied 135 PBC patients and 157 pathological controls with type 1 autoimmune hepatitis, primary sclerosing cholangitis, and systemic lupus erythematosus. We used indirect immunofluorescence and a neuroblastoma cell line expressing Sp140 for detecting anti-Sp140 antibodies, and a commercially available immunoblot for detecting anti-Sp100 and anti-PML antibodies. Anti-Sp140 antibodies were present in 20 (15%) PBC patients but not in control samples, with a higher frequency in antimitochondrial antibody (AMA)-negative cases (53 vs. 9%, P<0.0001). Anti-Sp140 antibodies were found together with anti-Sp100 antibodies in all but one case (19 of 20, 90%) and with anti-PML antibodies in 12 (60%) cases. Anti-Sp140 positivity was not associated with a specific clinical feature of PBC. Our study identifies Sp140 as a new, highly specific autoantigen in PBC for the first time. The very frequent coexistence of anti-Sp140, anti-Sp100 and anti-PML antibodies suggests that the NB is a multiantigenic complex in PBC and enhances the diagnostic significance of these reactivities, which are particularly useful in AMA-negative cases.

  9. Superficial disposition of the N-terminal region of the surfactant protein SP-C and the absence of specific SP-B-SP-C interactions in phospholipid bilayers

    DEFF Research Database (Denmark)

    Plasencia, I; Cruz, A; Casals, C


    A dansylated form of porcine surfactant-associated protein C (Dns-SP-C), bearing a single dansyl group at its N-terminal end, has been used to characterize the lipid-protein and protein-protein interactions of SP-C reconstituted in phospholipid bilayers, using fluorescence spectroscopy...... of the N-terminal segment of the protein into less polar environments that originate during protein lateral segregation. This suggests that conformation and interactions of the N-terminal segment of SP-C could be important in regulating the lateral distribution of the protein in surfactant bilayers...

  10. Three new asexual arthroconidial yeasts, Geotrichum carabidarum sp. nov., Geotrichum histeridarum sp. nov., and Geotrichum cucujoidarum sp. nov., isolated from the gut of insects. (United States)

    Suh, Sung-Oui; Blackwell, Meredith


    Twenty arthroconidial yeasts were isolated from the digestive tract of basidiome-feeding beetles and lepidopteran larvae. All of the yeasts reproduced only asexually by arthroconidia and some by endo- or blastoconidia as well. Based on the comparisons of sequences in ribosomal RNA genes and other taxonomic characteristics, the yeasts were identified as three unknown Geotrichum species. The three new species are described as Geotrichum carabidarum (NRRL Y-27727T), G. histeridarum (NRRL Y-27729T), and G. cucujoidarum (NRRL Y-27731T). Phylogenetic analyses from ribosomal DNA sequences showed that members of the genus Geotrichum and related arthroconidial yeast taxa were divided into two major clades: (1) Dipodascus and Galactomyces with Geotrichum anamorphs including all the new species; and (2) Magnusiomyces with Saprochaete anamorphs. G. cucujoidarum formed a subclade with G. fermentans and Geotrichum sp. Y-5419, while the two closely related species, G. carabidarum and G. histeridarum, represent a new basal subclade in the clade of Geotrichum and its teleomorphs.

  11. Overexpression of transcription factor Sp1 leads to gene expression perturbations and cell cycle inhibition.

    Directory of Open Access Journals (Sweden)

    Emmanuelle Deniaud

    Full Text Available BACKGROUND: The ubiquitous transcription factor Sp1 regulates the expression of a vast number of genes involved in many cellular functions ranging from differentiation to proliferation and apoptosis. Sp1 expression levels show a dramatic increase during transformation and this could play a critical role for tumour development or maintenance. Although Sp1 deregulation might be beneficial for tumour cells, its overexpression induces apoptosis of untransformed cells. Here we further characterised the functional and transcriptional responses of untransformed cells following Sp1 overexpression. METHODOLOGY AND PRINCIPAL FINDINGS: We made use of wild-type and DNA-binding-deficient Sp1 to demonstrate that the induction of apoptosis by Sp1 is dependent on its capacity to bind DNA. Genome-wide expression profiling identified genes involved in cancer, cell death and cell cycle as being enriched among differentially expressed genes following Sp1 overexpression. In silico search to determine the presence of Sp1 binding sites in the promoter region of modulated genes was conducted. Genes that contained Sp1 binding sites in their promoters were enriched among down-regulated genes. The endogenous sp1 gene is one of the most down-regulated suggesting a negative feedback loop induced by overexpressed Sp1. In contrast, genes containing Sp1 binding sites in their promoters were not enriched among up-regulated genes. These results suggest that the transcriptional response involves both direct Sp1-driven transcription and indirect mechanisms. Finally, we show that Sp1 overexpression led to a modified expression of G1/S transition regulatory genes such as the down-regulation of cyclin D2 and the up-regulation of cyclin G2 and cdkn2c/p18 expression. The biological significance of these modifications was confirmed by showing that the cells accumulated in the G1 phase of the cell cycle before the onset of apoptosis. CONCLUSION: This study shows that the binding to DNA

  12. Cryptosporidium sp. em intestinos, bursa de Fabricius e traquéia de frangos (Gallus gallus sp Cryptosporidium sp. in intestines, bursa of Fabricius and poultry trachea (Gallus gallus sp

    Directory of Open Access Journals (Sweden)

    Gislaine Jacobsen


    Full Text Available Parasitas do gênero Cryptosporidium infectam várias espécies de animais, e a enfermidade resultante é a criptosporidiose, importante zoonose de distribuição mundial. Em aves, a infecção tem sido reportada em várias espécies. Este trabalho objetivou identificar a presença do parasita em 208 amostras de bursa de Fabricius, 208 amostras de intestino e 208 de traquéia, coletadas de frangos (Gallus gallus sp de diferentes idades, abatidos em três propriedades rurais do município de Santa Maria, RS. Foram feitas três impressões de cada amostra em lâminas para microscopia, coradas pelas técnicas de Ziehl Neelsen modificada com Dimetil Sulfóxido (DMSO, Ziehl Neelsen modificada por Henriksen e Pohlens (HP, Ziehl Neelsen (ZN e Kinyoun (K, perfazendo 1872 impressões analisadas em microscopia óptica (1000 x. Neste total, nas diferentes colorações empregadas, oocistos do parasita Cryptosporidium sp. foram visualizados em 18 impressões de traquéia, 42 de bursa de Fabricius e 29 de intestino, resultando positivas, portanto, 89 impressões. Destas, 44 foram identificadas pela técnica de DMSO, 32 por HP, três por ZN e 10 por K. Pode-se concluir que os oocistos do parasita Cryptosporidium sp. foram visualizados com maior freqüência nas impressões de bursa de Fabricius, e que o método de coloração, dentre os utilizados, que proporcionou a maior visualização dos oocistos foi o DMSO.Parasites of the gennus Cryptosporidium infect several animal species.The disease resultant is the criptosporidiosis, an important zoonosis spreaded worldwide. In poultry, the infection has been reported in several species. This study goal was to identify the parasite presence in 208 bursa of Fabricius samples, 208 intestine and 208 of trachea, collected at chicks (Gallus gallus sp of different ages, killed at three farms in Santa Maria city, Rio Grande do Sul State, Brazil. Three printings of each sample were done,on glass slides colored through the

  13. [Biofilm Formation by the Nonflagellated flhB1 Mutant of Azospirillum brasilense Sp245]. (United States)

    Shelud'ko, A V; Filip'echeva, Yu A; Shumiliva, E M; Khlebtsov, B N; Burov, A M; Petrova, L P; Katsy, E I


    Azospirillum brasilense Sp245 with mixed flagellation are able to form biofilms on various surfaces. A nonflagellated mutant of this strain with inactivated chromosomal copy of the flhB gene (flhB1) was shown to exhibit specific traits at the later stages of biofilm formation on a hydrophilic (glass) surface. Mature biofilms of the flhB1::Omegon-Km mutant Sp245.1063 were considerably thinner than those of the parent strain Sp245. The biofilms of the mutant were more susceptible to the forces of hydrodynamic shear. A. brasilense Sp245 cells in biofilms were not found to possess lateral flagella. Cells with polar flagella were, however, revealed by atomic force microscopy of mature native biofilms of strain Sp245. Preservation of a polar flagellum (probably nonmotile) on the cells of A. brasilense Sp245 may enhance the biofilm stability.

  14. Programmēšanas spēle "PyDrone"


    Siliņš, Viesturs


    Darbā “Programmēšanas spēle “PyDrone”” ir dokumentēta atvērtā koda programmas PyDrone izstrāde. PyDrone ir programmēšanas spēle, kas paredzēta izklaidei un izglītošanai, spēles veidā iepazīstinot cilvēkus ar programmēšanu. Programma izstrādāta, izmantojot Python programmēšanas valodu. Programma izstrādāta, izmantojot spējo metodiku programmizstrādes principus. Atslēgvārdi: Python, spējās metodikas, programmēšanas spēle.

  15. Space nuclear reactor SP-100 thermal-hydraulic simulation

    International Nuclear Information System (INIS)

    Borges, Eduardo M.; Braz Filho, Francisco A.; Camillo, Giannino P.; Guimaraes, Lamartine N.F.


    Since 1983 it has been under development in the USA the project SP-100 of space nuclear reactors for electric generation in a range of 100 to 1000 KWe. In this project the heat is generated at the core of a fast compact liquid lithium refrigerated reactor. Thermoelectric converters produce direct current electric energy and the primary and secondary loops flow is controlled by electromagnetic thermoelectric pumps (EMTE). In this work it is studied a system with a fast nuclear reactor, with similar characteristics to the SP-100, aiming at generating high electric power in space for a future application on the TERRA (Advanced Fast Reactor Technology) Project of IEAv (Institute for Advanced Studies). It will be presented the working principles, basic structure and operation characteristics of an electromagnetic thermoelectric pump (EMTE) for a liquid metal cooled nuclear reactor refrigeration loops flow control. In order to determine the operating point of the reactor, it is indispensable the simulation of the EMTE pump along with the other components of the system, once all the working parameters are connected. So, it has been developed a computer system, named BEMTE-3 (a FORTRAN micro-computer code), which simulates the primary and secondary refrigeration components of liquid metal cooled fast space reactor. This computer code also simulates the thermoelectric conversion, with the flow being controlled by the EMTE pump with thermoelectric converters, determining the system operation point for a given nominal operating power. The BEMTE-3 is used for the study of the SP-100 primary and secondary loops thermal-hydraulic simulation and for the calculation of the operating point of the system based on data from available projects. (author)

  16. Regulation of xylanase activity in cellulomonas Sp. IIbc

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, H.; Alea, F. (Cuban Research Inst. for Sugar Cane By-Products (ICIDCA), La Habana (Cuba))


    The regulation mechanism governing the xylanolytic activity in the strain Cellulomonas sp. IIbc was studied. High levels of activity were detected during the cultivation on cellulose as the only carbon source. No activity was produced with glucose, xylose or cellobiose cultures, but in the last one, the synthesis was de-repressed when the sugar concentration dropped to 0.2%. The activity was not inhibited by glucose, cellobiose and xylose up to 1% concentration. A basal constitutive synthesis was detected in nutrient broth cultures. At the same time, xylose and cellobiose acted as inducers of the xylanase activity. (orig.).


    Directory of Open Access Journals (Sweden)

    Asadatun Abdullah


    Full Text Available Sponges are host organisms for various symbiotic microorganisms. Various symbiotic microorganisms have been found in Sponges such as archaea, heterotrophic bacteria, cyanobacteria, green algae, red algae, cryptophytes, dinoflagellates, and diatoms. The objectives of the research were to isolate and identify teh Axinella sp. Sponge-symbiotic microoganisms such asbacteria, micro fungi, and yeast. Sponge-symbiotic microoganisms that have been isolated cosisted of 7 bacteria isolates, 3 micro fungi, and 2 yeast isolates. Result from this research showed that the genus of bacteria was Alteromonas, Bacillus, and 2 yeast isolates have not been to identified.

  18. Renierosides, cerebrosides from a marine sponge Haliclona (Reniera) sp. (United States)

    Mansoor, Tayyab A; Shinde, Pramod B; Luo, Xuan; Hong, Jongki; Lee, Chong-O; Sim, Chung Ja; Son, Byeng Wha; Jung, Jee H


    Guided by the brine shrimp lethality assay, eight new cerebrosides (1-8) have been isolated from an extract of the marine sponge Haliclona (Reniera) sp. A novel feature of these cerebrosides was the presence of unprecedented amide-linked long-chain fatty acid moieties. The planar structures of the cerebrosides (1-8) were established by 1D and 2D NMR spectroscopic techniques, mass spectrometric analyses, and chemical degradation methods. The isolated compounds did not display cytotoxicity to a panel of five human solid tumor cell lines.

  19. Novel Adociaquinone Derivatives from the Indonesian Sponge Xestospongia sp.

    Directory of Open Access Journals (Sweden)

    Fei He


    Full Text Available Seven new adociaquinone derivatives, xestoadociaquinones A (1a, B (1b, 14-carboxy-xestoquinol sulfate (2 and xestoadociaminals A–D (3a, 3c, 4a, 4c, together with seven known compounds (5–11 were isolated from an Indonesian marine sponge Xestospongia sp. Their structures were elucidated by extensive 1D and 2D NMR and mass spectrometric data. All the compounds were evaluated for their potential inhibitory activity against eight different protein kinases involved in cell proliferation, cancer, diabetes and neurodegenerative disorders as well as for their antioxidant and antibacterial activities.

  20. Novel Adociaquinone Derivatives from the Indonesian Sponge Xestospongia sp. (United States)

    He, Fei; Mai, Linh H; Longeon, Arlette; Copp, Brent R; Loaëc, Nadège; Bescond, Amandine; Meijer, Laurent; Bourguet-Kondracki, Marie-Lise


    Seven new adociaquinone derivatives, xestoadociaquinones A (1a), B (1b), 14-carboxy-xestoquinol sulfate (2) and xestoadociaminals A-D (3a, 3c, 4a, 4c), together with seven known compounds (5-11) were isolated from an Indonesian marine sponge Xestospongia sp. Their structures were elucidated by extensive 1D and 2D NMR and mass spectrometric data. All the compounds were evaluated for their potential inhibitory activity against eight different protein kinases involved in cell proliferation, cancer, diabetes and neurodegenerative disorders as well as for their antioxidant and antibacterial activities.

  1. Novel Adociaquinone Derivatives from the Indonesian Sponge Xestospongia sp. (United States)

    He, Fei; Mai, Linh H.; Longeon, Arlette; Copp, Brent R.; Loaëc, Nadège; Bescond, Amandine; Meijer, Laurent; Bourguet-Kondracki, Marie-Lise


    Seven new adociaquinone derivatives, xestoadociaquinones A (1a), B (1b), 14-carboxy-xestoquinol sulfate (2) and xestoadociaminals A–D (3a, 3c, 4a, 4c), together with seven known compounds (5–11) were isolated from an Indonesian marine sponge Xestospongia sp. Their structures were elucidated by extensive 1D and 2D NMR and mass spectrometric data. All the compounds were evaluated for their potential inhibitory activity against eight different protein kinases involved in cell proliferation, cancer, diabetes and neurodegenerative disorders as well as for their antioxidant and antibacterial activities. PMID:25927661

  2. Nanostructured sp2-carbon infiltration of mesoporous silicon layers. (United States)

    Polini, Riccardo; Valentini, Veronica; Mattei, Giorgio


    The preparation of composite layers made of porous silicon (PS) infiltrated with nanostructured carbon is reported. These composite layers were obtained by chemical vapor infiltration (CVI) of mesoporous silicon under process conditions normally employed to grow diamond films by Hot Filament Chemical Vapour Deposition (HFCVD). Micro-Raman spectroscopy and Field Emission Gun Scanning Electron Microscopy (FEG-SEM) techniques showed that diamond nucleation density was very low whilst sp2 carbon permeated completely, even after 1 h deposition, the thickness of the PS layers that preserved their mesoporous columnar structure.

  3. [Rhabditis sp. infected cases in rural school children (United States)

    Ahn, Yung Kyum; Chung, Pyung Rim; Lee, Keun Tae


    Five cases infected with Rhabditis sp. were detected in a survey to examine the stool specimen from rural primary school children. A large number of the larvae of Rhabditis sp. detected by the direct cellophane thick smear were cultured by the filter paper method. The examination was carried out in April through June 1980 in Tangjeong-Myon, Ahsan-Gun, and in September 1983 in Sandong-Eup, Yeongwol-Gun. The results obtained in this study were as follows: Prevalence: Out of 925 children, 5(0.54%) children were found to be positive. The number of the detected larvae was 110/0.1 gm of feces in case 1, 35 in case 2, 130 in case 3, 86 in case 4 and 62 in case 5. Larvae: The larvae were prepared by means of the direct fecal smear and measured by a micrometer equipped in the microscope. Twelve(12) through 15-day old larvae in culture were 197.1 micrometer long in average, and the maximum size of the matured stage larvae was 884.0 x 25.9 micrometer. However, the length variation was ranged as 173.0 to 884.0 micrometer. Adults: The size of clubbed adult female was 1,357 micrometer(1,176~1,419) in length and 80 micrometer(79~82) in width. Length of buccal cavity was 33 micrometer. A long cylindrical esophagus (273 micrometer) of the worms with a valved posterior cardiac bulb and with median bulbar swelling was morphologically indicated. Distance from mouth to vulva was occupied 58 percent of body length. Male worm was 1,006 micrometer (890~1,148) in length and 49 micrometer(48~49) wide. Caudal alae of bursa and spicules (75 micrometer in length) were well developed. Eggs: The oval shaped eggs in the female uterus, when cultured, were 66 x 56 micrometer in size, and the eggs laid by the adult could not be detected. So, reproduction might be through to be ovoviviparity. The five cases were re-examined during the period from the 1st to the 3rd week after stool examinations, but Rhabditis sp. were detected again in 4 cases in 1st week. When they were examined in 3rd week, larvae

  4. Antimicrobials from the marine algal endophyte Penicillium sp. (United States)

    Flewelling, Andrew J; Johnson, John A; Gray, Christopher A


    An endophytic fungus identified as Penicillium sp. was isolated from the brown alga Fucus spiralis collected from the Shetland Islands, United Kingdom. Bioassay-guided fractionation of an extract of the fungus led to the isolation of cladosporin, epiepoformin, phyllostine, and patulin, all of which showed antimicrobial activity against either Staphylococcus aureus or Pseudomonas aeruginosa. Cladosporin has not previously been identified from a fungus of the genus Penicillium, and, despite being biosynthetically related, epiepoformin, phyllostine and patulin have not been previously reported from one source.

  5. Hubungan Kemelimpahan Chlorella sp Dengan Kualitas Lingkungan Perairan Pada Skala Semi Masal di BBBPBAP Jepara


    Siska Aprilliyanti; Tri Retnaningsih Soeprobowati; Bambang Yulianto


    ABSTRAK Chlorella   sp merupakan salah satu mikroalga yang sering dibudidayakan untuk berbagai keperluan seperti obat-obatan, kosmetik, atau untuk alternatif  biodiesel Chlorella    sp  merupakan suatu agen bioremediasi yang baik, selain dapat hidup pada lingkungan yang tercemar juga dapat memakai logam berat sebagai logam esensial untuk metabolisme. Banyaknya manfaat yang akan dapat diambil apabila dapat mengembangkan Chlorella    sp pada skala masal. Dengan kemanfaatannya dari Chlorella...



    Maria Theresia Darini


    The study aims to determine the types, population, frequency and dominance Aloe sp. plant has been conducted in Yogyakarta, from March up to September 2012. Research carried out by the method of vegetation analysis through surveys and sampling of the Aloe sp. plant locations, districts in the regency and in the province Special Region of Yogyakarta. To determine the types of Aloe sp. plants using descriptions that are tailored to the identification of key observations dichotomi...

  7. Vibrio sp. DSM 14379 pigment production--a competitive advantage in the environment? (United States)

    Starič, Nejc; Danevčič, Tjaša; Stopar, David


    The ability to produce several antibacterial agents greatly increases the chance of producer's survival. In this study, red-pigmented Vibrio sp. DSM 14379 and Bacillus sp., both isolated from the same sampling volume from estuarine waters of the Northern Adriatic Sea, were grown in a co-culture. The antibacterial activity of the red pigment extract was tested on Bacillus sp. in microtiter plates. The MIC(50) for Bacillus sp. was estimated to be around 10⁻⁵ mg/L. The extract prepared form the nonpigmented mutant of Vibrio sp. had no antibacterial effect. The pigment production of Vibrio sp. was studied under different physicochemical conditions. There was no pigment production at high or low temperatures, high or low salt concentrations in peptone yeast extract (PYE) medium, low glucose concentration in mineral growth medium or high glucose concentration in PYE medium. This indicates that the red pigment production is a luxurious good that Vibrio sp. makes only under favorable conditions. The Malthusian fitness of Bacillus sp. in a co-culture with Vibrio sp. under optimal environmental conditions dropped from 4.0 to -7.6, which corresponds to three orders of magnitude decrease in the number of CFU relative to the monoculture. The nonpigmented mutant of Vibrio sp. in a co-culture with Bacillus sp. had a significant antibacterial activity. This result shows that studying antibacterial properties in isolation (i.e. pigment extract only) may not reveal full antibacterial potential of the bacterial strain. The red pigment is a redundant antibacterial agent of Vibrio sp.

  8. Aspirin Inhibits Colon Cancer Cell and Tumor Growth and Downregulates Specificity Protein (Sp) Transcription Factors (United States)

    Pathi, Satya; Jutooru, Indira; Chadalapaka, Gayathri; Nair, Vijayalekshmi; Lee, Syng-Ook; Safe, Stephen


    Acetylsalicylic acid (aspirin) is highly effective for treating colon cancer patients postdiagnosis; however, the mechanisms of action of aspirin in colon cancer are not well defined. Aspirin and its major metabolite sodium salicylate induced apoptosis and decreased colon cancer cell growth and the sodium salt of aspirin also inhibited tumor growth in an athymic nude mouse xenograft model. Colon cancer cell growth inhibition was accompanied by downregulation of Sp1, Sp3 and Sp4 proteins and decreased expression of Sp-regulated gene products including bcl-2, survivin, VEGF, VEGFR1, cyclin D1, c-MET and p65 (NFκB). Moreover, we also showed by RNA interference that β-catenin, an important target of aspirin in some studies, is an Sp-regulated gene. Aspirin induced nuclear caspase-dependent cleavage of Sp1, Sp3 and Sp4 proteins and this response was related to sequestration of zinc ions since addition of zinc sulfate blocked aspirin-mediated apoptosis and repression of Sp proteins. The results demonstrate an important underlying mechanism of action of aspirin as an anticancer agent and, based on the rapid metabolism of aspirin to salicylate in humans and the high salicylate/aspirin ratios in serum, it is likely that the anticancer activity of aspirin is also due to the salicylate metabolite. PMID:23110215

  9. Application of pregnancy specific β1 glycoprotein-radioimmunoassay (SP1-ria) in obstetrics and gynecology

    International Nuclear Information System (INIS)

    Zhang Weiyuan


    Serum SP 1 values of 395 patients were determined by radioimmunoassay. It was found that SP 1 was apparently absent from the blood of normal men and nonpregnant women, increased with gestational stage in pregnant women, and was highest in late pregnancy. In high-risk pregnancy, SP 1 was lower than normal pregnamey group (PC0.01) could also be detected in ectopic pregnancy. In patients with benign and malignant hydatidiform mole, and choriocarcinoma, AP 1 level decreased with malignant degree. The authors suggest that measurement of SP 1 levels is a valuable index for monitoring high-risk pregnancy, diagnosing ectopic pregnancy and following-up trophoblastic cell diseases

  10. Phosphorylation of the transcription factor Sp4 is reduced by NMDA receptor signaling. (United States)

    Saia, Gregory; Lalonde, Jasmin; Sun, Xinxin; Ramos, Belén; Gill, Grace


    The regulation of transcription factor function in response to neuronal activity is important for development and function of the nervous system. The transcription factor Sp4 regulates the developmental patterning of dendrites, contributes to complex processes including learning and memory, and has been linked to psychiatric disorders such as schizophrenia and bipolar disorder. Despite its many roles in the nervous system, the molecular mechanisms regulating Sp4 activity are poorly understood. Here, we report a site of phosphorylation on Sp4 at serine 770 that is decreased in response to membrane depolarization. Inhibition of the voltage-dependent NMDA receptor increased Sp4 phosphorylation. Conversely, stimulation with NMDA reduced the levels of Sp4 phosphorylation, and this was dependent on the protein phosphatase 1/2A. A phosphomimetic substitution at S770 impaired the Sp4-dependent maturation of cerebellar granule neuron primary dendrites, whereas a non-phosphorylatable Sp4 mutant behaved like wild type. These data reveal that transcription factor Sp4 is regulated by NMDA receptor-dependent activation of a protein phosphatase 1/2A signaling pathway. Our findings also suggest that the regulated control of Sp4 activity is an important mechanism governing the developmental patterning of dendrites. © 2014 International Society for Neurochemistry.

  11. Sp100 colocalizes with HPV replication foci and restricts the productive stage of the infectious cycle.

    Directory of Open Access Journals (Sweden)

    Wesley H Stepp


    Full Text Available We have shown previously that Sp100 (a component of the ND10 nuclear body represses transcription, replication and establishment of incoming human papillomavirus (HPV DNA in the early stages of infection. In this follow up study, we show that Sp100 does not substantially regulate viral infection in the maintenance phase, however at late stages of infection Sp100 interacts with amplifying viral genomes to repress viral processes. We find that Sp100 localizes to HPV16 replication foci generated in primary keratinocytes, to HPV31 replication foci that form in differentiated cells, and to HPV16 replication foci in CIN 1 cervical biopsies. To analyze this further, Sp100 was down regulated by siRNA treatment of differentiating HPV31 containing cells and levels of viral transcription and replication were assessed. This revealed that Sp100 represses viral transcription and replication in differentiated cells. Analysis of Sp100 binding to viral chromatin showed that Sp100 bound across the viral genome, and that binding increased at late stages of infection. Therefore, Sp100 represses the HPV life cycle at both early and late stages of infection.

  12. Cdc20 mediates D-box-dependent degradation of Sp100

    International Nuclear Information System (INIS)

    Wang, Ran; Li, Ke-min; Zhou, Cai-hong; Xue, Jing-lun; Ji, Chao-neng; Chen, Jin-zhong


    Highlights: ► Cdc20 is a co-activator of APC/C complex. ► Cdc20 recruits Sp100 and mediates its degradation. ► The D-box of Sp100 is required for Cdc20-mediated degradation. ► Sp100 expresses consistently at both the mRNA and protein levels in cell cycle. -- Abstract: Cdc20 is a co-activator of the anaphase-promoting complex/cyclosome (APC/C complex), which recruits substrates at particular phases of the cell cycle and mediates their degradation. Sp100 is a PML-NB scaffold protein, which localizes to nuclear particles during interphase and disperses from them during mitosis, participates in viral resistance, transcriptional regulation, and apoptosis. However, its metabolism during the cell cycle has not yet been fully characterized. We found a putative D-box in Sp100 using the Eukaryotic Linear Motif (ELM) predictor database. The putative D-box of Sp100 was verified by mutational analysis. Overexpression of Cdc20 resulted in decreased levels of both endogenous Sp100 protein and overexpressed Sp100 mRNA in HEK 293 cells. Only an overexpressed D-box deletion mutant of Sp100 accumulated in HEK293 cells that also overexpressed Cdc20. Cdc20 knockdown by cdc20 specific siRNA resulted in increased Sp100 protein levels in cells. Furthermore, we discovered that the Cdc20 mediated degradation of Sp100 is diminished by the proteasome inhibitor MG132, which suggests that the ubiquitination pathway is involved in this process. However, unlike the other Cdc20 substrates, which display oscillating protein levels, the level of Sp100 protein remains constant throughout the cell cycle. Additionally, both overexpression and knockdown of endogenous Sp100 had no effect on the cell cycle. Our results suggested that sp100 is a novel substrate of Cdc20 and it is degraded by the ubiquitination pathway. The intact D-box of Sp100 was necessary for this process. These findings expand our knowledge of both Sp100 and Cdc20 as well as their role in ubiquitination.

  13. Synthetic lung surfactants containing SP-B and SP-C peptides plus novel phospholipase-resistant lipids or glycerophospholipids

    Directory of Open Access Journals (Sweden)

    Robert H. Notter


    Full Text Available Background This study examines the biophysical and preclinical pulmonary activity of synthetic lung surfactants containing novel phospholipase-resistant phosphonolipids or synthetic glycerophospholipids combined with Super Mini-B (S-MB DATK and/or SP-Css ion-lock 1 peptides that replicate the functional biophysics of surfactant proteins (SP-B and SP-C. Phospholipase-resistant phosphonolipids used in synthetic surfactants are DEPN-8 and PG-1, molecular analogs of dipalmitoyl phosphatidylcholine (DPPC and palmitoyl-oleoyl phosphatidylglycerol (POPG, while glycerophospholipids used are active lipid components of native surfactant (DPPC:POPC:POPG 5:3:2 by weight. The objective of the work is to test whether these novel lipid/peptide synthetic surfactants have favorable preclinical activity (biophysical, pulmonary for therapeutic use in reversing surfactant deficiency or dysfunction in lung disease or injury. Methods Surface activity of synthetic lipid/peptide surfactants was assessed in vitro at 37 °C by measuring adsorption in a stirred subphase apparatus and dynamic surface tension lowering in pulsating and captive bubble surfactometers. Shear viscosity was measured as a function of shear rate on a Wells-Brookfield micro-viscometer. In vivo pulmonary activity was determined by measuring lung function (arterial oxygenation, dynamic lung compliance in ventilated rats and rabbits with surfactant deficiency/dysfunction induced by saline lavage to lower arterial PO2 to <100 mmHg, consistent with clinical acute respiratory distress syndrome (ARDS. Results Synthetic surfactants containing 5:3:2 DPPC:POPC:POPG or 9:1 DEPN-8:PG-1 combined with 3% (by wt of S-MB DATK, 3% SP-Css ion-lock 1, or 1.5% each of both peptides all adsorbed rapidly to low equilibrium surface tensions and also reduced surface tension to ≤1 mN/m under dynamic compression at 37 °C. However, dual-peptide surfactants containing 1.5% S-MB DATK + 1.5% SP-Css ion-lock 1 combined with

  14. Synthetic lung surfactants containing SP-B and SP-C peptides plus novel phospholipase-resistant lipids or glycerophospholipids. (United States)

    Notter, Robert H; Gupta, Rohun; Schwan, Adrian L; Wang, Zhengdong; Shkoor, Mohanad Gh; Walther, Frans J


    This study examines the biophysical and preclinical pulmonary activity of synthetic lung surfactants containing novel phospholipase-resistant phosphonolipids or synthetic glycerophospholipids combined with Super Mini-B (S-MB) DATK and/or SP-Css ion-lock 1 peptides that replicate the functional biophysics of surfactant proteins (SP)-B and SP-C. Phospholipase-resistant phosphonolipids used in synthetic surfactants are DEPN-8 and PG-1, molecular analogs of dipalmitoyl phosphatidylcholine (DPPC) and palmitoyl-oleoyl phosphatidylglycerol (POPG), while glycerophospholipids used are active lipid components of native surfactant (DPPC:POPC:POPG 5:3:2 by weight). The objective of the work is to test whether these novel lipid/peptide synthetic surfactants have favorable preclinical activity (biophysical, pulmonary) for therapeutic use in reversing surfactant deficiency or dysfunction in lung disease or injury. Surface activity of synthetic lipid/peptide surfactants was assessed in vitro at 37 °C by measuring adsorption in a stirred subphase apparatus and dynamic surface tension lowering in pulsating and captive bubble surfactometers. Shear viscosity was measured as a function of shear rate on a Wells-Brookfield micro-viscometer. In vivo pulmonary activity was determined by measuring lung function (arterial oxygenation, dynamic lung compliance) in ventilated rats and rabbits with surfactant deficiency/dysfunction induced by saline lavage to lower arterial PO 2 to surfactants containing 5:3:2 DPPC:POPC:POPG or 9:1 DEPN-8:PG-1 combined with 3% (by wt) of S-MB DATK, 3% SP-Css ion-lock 1, or 1.5% each of both peptides all adsorbed rapidly to low equilibrium surface tensions and also reduced surface tension to ≤1 mN/m under dynamic compression at 37 °C. However, dual-peptide surfactants containing 1.5% S-MB DATK + 1.5% SP-Css ion-lock 1 combined with 9:1 DEPN-8:PG-1 or 5:3:2 DPPC:POPC:POPG had the greatest in vivo activity in improving arterial oxygenation and dynamic lung

  15. The difference of anti-inflammatory effect of brown algae extract Padina sp. and Sargassum sp. that is derived from Punaga beach, South Sulawesi

    Directory of Open Access Journals (Sweden)

    Asmawati Asmawati


    Full Text Available The aim of this research is to evaluate the difference of anti-inflammatory effect of brown algae extract Padina sp. and Sargassum sp. that is derived from Punaga beach, South Sulawesi toward mice. Seaweed is one of resourceful plants in Indonesian ocean. Some researchers suggested that brown seaweed has a potential to be an anti-inflammatory agent because of it contains polysaccharide sulfate, PUFA, and fuchosantin. Punaga village that is located in South Sulawesi is an area with most of their people work as seaweed farmer and cultivation of seaweed. This is the reason why researcher found it interest to use natural sources as an alternative of herbal medicine especially as an anti-inflamatory.As many as 20 male mice were used as sample in this study weighing 14-35 g and divided into four treatment groups (n=5. Group 1 as positive control with 5 mice for sample, use diclofenac sodium solution 0.35 mg/35 g body weight. Group 2 as negative control with 5 mice for sample use NaCMC solution. Group 3 with also 5 mice for sample use methanol extract of Padina sp. with dose 7 mg/35 g body weight. And group 4 with 5 mice use methanol extract of Sargassum sp. with dose 6.125 mg/35 g body weight. Thirty minutes after injection of test material, 0.5 ml pepton 1% is injected into mice leg. The assessment of mice leg use plethysmometer that is taken on the first hour until fourth hour after injection of pepton 1%. Data analysis use T-test to find out the difference of anti-inflamatory effect of brown algae extract Padina sp. and Sargassum sp. Based on the result of this study, it showed that brown algae extract Padina sp has P (0.025 < 0.05 and brown algae extract Sargassum sp. has P (0.02 < 0.05 which means that there are anti-inflammatory effect found in both test materials. And it is also found that brown algae extract Padina sp. has longer anti inflammatory effect half time than in brown algae extract Sargassum sp. Brown algae extract

  16. Value of imaging procedures for the diagnosis of sclerosing peritonitis (SP) after chronic ambulatory peritoneal dialysis (CAPD). Bildgebende Diagnostik der sklerosierenden Peritonitis (SP) nach kontinuierlicher ambulanter Peritonealdialyse (CAPD)

    Energy Technology Data Exchange (ETDEWEB)

    Krestin, G.P. (Dept. Medizinische Radiologie, Universitaetsspital Zurich (Switzerland)); Kacl, G. (Dept. Medizinische Radiologie, Universitaetsspital Zurich (Switzerland)); Hoffmann, R. (Dept. Chirurgie, Universitaetsspital Zurich (Switzerland)); Keusch, G. (Dept. Innere Medizin, Universitaetsspital Zurich (Switzerland)); Burger, H.R. (Inst. fuer Pathologie, Universitaetsspital Zurich (Switzerland))


    Sclerosing peritonitis is a serious complication of CAPD characterised by thickened peritoneal membranes which lead to decreased ultrafiltration and intestinal obstruction. The roentgenographic signs of SP were analysed in 11 patients who underwent plain X-ray of the abdomen, follow-through examinations of the small bowel, ultrasonography and computed tomography. Results were correlated with the histological degree of SP. Due to the fact that postoperative complications often occur in patients with SP, detection of the radiological signs should lead to cautious surgical interventions and changeover to haemodialysis. (orig./GDG)

  17. Structural Analysis of Planar sp3 and sp2 Films: Diamond-Like Carbon and Graphene Overlayers

    KAUST Repository

    Mansour, Ahmed


    The special electronic configuration of carbon enables the existence of wide ranging allotropes taking all possible dimensionalities. The allotropes of carbon are characterized by the type of hybridized bonding forming its structure, ranging from pure sp2 as in graphene, carbon nanotubes and fullerenes, to pure sp3 as in diamond. Amorphous and diamond-like carbon consists of a mixture of both hybridizations. This variation in hybridization in carbon materials enables a wide spectrum of properties, ranging from high bulk mechanical hardness, tribological properties and chemical inertness made possible by moving towards pure sp3 bonding to the extraordinary electrical conductivity, optical properties and in-plane mechanical strength resulting from pure sp2 bonding. Two allotropes at the extremes of this spectrum, diamond like carbon (DLC) and graphene, are investigated in this thesis; the former is investigated as a protective coating in hard drive applications, while the latter is investigated in the context of chemically derived graphene as material for transparent conducting electrode applications. DLC thin films are a main component in computer hard drives, acting as a protective coating against corrosion and mechanical wear of the magnetic layer and read-write head. The thickness of DLC films greatly affects the storage density in such devices, as larger separation between the read/write head and the magnetic layer decreases the storage density. A targeted DLC thickness of 2 nm would increase the storage density towards 1 Tbits/inch2. However, difficulty achieving continuous films at such thicknesses by commonly used sputtering methods challenges the industry to investigate alternative methods. Filtered cathodic vacuum arc (FCVA) has been proposed as an efficient technique to provide continuous, smooth and ultra-thin DLC films. We investigate the influence of deposition angle, deposition time, and substrate biasing to define the optimum process window to obtain

  18. Description of Endozoicomonas ascidiicola sp. nov., isolated from Scandinavian ascidians. (United States)

    Schreiber, Lars; Kjeldsen, Kasper Urup; Obst, Matthias; Funch, Peter; Schramm, Andreas


    Two gram-negative, facultative anaerobic, chemoorganoheterotrophic, motile and rod-shaped bacteria, strains AVMART05(T) and KASP37, were isolated from ascidians (Tunicata, Ascidiaceae) of the genus Ascidiella collected at Gullmarsfjord, Sweden. The strains are the first cultured representatives of an ascidian-specific lineage within the genus Endozoicomonas (Gammaproteobacteria, Oceanospirillales, Hahellaceae). Both strains feature three distinct 16S rRNA gene paralogs, with identities of 98.9-99.1% (AVMART05(T)) and 97.7-98.8% (KASP37) between paralogs. The strains are closely related to Endozoicomonas atrinae and Endozoicomonas elysicola, with which they share 97.3-98.0% 16S rRNA gene sequence identity. Digital DNA-DNA hybridization, average nucleotide identity, and tetra-nucleotide correlation analysis indicate that both strains belong to a single species distinct from their closest relatives. Both strains feature similar DNA G+C contents of 46.70mol% (AVMART05(T)) and 44.64mol% (KASP37). The fatty acid patterns of AVMART05(T) and KASP37 are most similar to those of Endozoicomonas euniceicola and Endozoicomonas gorgoniicola. Based on the polyphasic approach, we propose the species Endozoicomonas ascidiicola sp. nov. to accommodate the newly isolated strains. E. ascidiicola sp. nov. is represented by the type strain AVMART05(T) (=DSM 100913(T)=LMG 29095(T)) and strain KASP37 (=DSM 100914=LMG 29096). Copyright © 2016 Elsevier GmbH. All rights reserved.


    Directory of Open Access Journals (Sweden)

    Gudzenko E. V


    Full Text Available The purpose of this work was to investigate α-L-rhamnosidase that hydrolytically cleaves the terminal unreduced α-1,2-, α-1,4- and α-1,6-linked rhamnose residues in both synthetic and natural glycosides, oligo-, and polysaccharides, various glycoconjugates: flavonoid derivatives such es rutin, neohesperidin, hesperidin, naringin, quercitrin, saponins, terpene glycosides. These properties of the enzyme could be used for the needs of food industry, pharmaceutical and chemical industry: to improve the quality of beverages (reduction of bitterness, flavor enhancing wines, for production of food additives, medicine preparations and rhamnose. As a result of screening conducted among 9 strains of micromycetes, ability to synthesize α–Lrhamnosidase was revealed only in Penicillium sp. 2918. Complex enzyme preparation was obtained from culture supernatant of this micromycete by fractionation with ammonium sulfate (90% saturation and its physico-chemical properties such as pH- and thermooptimum, pH- and thermal stability and substrate specificity were studied as well. It is shown that enzyme has pH optimum is about 6.0 and thermooptimum is about 60 оC. Preparation of Penicillium sp. 2918 with α-L-rhamnosidase reveals α-D-glucosidase, α-D-galactosidase and α D-glucosaminidase activity.

  20. Microbial Degradation of Chlorogenic Acid by a Sphingomonas sp. Strain. (United States)

    Ma, Yuping; Wang, Xiaoyu; Nie, Xueling; Zhang, Zhan; Yang, Zongcan; Nie, Cong; Tang, Hongzhi


    In order to elucidate the metabolism of chlorogenic acid by environmental microbes, a strain of Sphingomonas sp. isolated from tobacco leaves was cultured under various conditions, and chlorogenic acid degradation and its metabolites were investigated. The strain converting chlorogenic acid was newly isolated and identified as a Sphingomonas sp. strain by 16S rRNA sequencing. The optimal conditions for growth and chlorogenic acid degradation were 37 °C and pH 7.0 with supplementation of 1.5 g/l (NH4)2SO4 as the nitrogen source and 2 g/l chlorogenic acid as the sole carbon source. The maximum chlorogenic acid tolerating capability for the strain was 5 g/l. The main metabolites were identified as caffeic acid, shikimic acid, and 3,4-dihydroxybenzoic acid based on gas chromatography-mass spectrometry analysis. The analysis reveals the biotransformation mechanism of chlorogenic acid in microbial cells isolated from the environment.

  1. UNIPASS for AvSP? A Broader View (United States)

    Wu, N. Eva


    UNIPASS is a general-purpose probabilistic computer program consisting of three major modules, including preprocessor, solver and postprocessor. UNIPASS contains a user-friendly Graphical User Interface (GUI), numerous state-of-the-art probabilistic analysis techniques, a large library of statistical distributions and a function module with a large library of support functions that can easily define any complex limit-state function in a scripting FORTRAN-like syntax format. Its inverse probability analysis and sensitivities analysis capabilities make it a powerful design aid in any product cycle. Its precise numerical analysis engine is accurate enough to push the failure probabilities of a design to well below 10 (exp -50). UNIPASS is equipped with advanced artificial intelligence that is designed to handle systems with an essentially unlimited number of random variables with ease and efficiency. Its modular arrangement allows you to tailor an analysis to the desired level of accuracy and efficiency. The depth and comprehensiveness of UNIPASS are built upon the decades of experience and expertise of industry leaders including Boeing Aircraft, NASA and the DoD. Its rich content also makes UNIPASS a valuable instructional tool for random processes and probabilistic mechanics. The topics include: 1) Reliability in AvSP; 2) Role of UNIPASS in AvSP; and 3) Examples. This paper is in viewgraph form.

  2. Biodegradation of methyl tert-butyl ether by Kocuria sp.

    Directory of Open Access Journals (Sweden)

    Kiković Dragan D.


    Full Text Available Methyl tert-butyl ether (MTBE has been used to replace the toxic compounds from gasoline and to reduce emission of air pollutants. Due to its intensive use, MTBE has become one of the most important environment pollutants. The aim of this paper is isolation and identification of the bacteria from wastewater sample of “HIP Petrohemija” Pančevo (Serbia, capable of MTBE biodegradation. The results of the investigation showed that only the bacterial isolate 27/1 was capable of growth on MTBE. The result of sequence analyzes of 16S rDNA showed that this bacterial isolate belongs to the Kocuria sp. After the incubation period of 86 days, the degradation rates of initial MTBE concentration of 25 and 125 μg/ml were 55 and 36%, respectively. These results indicated that bacteria Kocuria sp. is successfully adapted on MTBE and can be potentially used in bioremediation of soils and waters contaminated with MTBE.

  3. La spécialisation à l’œuvre

    Directory of Open Access Journals (Sweden)

    Meynard Jean-Marc


    Full Text Available La spécialisation, à l’œuvre dans les exploitations françaises depuis plusieurs décennies, a remodelé le paysage agricole de l’Hexagone : la céréaliculture est aujourd’hui largement dominante dans le centre du Bassin Parisien, en Alsace ou en Aquitaine, tandis que l’Ouest de la France, qui se consacre à l’élevage intensif, donne une large place dans ses assolements, au maïs ensilage et aux prairies monospécifiques de courte durée. Cette spécialisation régionale s’accompagne d’une réduction du nombre d’espèces cultivées, et d’un raccourcissement des rotations, qui engendre des difficultés à maîtriser les populations d’adventices ou les parasites et de nombreux problèmes écologiques (perte de biodiversité; faible recyclage des éléments minéraux N, P, K....

  4. Metalaxyl Degradation by Mucorales Strains Gongronella sp. and Rhizopus oryzae

    Directory of Open Access Journals (Sweden)

    Maria Rosário Martins


    Full Text Available In this study, the degradation of metalaxyl was investigated in the presence of two Mucorales strains, previously isolated from soil subjected to repeated treatments with this fungicide and selected after enrichment technique. Fungal strains were characterised by a polyphasic approach using phylogenetic analysis of the Internal Transcribed Spacer (ITS gene region, phenotypic characterisation by Matrix-Assisted Laser Desorption Ionization Time-Of-Flight Mass Spectrometry (MALDI-TOF MS spectral analysis, and growth kinetics experiments. The strains were identified as Gongronella sp. and Rhizopus oryzae. The fungal growth kinetics in liquid cultures containing metalaxyl fits with Haldane model. Under laboratory conditions, the ability of Gongronella sp. and R. oryzae cultures to degrade metalaxyl was evaluated in liquid cultures and soil experiments. Both species were able to: (a use metalaxyl as the main carbon and energy source; and (b degrade metalaxyl in polluted soils, with rates around 1.0 mg kg−1 d−1. This suggests these strains could degrade metalaxyl in soils contaminated with this fungicide.


    Directory of Open Access Journals (Sweden)



    Full Text Available Besouros predadores da família Histeridae foram coletados através do uso de armadilhas "pitfall" iscadas com massa fecal fresca de bovinos instaladas em área de pastagem em Piracicaba, SP. Coletaram-se durante o período de 15 de abril de 1995 a 17 de fevereiro de 1996, quatro espécies identificadas como Hister punctifer, Phelister panamensis, P. haemorrhous e P. rufinotus. A espécie P. panamensis é um importante predador de ovos e larvas de Haematobia irritans e representou 72,93% do total de insetos coletados.Histeridae beetles were collected using pitfall traps baited with cattle manure, placed in a pasture area in Piracicaba, SP, Brazil. The following species were collected from April 15th 1995 to February 17th 1996.: Hister punctifer, Phelister panamensis, P. haemorrhous and P. rufinotus. The species P. panamensis, an important predator of the horn fly, Haematobia irritans, represented 72,93% of all insects collected.

  6. SP-100 power system conceptual design for lunar base applications

    International Nuclear Information System (INIS)

    Mason, L.S.; Bloomfield, H.S.; Hainley, D.C.


    A conceptual design is presented for a nuclear power system utilizing an SP-100 reactor and multiple Stirling cycle engines for operation on the lunar surface. Based on the results of this study, it was concluded that this power plant could be a viable option for an evolutionary lunar base. The design concept consists of a 2500 kWt (kilowatt thermal) SP-100 reactor coupled to eight free-piston Stirling engines. Two of the engines are held in reserve to provide conversion system redundancy. The remaining engines operate at 91.7 percent of their rated capacity of 150 kWe. The design power level for this system is 825 kWe. Each engine has a pumped heat-rejection loop connected to a heat pipe radiator. Power system performance, sizing, layout configurations, shielding options, and transmission line characteristics are described. System components and integration options are compared for safety, high performance, low mass, and ease of assembly. The power plant was integrated with a proposed human lunar base concept to ensure mission compatibility. This study should be considered a preliminary investigation; further studies are planned to investigate the effect of different technologies on this baseline design

  7. sp3-Bonded silicon allotropes based on the Kelvin problem. (United States)

    Zhao, Hui-Yan; Wang, Jing; Ma, Qing-Min; Liu, Ying


    The Kelvin problem, how to partition three-dimensional space into cells of equal volume with minimal area, is a fascinating one. Aggregations of bubbles are naturally physical illustrations of the Kelvin problem. And the superconductor Na8Si46 as an inspiration leads to an amazing discovery of the Weaire-Phelan (WP) structure of foam - the optimal solution to the Kelvin problem to date. Here based on the structural similarity between sp(3)-bonded silicon allotropes and the solutions to the Kelvin problem, a series of new sp(3)-hybridization silicon allotropes, named "Kelvin Silicons", are presented. Furthermore, the structural stability and electronic properties of these new silicon allotropes are investigated using density-functional theory (DFT) calculations. The results show that Kelvin Silicons are structurally stable semiconductors with indirect bandgaps in the range of 0.17-1.40 eV, and their bulk moduli are about 75.9-88.5% that of the diamond phase. The simulated X-ray diffraction spectra of the new silicon crystalline structures would provide more information for possible experimental observations and synthesis.


    Directory of Open Access Journals (Sweden)

    Titik Nur Aeny1 .


    Pathogenicity of banana wilt  bacteria (Ralstonia sp. on  several other  plants.  This experiment was conducted to investigate the pathogenicity of bacterial wilt of banana pathogen (Ralstonia sp. isolated from infected plants in Lampung on tomato, chili pepper, eggplant, and ginger.  The experiment was conducted in Laboratory of Plant Protection Department,  Faculty of Agricultural University of Lampung, from May 1999 to February 2000.  Treatments in this experiment were arranged in a completely randomized design with four replications. The treatments were tomato, eggplant, chili pepper, and  ginger.  Banana was used as the control. The results of this experiment showed that up to 30 days after inoculation, the bacteria isolated from banana found  in Lampung was not able to cause symptom on tomato,  chili pepper, eggplant, nor ginger. However, this bacteria caused wilting on banana eight days after inoculation; the incubation period of this bacteria on banana was eight days.

  9. Polyhydroxybutyrate particles in Synechocystis sp PCC 6803: facts and fiction

    Energy Technology Data Exchange (ETDEWEB)

    Tsang, TK; Roberson, RW; Vermaas, WFJ


    Transmission electron microscopy has been used to identify poly-3-hydroxybutyrate (PHB) granules in cyanobacteria for over 40 years. Spherical inclusions inside the cell that are electron-transparent and/or slightly electron-dense and that are found in transmission electron micrographs of cyanobacteria are generally assumed to be PHB granules. The aim of this study was to test this assumption in different strains of the cyanobacterium Synechocystis sp. PCC 6803. Inclusions that resemble PHB granules were present in strains lacking a pair of genes essential for PHB synthesis and in wild-type cells under conditions that no PHB granules could be detected by fluorescence staining of PHB. Indeed, in these cells PHB could not be demonstrated chemically by GC/MS either. Based on the results gathered, it is concluded that not all the slightly electron-dense spherical inclusions are PHB granules in Synechocystis sp. PCC 6803. This result is potentially applicable to other cyanobacteria. Alternate assignments for these inclusions are discussed.

  10. Assessing biodiesel quality parameters for wastewater grown Chlorella sp. (United States)

    Bagul, Samadhan Yuvraj; K Bharti, Randhir; Dhar, Dolly Wattal


    Microalgae are reported as the efficient source of renewable biodiesel which should be able to meet the global demand of transport fuels. Present study is focused on assessment of wastewater grown indigenous microalga Chlorella sp. for fuel quality parameters. This was successfully grown in secondary treated waste water diluted with tap water (25% dilution) in glass house. The microalga showed a dry weight of 0.849 g L -1 with lipid content of 27.1% on dry weight basis on 21st day of incubation. After transesterification, the yield of fatty acid methyl ester was 80.64% with major fatty acids as palmitic, linoleic, oleic and linolenic. The physical parameters predicted from empirical equations in the biodiesel showed cetane number as 56.5, iodine value of 75.5 g I 2 100 g -1 , high heating value 40.1 MJ kg -1 , flash point 135 °C, kinematic viscosity 4.05 mm 2 s -1 with density of 0.86 g cm 3 and cold filter plugging point as 0.7 °C. Fourier transform infra-red (FTIR), 1 H, 13 C NMR spectrum confirmed the chemical nature of biodiesel. The results indicated that the quality of biodiesel was almost as per the criterion of ASTM standards; hence, wastewater grown Chlorella sp. can be used as a promising strain for biodiesel production.

  11. Parallelization of ITS on an IBM SP2 computer

    International Nuclear Information System (INIS)

    Monte Carlo simulation of complex phenomena that occur in coupled electron-photon radiation transport can tax even the most powerful serial computers. Depending on the number of materials and the required resolution, there is a need to use up to millions of histories to adequately represent three-dimensional transport. The greatest limitation of most Monte Carlo simulations is the large computational time and computing memory required for very large scale problems. Emergence of new parallel computers, such as the IBM SP2, may lessen this difficulty for radiation transport simulation. This study presents the implementation of the Integrated Tiger Series, (ITS) of codes on the IBM SP2 using the PVMe message-passing library to achieve parallel efficiencies as high as 98% on eight computer nodes. ITS is a general purpose state-of-the-art Monte Carlo method for solving linear, time-independent, coupled electron-photon radiation transport problems with or without the presence of external electric and magnetic fields. A batch decomposition approach has been taken toward parallelization of the code. In ITS, the particle histories are divided into open-quotes batchesclose quotes of equal size and the evaluation of the estimated quantities are performed using batch-averaged sample statistics

  12. Pertumbuhan cacing tanah Eisenia fetida sp. Pada kompos limbah fleshing

    Directory of Open Access Journals (Sweden)

    Prayitno Prayitno


    Full Text Available The use of earthworm as a source of income and a means for managing organic solid waste such as fleshing waste has been widely applied. The aim of this research was to find the optimum ratio between fleshing waste and cow dung in the growing medium of Eisenia fetida sp. This research was conducted by growing the E. fetida sp. earthworm in the medium containing fleshing waste mixed with cow dung. The ratio of fleshing waste and cow dung was varied at 0:100; 10:90; 20:80; 30:70; 40:60; and 50:50. In addition, 2 parts of chopped stubbles per part of every sample was added as a carbon source. The prepared media were fermented for three weeks with EM4 as a starter, followed by incubation of the earthworm for six weeks. The weight and the number of earthworm were evaluated every two weeks. The optimum growth of earthworm was achieved at the 2nd week of incubation with 185.48% and 121.10% increase of weight and number of earthworm, respectively, at 40:60 ratio of fleshing waste and cow dung in the growing medium.

  13. Determination of the carbonate dissolution mechanism of Lactococcus sp. (United States)

    Yanmiş, Derya; Orhan, Furkan; Güllüce, Medine; Şahin, Fikrettin


    Magnesite, the main source for magnesium and magnesium derivatives, are also commonly used in the production of caustic, dead-burned and fused magnesia. World magnesite resources are estimated to be at 12 billion tonnes mostly located in China, Russia, North Korea, Australia and Turkey. Turkey is the second producer of the magnesite. Magnesite deposits in Turkey are sedimentary magnesite which have been formed in specific conditions as high concentrations of MgSO4 and CO2 and presence of certain organic salts or created by hot or cold dissolution connected with carbonate rocks mainly with dolomites. According to the genesis of magnesite deposits, they have some impurities as calcium, quartz, iron, etc. Impurities of magnesite, especially CaCO3, reduce its economic value and industrial usability. In our previous study, we have performed biotechnologically enrichment of magnesite by Lactococcus sp., which gave significantly important results. However, we had no information about carbonate dissolution mechanism of bacteria. Therefore, it is aimed to reveal the metabolites of Lactococcus sp. and mechanism leading to the carbonate dissolution (MgCO3 and CaCO3).

  14. Surface activity of Acinetobacter calcoaceticus sp. 2CA2

    Energy Technology Data Exchange (ETDEWEB)

    Neufeld, R.J.; Zajic, J.E.


    The hydrocarbon metabolizing Acinetobacter calcoaceticus sp. 2CA2 reduces the surface tension of the culture broth during growth on liquid hydrocarbons. This activity, which is not evident during growth on soluble substrates, is associated with the whole cells. Removing the cells from the culture broth increases the surface tension of the liquid phase. The cells when resuspended in water result in a dramatic lowering of the surface tension. Acinetobacter sp. 2CA2 tends to partition between the two liquid phases during growth on hydrocarbons. Both the hydrocarbon bound and nonadhering cells are equally surface active. The whole cells are also able to form and stabilize kerosene-water emulsions. This ability is not related to the lowering of the liquid surface or interfacial tension, since both surface active and nonsurface active cells demonstrated the same emulsifying properties. An extracellular lipopeptide produced during growth on hydrocarbons is not surface active but effectively forms and stabilizes kerosene-water emulsions. The cells and extracellular lipopeptide are also effective in de-emulsifying surfactant stabilized test emulsions. The cells and extracellular lipopeptide are also effective in de-emulsifying surfactant stabilized test emulsions. The lipopeptide product reduced the half-life of a Tween-Span (TS) stabilized kerosene-water emulsion from 650 to 0.4 h at product concentrations of less than 1% (w/v).

  15. Efficient Biotransformation of Phytosterols to Dehydroepiandrosterone by Mycobacterium sp. (United States)

    Zhou, Pei; Fang, Ya-Kun; Yao, Hao-Ke; Li, Hua; Wang, Gang; Liu, Yu-Peng


    In this study, a method for the efficient production of dehydroepiandrosterone (DHEA) from phytosterols in a vegetable oil/aqueous two-phase system by Mycobacterium sp. was developed. After the 3-hydroxyl group of phytosterols was protected, they could be converted into DHEA with high yield and productivity by Mycobacterium sp. NRRL B-3683. In a shake flask biotransformation, 15.05 g l -1 of DHEA and a DHEA yield of 85.39% (mol mol -1 ) were attained after 7 days with an initial substrate concentration of 25 g l -1 . When biotransformation was carried out in a 30-l stirred bioreactor with 25 g l -1 substrate, the DHEA concentration and yield was 16.33 g l -1 and 92.65% (mol mol -1 ) after 7 days, respectively. The results of this study suggest that inexpensive phytosterols could be utilized for the efficient production of DHEA.

  16. Transcriptional activation of Mina by Sp1/3 factors. (United States)

    Lian, Shangli; Potula, Hari Hara S K; Pillai, Meenu R; Van Stry, Melanie; Koyanagi, Madoka; Chung, Linda; Watanabe, Makiko; Bix, Mark


    Mina is an epigenetic gene regulatory protein known to function in multiple physiological and pathological contexts, including pulmonary inflammation, cell proliferation, cancer and immunity. We showed previously that the level of Mina gene expression is subject to natural genetic variation linked to 21 SNPs occurring in the Mina 5' region. In order to explore the mechanisms regulating Mina gene expression, we set out to molecularly characterize the Mina promoter in the region encompassing these SNPs. We used three kinds of assays--reporter, gel shift and chromatin immunoprecipitation--to analyze a 2 kb genomic fragment spanning the upstream and intron 1 regions flanking exon 1. Here we discovered a pair of Mina promoters (P1 and P2) and a P1-specific enhancer element (E1). Pharmacologic inhibition and siRNA knockdown experiments suggested that Sp1/3 transcription factors trigger Mina expression through additive activity targeted to a cluster of four Sp1/3 binding sites forming the P1 promoter. These results set the stage for comprehensive analysis of Mina gene regulation from the context of tissue specificity, the impact of inherited genetic variation and the nature of upstream signaling pathways.

  17. Babesial vector tick defensin against Babesia sp. parasites. (United States)

    Tsuji, Naotoshi; Battsetseg, Badgar; Boldbaatar, Damdinsuren; Miyoshi, Takeharu; Xuan, Xuenan; Oliver, James H; Fujisaki, Kozo


    Antimicrobial peptides are major components of host innate immunity, a well-conserved, evolutionarily ancient defensive mechanism. Infectious disease-bearing vector ticks are thought to possess specific defense molecules against the transmitted pathogens that have been acquired during their evolution. We found in the tick Haemaphysalis longicornis a novel parasiticidal peptide named longicin that may have evolved from a common ancestral peptide resembling spider and scorpion toxins. H. longicornis is the primary vector for Babesia sp. parasites in Japan. Longicin also displayed bactericidal and fungicidal properties that resemble those of defensin homologues from invertebrates and vertebrates. Longicin showed a remarkable ability to inhibit the proliferation of merozoites, an erythrocyte blood stage of equine Babesia equi, by killing the parasites. Longicin was localized at the surface of the Babesia sp. parasites, as demonstrated by confocal microscopic analysis. In an in vivo experiment, longicin induced significant reduction of parasitemia in animals infected with the zoonotic and murine B. microti. Moreover, RNA interference data demonstrated that endogenous longicin is able to directly kill the canine B. gibsoni, thus indicating that it may play a role in regulating the vectorial capacity in the vector tick H. longicornis. Theoretically, longicin may serve as a model for the development of chemotherapeutic compounds against tick-borne disease organisms.

  18. Phlebotomus (Euphlebotomus barguesae n. sp. from Thailand (Diptera – Psychodidae

    Directory of Open Access Journals (Sweden)

    Léger Nicole


    Full Text Available Abstract Background A few studies have been carried out on the Phlebotomine sandflies from Thailand. Within the Phlebotomine sandflies, the genus Phlebotomus Rondani & Berté, 1840 contains the vectors of leishmaniases in Europe, Africa and Asia. It includes several subgenera. Among them the subgenus Euphlebotomus Theodor, 1948 contains at the present time 12 taxa. The type-species of this subgenus is P. argentipes Annandale & Brunetti, 1908, the vector of Leishmania donovani (Laveran & Mesnil, 1903 in India. Results A new species of sandfly, P. barguesae n. sp. is described from limestone caves in Thailand. The male-female gathering in the same species is based on ecological, morphological and molecular criteria (homology of mtDNA cytochrome c oxidase I sequences. The inclusion of P. barguesae n. sp. in the subgenus Euphlebotomus is justified on the basis of characters of the male genitalia (five spines on the style, bifurcated paramere, and no basal lobe on the coxite and of female pharyngeal armature (two kinds of teeth. It well differenciated from another sympatric species: P. mascomai. Conclusion The new species described in the present study has smooth spermathecae. This original morphology opens a discussion on the heterogeneity of this subgenus.


    Directory of Open Access Journals (Sweden)

    Nathali López Cardona


    Full Text Available Abstract. Analysis of 914 samples of roots, rhizomes, pseudostems, inflorescences and leaves of four commercial varieties of heliconia, cultivated at the municipality of Chinchiná-Caldas (Colombia, allowed to identify five genera of plant pathogenic fungi (Rhizoctonia, Fusarium, Colletotrichum, Helminthosporium and Curvularia, three genera of plant pathogenic bacteria (Ralstonia, Pseudomonas and Erwinia, two species of viruses (Banana streak virus (BSV, Badnavirus, and Cucumber mosaic virus (CMV, Cucumovirus,, and seven genera of plant parasitic nematodes (Helicotylenchus, Tylenchus, Meloidogyne, Ditylenchus, Aphelenchoides, Pratylenchus, and Radopholus. Of these, Fusarium sp., affecting pseudostems, Pseudomonas sp., affecting leaves and inflorescences, and the plant parasitic nematodes Ditylenchus sp., Aphelenchoides sp., Pratylenchus sp. and Radopholus sp., are new records in the heliconia production in Colombia . The most limiting diseases corresponded to leaf blight, caused by Helminthosporium sp.; the bacterioses, caused by Pseudomonas sp.; the spotted stems, caused by Fusarium sp.; and soft rot of the pseudostems, caused by Erwinia sp. The pathogenicity tests demonstrated that Colletotrichum sp. and Phoma sp. are not pathogenic in leaves; while Fusarium sp., inoculated in pseudostems, Helminthosporium sp. and Pseudomonas sp., inoculated in leaves, and Colletotrichum sp. and Pseudomonas sp., inoculated in inflorescences, had incidence values of 83.3, 86.6, 93.3, 100.0 and 100.0%, respectively.Resumen. El análisis de 914 muestras de raíces, rizomas, pseudotallos, inflorescencias y hojas de cuatro variedades comerciales de heliconia, cultivadas en el municipio de Chinchiná-Caldas (Colombia, permitieron identificar cinco géneros de hongos fitopatógenos (Rhizoctonia, Fusarium, Colletotrichum, Helminthosporium y Curvularia, tres géneros de bacterias fitopatógenas (Ralstonia, Pseudomonas y Erwinia, dos especies de virus (Banana streak

  20. Caracterización ecológica de lombrices nativas (Pheretima sp., Eudovoscolex sp. y Periscolex sp. bajo diferentes usos del suelo (Guaviare, Colombia Ecological characterization of nature earthworm (Pheretima sp., Eudovoscolex sp. y Periscolex sp. under different soil uses (Guaviare, Colombia

    Directory of Open Access Journals (Sweden)

    Fuentes Baca Anamaría


    Full Text Available Se caracterizaron las poblaciones de lombrices de tierr.a de las especies Pheretimasp., Eudovoscolexsp. y Periscolex sp., presentes en un Typic Dystropept del municipio El Retorno (Guaviare, Colombia, bajo ocho tipos de usos (pradera sin pastoreo, pradera con semipastoreo, arreglo silvopastoril, cultivos de chontaduro y cacao socolado, rastrojo de cinco años, rastrojo de segundo crecimiento y bosque, utilizando 10 unidades de muestreo por cobertura y evaluando parámetros de abundancia, densidad y biomasa en relación con algunas características físico-químicas del suelo. Los resultados mostraron diferencias significativas entre las cantidades totales de huevos y adultos en el sistema silvopastoril vs. las praderas y en la pradera con semipastoreo vs. pradera sin pastoreo y de adultos en la cobertura chontaduro (Bactrys gasipaes - kudzu vs. cacao (Theobroma cacao. En varios casos, las respuestas de biomasa y densidad no fueron coincidentes. Mientras que en bosque natural las especies se distribuyen por igual, en las demás coberturas se presentan diferentes patrones de distribución. Se encontraron correlaciones entre biomasa, densidad y abundancia de lombrices con los contenidos de fósforo y magnesio y con la densidad aparente del suelo.
    Earthworm populations of Pheretima sp., Eudovoscolex sp. and Periscolex sp found in Typic Dystropepts from El Retorno (Guaviare, Colombia were evaluated for eight different soil uses. Ten experimental units were used to evaluate abundance, density and biomass, as related to soil physico-chemical characteristics. Results showed significant differences between total amount of eggs and adults under forest pasture combinet use vs grazing, and, grazing plus partially grazing vs non-pasture grazing, and, adults in chontaduro (Bactrys gasipaes - Kudzu vs cacao (Theobroma cacao covering. Biomass and densities answers did not show similar results while in undisturbed forest the species have the same pattern