CAI: Overcoming Attitude Barriers.
Netusil, Anton J.; Kockler, Lois H.
During each of two school quarters, approximately 60 college students enrolled in a mathematics course were randomly assigned to an experimental group or a control group. The control group received instruction by the lecture method only; the experimental group received the same instruction, except that six computer-assisted instruction (CAI) units…
Computers for Your Classroom: CAI and CMI.
Thomas, David B.; Bozeman, William C.
1981-01-01
The availability of compact, low-cost computer systems provides a means of assisting classroom teachers in the performance of their duties. Computer-assisted instruction (CAI) and computer-managed instruction (CMI) are two applications of computer technology with which school administrators should become familiar. CAI is a teaching medium in which…
A risk management approach to CAIS development
Hart, Hal; Kerner, Judy; Alden, Tony; Belz, Frank; Tadman, Frank
1986-01-01
The proposed DoD standard Common APSE Interface Set (CAIS) was developed as a framework set of interfaces that will support the transportability and interoperability of tools in the support environments of the future. While the current CAIS version is a promising start toward fulfilling those goals and current prototypes provide adequate testbeds for investigations in support of completing specifications for a full CAIS, there are many reasons why the proposed CAIS might fail to become a usable product and the foundation of next-generation (1990'S) project support environments such as NASA's Space Station software support environment. The most critical threats to the viability and acceptance of the CAIS include performance issues (especially in piggybacked implementations), transportability, and security requirements. To make the situation worse, the solution to some of these threats appears to be at conflict with the solutions to others.
El Kissi, Yousri; Maarouf Bouraoui, Meriem; Amamou, Badii; Bannour, Ahmed Souheil; Ben Romdhane, Asma; Ben Nasr, Selma; Ali, Béchir Ben Hadj
2014-01-01
Stress is a part of the nursing profession and it is reflected in higher rates of depression and anxiety disorders. aim : This study aimed to determine the prevalence of major depression episodes (MDE), Dysthymia and generalized anxiety disorder (GAD), as well as their associated factors, in a representative sample of nurses in Sousse Farhat Hached teaching hospital, using the Tunisian version of CIDI. It's a descriptive study, carried out among a representative sample of the nursing staff of Sousse Farhat Hached teaching hospital (N=228). The data obtained was the result of an interview using the CIDI sections related to MDD, dysthymia and GAD. Sociodemographic, medical and professional data were also collected. The MDE prevalence was estimated at 7.5% and was associated with the female gender, the remoteness of the workplace, the number of persons on the participant's charge, the personal antecedents of mental and organic pathologies, the job satisfaction related to internal relationships and security as well as with the wish to change position. The prevalence of Dysthymia was 5.7% and was associated with family antecedents of mental pathologies. The prevalence of TAG (4.4%) was associated with remoteness of the workplace, personal antecedents of mental pathologies and with satisfaction related to material conditions. The important issues of human and financial consequences of stress at work require the use of large-scale measures that should be incorporated into a strategy covering all factors and involving both health authorities and administrative occupational medicine.
Mishra, R. K.; Simon, J. I.; Ross, D. K.; Marhas, K. K.
2016-01-01
Calcium, Aluminum-rich inclusions (CAIs) are the first forming solids of the Solar system. Their observed abundance, mean size, and mineralogy vary quite significantly between different groups of chondrites. These differences may reflect the dynamics and distinct cosmochemical conditions present in the region(s) of the protoplanetary disk from which each type likely accreted. Only about 11 such objects have been found in L and LL type while another 57 have been found in H type ordinary chondrites, compared to thousands in carbonaceous chondrites. At issue is whether the rare CAIs contained in ordinary chondrites truly reflect a distinct population from the inclusions commonly found in other chondrite types. Semarkona (LL3.00) (fall, 691 g) is the most pristine chondrite available in our meteorite collection. Here we report petrography and mineralogy of 3 CAIs from Semarkona
The Relevance of AI Research to CAI.
Kearsley, Greg P.
This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…
NALDA (Naval Aviation Logistics Data Analysis) CAI (computer aided instruction)
Energy Technology Data Exchange (ETDEWEB)
Handler, B.H. (Oak Ridge K-25 Site, TN (USA)); France, P.A.; Frey, S.C.; Gaubas, N.F.; Hyland, K.J.; Lindsey, A.M.; Manley, D.O. (Oak Ridge Associated Universities, Inc., TN (USA)); Hunnum, W.H. (North Carolina Univ., Chapel Hill, NC (USA)); Smith, D.L. (Memphis State Univ., TN (USA))
1990-07-01
Data Systems Engineering Organization (DSEO) personnel developed a prototype computer aided instruction CAI system for the Naval Aviation Logistics Data Analysis (NALDA) system. The objective of this project was to provide a CAI prototype that could be used as an enhancement to existing NALDA training. The CAI prototype project was performed in phases. The task undertaken in Phase I was to analyze the problem and the alternative solutions and to develop a set of recommendations on how best to proceed. The findings from Phase I are documented in Recommended CAI Approach for the NALDA System (Duncan et al., 1987). In Phase II, a structured design and specifications were developed, and a prototype CAI system was created. A report, NALDA CAI Prototype: Phase II Final Report, was written to record the findings and results of Phase II. NALDA CAI: Recommendations for an Advanced Instructional Model, is comprised of related papers encompassing research on computer aided instruction CAI, newly developing training technologies, instructional systems development, and an Advanced Instructional Model. These topics were selected because of their relevancy to the CAI needs of NALDA. These papers provide general background information on various aspects of CAI and give a broad overview of new technologies and their impact on the future design and development of training programs. The paper within have been index separately elsewhere.
E-CAI: a novel server to estimate an expected value of Codon Adaptation Index (eCAI
Directory of Open Access Journals (Sweden)
Garcia-Vallvé Santiago
2008-01-01
Full Text Available Abstract Background The Codon Adaptation Index (CAI is a measure of the synonymous codon usage bias for a DNA or RNA sequence. It quantifies the similarity between the synonymous codon usage of a gene and the synonymous codon frequency of a reference set. Extreme values in the nucleotide or in the amino acid composition have a large impact on differential preference for synonymous codons. It is thence essential to define the limits for the expected value of CAI on the basis of sequence composition in order to properly interpret the CAI and provide statistical support to CAI analyses. Though several freely available programs calculate the CAI for a given DNA sequence, none of them corrects for compositional biases or provides confidence intervals for CAI values. Results The E-CAI server, available at http://genomes.urv.es/CAIcal/E-CAI, is a web-application that calculates an expected value of CAI for a set of query sequences by generating random sequences with G+C and amino acid content similar to those of the input. An executable file, a tutorial, a Frequently Asked Questions (FAQ section and several examples are also available. To exemplify the use of the E-CAI server, we have analysed the codon adaptation of human mitochondrial genes that codify a subunit of the mitochondrial respiratory chain (excluding those genes that lack a prokaryotic orthologue and are encoded in the nuclear genome. It is assumed that these genes were transferred from the proto-mitochondrial to the nuclear genome and that its codon usage was then ameliorated. Conclusion The E-CAI server provides a direct threshold value for discerning whether the differences in CAI are statistically significant or whether they are merely artifacts that arise from internal biases in the G+C composition and/or amino acid composition of the query sequences.
Numerical simulation and validation of SI-CAI hybrid combustion in a CAI/HCCI gasoline engine
Wang, Xinyan; Xie, Hui; Xie, Liyan; Zhang, Lianfang; Li, Le; Chen, Tao; Zhao, Hua
2013-02-01
SI-CAI hybrid combustion, also known as spark-assisted compression ignition (SACI), is a promising concept to extend the operating range of CAI (Controlled Auto-Ignition) and achieve the smooth transition between spark ignition (SI) and CAI in the gasoline engine. In this study, a SI-CAI hybrid combustion model (HCM) has been constructed on the basis of the 3-Zones Extended Coherent Flame Model (ECFM3Z). An ignition model is included to initiate the ECFM3Z calculation and induce the flame propagation. In order to precisely depict the subsequent auto-ignition process of the unburned fuel and air mixture independently after the initiation of flame propagation, the tabulated chemistry concept is adopted to describe the auto-ignition chemistry. The methodology for extracting tabulated parameters from the chemical kinetics calculations is developed so that both cool flame reactions and main auto-ignition combustion can be well captured under a wider range of thermodynamic conditions. The SI-CAI hybrid combustion model (HCM) is then applied in the three-dimensional computational fluid dynamics (3-D CFD) engine simulation. The simulation results are compared with the experimental data obtained from a single cylinder VVA engine. The detailed analysis of the simulations demonstrates that the SI-CAI hybrid combustion process is characterised with the early flame propagation and subsequent multi-site auto-ignition around the main flame front, which is consistent with the optical results reported by other researchers. Besides, the systematic study of the in-cylinder condition reveals the influence mechanism of the early flame propagation on the subsequent auto-ignition.
Particulated articular cartilage: CAIS and DeNovo NT.
Farr, Jack; Cole, Brian J; Sherman, Seth; Karas, Vasili
2012-03-01
Cartilage Autograft Implantation System (CAIS; DePuy/Mitek, Raynham, MA) and DeNovo Natural Tissue (NT; ISTO, St. Louis, MO) are novel treatment options for focal articular cartilage defects in the knee. These methods involve the implantation of particulated articular cartilage from either autograft or juvenile allograft donor, respectively. In the laboratory and in animal models, both CAIS and DeNovo NT have demonstrated the ability of the transplanted cartilage cells to "escape" from the extracellular matrix, migrate, multiply, and form a new hyaline-like cartilage tissue matrix that integrates with the surrounding host tissue. In clinical practice, the technique for both CAIS and DeNovo NT is straightforward, requiring only a single surgery to affect cartilage repair. Clinical experience is limited, with short-term studies demonstrating both procedures to be safe, feasible, and effective, with improvements in subjective patient scores, and with magnetic resonance imaging evidence of good defect fill. While these treatment options appear promising, prospective randomized controlled studies are necessary to refine the indications and contraindications for both CAIS and DeNovo NT.
The Instructional Use of CAI in the Education of the Mentally Retarded.
Winters, John J., Jr.; And Others
Computer assisted instruction (CAI) studies with the mentally retarded in the United States and Canada reveal that the retarded benefit from CAI in academic and social skills. Their learning is enhanced to the same extent as that of the nonretarded. CAI can be cost-effective, especially with the reduced costs of mini and micro-computers; however,…
Directory of Open Access Journals (Sweden)
Fenny Purwani
2016-03-01
Full Text Available Strategi penggunaan Computer Assisted Instruction (CAI sebagai media pembelajaran dibutuhkan untuk mengatasi permasalahan yang muncul dalam proses pembelajaran. Pembelajaran yang dikemas dengan baik memberikan dampak yang positif dalam memajukan potensi pada diri manusia. CAI sebagai media pembelajaran berbasis computer dibangun sebagai pelengkap dan pendukung metode pembelajaran yang selama ini hanya menggunakan metode ceramah, diskusi informasi dan demonstrasi. Tujuan penelitian ini adalah merancang dan membangun media pembelajaran CAI yang interaktif dengan berbasis Web. Kemudian hasilnya berupa rancangan CAI dengan model tutorial, serta dilengkapi dengan latihan soal-soal dari materi yang diberikan. Perancangan CAI ini kemudian digunakan untuk media pembelajaran ilmu Tajwid dengan komputer. Strategic use of Computer Assisted Instruction (CAI as a learning media needed to overcome the problems that appeared in the learning process. Learning that was packaged well gave a positive impact in advancing the potential in human beings. CAI as a computer-based learning media was built to complement and support the learning method which as long as only used the speech, discussions, information and demonstrations method. The purpose of this study was to design and build learning media of CAI which was interactive with Web-based. Then the result was a design of CAI with tutorial model and completed with practicing questions from the material provided. This CAI design was then used for learning media of Tajwid with computer.
Oxygen isotope variations at the margin of a CAI records circulation within the solar nebula.
Simon, Justin I; Hutcheon, Ian D; Simon, Steven B; Matzel, Jennifer E P; Ramon, Erick C; Weber, Peter K; Grossman, Lawrence; DePaolo, Donald J
2011-03-04
Micrometer-scale analyses of a calcium-, aluminum-rich inclusion (CAI) and the characteristic mineral bands mantling the CAI reveal that the outer parts of this primitive object have a large range of oxygen isotope compositions. The variations are systematic; the relative abundance of (16)O first decreases toward the CAI margin, approaching a planetary-like isotopic composition, then shifts to extremely (16)O-rich compositions through the surrounding rim. The variability implies that CAIs probably formed from several oxygen reservoirs. The observations support early and short-lived fluctuations of the environment in which CAIs formed, either because of transport of the CAIs themselves to distinct regions of the solar nebula or because of varying gas composition near the proto-Sun.
The Impact of Different Support Vectors on GOSAT-2 CAI-2 L2 Cloud Discrimination
Directory of Open Access Journals (Sweden)
Yu Oishi
2017-11-01
Full Text Available Greenhouse gases Observing SATellite-2 (GOSAT-2 will be launched in fiscal year 2018. GOSAT-2 will be equipped with two sensors: the Thermal and Near-infrared Sensor for Carbon Observation (TANSO-Fourier Transform Spectrometer 2 (FTS-2 and the TANSO-Cloud and Aerosol Imager 2 (CAI-2. CAI-2 is a push-broom imaging sensor that has forward- and backward-looking bands to observe the optical properties of aerosols and clouds and to monitor the status of urban air pollution and transboundary air pollution over oceans, such as PM2.5 (particles less than 2.5 micrometers in diameter. CAI-2 has important applications for cloud discrimination in each direction. The Cloud and Aerosol Unbiased Decision Intellectual Algorithm (CLAUDIA1, which applies sequential threshold tests to features is used for GOSAT CAI L2 cloud flag processing. If CLAUDIA1 is used with CAI-2, it is necessary to optimize the thresholds in accordance with CAI-2. However, CLAUDIA3 with support vector machines (SVM, a supervised pattern recognition method, was developed, and then we applied CLAUDIA3 for GOSAT-2 CAI-2 L2 cloud discrimination processing. Thus, CLAUDIA3 can automatically find the optimized boundary between clear and cloudy areas. Improvements in CLAUDIA3 using CAI (CLAUDIA3-CAI continue to be made. In this study, we examined the impact of various support vectors (SV on GOSAT-2 CAI-2 L2 cloud discrimination by analyzing (1 the impact of the choice of different time periods for the training data and (2 the impact of different generation procedures for SV on the cloud discrimination efficiency. To generate SV for CLAUDIA3-CAI from MODIS data, there are two times at which features are extracted, corresponding to CAI bands. One procedure is equivalent to generating SV using CAI data. Another procedure generates SV for MODIS cloud discrimination at the beginning, and then extracts decision function, thresholds, and SV corresponding to CAI bands. Our results indicated the following
Coordinated Oxygen Isotopic and Petrologic Studies of CAIS Record Varying Composition of Protosolar
Simon, Justin I.; Matzel, J. E. P.; Simon, S. B.; Weber, P. K.; Grossman, L.; Ross, D. K.; Hutcheon, I. D.
2012-01-01
Ca-, Al-rich inclusions (CAIs) record the O-isotope composition of Solar nebular gas from which they grew [1]. High spatial resolution O-isotope measurements afforded by ion microprobe analysis across the rims and margin of CAIs reveal systematic variations in (Delta)O-17 and suggest formation from a diversity of nebular environments [2-4]. This heterogeneity has been explained by isotopic mixing between the O-16-rich Solar reservoir [6] and a second O-16-poor reservoir (probably nebular gas) with a "planetary-like" isotopic composition [e.g., 1, 6-7], but the mechanism and location(s) where these events occur within the protoplanetary disk remain uncertain. The orientation of large and systematic variations in (Delta)O-17 reported by [3] for a compact Type A CAI from the Efremovka reduced CV3 chondrite differs dramatically from reports by [4] of a similar CAI, A37 from the Allende oxidized CV3 chondrite. Both studies conclude that CAIs were exposed to distinct, nebular O-isotope reservoirs, implying the transfer of CAIs among different settings within the protoplanetary disk [4]. To test this hypothesis further and the extent of intra-CAI O-isotopic variation, a pristine compact Type A CAI, Ef-1 from Efremovka, and a Type B2 CAI, TS4 from Allende were studied. Our new results are equally intriguing because, collectively, O-isotopic zoning patterns in the CAIs indicate a progressive and cyclic record. The results imply that CAIs were commonly exposed to multiple environments of distinct gas during their formation. Numerical models help constrain conditions and duration of these events.
The Vibrio cholerae quorum-sensing autoinducer CAI-1: analysis of the biosynthetic enzyme CqsA
Energy Technology Data Exchange (ETDEWEB)
Kelly, R.; Bolitho, M; Higgins, D; Lu, W; Ng, W; Jeffrey, P; Rabinowitz, J; Semmelhack, M; Hughson, F; Bassler, B
2009-01-01
Vibrio cholerae, the bacterium that causes the disease cholera, controls virulence factor production and biofilm development in response to two extracellular quorum-sensing molecules, called autoinducers. The strongest autoinducer, called CAI-1 (for cholera autoinducer-1), was previously identified as (S)-3-hydroxytridecan-4-one. Biosynthesis of CAI-1 requires the enzyme CqsA. Here, we determine the CqsA reaction mechanism, identify the CqsA substrates as (S)-2-aminobutyrate and decanoyl coenzyme A, and demonstrate that the product of the reaction is 3-aminotridecan-4-one, dubbed amino-CAI-1. CqsA produces amino-CAI-1 by a pyridoxal phosphate-dependent acyl-CoA transferase reaction. Amino-CAI-1 is converted to CAI-1 in a subsequent step via a CqsA-independent mechanism. Consistent with this, we find cells release {ge}100 times more CAI-1 than amino-CAI-1. Nonetheless, V. cholerae responds to amino-CAI-1 as well as CAI-1, whereas other CAI-1 variants do not elicit a quorum-sensing response. Thus, both CAI-1 and amino-CAI-1 have potential as lead molecules in the development of an anticholera treatment.
Structural basis of Na+-independent and cooperative substrate/product antiport in CaiT
Schulze, Sabrina; Köster, Stefan; Geldmacher, Ulrike; Terwisscha van Scheltinga, Anke C.; Kühlbrandt, Werner
2010-01-01
Transport of solutes across biological membranes is performed by specialized secondary transport proteins in the lipid bilayer, and is essential for life. Here we report the structures of the sodium-independent carnitine/butyrobetaine antiporter CaiT from Proteus mirabilis (PmCaiT) at 2.3-Å and from
An Object-Oriented Architecture for a Web-Based CAI System.
Nakabayashi, Kiyoshi; Hoshide, Takahide; Seshimo, Hitoshi; Fukuhara, Yoshimi
This paper describes the design and implementation of an object-oriented World Wide Web-based CAI (Computer-Assisted Instruction) system. The goal of the design is to provide a flexible CAI/ITS (Intelligent Tutoring System) framework with full extendibility and reusability, as well as to exploit Web-based software technologies such as JAVA, ASP (a…
Generative Computer Assisted Instruction: An Application of Artificial Intelligence to CAI.
Koffman, Elliot B.
Frame-oriented computer-assisted instruction (CAI) systems dominate the field, but these mechanized programed texts utilize the computational power of the computer to a minimal degree and are difficult to modify. Newer, generative CAI systems which are supplied with a knowledge of subject matter can generate their own problems and solutions, can…
INAA of CAIs from the Maralinga CK4 chondrite: Effects of parent body thermal metamorphism
Lindstrom, D. J.; Keller, L. P.; Martinez, R. R.
1993-01-01
Maralinga is an anomalous CK4 carbonaceous chondrite which contains numerous Ca-, Al-rich inclusions (CAI's) unlike the other members of the CK group. These CAI's are characterized by abundant green hercynitic spinel intergrown with plagioclase and high-Ca clinopyroxene, and a total lack of melilite. Instrumental Neutron Activation Analysis (INAA) was used to further characterize the meteorite, with special focus on the CAI's. High sensitivity INAA was done on eight sample disks about 100-150 microns in diameter obtained from a normal 30 micron thin section with a diamond microcoring device. The CAI's are enriched by 60-70X bulk meteorite values in Zn, suggesting that the substantial exchange of Fe for Mg that made the spinel in the CAI's hercynitic also allowed efficient scavenging of Zn from the rest of the meteorite during parent body thermal metamorphism. Less mobile elements appear to have maintained their initial heterogeneity.
CAD/CAM/CAI Application for High-Precision Machining of Internal Combustion Engine Pistons
Directory of Open Access Journals (Sweden)
V. V. Postnov
2014-07-01
Full Text Available CAD/CAM/CAI application solutions for internal combustion engine pistons machining was analyzed. Low-volume technology of internal combustion engine pistons production was proposed. Fixture for CNC turning center was designed.
CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming
Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke
A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.
Kööp, Levke; Nakashima, Daisuke; Heck, Philipp R.; Kita, Noriko T.; Tenner, Travis J.; Krot, Alexander N.; Nagashima, Kazuhide; Park, Changkun; Davis, Andrew M.
2018-01-01
Calcium-aluminum-rich inclusions (CAIs) are the oldest dated objects that formed inside the Solar System. Among these are rare, enigmatic objects with large mass-dependent fractionation effects (F CAIs), which sometimes also have large nucleosynthetic anomalies and a low initial abundance of the short-lived radionuclide 26Al (FUN CAIs). We have studied seven refractory hibonite-rich CAIs and one grossite-rich CAI from the Murchison (CM2) meteorite for their oxygen, calcium, and titanium isotopic compositions. The 26Al-26Mg system was also studied in seven of these CAIs. We found mass-dependent heavy isotope enrichment in all measured elements, but never simultaneously in the same CAI. The data are hard to reconcile with a single-stage melt evaporation origin and may require reintroduction or reequilibration for magnesium, oxygen and titanium after evaporation for some of the studied CAIs. The initial 26Al/27Al ratios inferred from model isochrons span a range from <1 × 10-6 to canonical (∼5 × 10-5). The CAIs show a mutual exclusivity relationship between inferred incorporation of live 26Al and the presence of resolvable anomalies in 48Ca and 50Ti. Furthermore, a relationship exists between 26Al incorporation and Δ17O in the hibonite-rich CAIs (i.e., 26Al-free CAIs have resolved variations in Δ17O, while CAIs with resolved 26Mg excesses have Δ17O values close to -23‰). Only the grossite-rich CAI has a relatively enhanced Δ17O value (∼-17‰) in spite of a near-canonical 26Al/27Al. We interpret these data as indicating that fractionated hibonite-rich CAIs formed over an extended time period and sampled multiple stages in the isotopic evolution of the solar nebula, including: (1) an 26Al-poor nebula with large positive and negative anomalies in 48Ca and 50Ti and variable Δ17O; (2) a stage of 26Al-admixture, during which anomalies in 48Ca and 50Ti had been largely diluted and a Δ17O value of ∼-23‰ had been achieved in the CAI formation region; and (3
Yusepa, B. G. P.; Kusumah, Y. S.; Kartasasmita, B. G.
2018-03-01
This study aims to get an in-depth understanding of the enhancement of students’ mathematical representation. This study is experimental research with pretest-posttest control group design. The subject of this study is the students’ of the eighth grade from junior high schools in Bandung: high-level and middle-level. In each school, two parallel groups were chosen as a control group and an experimental group. The experimental group was given cognitive apprenticeship instruction (CAI) treatment while the control group was given conventional learning. The results show that the enhancement of students’ mathematical representation who obtained CAI treatment was better than the conventional one, viewed which can be observed from the overall, mathematical prior knowledge (MPK), and school level. It can be concluded that CAI can be used as a good alternative learning model to enhance students’ mathematical representation.
Rancangan Perangkat Lunak Computer Assisted Instruction (CAI Untuk Ilmu Tajwid Berbasis Web
Directory of Open Access Journals (Sweden)
Fenny Purwani
2015-08-01
Full Text Available The development of information technology and science refer to the need of teching-learning concept and mechanism wich are based on information technology, undoubtedly. Regarding the development, it needs qualified human resources and flexible material changing and it should be appropriate with technology and science development. Additionaly, this combines between education based on religious and techology (IMTAK and IPTEK. Internet techology can be used as teaching tool which is known as Computer Assisted Intruction (CAI. CAI software might be one of media or tool in learnig tajwid and it can help people to learn Tajwid easier.
Williams, C. D.; Ushikubo, T.; Bullock, E. S.; Janney, P. E.; Hines, R. R.; Kita, N. T.; Hervig, R. L.; MacPherson, G. J.; Mendybaev, R. A.; Richter, F. M.; Wadhwa, M.
2017-03-01
Detailed petrologic, geochemical and isotopic analyses of a new FUN CAI from the Allende CV3 meteorite (designated CMS-1) indicate that it formed by extensive melting and evaporation of primitive precursor material(s). The precursor material(s) condensed in a 16O-rich region (δ17O and δ18O ∼ -49‰) of the inner solar nebula dominated by gas of solar composition at total pressures of ∼10-3-10-6 bar. Subsequent melting of the precursor material(s) was accompanied by evaporative loss of magnesium, silicon and oxygen resulting in large mass-dependent isotope fractionations in these elements (δ25Mg = 30.71-39.26‰, δ29Si = 14.98-16.65‰, and δ18O = -41.57 to -15.50‰). This evaporative loss resulted in a bulk composition similar to that of compact Type A and Type B CAIs, but very distinct from the composition of the original precursor condensate(s). Kinetic fractionation factors and the measured mass-dependent fractionation of silicon and magnesium in CMS-1 suggest that ∼80% of the silicon and ∼85% of the magnesium were lost from its precursor material(s) through evaporative processes. These results suggest that the precursor material(s) of normal and FUN CAIs condensed in similar environments, but subsequently evolved under vastly different conditions such as total gas pressure. The chemical and isotopic differences between normal and FUN CAIs could be explained by sorting of early solar system materials into distinct physical and chemical regimes, in conjunction with discrete heating events, within the protoplanetary disk.
Stable Magnesium Isotope Variation in Melilite Mantle of Allende Type B1 CAI EK 459-5-1
Kerekgyarto, A. G.; Jeffcoat, C. R.; Lapen, T. J.; Andreasen, R.; Righter, M.; Ross, D. K.
2014-01-01
Ca-Al-rich inclusions (CAIs) are the earliest formed crystalline material in our solar system and they record early Solar System processes. Here we present petrographic and delta Mg-25 data of melilite mantles in a Type B1 CAI that records early solar nebular processes.
Brunner, Franziska; Fliegner, Maike; Krupp, Kerstin; Rall, Katharina; Brucker, Sara; Richter-Appelt, Hertha
2016-01-01
The perception of gender development of individuals with complete androgen insensitivity syndrome (CAIS) as unambiguously female has recently been challenged in both qualitative data and case reports of male gender identity. The aim of the mixed-method study presented was to examine the self-perception of CAIS individuals regarding different aspects of gender and to identify commonalities and differences in comparison with subfertile and infertile XX-chromosomal women with diagnoses of Mayer-Rokitansky-Küster-Hauser syndrome (MRKHS) and polycystic ovary syndrome (PCOS). The study sample comprised 11 participants with CAIS, 49 with MRKHS, and 55 with PCOS. Gender identity was assessed by means of a multidimensional instrument, which showed significant differences between the CAIS group and the XX-chromosomal women. Other-than-female gender roles and neither-female-nor-male sexes/genders were reported only by individuals with CAIS. The percentage with a not exclusively androphile sexual orientation was unexceptionally high in the CAIS group compared to the prevalence in "normative" women and the clinical groups. The findings support the assumption made by Meyer-Bahlburg ( 2010 ) that gender outcome in people with CAIS is more variable than generally stated. Parents and professionals should thus be open to courses of gender development other than typically female in individuals with CAIS.
Ventura, Joseph; Subotnik, Kenneth L; Ered, Arielle; Hellemann, Gerhard S; Nuechterlein, Keith H
2016-04-01
Progress has been made in developing interview-based measures for the assessment of cognitive functioning, such as the Cognitive Assessment Interview (CAI), as co-primary measures that compliment objective neurocognitive assessments and daily functioning. However, a few questions remain, including whether the relationships with objective cognitive measures and daily functioning are high enough to justify the CAI as an co-primary measure and whether patient-only assessments are valid. Participants were first-episode schizophrenia patients (n=60) and demographically-similar healthy controls (n=35), chronic schizophrenia patients (n=38) and demographically similar healthy controls (n=19). Participants were assessed at baseline with an interview-based measure of cognitive functioning (CAI), a test of objective cognitive functioning, functional capacity, and role functioning at baseline, and in the first episode patients again 6 months later (n=28). CAI ratings were correlated with objective cognitive functioning, functional capacity, and functional outcomes in first-episode schizophrenia patients at similar magnitudes as in chronic patients. Comparisons of first-episode and chronic patients with healthy controls indicated that the CAI sensitively detected deficits in schizophrenia. The relationship of CAI Patient-Only ratings with objective cognitive functioning, functional capacity, and daily functioning were comparable to CAI Rater scores that included informant information. These results confirm in an independent sample the relationship of the CAI ratings with objectively measured cognition, functional capacity, and role functioning. Comparison of schizophrenia patients with healthy controls further validates the CAI as an co-primary measure of cognitive deficits. Also, CAI change scores were strongly related to objective cognitive change indicating sensitivity to change. Copyright © 2016 Elsevier B.V. All rights reserved.
Consumption of fa cai Nostoc soup: a potential for BMAA exposure from Nostoc cyanobacteria in China?
Roney, Britton R; Renhui, Li; Banack, Sandra Anne; Murch, Susan; Honegger, Rosmarie; Cox, Paul Alan
2009-01-01
Grown in arid regions of western China the cyanobacterium Nostoc flagelliforme--called fa cai in Mandarin and fat choy in Cantonese--is wild-harvested and used to make soup consumed during New Year's celebrations. High prices, up to $125 USD/kg, led to overharvesting in Inner Mongolia, Ningxia, Gansu, Qinghai, and Xinjiang. Degradation of arid ecosystems, desertification, and conflicts between Nostoc harvesters and Mongol herdsmen concerned the Chinese environmental authorities, leading to a government ban of Nostoc commerce. This ban stimulated increased marketing of a substitute made from starch. We analysed samples purchased throughout China as well as in Chinese markets in the United States and the United Kingdom. Some were counterfeits consisting of dyed starch noodles. A few samples from California contained Nostoc flagelliforme but were adulterated with starch noodles. Other samples, including those from the United Kingdom, consisted of pure Nostoc flagelliforme. A recent survey of markets in Cheng Du showed no real Nostoc flagelliforme to be marketed. Real and artificial fa cai differ in the presence of beta-N-methylamino-L-alanine (BMAA). Given its status as a high-priced luxury food, the government ban on collection and marketing, and the replacement of real fa cai with starch substitutes consumed only on special occasions, it is anticipated that dietary exposure to BMAA from fa cai will be reduced in the future in China.
CAIS/ACSI 2001: Beyond the Web: Technologies, Knowledge and People.
Canadian Journal of Information and Library Science, 2000
2000-01-01
Presents abstracts of papers presented at the 29th Annual Conference of the Canadian Association for Information Science (CAIS) held in Quebec on May 27-29, 2001. Topics include: professional development; librarian/library roles; information technology uses; virtual libraries; information seeking behavior; literacy; information retrieval;…
Calcium-aluminum-rich inclusions with fractionation and unknown nuclear effects (FUN CAIs)
DEFF Research Database (Denmark)
Krot, Alexander N.; Nagashima, Kazuhide; Wasserburg, Gerald J.
2014-01-01
We present a detailed characterization of the mineralogy, petrology, and oxygen isotopic compositions of twelve FUN CAIs, including C1 and EK1-4-1 from Allende (CV), that were previously shown to have large isotopic fractionation patterns for magnesium and oxygen, and large isotopic anomalies...
An ion microprobe study of CAIs from CO3 meteorites. [Abstract only
Russell, S. S.; Greenwood, R. C.; Fahey, A. J.; Huss, G. R.; Wasserburg, G. J.
1994-01-01
When attempting to interpret the history of Ca, Al-rich inclusions (CAIs) it is often difficult to distinguish between primary features inherited from the nebula and those produced during secondary processing on the parent body. We have undertaken a systematic study of CAIs from 10 CO chondrites, believed to represent a metamorphic sequence with the goal of distinguishing primary and secondary features. ALHA 77307 (3.0), Colony (3.0), Kainsaz (3.1), Felix (3.2), ALH 82101 (3.3), Ornans (3.3), Lance (3.4), ALHA 77003 (3.5), Warrenton (3.6), and Isna (3.7) were examined by Scanning Electron Microscopy (SEM) and optical microscopy. We have identified 141 CAIs within these samples, and studied in detail the petrology of 34 inclusions. The primary phases in the lower petrologic types are spinel, melilite, and hibonite. Perovskite, FeS, ilmenite, anorthite, kirschsteinite, and metallic Fe are present as minor phases. Melilite becomes less abundant in higher petrologic types and was not detected in chondrites of type 3.5 and above, confirming previous reports that this mineral easily breaks down during heating. Iron, an element that would not be expected to condense at high temperatures, has a lower abundance in spinel from low-petrologic-type meteorites than those of higher grade, and CaTiO3 is replaced by FeTiO3 in meteorites of higher petrologic type. The abundance of CAIs is similar in each meteorite. Eight inclusions have been analyzed by ion probe. The results are summarized. The results obtained to date show that CAIs in CO meteorites, like those from other meteorite classes, contain Mg* and that Mg in some inclusions has been redistributed.
Northwest Africa 10758: A New CV3 Chondrite Bearing a Giant CAI with Hibonite-Rich Wark-Lovering Rim
Ross, D. K.; Simon, J. I.; Zolensky, M.
2017-01-01
Northwest Africa (NWA) 10758 is a newly identified carbonaceous chondrite that is a Bali-like oxidized CV3. The large Ca-Al rich inclusion (CAI) in this sample is approx. 2.4 x 1.4 cm. The CAI is transitional in composition between type A and type B, with interior mineralogy dominated by melilite, plus less abundant spinel and Al-Ti rich diopside, and only very minor anorthite (Fig. 1A). This CAI is largely free of secondary alteration in the exposed section we examined, with almost no nepheline, sodalite or Ca-Fe silicates. The Wark-Lovering (WL) rim on this CAI is dominated by hibonite, with lower abundances of spinel and perovskite, and with hibonite locally overlain by melilite plus perovskite (as in Fig. 1B). Note that the example shown in 1B is exceptional. Around most of the CAI, hibonite + spinel + perovskite form the WL rim, without overlying melilite. The WL rim can be unusually thick, ranging from approx.20 microns up to approx. 150 microns. A well-developed, stratified accretionary rim infills embayments of the CAI, and thins over protuberances in the convoluted CAI surface.
NWA10758: A New CV3 Chondrite Bearing a Giant CAI with Hibonite-Rich Wark-Lovering Rim
Ross, D. K.; Simon, J. I.; Zolensky, M.
2017-01-01
Northwest Africa (NWA) 10758 is a newly identified carbonaceous chondrite that is a Bali-like oxidized CV3. The large Ca-Al rich inclusion (CAI) in this sample is approx. 2.4 x 1.4 cm. The CAI is transitional in composition between type A and type B, with interior mineralogy dominated by melilite, plus less abundant spinel and Al-Ti rich diopside, and only very minor anorthite (Fig. 1A). This CAI is largely free of secondary alteration in the exposed section we examined, with almost no nepheline, sodalite or Ca-Fe silicates. The Wark-Lovering (WL) rim on this CAI is dominated by hibonite, with lower abundances of spinel and perovskite, and with hibonite locally overlain by melilite plus perovskite (as in Fig. 1B). Note that the example shown in 1B is exceptional. Around most of the CAI, hibonite + spinel + perovskite form the WL rim, without overlying melilite. The WL rim can be unusually thick, ranging from approx. 20 microns up to approx. 150 microns. A well-developed, stratified accretionary rim infills embayments of the CAI, and thins over protuberances in the convoluted CAI surface.
Simon, J. I.; Simon, S. B.; Nguyen, A. N.; Ross, D. K.; Messenger, S.
2017-01-01
We conducted NanoSIMS O-isotopic imaging of a primitive spinel-rich CAI spherule (27-2) from the MIL 090019 CO3 chondrite. Inclusions such as 27-2 are proposed to record inner nebula processes during an epoch of rapid solar nebula evolution. Mineralogical and textural analyses suggest that this CAI formed by high temperature reactions, partial melting, and condensation. This CAI exhibits radial O-isotopic heterogeneity among multiple occurrences of the same mineral, reflecting interactions with distinct nebular O-isotopic reservoirs.
Development of an intelligent CAI system for a distributed processing environment
International Nuclear Information System (INIS)
Fujii, M.; Sasaki, K.; Ohi, T.; Itoh, T.
1993-01-01
In order to operate a nuclear power plant optimally in both normal and abnormal situations, the operators are trained using an operator training simulator in addition to classroom instruction. Individual instruction using a CAI (Computer-Assisted Instruction) system has become popular as a method of learning plant information, such as plant dynamics, operational procedures, plant systems, plant facilities, etc. The outline is described of a proposed network-based intelligent CAI system (ICAI) incorporating multi-medial PWR plant dynamics simulation, teaching aids and educational record management using the following environment: existing standard workstations and graphic workstations with a live video processing function, TCP/IP protocol of Unix through Ethernet and X window system. (Z.S.) 3 figs., 2 refs
Bird community structure in riparian environments in Cai River, Rio Grande do Sul, Brazil
Jaqueline Brummelhaus; Marcia Suelí Bohn; Maria Virginia Petry
2012-01-01
Urbanization produces changes in riparian environments, causing effects in the structure of bird communities, which present different responses to the impacts. We compare species richness, abundance, and composition of birds in riparian environments with different characteristics in Cai River, Rio Grande do Sul, Brazil. We carried out observations in woodland, grassland, and urban environments, between September 2007 and August 2008. We listed 130 bird species, 29 species unique to woodland e...
Pyszczek, R.; Mazuro, P.; Teodorczyk, A.
2016-09-01
This paper is focused on the CAI combustion control in a turbocharged 2-stroke Opposed-Piston (OP) engine. The barrel type OP engine arrangement is of particular interest for the authors because of its robust design, high mechanical efficiency and relatively easy incorporation of a Variable Compression Ratio (VCR). The other advantage of such design is that combustion chamber is formed between two moving pistons - there is no additional cylinder head to be cooled which directly results in an increased thermal efficiency. Furthermore, engine operation in a Controlled Auto-Ignition (CAI) mode at high compression ratios (CR) raises a possibility of reaching even higher efficiencies and very low emissions. In order to control CAI combustion such measures as VCR and water injection were considered for indirect ignition timing control. Numerical simulations of the scavenging and combustion processes were performed with the 3D CFD multipurpose AVL Fire solver. Numerous cases were calculated with different engine compression ratios and different amounts of directly and indirectly injected water. The influence of the VCR and water injection on the ignition timing and engine performance was determined and their application in the real engine was discussed.
Energy Technology Data Exchange (ETDEWEB)
Krot, A N; Chaussidon, M; Yurimoto, H; Sakamoto, N; Nagashima, K; Hutcheon, I D; MacPherson, G J
2008-02-21
Based on the mineralogy and petrography, coarse-grained, igneous, anorthite-rich (Type C) calcium-aluminum-rich inclusions (CAIs) in the CV3 carbonaceous chondrite Allende have been recently divided into three groups: (i) CAIs with melilite and Al,Ti-diopside of massive and lacy textures (coarse grains with numerous rounded inclusions of anorthite) in a fine-grained anorthite groundmass (6-1-72, 100, 160), (ii) CAI CG5 with massive melilite, Al,Ti-diopside and anorthite, and (iii) CAIs associated with chondrule material: either containing chondrule fragments in their peripheries (ABC, TS26) or surrounded by chondrule-like, igneous rims (93) (Krot et al., 2007a,b). Here, we report in situ oxygen isotopic measurements of primary (melilite, spinel, Al,Ti-diopside, anorthite) and secondary (grossular, monticellite, forsterite) minerals in these CAIs. Spinel ({Delta}{sup 17}O = -25{per_thousand} to -20{per_thousand}), massive and lacy Al,Ti-diopside ({Delta}{sup 17}O = -20{per_thousand} to -5{per_thousand}) and fine-grained anorthite ({Delta}{sup 17}O = -15{per_thousand} to -2{per_thousand}) in 100, 160 and 6-1-72 are {sup 16}O-enriched relative spinel and coarse-grained Al,Ti-diopside and anorthite in ABC, 93 and TS26 ({Delta}{sup 17}O ranges from -20{per_thousand} to -15{per_thousand}, from -15{per_thousand} to -5{per_thousand}, and from -5{per_thousand} to 0{per_thousand}, respectively). In 6-1-72, massive and lacy Al,Ti-diopside grains are {sup 16}O-depleted ({Delta}{sup 17}O {approx} -13{per_thousand}) relative to spinel ({Delta}{sup 17}O = -23{per_thousand}). Melilite is the most {sup 16}O-depleted mineral in all Allende Type C CAIs. In CAI 100, melilite and secondary grossular, monticellite and forsterite (minerals replacing melilite) are similarly {sup 16}O-depleted, whereas grossular in CAI 160 is {sup 16}O-enriched ({Delta}{sup 17}O = -10{per_thousand} to -6{per_thousand}) relative to melilite ({Delta}{sup 17}O = -5{per_thousand} to -3{per_thousand}). We infer
Ventura, Joseph; Reise, Steven P; Keefe, Richard S E; Baade, Lyle E; Gold, James M; Green, Michael F; Kern, Robert S; Mesholam-Gately, Raquelle; Nuechterlein, Keith H; Seidman, Larry J; Bilder, Robert M
2010-08-01
Practical, reliable "real world" measures of cognition are needed to supplement neurocognitive performance data to evaluate possible efficacy of new drugs targeting cognitive deficits associated with schizophrenia. Because interview-based measures of cognition offer one possible approach, data from the MATRICS initiative (n=176) were used to examine the psychometric properties of the Schizophrenia Cognition Rating Scale (SCoRS) and the Clinical Global Impression of Cognition in Schizophrenia (CGI-CogS). We used classical test theory methods and item response theory to derive the 10-item Cognitive Assessment Interview (CAI) from the SCoRS and CGI-CogS ("parent instruments"). Sources of information for CAI ratings included the patient and an informant. Validity analyses examined the relationship between the CAI and objective measures of cognitive functioning, intermediate measures of cognition, and functional outcome. The rater's score from the newly derived CAI (10 items) correlate highly (r=.87) with those from the combined set of the SCoRS and CGI-CogS (41 items). Both the patient (r=.82) and the informant (r=.95) data were highly correlated with the rater's score. The CAI was modestly correlated with objectively measured neurocognition (r=-.32), functional capacity (r=-.44), and functional outcome (r=-.32), which was comparable to the parent instruments. The CAI allows for expert judgment in evaluating a patient's cognitive functioning and was modestly correlated with neurocognitive functioning, functional capacity, and functional outcome. The CAI is a brief, repeatable, and potentially valuable tool for rating cognition in schizophrenia patients who are participating in clinical trials. Copyright 2010 Elsevier B.V. All rights reserved.
CAI and training system for the emergency operation procedure in the advanced thermal reactor, FUGEN
International Nuclear Information System (INIS)
Kozaki, T.; Imanaga, K.; Nakamura, S.; Maeda, K.; Sakurai, N.; Miyamoto, M.
2003-01-01
In the Advanced Thermal Reactor (ATR ) of the JNC, 'FUGEN', a symptom based Emergency Operating Procedure (EOF) was introduced in order to operate Fugen more safely and it became necessary for the plant operators to master the EOF. However it took a lot of time for the instructor to teach the EOP to operators and to train them. Thus, we have developed a Computer Aided Instruction (CAI) and Training System for the EOP, by which the operators can learn the EOP and can be trained. This system has two major functions, i.e., CAI and training. In the CAI function, there are three learning courses, namely, the EOP procedure, the simulation with guidance and Q and A, and the free simulation. In the training function, all of necessary control instruments (indicators, switches, annunciators and so forth) and physics models for the EOP training are simulated so that the trainees can be trained for all of the EOPs. In addition, 50 kinds of malfunction models are installed in order to perform appropriate accident scenarios for the EOP. The training of the EOP covers the range from AOO (Anticipated Operational Occurrence) to Over-DBAs (Design Based Accidents). This system is built in three personal computers that are connected by the computer network. One of the computers is expected to be used for the instructor and the other two are for the trainees. The EOP is composed of eight guidelines, such as 'Reactor Control' and 'Depression and Cooling', and the operation screens which are corresponded to the guidelines are respectively provided. According to the trial, we have estimated that the efficiency of the learning and the training would be improved about 30% for the trainee and about 75% for the instructor in the actual learning and training. (author)
Exploring Chondrule and CAI Rims Using Micro- and Nano-Scale Petrological and Compositional Analysis
Cartwright, J. A.; Perez-Huerta, A.; Leitner, J.; Vollmer, C.
2017-12-01
As the major components within chondrites, chondrules (mm-sized droplets of quenched silicate melt) and calcium-aluminum-rich inclusions (CAI, refractory) represent the most abundant and the earliest materials that solidified from the solar nebula. However, the exact formation mechanisms of these clasts, and whether these processes are related, remains unconstrained, despite extensive petrological and compositional study. By taking advantage of recent advances in nano-scale tomographical techniques, we have undertaken a combined micro- and nano-scale study of CAI and chondrule rim morphologies, to investigate their formation mechanisms. The target lithologies for this research are Wark-Lovering rims (WLR), and fine-grained rims (FGR) around CAIs and chondrules respectively, present within many chondrites. The FGRs, which are up to 100 µm thick, are of particular interest as recent studies have identified presolar grains within them. These grains predate the formation of our Solar System, suggesting FGR formation under nebular conditions. By contrast, WLRs are 10-20 µm thick, made of different compositional layers, and likely formed by flash-heating shortly after CAI formation, thus recording nebular conditions. A detailed multi-scale study of these respective rims will enable us to better understand their formation histories and determine the potential for commonality between these two phases, despite reports of an observed formation age difference of up to 2-3 Myr. We are using a combination of complimentary techniques on our selected target areas: 1) Micro-scale characterization using standard microscopic and compositional techniques (SEM-EBSD, EMPA); 2) Nano-scale characterization of structures using transmission electron microscopy (TEM) and elemental, isotopic and tomographic analysis with NanoSIMS and atom probe tomography (APT). Preliminary nano-scale APT analysis of FGR morphologies within the Allende carbonaceous chondrite has successfully discerned
Complete genome sequence of Defluviimonas alba cai42T, a microbial exopolysaccharides producer.
Zhao, Jie-Yu; Geng, Shuang; Xu, Lian; Hu, Bing; Sun, Ji-Quan; Nie, Yong; Tang, Yue-Qin; Wu, Xiao-Lei
2016-12-10
Defluviimonas alba cai42 T , isolated from the oil-production water in Xinjiang Oilfield in China, has a strong ability to produce exopolysaccharides (EPS). We hereby present its complete genome sequence information which consists of a circular chromosome and three plasmids. The strain characteristically contains various genes encoding for enzymes involved in EPS biosynthesis, modification, and export. According to the genomic and physiochemical data, it is predicted that the strain has the potential to be utilized in industrial production of microbial EPS. Copyright © 2016 Elsevier B.V. All rights reserved.
On native Danish learners' challenges in distinguishing /tai/, /cai/ and /zai/
DEFF Research Database (Denmark)
Sloos, Marjoleine; Zhang, Chun
2015-01-01
University participated in an ABX experiment. They were auditorily presented pairs of the critical stimuli tai-cai-zai, te-ce-ze and tuo-cuo-zuo combined with all four tones and alternated with fillers. The subjects indicated for each pair which of the two words matched the pinyin description. The expected...... results show that beginner learners perform on chance level regarding the distinction between t and z and between c and z. The reason is that in Danish, which has an aspiration contrast between plosives (like Chinese) /th/ is variably pronounced as affricated /ts/ and many speakers are unaware...
CAI多媒體教學軟體之開發模式 Using an Instructional Design Model for Developing a Multimedia CAI Courseware
Directory of Open Access Journals (Sweden)
Hsin-Yih Shyu
1995-09-01
Full Text Available 無This article outlined a systematic instructional design model for developing a multimedia computer-aided instruction (CAI courseware. The model illustrated roles and tasks as two dimensions necessary in a CAI production teamwork. Four major components (Analysis, Design, Development, and Revise/Evaluation following by totally 25 steps are provided. Eight roles with each competent skills were identified. The model will be useful in serving as a framework for developing a mulrimedia CAI courseware for educators, instructional designers and CAI industry developers.
An experimental study of fuel injection strategies in CAI gasoline engine
Energy Technology Data Exchange (ETDEWEB)
Hunicz, J.; Kordos, P. [Department of Combustion Engines and Transport, Lublin University of Technology, Nadbystrzycka 36, 20-618 Lublin (Poland)
2011-01-15
Combustion of gasoline in a direct injection controlled auto-ignition (CAI) single-cylinder research engine was studied. CAI operation was achieved with the use of the negative valve overlap (NVO) technique and internal exhaust gas re-circulation (EGR). Experiments were performed at single injection and split injection, where some amount of fuel was injected close to top dead centre (TDC) during NVO interval, and the second injection was applied with variable timing. Additionally, combustion at variable fuel-rail pressure was examined. Investigation showed that at fuel injection into recompressed exhaust fuel reforming took place. This process was identified via an analysis of the exhaust-fuel mixture composition after NVO interval. It was found that at single fuel injection in NVO phase, its advance determined the heat release rate and auto-ignition timing, and had a strong influence on NO{sub X} emission. However, a delay of single injection to intake stroke resulted in deterioration of cycle-to-cycle variability. Application of split injection showed benefits of this strategy versus single injection. Examinations of different fuel mass split ratios and variable second injection timing resulted in further optimisation of mixture formation. At equal share of the fuel mass injected in the first injection during NVO and in the second injection at the beginning of compression, the lowest emission level and cyclic variability improvement were observed. (author)
A Braça da Rede, uma Técnica Caiçara de Medir
Directory of Open Access Journals (Sweden)
Gilberto Chieus Jr.
2009-08-01
Full Text Available Este artigo relata como os caiçaras da cidade de Ubatuba litoral norte paulista medem suas redes de pesca.Mas antes de estar analisando sua técnica de medir estaremos fazendo uma pequena abordagem da cultura caiçara e suas transformações. Em seguida mostraremos alguns momentos históricos da construção do metro. Depois como os caiçaras medem suas redes e o problema ocorrido no Brasil na implantação do sistema métrico decimal e a resistência de determinadas civilizações que se utiliza de outros padrões para realizar suas medidas, ignorando o atual sistema métrico, devidos o seu contexto cultural. Toda esta discussão está enfocada numa perspectiva histórica da Etnomatemática.
Ross, D. K.; Simon, J. I.; Simon, S. B.; Grossman, L.
2012-01-01
Ca-Fe and alkali-halide alteration of CAIs is often attributed to aqueous alteration by fluids circulating on asteroidal parent bodies after the various chondritic components have been assembled, although debate continues about the roles of asteroidal vs. nebular modification processes [1-7]. Here we report de-tailed observations of alteration products in a large Type B2 CAI, TS4 from Allende, one of the oxidized subgroup of CV3s, and propose a speculative model for aqueous alteration of CAIs in a nebular setting. Ca-Fe alteration in this CAI consists predominantly of end-member hedenbergite, end-member andradite, and compositionally variable, magnesian high-Ca pyroxene. These phases are strongly concentrated in an unusual "nodule" enclosed within the interior of the CAI (Fig. 1). The Ca, Fe-rich nodule superficially resembles a clast that pre-dated and was engulfed by the CAI, but closer inspection shows that relic spinel grains are enclosed in the nodule, and corroded CAI primary phases interfinger with the Fe-rich phases at the nodule s margins. This CAI also contains abundant sodalite and nepheline (alkali-halide) alteration that occurs around the rims of the CAI, but also penetrates more deeply into the CAI. The two types of alteration (Ca-Fe and alkali-halide) are adjacent, and very fine-grained Fe-rich phases are associated with sodalite-rich regions. Both types of alteration appear to be replacive; if that is true, it would require substantial introduction of Fe, and transport of elements (Ti, Al and Mg) out of the nodule, and introduction of Na and Cl into alkali-halide rich zones. Parts of the CAI have been extensively metasomatized.
Microstructures of Hibonite From an ALH A77307 (CO3.0) CAI: Evidence for Evaporative Loss of Calcium
Han, Jangmi; Brearley, Adrian J.; Keller, Lindsay P.
2014-01-01
Hibonite is a comparatively rare, primary phase found in some CAIs from different chondrite groups and is also common in Wark-Lovering rims [1]. Hibonite is predicted to be one of the earliest refractory phases to form by equilibrium condensation from a cooling gas of solar composition [2] and, therefore, can be a potential recorder of very early solar system processes. In this study, we describe the microstructures of hibonite from one CAI in ALH A77307 (CO3.0) using FIB/TEM techniques in order to reconstruct its formational history.
Cushion, Christopher; Harvey, Stephen; Muir, Bob; Nelson, Lee
2012-01-01
We outline the evolution of a computerised systematic observation tool and describe the process for establishing the validity and reliability of this new instrument. The Coach Analysis and Interventions System (CAIS) has 23 primary behaviours related to physical behaviour, feedback/reinforcement, instruction, verbal/non-verbal, questioning and management. The instrument also analyses secondary coach behaviour related to performance states, recipient, timing, content and questioning/silence. The CAIS is a multi-dimensional and multi-level mechanism able to provide detailed and contextualised data about specific coaching behaviours occurring in complex and nuanced coaching interventions and environments that can be applied to both practice sessions and competition.
Simon, J. I.; Jordan, M. K.; Tappa, M. J.; Kohl, I. E.; Young, E. D.
2016-01-01
The chemical and isotopic compositions of calcium-aluminum-rich inclusions (CAIs) can be used to understand the conditions present in the protoplantary disk where they formed. The isotopic compositions of these early-formed nebular materials are largely controlled by chemical volatility. The isotopic effects of evaporation/sublimation, which are well explained by both theory and experimental work, lead to enrichments of the heavy isotopes that are often exhibited by the moderately refractory elements Mg and Si. Less well understood are the isotopic effects of condensation, which limits our ability to determine whether a CAI is a primary condensate and/or retains any evidence of its primordial formation history.
Two years since SSAMS: Status of {sup 14}C AMS at CAIS
Energy Technology Data Exchange (ETDEWEB)
Ravi Prasad, G.V.; Cherkinsky, Alexander; Culp, Randy A.; Dvoracek, Doug K.
2015-10-15
The NEC 250 kV single stage AMS accelerator (SSAMS) was installed two years ago at the Center for Applied Isotope Studies (CAIS), University of Georgia. The accelerator is primarily being used for radiocarbon measurements to test the authenticity of natural and bio-based samples while all other samples such as geological, atmospheric, marine and archaeological. are run on the 500 kV, NEC 1.5SDH-1 model tandem accelerator, which has been operating since 2001. The data obtained over a six months period for OXI, OXII, ANU sucrose and FIRI-D are discussed. The mean value of ANU sucrose observed to be slightly lower than the consensus value. The processed blanks on SSAMS produce lower apparent age compared to the tandem accelerator as expected.
Hypertext and three-dimensional computer graphics in an all digital PC-based CAI workstation.
Schwarz, D. L.; Wind, G. G.
1991-01-01
In the past several years there has been an enormous increase in the number of computer-assisted instructional (CAI) applications. Many medical educators and physicians have recognized the power and utility of hypertext. Some developers have incorporated simple diagrams, scanned monochrome graphics or still frame photographs from a laser disc or CD-ROM into their hypertext applications. These technologies have greatly increased the role of the microcomputer in education and training. There still remain numerous applications for these tools which are yet to be explored. One of these exciting areas involves the use of three-dimensional computer graphics. An all digital platform increases application portability. Images Figure 1 Figure 2 Figure 3 Figure 4 PMID:1807767
Hunting and use of terrestrial fauna used by Caiçaras from the Atlantic Forest coast (Brazil
Directory of Open Access Journals (Sweden)
Alves Rômulo RN
2009-11-01
Full Text Available Abstract Background The Brazilian Atlantic Forest is considered one of the hotspots for conservation, comprising remnants of rain forest along the eastern Brazilian coast. Its native inhabitants in the Southeastern coast include the Caiçaras (descendants from Amerindians and European colonizers, with a deep knowledge on the natural resources used for their livelihood. Methods We studied the use of the terrestrial fauna in three Caiçara communities, through open-ended interviews with 116 native residents. Data were checked through systematic observations and collection of zoological material. Results The dependence on the terrestrial fauna by Caiçaras is especially for food and medicine. The main species used are Didelphis spp., Dasyprocta azarae, Dasypus novemcinctus, and small birds (several species of Turdidae. Contrasting with a high dependency on terrestrial fauna resources by native Amazonians, the Caiçaras do not show a constant dependency on these resources. Nevertheless, the occasional hunting of native animals represents a complimentary source of animal protein. Conclusion Indigenous or local knowledge on native resources is important in order to promote local development in a sustainable way, and can help to conserve biodiversity, particularly if the resource is sporadically used and not commercially exploited.
Tuan, Luu Trong
2015-01-01
Purpose: This paper aims to examine the role of antecedents such as corporate social responsibility (CSR) and entrepreneurial orientation in the chain effect to knowledge sharing among members of Cai Luong theatre companies in the Vietnamese context. Knowledge sharing contributes to the depth of the knowledge pool of both the individuals and the…
1990-06-01
The objective of this thesis research is to create a tutorial for teaching aspects of undirected graphs in discrete math . It is one of the submodules...of the Discrete Math Tutorial (DMT), which is a Computer Aided Instructional (CAI) tool for teaching discrete math to the Naval Academy and the
1990-06-01
The objective of this thesis research is to create a tutorial for teaching aspects of undirected graphs in discrete math . It is one of the submodules...of the Discrete Math Tutorial (DMT), which is a Computer Aided Instructional (CAI) tool for teaching discrete math to the Naval Academy and the
Wu, Rina; Yu, Meiling; Liu, Xiaoyu; Meng, Lingshuai; Wang, Qianqian; Xue, Yating; Wu, Junrui; Yue, Xiqing
2015-10-15
We measured changes in the main physical and chemical properties, flavour compounds and microbial diversity in suan-cai during natural fermentation. The results showed that the pH and concentration of soluble protein initially decreased but were then maintained at a stable level; the concentration of nitrite increased in the initial fermentation stage and after reaching a peak it decreased significantly to a low level by the end of fermentation. Suan-cai was rich in 17 free amino acids. All of the free amino acids increased in concentration to different degrees, except histidine. Total free amino acids reached their highest levels in the mid-fermentation stage. The 17 volatile flavour components identified at the start of fermentation increased to 57 by the mid-fermentation stage; esters and aldehydes were in the greatest diversity and abundance, contributing most to the aroma of suan-cai. Bacteria were more abundant and diverse than fungi in suan-cai; 14 bacterial species were identified from the genera Leuconostoc, Bacillus, Pseudomonas and Lactobacillus. The predominant fungal species identified were Debaryomyces hansenii, Candida tropicalis and Penicillium expansum. Copyright © 2015 Elsevier B.V. All rights reserved.
Brown, John S.; And Others
A question answering system which permits a computer-assisted instruction (CAI) student greater initiative in the variety of questions he can ask is described. A method is presented to represent the dynamic processes of a subject matter area by augmented finite state automata, which permits efficient inferencing about dynamic processes and…
Simon, J. I.; Simon, S. B.; Nguyen, A. N.; Ross, D. K.; Messenger, S.
2017-07-01
We conducted NanoSIMS ion imaging studies of a primitive spinel-rich CAI from the MIL 090019 CO3 chondrite. It records radial O-isotopic heterogeneity among multiple occurrences of the same mineral, reflecting distinct nebular O-isotopic reservoirs.
Dietary Changes over Time in a Caiçara Community from the Brazilian Atlantic Forest
Directory of Open Access Journals (Sweden)
Priscila L. MacCord
2006-12-01
Full Text Available Because they are occurring at an accelerated pace, changes in the livelihoods of local coastal communities, including nutritional aspects, have been a subject of interest in human ecology. The aim of this study is to explore the dietary changes, particularly in the consumption of animal protein, that have taken place in Puruba Beach, a rural community of caiçaras on the São Paulo Coast, Brazil, over the 10-yr period from 1992-1993 to 2002-2003. Data were collected during six months in 1992-1993 and during the same months in 2002-2003 using the 24-hr recall method. We found an increasing dependence on external products in the most recent period, along with a reduction in fish consumption and in the number of fish species eaten. These changes, possibly associated with other nonmeasured factors such as overfishing and unplanned tourism, may cause food delocalization and a reduction in the use of natural resources. Although the consequences for conservation efforts in the Atlantic Forest and the survival of the caiçaras must still be evaluated, these local inhabitants may be finding a way to reconcile both the old and the new dietary patterns by keeping their houses in the community while looking for sources of income other than natural resources. The prospect shown here may reveal facets that can influence the maintenance of this and other communities undergoing similar processes by, for example, shedding some light on the ecological and economical processes that may occur within their environment and in turn affect the conservation of the resources upon which the local inhabitants depend.
Dunham, E.; Wadhwa, M.; Liu, M.-C.
2017-07-01
We report a more accurate range of initial 10Be/9Be in CAIs including FUN CAI CMS-1 from Allende (CV3) and a new CAI from NWA 5508 (CV3) using melilite composition glass standards; we suggest 10Be is largely produced by irradiation in the nebula.
Crystal structures of coordination polymers from CaI2 and proline
Directory of Open Access Journals (Sweden)
Kevin Lamberts
2015-06-01
Full Text Available Completing our reports concerning the reaction products from calcium halides and the amino acid proline, two different solids were found for the reaction of l- and dl-proline with CaI2. The enantiopure amino acid yields the one-dimensional coordination polymer catena-poly[[aqua-μ3-l-proline-tetra-μ2-l-proline-dicalcium] tetraiodide 1.7-hydrate], {[Ca2(C5H9NO25(H2O]I4·1.7H2O}n, (1, with two independent Ca2+ cations in characteristic seven- and eightfold coordination. Five symmetry-independent zwitterionic l-proline molecules bridge the metal sites into a cationic polymer. Racemic proline forms with Ca2+ cations heterochiral chains of the one-dimensional polymer catena-poly[[diaquadi-μ2-dl-proline-calcium] diiodide], {[Ca(C5H9NO22(H2O2]I2}n, (2. The centrosymmetric structure is built by one Ca2+ cation that is bridged towards its symmetry equivalents by two zwitterionic proline molecules. In both structures, the iodide ions remain non-coordinating and hydrogen bonds are formed between these counter-anions, the amino groups, coordinating and co-crystallized water molecules. While the overall composition of (1 and (2 is in line with other structures from calcium halides and amino acids, the diversity of the carboxylate coordination geometry is quite surprising.
Bird community structure in riparian environments in Cai River, Rio Grande do Sul, Brazil
Directory of Open Access Journals (Sweden)
Jaqueline Brummelhaus
2012-06-01
Full Text Available Urbanization produces changes in riparian environments, causing effects in the structure of bird communities, which present different responses to the impacts. We compare species richness, abundance, and composition of birds in riparian environments with different characteristics in Cai River, Rio Grande do Sul, Brazil. We carried out observations in woodland, grassland, and urban environments, between September 2007 and August 2008. We listed 130 bird species, 29 species unique to woodland environment, and an endangeredspecies: Triclaria malachitacea. Bird abundance differed from woodland (n = 426 individuals to urban environments (n = 939 individuals (F2,6 = 7.315; P = 0.025. Species composition and feeding guilds differed significantly in the bird community structures among these three riparian environments. In the grassland and urban environments there were more generalist insectivorous species, while in the woodland environments we find more leaf and trunk insectivorous species and frugivorous species, sensitive to human impacts. Bird species can be biological quality indicators and they contribute to ecosystems performing relevant functions. With the knowledge on bird community structure and their needs, it is possible to implement management practices for restoration of degraded riparian environments.
Directory of Open Access Journals (Sweden)
Huong Nguyen Thi Thanh
2017-06-01
Full Text Available The pollution on the Thi Vai River has been spreading out rapidly over the two lasted decades caused by the wastewater from the industrial parks in the left bank of Thi Vai River and Cai Mep Estuaries. The evaluation of the benthic macroinvertebrate changes was very necessary to identify the consequences of the industrial wastewater on water quality and aquatic ecosystem of Thi Vai River and Cai Mep Estuaries. In this study, the variables of benthic macroinvertebrates and water quality were investigated in Thi Vai River and Cai Mep Estuaries, Southern Vietnam. The monitoring data of benthic macroinvertebrates and water quality parameters covered the period from 1989 to 2015 at 6 sampling sites in Thi Vai River and Cai Mep Estuaries. The basic water quality parameters were also tested including pH, dissolved oxygen (DO, total nitrogen, and total phosphorus. The biodiversity indices of benthic macroinvertebrates were applied for water quality assessment. The results showed that pH ranged from 6.4 – 7.6 during the monitoring. The DO concentrations were in between 0.20 - 6.70 mg/L. The concentrations of total nitrogen and total phosphorous ranged from 0.03 - 5.70 mg/L 0.024 - 1.380 mg/L respectively. Macroinvertebrate community in the study area consisted of 36 species of polychaeta, gastropoda, bivalvia, and crustacea, of which, species of polychaeta were dominant in species number. The benthic macroinvertebartes density ranged from 0 - 2.746 individuals/m−1 with the main dominant species of Neanthes caudata, Prionospio malmgreni, Paraprionospio pinnata, Trichochaeta carica, Maldane sarsi, Capitella capitata, Terebellides stroemi, Euditylia polymorpha, Grandidierella lignorum, Apseudes vietnamensis. The biodiversity index values during the monitoring characterized for aquatic environmental conditions of mesotrophic to polytrophic. Besides, species richness positively correlated with DO, total nitrogen, and total phosphorus. The results
Cao, Li; Zhao, Hua; Jiang, Xi; Kalian, Navin
2006-02-01
The Controlled Auto-Ignition (CAI) combustion, also known as Homogeneous Charge Compression Ignition (HCCI), was achieved by trapping residuals with early exhaust valve closure in conjunction with direct injection. Multi-cycle 3D engine simulations have been carried out for parametric study on four different injection timings in order to better understand the effects of injection timings on in-cylinder mixing and CAI combustion. The full engine cycle simulation including complete gas exchange and combustion processes was carried out over several cycles in order to obtain the stable cycle for analysis. The combustion models used in the present study are the Shell auto-ignition model and the characteristic-time combustion model, which were modified to take the high level of EGR into consideration. A liquid sheet breakup spray model was used for the droplet breakup processes. The analyses show that the injection timing plays an important role in affecting the in-cylinder air/fuel mixing and mixture temperature, which in turn affects the CAI combustion and engine performance.
CO-Bridged H-Cluster Intermediates in the Catalytic Mechanism of [FeFe]-Hydrogenase CaI.
Ratzloff, Michael W; Artz, Jacob H; Mulder, David W; Collins, Reuben T; Furtak, Thomas E; King, Paul W
2018-06-20
The [FeFe]-hydrogenases ([FeFe] H 2 ases) catalyze reversible H 2 activation at the H-cluster, which is composed of a [4Fe-4S] H subsite linked by a cysteine thiolate to a bridged, organometallic [2Fe-2S] ([2Fe] H ) subsite. Profoundly different geometric models of the H-cluster redox states that orchestrate the electron/proton transfer steps of H 2 bond activation have been proposed. We have examined this question in the [FeFe] H 2 ase I from Clostridium acetobutylicum (CaI) by Fourier-transform infrared (FTIR) spectroscopy with temperature annealing and H/D isotope exchange to identify the relevant redox states and define catalytic transitions. One-electron reduction of H ox led to formation of H red H + ([4Fe-4S] H 2+ -Fe I -Fe I ) and H red ' ([4Fe-4S] H 1+ -Fe II -Fe I ), with both states characterized by low frequency μ-CO IR modes consistent with a fully bridged [2Fe] H . Similar μ-CO IR modes were also identified for H red H + of the [FeFe] H 2 ase from Chlamydomonas reinhardtii (CrHydA1). The CaI proton-transfer variant C298S showed enrichment of an H/D isotope-sensitive μ-CO mode, a component of the hydride bound H-cluster IR signal, H hyd . Equilibrating CaI with increasing amounts of NaDT, and probed at cryogenic temperatures, showed H red H + was converted to H hyd . Over an increasing temperature range from 10 to 260 K catalytic turnover led to loss of H hyd and appearance of H ox , consistent with enzymatic turnover and H 2 formation. The results show for CaI that the μ-CO of [2Fe] H remains bridging for all of the "H red " states and that H red H + is on pathway to H hyd and H 2 evolution in the catalytic mechanism. These results provide a blueprint for designing small molecule catalytic analogs.
Zanatta, Melina Borges Teixeira; Nakadi, Flávio Venâncio; da Veiga, Márcia Andreia Mesquita Silva
2018-03-01
A new method to determine iodine in drug samples by high-resolution continuum source graphite furnace molecular absorption spectrometry (HR-CS GF MAS) has been developed. The method measures the molecular absorption of a diatomic molecule, CaI or SrI (less toxic molecule-forming reagents), at 638.904 or 677.692nm, respectively, and uses a mixture containing 5μg of Pd and 0.5μg of Mg as chemical modifier. The method employs pyrolysis temperatures of 1000 and 800°C and vaporization temperatures of 2300 and 2400°C for CaI and SrI, respectively. The optimized amounts of Ca and Sr as molecule-forming reagents are 100 and 150µg, respectively. On the basis of interference studies, even small chlorine concentrations reduce CaI and SrI absorbance significantly. The developed method was used to analyze different commercial drug samples, namely thyroid hormone pills with three different iodine amounts (15.88, 31.77, and 47.66µg) and one liquid drug with 1% m v -1 active iodine in their compositions. The results agreed with the values informed by the manufacturers (95% confidence level) regardless of whether CaI or SrI was determined. Therefore, the developed method is useful for iodine determination on the basis of CaI or SrI molecular absorption. Copyright © 2017 Elsevier B.V. All rights reserved.
Park, Changkun; Nagashima, Kazuhide; Krot, Alexander N.; Huss, Gary R.; Davis, Andrew M.; Bizzarro, Martin
2017-03-01
Calcium-aluminum-rich inclusions with isotopic mass fractionation effects and unidentified nuclear isotopic anomalies (FUN CAIs) have been studied for more than 40 years, but their origins remain enigmatic. Here we report in situ high precision measurements of aluminum-magnesium isotope systematics of FUN CAIs by secondary ion mass spectrometry (SIMS). Individual minerals were analyzed in six FUN CAIs from the oxidized CV3 carbonaceous chondrites Axtell (compact Type A CAI Axtell 2271) and Allende (Type B CAIs C1 and EK1-4-1, and forsterite-bearing Type B CAIs BG82DH8, CG-14, and TE). Most of these CAIs show evidence for excess 26Mg due to the decay of 26Al. The inferred initial 26Al/27Al ratios [(26Al/27Al)0] and the initial magnesium isotopic compositions (δ26Mg0) calculated using an exponential law with an exponent β of 0.5128 are (3.1 ± 1.6) × 10-6 and 0.60 ± 0.10‰ (Axtell 2271), (3.7 ± 1.5) × 10-6 and -0.20 ± 0.05‰ (BG82DH8), (2.2 ± 1.1) × 10-6 and -0.18 ± 0.05‰ (C1), (2.3 ± 2.4) × 10-5 and -2.23 ± 0.37‰ (EK1-4-1), (1.5 ± 1.1) × 10-5 and -0.42 ± 0.08‰ (CG-14), and (5.3 ± 0.9) × 10-5 and -0.05 ± 0.08‰ (TE) with 2σ uncertainties. We infer that FUN CAIs recorded heterogeneities of magnesium isotopes and 26Al in the CAI-forming region(s). Comparison of 26Al-26Mg systematics, stable isotope (oxygen, magnesium, calcium, and titanium) and trace element studies of FUN and non-FUN igneous CAIs indicates that there is a continuum among these CAI types. Based on these observations and evaporation experiments on CAI-like melts, we propose a generic scenario for the origin of igneous (FUN and non-FUN) CAIs: (i) condensation of isotopically normal solids in an 16O-rich gas of approximately solar composition; (ii) formation of CAI precursors by aggregation of these solids together with variable abundances of isotopically anomalous grains-possible carriers of unidentified nuclear (UN) effects; and (iii) melt evaporation of these precursors
Directory of Open Access Journals (Sweden)
Luis Alberto Beares
2008-10-01
Full Text Available Tourism in secluded communities puts different cultures in contact with each other and must be handled carefully not to cause environmental damage as well as cultural loss which might jeopardize the local development and create hostile relationships. The proposal of in sito tourism, considering the local memory and patrimony as a hospitality potential, was observed during technical visitations to three communities located in the Paraty region and surroundings: Guarani, Caiçara (fishermen and Quilombola(African slaves descendants. Through field work involving visitations to communities and interviews with locals, information regarding cultural differences and the importance of the land occupation in the history of each of the communities was assessed. The common link in the history of these peoples is the struggle for the right of land possession. During visits when people shared their territory various forms of hospitality in each community were verified, issued from different cultures and cultural values.
Daellenbach, Lawrence A.; And Others
The purpose of this study was to determine the effect of computer assisted instruction (CAI) on the cognitive and affective development of college students enrolled in a principles of macroeconomics course. The hypotheses of the experiment were stated as follows: In relation to the traditional principles course, the experimental treatment will…
《采薇》的叙事伦理分析%Narrative Ethics of Cai Wei
Institute of Scientific and Technical Information of China (English)
王海燕
2014-01-01
The controversial dilemma of how to understand Boyi, Shuqi in Luxun’ s novel Cai Wei, it is not a realistic ethical problem, which should be based on the novel's narrative ethics to answer. Narrative ethics refers to various forms of arrangement of ethical dimension revealed. Novel manifests sympathy ethics to Boyi, Shu Qi through the narrative angle choice and narrative distance controlling. Also, by the counterpoint to character, event and ironic expression in structure, novel conveys the ethics excluding to all sorts of characters from emperor Zhouwu to A Jin. Compared to other “Generational change” theme novels of Luxun, the complication of narrative ethics of Cai Wei not only is the projection of reality, but also reflects the further conscious to narrative art of Luxun.%《采薇》中颇有争议的“如何理解伯夷、叔齐”这一难点,并不是一个现实伦理问题,而应依据小说的叙事伦理来解答。叙事伦理即各种形式安排透露出的伦理维度。小说通过叙事角度的选择与叙事距离的控制体现出对伯夷、叔齐的伦理同情,而由结构上的人物对位与事件对位及反讽表达的是对自周武王至阿金诸色人物的伦理拒斥。与前期同是“易代”主题的小说相比,《采薇》叙事伦理的复杂化既是现实的投射,也体现了鲁迅对于小说叙事艺术的进一步自觉。
A New Type of Foreign Clast in A Polymict Ureilite: A CAI or AL-Rich Chondrule
Goodrich, C. A.; Ross, D. K.; Treiman, A. H.
2017-01-01
Introduction: Polymict ureilites are breccias interpreted to represent regolith formed on a ureilitic asteroid [1-3]. They consist of approximately 90-95% clasts of various ureilite types (olivine-pyroxene rocks with Fo 75-95), a few % indigenous feldspathic clasts, and a few % foreign clasts [4-20]. The foreign clasts are diverse, including fragments of H, L, LL and R chondrites, angrites, other achondrites, and dark clasts similar to CC [6,7,9-19]. We report a new type of foreign clast in polymict ureilite DaG 999. Methods: Clast 8 in Dar al Gani (DaG) 999/1 (Museum fur Naturkunde) was discovered during a survey of feldspathic clasts in polymict ureilites [19,20]. It was studied by BEI, EMPA, and X-ray mapping on the JEOL 8530F electron microprobe at ARES, JSC. Petrography and Mineral Compositions: Clast 8 is sub-rounded to irregular in shape, approximately 85 micrometers in diameter, and consists of approximately 68% pyroxene and 32% mesostasis (by area). Part of the pyroxene (top half of clast in Fig. 1a and 2) shows a coarse dendritic morphology; the rest appears massive. Mesostasis may be glassy and contains fine needles/grains of pyroxene. The pyroxene has very high CaO (23.5 wt.%) and Al2O3 (19.7 wt.%), with the formula: (Ca(0.91)Mg(0.63)Fe(0.01)Al(sup VI) (0.38)Cr(0.01)Ti(0.05)1.99 Si2O6. The bulk mesostasis also has very high Al2O3 (approximately 26 wt.%). A bulk composition for the clast was obtained by combining modal abundances with phase compositions (Table 1, Fig. 3). Discussion: The pyroxene in clast 8 has a Ca-Al-(Ti)- rich (fassaitic) composition that is clearly distinct from compositions of pyroxenes in main group ureilites [22] or indigenous feldspathic clasts in polymict ureilites [4-8]. It also has significantly higher Al than fassaite in angrites (up to approximately 12 wt.% [23]), which occur as xenoliths in polymict ureilites. Ca-Al-Ti rich pyroxenes are most commonly found in CAIs, Al-rich chondrules and other types of refractory
New Petrology, Mineral Chemistry and Stable MG Isotope Compositions of an Allende CAI: EK-459-7-2
Jeffcoat, C. R.; Kerekgyarto, A. G.; Lapen, T. J.; Righter, M.; Simon, J. I.; Ross, D. K.
2016-01-01
Calcium-aluminum-rich inclusions (CAIs) are the key to understanding physical and chemical conditions in the nascent solar nebula. These inclusions have the oldest radiometric ages of solar system materials and are composed of phases that are predicted to condense early from a gas of solar composition. Thus, their chemistry and textures record conditions and processes in the earliest stages of development of the solar nebula. Type B inclusions are typically larger and more coarse grained than other types with substantial evidence that many of them were at least partially molten. Type B inclusions are further subdivided into Type B1 (possess thick melilite mantle) and Type B2 (lack melilite mantle). Despite being extensively studied, the origin of the melilite mantles of Type B1 inclusions remains uncertain. We present petrologic and chemical data for a Type B inclusion, EK-459-7-2, that bears features found in both Type B1 and B2 inclusions and likely represents an intermediate between the two types. Detailed studies of more of these intermediate objects may help to constrain models for Type B1 rim formation.
Fliegner, Maike; Krupp, Kerstin; Brunner, Franziska; Rall, Katharina; Brucker, Sara Y; Briken, Peer; Richter-Appelt, Hertha
2014-03-01
Sexual wellness depends on a person's physical and psychological constitution. Complete Androgen Insensitivity Syndrome (CAIS) and Mayer-Rokitansky-Küster-Hauser Syndrome (MRKHS) can compromise sexual well-being. To compare sexual well-being in CAIS and MRKHS using multiple measures: To assess sexual problems and perceived distress. To gain insight into participants' feelings of inadequacy in social and sexual situations, level of self-esteem and depression. To determine how these psychological factors relate to sexual (dys)function. To uncover what participants see as the source of their sexual problems. Data were collected using a paper-and-pencil questionnaire. Eleven individuals with CAIS and 49 with MRKHS with/without neovagina treatment were included. Rates of sexual dysfunctions, overall sexual function, feelings of inadequacy in social and sexual situations, self-esteem and depression scores were calculated. Categorizations were used to identify critical cases. Correlations between psychological variables and sexual function were computed. Sexually active subjects were compared with sexually not active participants. A qualitative content analysis was carried out to explore causes of sexual problems. An extended list of sexual problems based on the Diagnostic and Statistical Manual of Mental Disorders, 4th ed., text revision, by the American Psychiatric Association and related distress. Female Sexual Function Index (FSFI), German Questionnaire on Feelings of Inadequacy in Social and Sexual Situations (FUSS social scale, FUSS sexual scale), Rosenberg Self-Esteem Scale (RSE), Brief Symptom Inventory (BSI) subscale depression. Open question on alleged causes of sexual problems. The results point to a far-reaching lack of sexual confidence and sexual satisfaction in CAIS. In MRKHS apprehension in sexual situations is a source of distress, but sexual problems seem to be more focused on issues of vaginal functioning. MRKHS women report being satisfied with their
Hashimoto, M.; Takenaka, H.; Higurashi, A.; Nakajima, T.
2017-12-01
Aerosol in the atmosphere is an important constituent for determining the earth's radiation budget, so the accurate aerosol retrievals from satellite is useful. We have developed a satellite remote sensing algorithm to retrieve the aerosol optical properties using multi-wavelength and multi-pixel information of satellite imagers (MWPM). The method simultaneously derives aerosol optical properties, such as aerosol optical thickness (AOT), single scattering albedo (SSA) and aerosol size information, by using spatial difference of wavelegths (multi-wavelength) and surface reflectances (multi-pixel). The method is useful for aerosol retrieval over spatially heterogeneous surface like an urban region. In this algorithm, the inversion method is a combination of an optimal method and smoothing constraint for the state vector. Furthermore, this method has been combined with the direct radiation transfer calculation (RTM) numerically solved by each iteration step of the non-linear inverse problem, without using look up table (LUT) with several constraints. However, it takes too much computation time. To accelerate the calculation time, we replaced the RTM with an accelerated RTM solver learned by neural network-based method, EXAM (Takenaka et al., 2011), using Rster code. And then, the calculation time was shorternd to about one thouthandth. We applyed MWPM combined with EXAM to GOSAT/TANSO-CAI (Cloud and Aerosol Imager). CAI is a supplement sensor of TANSO-FTS, dedicated to measure cloud and aerosol properties. CAI has four bands, 380, 674, 870 and 1600 nm, and observes in 500 meters resolution for band1, band2 and band3, and 1.5 km for band4. Retrieved parameters are aerosol optical properties, such as aerosol optical thickness (AOT) of fine and coarse mode particles at a wavelenth of 500nm, a volume soot fraction in fine mode particles, and ground surface albedo of each observed wavelength by combining a minimum reflectance method and Fukuda et al. (2013). We will show
Directory of Open Access Journals (Sweden)
Sunny S. J. Lin
1988-03-01
Full Text Available 無First reviews the development of Computer. Assisted Instruction (CAI in Taiwan. This study describes the training of teachers from different levels of schools to design CAI coursewares, and the planning of CAI courseware bank possesses 2,000 supplemental coursewares. Some CAI's c1assroom application system should be carefully established to prevent the easy abuse of a CAI courseware as an instructional plan. The study also claims to steer CAI in our elemantary and secondary education could rely on the mastery learning as the instructional plan. In this case, CAI must limit its role as the formative test and remedial material only. In the higher education , the Keller's Personalized System of Instruction could be an effective c1assroom management system. Therefore, CAI will offer study guide and formative test only. Using these 2 instructional system may enhance student's achievement , and speed up the learning rate at the same time. Combining with individualized instruction and CAI will be one of the most workable approach in current c1assroom . The author sets up an experiment 10 varify their effectiveness and efficiency in the near future.
Energy Technology Data Exchange (ETDEWEB)
Jeong, D. [Korea Inst. of Machinery and Materials, Daejou (Korea)
2005-07-01
A significant challenge grows from the ever-increasing demands for the optimization of performance, emissions, fuel economy and drivability. The most powerful technologies in the near future to improve these factors are believed Controlled Auto-Ignition (CAI) in gasoline engine and Gas to Liquid (GTL) as a fuel of Diesel engine. In recent years there has been an increasing trend to use more complex valvetrain designs from traditional camshaft driven mechanical systems to camless electromagnetic or electrohydraulic solutions. Comparing to fixed valve actuation systems, variable valve actuation (VVA) should be powerful to optimize the engine cycle. The matching of valve events to the engine performance and to emission requirements at a given engine or vehicle operating condition can be further optimized to the Controlled Auto-Ignition (CAI) in gasoline engine, which has benefits in NOx emission, fuel consumption, combustion stability and intake throttle load. In case of Diesel engine, the increasing demands for NOx and soot emission reduction have introduced aftertreatment technologies recently, but been in need of basic solution for the future, such as a super clean fuel like Gas to Liquid (GTL), which has benefits in comparability to diesel fuel, independency from crude oil and reduction of CO, THC and soot emissions. Korea looks to the future with these kinds of technologies, and tries to find the possibility for reaching the future targets in the internal combustion engine. (orig.)
Crystal Growth and Scintillation Properties of Eu2+ doped Cs4CaI6 and Cs4SrI6
Stand, L.; Zhuravleva, M.; Chakoumakos, B.; Johnson, J.; Loyd, M.; Wu, Y.; Koschan, M.; Melcher, C. L.
2018-03-01
In this work we present the crystal growth and scintillation properties of two new ternarymetal halide scintillators activated with divalent europium, Cs4CaI6 and Cs4SrI6. Single crystals of each compound were grown in evacuated quartz ampoules via the vertical Bridgman technique using a two-zone transparent furnace. Single crystal X-ray diffraction experiments showed that both crystals have a trigonal (R-3c) structure, with a density of 3.99 g/cm3 and 4.03 g/cm3. The radioluminescence and photoluminescence measurements showed typical luminescence properties due to the 5d-4f radiative transitions in Eu2+. At this early stage of development Cs4SrI6:Eu and Cs4CaI6:Eu have shown very promising scintillation properties, with light yields and energy resolutions of 62,300 ph/MeV and 3.3%, and 51,800 photons/MeV and 3.6% at 662 keV, respectively.
Directory of Open Access Journals (Sweden)
Rodrigo Borges
2009-09-01
Full Text Available A Área de Proteção Ambiental de Cairuçu (APA localiza-se no município de Paraty, RJ. É uma unidade de conservação de uso sustentável e dispõe-se a proteger o ambiente natural e as comunidades caiçaras da região. O objetivo deste estudo foi realizar um inventário etnobotânico das plantas conhecidas e utilizadas pela comunidade caiçara que habita a praia de Martim de Sá. Moram no local 30 pessoas das quais 10 foram entrevistadas. As informações etnobotânicas foram obtidas através da observação participante e entrevistas semi-estruturadas. O material botânico coletado foi depositado no Herbário do Instituto de Pesquisas Jardim Botânico do Rio de Janeiro (RB. Foram identificadas 76 espécies pertencentes a 59 gêneros e 30 famílias botânicas consideradas úteis pelos caiçaras. As três espécies mais citadas foram: Sloanea obtusifolia (Sapopema, Scherolobium denudatum (Ingá-ferro e Balizia pedicelaris (Timbuíba. Utilizou-se o Índice de Shannon (H' = 1,81 - base 10 para a análise da diversidade de espécies. O registro sobre o uso dos recursos vegetais na comunidade estudada fornece informações que podem ser utilizadas para programas de conservação baseados no conhecimento local do ambiente.The Cairuçu Environmental Protection Area (APA was created to help assure the protection of the natural environment and its sustainable use by the caiçara communities in the region. This work presents an ethnobotanical inventory of the plants known and used by the caiçara community living on Martim de Sá beach in Paraty municipality, RJ. Thirty people live in the locality and ten of them were interviewed. Ethnobotanical information was obtained through participatory observations and semi-structured interviews with the local residents. All botanical material collected was deposited in the herbarium of the Instituto de Pesquisas Jardim Botânico do Rio de Janeiro (RB. A total of 76 species belonging to 59 genera and 30
DEFF Research Database (Denmark)
Bui, Huong Mai; Le Danh Tuyen; Do Huu Tuan
2016-01-01
Aflatoxins, fumonisins and ochratoxin A that contaminate various agricultural commodities are considered of significant toxicity and potent human carcinogens. This study took a total dietary study approach and estimated the dietary exposure of these mycotoxins for adults living in Lao Cai province...... higher than recommended provisional tolerable daily intake (PTDI) values mainly due to contaminated cereals and meat. The exposure to total fumonisins (1400 ng/kg bw/day) was typically lower than the PTDI value (2000 ng/kg bw/day). The estimated risk of liver cancer associated with exposure to aflatoxin...... B1 was 2.7 cases/100,000 person/year. Margin of exposure (MOE) of renal cancer linked to ochratoxin A and liver cancer associated with fumonisins were 1124 and 1954, respectively indicating risk levels of public health concern. Further studies are needed to evaluate the efficiency of technical...
Huong, Bui Thi Mai; Tuyen, Le Danh; Tuan, Do Huu; Brimer, Leon; Dalsgaard, Anders
2016-12-01
Aflatoxins, fumonisins and ochratoxin A that contaminate various agricultural commodities are considered of significant toxicity and potent human carcinogens. This study took a total dietary study approach and estimated the dietary exposure of these mycotoxins for adults living in Lao Cai province, Vietnam. A total of 42 composite food samples representing 1134 individual food samples were prepared according to normal household practices and analysed for the three mycotoxins. Results showed that the dietary exposure to aflatoxin B1 (39.4 ng/kg bw/day) and ochratoxin A (18.7 ng/kg bw/day) were much higher than recommended provisional tolerable daily intake (PTDI) values mainly due to contaminated cereals and meat. The exposure to total fumonisins (1400 ng/kg bw/day) was typically lower than the PTDI value (2000 ng/kg bw/day). The estimated risk of liver cancer associated with exposure to aflatoxin B1 was 2.7 cases/100,000 person/year. Margin of exposure (MOE) of renal cancer linked to ochratoxin A and liver cancer associated with fumonisins were 1124 and 1954, respectively indicating risk levels of public health concern. Further studies are needed to evaluate the efficiency of technical solutions which could reduce mycotoxin contamination as well as to determine the health effects of the co-exposure to different types of mycotoxins. Copyright © 2016 Elsevier Ltd. All rights reserved.
Mendybaev, Ruslan A.; Williams, Curtis D.; Spicuzza, Michael J.; Richter, Frank M.; Valley, John W.; Fedkin, Alexei V.; Wadhwa, Meenakshi
2017-03-01
We present the results of laboratory experiments in which a forsterite-rich melt estimated to be a potential precursor of Allende CMS-1 FUN CAI was evaporated into vacuum for different lengths of time at 1900 °C. The evaporation of this melt resulted in residues that define trajectories in chemical as well as magnesium, silicon and oxygen isotopic composition space and come very close to the measured properties of CMS-1. The isotopic composition of the evaporation residues was also used to determine the kinetic isotopic fractionation factors [α2,1 (vapor-melt) defined as the ratio of isotopes 2 and 1 of a given element in the evaporating gas divided by their ratio in the evaporating source] for evaporation of magnesium (α25,24 for 25Mg/24Mg), silicon (α29,28 for 29Si/28Si) and oxygen (α18,16 for 18O/16O) from the forsterite-rich melt at 1900 °C. The values of α25,24 = 0.98383 ± 0.00033 and α29,28 = 0.99010 ± 0.00038 are essentially independent of change in the melt composition as evaporation proceeds. In contrast, α18,16 changes from 0.9815 ± 0.0016 to ∼0.9911 when the residual melt composition changes from forsteritic to melilitic. Using the determined values of α25,24 and α29,28 and present-day bulk chemical composition of the CMS-1, the composition of the precursor of the inclusion was estimated to be close to the clinopyroxene + spinel + forsterite assemblage condensed from a solar composition gas. The correspondence between the chemical composition and isotopic fractionation of experimental evaporation residues and the present-day bulk chemical and isotopic compositions of CMS-1 is evidence that evaporation played a major role in the chemical evolution of CMS-1.
Koukina, S. E.; Lobus, N. V.; Peresypkin, V. I.; Dara, O. M.; Smurov, A. V.
2017-11-01
Major (Si, Al, Fe, Ti, Mg, Ca, Na, K, S, P), minor (Mn) and trace (Li, V, Cr, Co, Ni, Cu, Zn, As, Sr, Zr, Mo, Cd, Ag, Sn, Sb, Cs, Ba, Hg, Pb, Bi and U) elements, their chemical forms and the mineral composition, organic matter (TOC) and carbonates (TIC) in surface sediments from the Cai River estuary and Nha Trang Bay were first determined along the salinity gradient. The abundance and ratio of major and trace elements in surface sediments are discussed in relation to the mineralogy, grain size, depositional conditions, reference background and SQG values. Most trace-element contents are at natural levels and are derived from the composition of rocks and soils in the watershed. A severe enrichment of Ag is most likely derived from metal-rich detrital heavy minerals such as Ag-sulfosalts. Along the salinity gradient, several zones of metal enrichment occur in surface sediments because of the geochemical fractionation of the riverine material. The parts of actually and potentially bioavailable forms (isolated by four single chemical reagent extractions) are most elevated for Mn and Pb (up to 36% and 32% of total content, respectively). The possible anthropogenic input of Pb in the region requires further study. Overall, the most bioavailable parts of trace elements are associated with easily soluble amorphous Fe and Mn oxyhydroxides. The sediments are primarily enriched with bioavailable metal forms in the riverine part of the estuary. Natural (such as turbidities) and human-generated (such as urban and industrial activities) pressures are shown to influence the abundance and speciation of potential contaminants and therefore change their bioavailability in this estuarine system.
Feurzeig, Wallace
1984-01-01
The first expert instructional system, the Socratic System, was developed in 1964. One of the earliest applications of this system was in the area of differential diagnosis in clinical medicine. The power of the underlying instructional paradigm was demonstrated and the potential of the approach for valuably supplementing medical instruction was recognized. Twenty years later, despite further educationally significant advances in expert systems technology and enormous reductions in the cost of computers, expert instructional methods have found very little application in medical schools.
Directory of Open Access Journals (Sweden)
T. T. B. Ngoc
2012-12-01
Full Text Available The effect of genotype, fibre level and fibre source on gut morphology, environment and microflora was studied using 18 Mong Cai (MC and 18 Landrace×Yorkshire (LY pigs, aged around 60 d. The diets were based on maize, rice bran, soybean meal, fish meal and soybean oil, and cassava residue (CR or brewer’s grain (BG as fibrous ingredient sources in the high-fibre diets (HF. A low-fibre diet (LF, containing around 200 g NDF/kg dry matter (DM, was formulated without CR and BG as feed ingredients. The HF diets (HF-CR and HF-BG were formulated to contain around 270 g NDF/kg DM. The experiment was arranged according to a 2×3 factorial completely randomized design with six replications, and lasted 30 d. Crypt density in ileum was lowest (p<0.05 and villus height in jejunum and ileum were the greatest (p<0.05 in pigs fed diet HF-BG. Villus width in ileum was greatest in pigs fed diets HF-CR and HF-BG (p<0.05. Lactic acid bacteria (LAB counts in stomach were greatest (p<0.05 and E. coli counts in ileum and colon were lowest (p<0.05 in pigs fed diet HF-CR. The concentration of total organic acids in ileum, caecum and colon were greatest (p<0.05, and pH in ileum and colon were lowest (p<0.05 in pigs fed diet HF-CR. Crypt density in ileum was lowest, and villus height in ileum and villus width in jejunum and ileum was greatest in LY pigs (p<0.05. LAB counts in stomach and ileum were greatest, and E. coli counts in ileum were lowest in MC pigs (p<0.05. The concentration of total organic acids in ileum, caecum and colon were greatest (p<0.05 and pH lowest (p<0.05 in MC pigs.
STAF: A Powerful and Sophisticated CAI System.
Loach, Ken
1982-01-01
Describes the STAF (Science Teacher's Authoring Facility) computer-assisted instruction system developed at Leeds University (England), focusing on STAF language and major program features. Although programs for the system emphasize physical chemistry and organic spectroscopy, the system and language are general purpose and can be used in any…
Spectroscopy and Photometry of CAI-rich asteroids
Tanga, P.; Devogele, M.; Bendjoya, Ph.; Cellino, A.; Surdej, J.
2017-09-01
Asteroids with an anomalous amount of primitive elements, formed in ancient times in the solar nebula, exist. Our study confirms their nature and provides hints to the interpretation of the ancient evolution of asteroids.
Development of the CAI system for inheritance of maintenance expertise
International Nuclear Information System (INIS)
Hanafusa, Hidemitsu; Chigusa, Naoki; Furuta, Kazuo
2002-01-01
High quality maintenance is required in order to secure the safety of nuclear power plants. The engineers engaged in maintenance activities have to master various knowledge, including the explicit and tacit knowledge of experienced experts, through education and training. Moreover, it is also very important to prevent these knowledge from getting scattered and lost with a change of generation and to share the knowledge or expertise. The purpose of this study is to develop a support system for the next generation experts to help them master and make use of the knowledge of their predecessors. The knowledge or expertise consist of ''knowledge about the maintenance tasks'', ''knowledge about structure/function of plant system/equipment'', and ''individual knowledge based on trouble experience etc.''. The ways this knowledge could be represented were considered first, then this support system was developed based on such representation. (author)
CAI and Its Application in Rural Junior English Class
He, Xiaojun
2015-01-01
Superiority in developing students' listening, speaking, etc. This thesis explores how to provide a better environment for English teaching in rural junior school with the aid of multimedia and find some ways to improve teaching efficiency. In recent years, using multimedia is the direction of reform and mainstream in English teaching. Compared…
Rigney, Joseph W.
A report is given of a feasibility study in which several possible relationships between student, computer terminal, and electronic equipment were considered. The simplest of these configurations was set up and examined in terms of its feasibility for teaching the performance of fault localization on a Navy transceiver. An instructional program…
Technical issues and a prospect of ICAI. Chiteki CAI no gijutsu kadai to kongo no doko
Energy Technology Data Exchange (ETDEWEB)
Otsuki, S. (Kyushu Institute of Technology, Kitakyushu (Japan))
1992-12-10
This paper explains technical issues and a prospect for intelligent computer assisted instruction (ICAI) which combines the intelligent tutoring system (ITS) with an open-ended (discovery) type education system. The paper summarizes the ITS characterized by modelling students based on error-origin diagnostic technologies; various functions that have been realized for the first time therefrom; different methods for error diagnosis and error-origin diagnosis; and criteria to evaluate these methods (evaluating generality, coverage, and tractability). The paper indicates that no complete diagnostic methods have been obtained according to these criteria, that, therefore, an issue of incompleteness in the student model still remains, and that unsolved issues in the ITS include some that exceed the framework of the ITS. Also mentioned in the paper are that the discovery type education system has a possibility of realizing an education with new quality, and that a new attempt is being performed to merge the ITS with the discovery type education system. 17 refs., 2 figs.
Esrall, F.
2013-01-01
Impact damage has been known to seriously limit the performance of composite aircraft structures. In the preliminary design phase, tens of thousands of subparts need to be analyzed for impact. Over the years, many approaches have been proposed to study the creation of impact damage and to determine
A Numerical/Experimental Study on the Impact and CAI Behaviour of Glass Reinforced Compsite Plates
Perillo, Giovanni; Jørgensen, Jens K.; Cristiano, Roberta; Riccio, Aniello
2018-04-01
This paper focuses on the development of an advance numerical model specifically for simulating low velocity impact events and related stiffness reduction on composite structures. The model is suitable for low cost thick composite structures like wind turbine blade and maritime vessels. The model consist of a combination of inter and intra laminar models. The intra-laminar model present a combination of Puck and Hashin failure theories for the evaluation of the fibre and matrix failure. The inter-laminar damage is instead simulated by Cohesive Zone Method based on energy approach. Basic material properties, easily measurable according to standardized tests, are required. The model has been used to simulate impact and compression after impact tests. Experimental tests have been carried out on thick E-Glass/Epoxy composite commonly used in the wind turbine industry. The clustering effect as well as the consequence of the impact energy have been experimentally tested. The accuracy of numerical model has been verified against experimental data showing a very good accuracy of the model.
Asociativismo Privado e Información Contable. Proyecto CAI+D
Directory of Open Access Journals (Sweden)
Ma. Luz Casabianca
2006-12-01
Full Text Available La información contable de entidades solidarias debe ser transparente y estar organizada de manera que su mera exposición ponga en evidencia tal condición. A ello se une la trascendencia de la información complementaria en los estados contables que contiene datos esenciales, donde le contenido es más importante que la forma y que puede resultar insuficiente para los asociados, terceros y organismos de control. La manipulación contable como el caso Parmalat -Italía, diciembre de 2003- o la quiebra de Enron -Estados Unidos, diciembre de 2001- alteraron la confianza en los objetivos sociales de la información contable. Conviene proteger al asociativismo, advirtiendo que se maquillan cuentas con Contabilidad Creativa sin desobedecer las disposiciones normativas, lo cual beneficia un sector en detrimento de otro.
Using a CAI Network for Statewide Remediation: GRI in South Carolina.
Rumford, John
1988-01-01
Describes South Carolina's Governor's Remediation Initiative (GRI), an instructional management system that links diagnostic tests and teaching modules for use by high school mathematics and reading laboratories. (TW)
A CAI System for Visually Impaired Children to Improve Abilities of Orientation and Mobility
Yoneda, Takahiro; Kudo, Hiroaki; Minagawa, Hiroki; Ohnishi, Noboru; Matsubara, Shizuya
Some visually impaired children have difficulty in simple locomotion, and need orientation and mobility training. We developed a computer assisted instruction system which assists this training. A user realizes a task given by a tactile map and synthesized speech. The user walks around a room according to the task. The system gives the gap of walk path from its target path via both auditory and tactile feedback after the end of a task. Then the user can understand how well the user walked. We describe the detail of the proposed system and task, and the experimental result with three visually impaired children.
2012-02-17
... components of a land mobile radio (LMR) system. LMR systems are commonly used by emergency responders in portable handheld and mobile vehicle-mounted devices. Although formal standards are being developed, no process is currently in place to confirm that LMR equipment advertised as P25-compliant meets all aspects...
Institute of Scientific and Technical Information of China (English)
无
2001-01-01
Natural gas diffusion through the cap rock is mainly by means ofdissolving in water, so its concentration can be replaced by solubility, which varies with temperature, pressure and salinity in strata. Under certain geological conditions the maximal solubility is definite, so the diffusion com-putation can be handled approximately by stable state equation. Furthermore, on the basis of the restoration of the paleo-buried history, the diffusion is calculated with the dynamic method, and the result is very close to the real diffusion value in the geological history.
Ollendick, Thomas H.; And Others
1986-01-01
The relationship between a self-report measure of assertive behavior in children and a role-play measure was examined in 69 elementary school children. Self-report of positive assertion related more closely to role-play measures and expert ratings of assertiveness than did self-report of negative assertion. (Author/LHW)
Qayumi, A K; Kurihara, Y; Imai, M; Pachev, G; Seo, H; Hoshino, Y; Cheifetz, R; Matsuura, K; Momoi, M; Saleem, M; Lara-Guerra, H; Miki, Y; Kariya, Y
2004-10-01
This study aimed to compare the effects of computer-assisted, text-based and computer-and-text learning conditions on the performances of 3 groups of medical students in the pre-clinical years of their programme, taking into account their academic achievement to date. A fourth group of students served as a control (no-study) group. Participants were recruited from the pre-clinical years of the training programmes in 2 medical schools in Japan, Jichi Medical School near Tokyo and Kochi Medical School near Osaka. Participants were randomly assigned to 4 learning conditions and tested before and after the study on their knowledge of and skill in performing an abdominal examination, in a multiple-choice test and an objective structured clinical examination (OSCE), respectively. Information about performance in the programme was collected from school records and students were classified as average, good or excellent. Student and faculty evaluations of their experience in the study were explored by means of a short evaluation survey. Compared to the control group, all 3 study groups exhibited significant gains in performance on knowledge and performance measures. For the knowledge measure, the gains of the computer-assisted and computer-assisted plus text-based learning groups were significantly greater than the gains of the text-based learning group. The performances of the 3 groups did not differ on the OSCE measure. Analyses of gains by performance level revealed that high achieving students' learning was independent of study method. Lower achieving students performed better after using computer-based learning methods. The results suggest that computer-assisted learning methods will be of greater help to students who do not find the traditional methods effective. Explorations of the factors behind this are a matter for future research.
The center-to-limb behavior of CaI lambda 6573 and [Ca II] lambda 7324
International Nuclear Information System (INIS)
Ayres, T.R.; Testerman, L.
1978-01-01
Center-to-limb measurements of the Ca I lambda 6573 intercombination line and the Ca II lambda 7324 forbidden line are compared with synthetic profiles based on a simple representation of the non-LTE Ca-Ca + ionization equilibrium. The effects of photoionization from low lying excited states of neutral calcium are found to reduce the sensitivity of the lambda 6573 center-to-limb behavior as a thermal structure diagnostic. The synthetic center-to-limb behavior is also sensitive to uncertainties in the nonthermal broadening. Nevertheless, the measured center-to-limb behavior of lambda 6573 favors a 'cool' photospheric model similar to the Vernazza, Avrett, and Loeser model M over hotter models based on the Ca II K wings. The non-LTE calcium abundance obtained from the disk center equivalent widths of lambda 6573 and lambda 7324 using the best fit model is Asub(Ca)approximately=2.1+-0.2x10 -6 (by number relative to hydrogen). Applications of these lines as diagnostics of the Ca-Ca + ionization equilibrium in other stars are briefly discussed. (Auth.)
Radiology examination as a diagnostic aid in presentations with ...
African Journals Online (AJOL)
Radiology examination as a diagnostic aid in presentations with wide differential diagnoses: Case report of new Hodgkin's lymphoma on a background of poorly controlled HIV. Rachel Hubbard, Jalpa Kotecha, Thomas Nash, Yu Jin Lee, Nasir Khan, Farhat Kazmi ...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...
Indian Academy of Sciences (India)
its nutritional value and low glycemic index (Ullrich 2011). Lebanon belongs to the ... Rim Mzid and Farhat Chibani contributed equally to this work. biochemical accomplished ..... environment interaction of hordein content. J. Cereal Sci. 34,.
On the Convergence of a Dual-Primal Substructuring Method
National Research Council Canada - National Science Library
Mandel, Jan; Tezaur, Radek
2000-01-01
In the Dual-Primal FETI method, introduced by Farhat et al., the domain is decomposed into non-overlapping subdomains, but the degrees of freedom on crosspoints remain common to all subdomains adjacent to the crosspoint...
l'otite externe nécrosante place de l'oxygénothérapie hyperbare
African Journals Online (AJOL)
HÔPITAL UNIVERSITAIRE FARHAT HACHED SOUSSE. * CENTRE ... Keywords : Necrotizing otitis externa; hyperbaric oxygen therapy; treatment. CAS CLINIQUES .... rapie hyperbare, mais la disponibilité d'un seul centre en. Tunisie. Auteurs.
Directory of Open Access Journals (Sweden)
Wang Shougang
2017-01-01
Full Text Available On the gradual implementation of the new medical education reform and thoroughly applying the Educational Development Plan and the Health Care System Reform, the teaching mode of medical discipline will be changed gradually by following the law of medical education and meeting the need to boost the medical education reform. Meanwhile, the changing life-style prompts the traditional dispensing mode for Chinese traditional medicine to various modes. This changing put forward higher requirement for medicine- related professionals During the process of Chinese medicine teaching, the only method which can fulfill the new need for graduates of Chinese medicine and qualified medicine personals is to change the traditional teaching mode to the new ones which can arose the enthusiasm of working and learning by the traditional medicine students.
DEFF Research Database (Denmark)
Therkildsen, Christina; Bergmann, Troels K; Henrichsen-Schnack, Tine
2014-01-01
BACKGROUND: In metastatic colorectal cancer, mutation testing for KRAS exon 2 is widely implemented to select patients with wild-type tumors for treatment with the monocloncal anti-EGFR antibodies cetuximab and panitumumab. The added predictive value of additional biomarkers in the RAS-RAF-MAPK a......BACKGROUND: In metastatic colorectal cancer, mutation testing for KRAS exon 2 is widely implemented to select patients with wild-type tumors for treatment with the monocloncal anti-EGFR antibodies cetuximab and panitumumab. The added predictive value of additional biomarkers in the RAS...
1996-10-01
Food and Water Consumption and Locomotor Movement in Rats, Lab Animals, 26:180-189 (1992). Mann, F.G. and Pope, W.J., "Production and Reactions of ý...and Use: t-butyl alcohol is used in the manufacture of flotation agents, flavors, perfumes, used extensively as a solvent, as a gasoline additive
Dry, Carolyn
2007-04-01
The research on self repair of airplane components, under an SBIR phase II with Wright Patterson Air Force Base, has investigated the attributes and best end use applications for such a technology. These attributes include issues related to manufacturability, cost, potential benefits such as weight reduction, and cost reduction. The goal of our research has been to develop self-repairing composites with unique strength for air vehicles. Our revolutionary approach involves the autonomous release of repair chemicals from within the composite matrix itself. The repair agents are contained in hollow, structural fibers that are embedded within the matrix. Under stress, the composite senses external environmental factors and reacts by releasing the repair agents from within the hollow vessels. This autonomous response occurs wherever and whenever cracking, debonding or other matrix damage transpires. Superior performance over the life of the composite is achieved through this self-repairing mechanism. The advantages to the military would be safely executed missions, fewer repairs and eventually lighter vehicles. In particular the research has addressed the issues by correlating the impact of the various factors, such as 1) delivery vessel placement, shape/size and effect on composite strength, chemicals released and their effect on the matrix, release trigger and efficacy and any impact on matrix properties 2) impact of composite processing methods that involve heat and pressure on the repair vessels. Our self repairing system can be processed at temperatures of 300-350F, repairs in less than 30 seconds and does not damage the composite by repair fiber insertion or chemical release. Scaling up and manufacture of components has revealed that anticipating potential problems allowed us to avoid those associated with processing temperatures and pressures. The presentation will focus on compression after impact testing and the placement of repair fibers/tubes into prepreg laminates.
Directory of Open Access Journals (Sweden)
Irawan Wisnu Wardhana
2013-03-01
Full Text Available Meningkatnya jumlah industri laundry akan mengakibatkan meningkatnya penggunaan deterjen. Zat yang dominan terkandung dalam deterjen adalah natrium tripolyphosphat yang berfungsi sebagai builder dan surfaktan, sehingga limbahnyapun mengandung phosphat. Hampir semua industri laundry membuang limbahnya tanpa melalui pengolahan terlebih dahulu, hal tersebut akan menyebabkan eutrofikasi dimana badan air menjadi kaya akan nutrien terlarut, menurunnya kandungan oksigen terlarut dan kemampuan daya dukung badan air terhad ap biota air. Menurut hasi uji pendahuluan, limbah cair industri tersebut mengandung kadar phos phat sebesar 10,21 mg/l. Kadar tersebut melebihi baku mutu Perda Prop. Jateng No 10 tahun 2004, dimana kadar maksimum untuk phosphat total adalah 2 mg/l. Salah satu cara pengolahan limbah adalah dengan proses adsorpsi menggunakan karbon aktif dari sampah plastik jenis polyethylene. Penelitian ini bertujuan untuk mengetahui kemamapuan karbon aktif dari sampah plas tik dalam menurunkan kandungan phosphat dengan percobaan batch dan kontinyu. Percobaan batch menggunakan variasi berat karbon aktif dari sampah plastik 1,2, dan 3 gram untuk masing-masimg variasi ukuran media 30-60 mesh dan 100-200 mesh. Percobaan batch mempunyai efisiensi penurunan phosphat tertinggi pada berat 3 gram (100-200mesh sebesar 45,45%. Sedangkan percobaan kontinyu dilakukan pada kolom berdiameter 1 inchi dengan variasi debit 50 ml/menit dan 100 ml/menit. Percobaan kontinyu mempunyai efisiensi penurunan phosphat terbesar pada debit 50 ml/menit sebesar 54,75%. Nilai konstanta kecepatan (k1 0,0108 ml/mg.dtk dengan kapasitas serap (qo 0,677 mg/g.
Stern, Cindy; Pearson, Alan; Chur-Hansen, Anna
2011-01-01
Background: Canine-assisted interventions are used frequently in long term care settings, even though their effectiveness has not been definitively proven. One concern commonly described in the literature is the risk of zoonotic infection or animal-related injury/allergy associated with this type of interaction. To date, no systematic review has been undertaken to determine the appropriateness of canine-assisted interventions in relation to these issues. The aim of the review was to synthesise the best available evidence on the appropriateness of canine-assisted interventions on the health and social care of the older population residing in long term care with regards to zoonotic infection or animal-related injury/allergy. A comprehensive search was undertaken on 32 electronic databases and two reputable websites from their inception to 2009. The search was restricted to English language and both published and unpublished studies and papers were considered. The review took an inclusive approach and considered quantitative and qualitative studies that focussed on zoonotic risk/exposure/infection or animal-related injury/allergy from canine-assisted interventions used in long term care settings. In the absence of research studies, text and opinion were also considered. Critical appraisal of papers was to be undertaken using the appropriate Joanna Briggs Institute critical appraisal instrument and data extraction was to be via the Joanna Briggs Institute data extraction forms, dependant on design. There were no studies located the met the inclusion requirements of this review. There were also no text and opinion pieces that were specific to long term care, older people and canines. There is currently no evidence available to determine the appropriateness of canine-assisted interventions used for older people in long term care in regards to zoonotic risk/exposure/infection or animal-related injuries/allergies. There is a small body of literature available that focuses on health care but it is generalised and does not delineate between different age groups, settings or the animals used. No conclusive recommendations can be made regarding the use of canine-assisted interventions in long term care in the context of zoonotic infection and animal-related injuries/allergies. Text and opinion suggests that if a health care facility of any kind is planning to implement or is currently running this type of intervention (using any animal for people of any age group) the following should be considered:Implications for Research: Quantitative and qualitative research studies are urgently required to determine whether there is an increased risk of zoonotic infections or animalrelated injuries/allergies for those people involved in canine-assisted interventions undertaken in long term care. Those at risk need to be identified in a systematic way.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 40; Issue 5. Comparative sequence analyses of genome and transcriptome reveal novel transcripts and variants in the Asian elephant Elephas maximus. Puli Chandramouli Reddy Ishani Sinha Ashwin Kelkar Farhat Habib Saurabh J Pradhan Raman Sukumar Sanjeev ...
African Journals Online (AJOL)
La cytoponction n'a été contributive dans aucun des trois cas. ... Material and methods: We reviewed 5 cases of thyroid pseudo nodules managed in Farhat ... cases. definitive histological exam had concluded to a hydatid cyst, a schwanoma, ...
Directory of Open Access Journals (Sweden)
Ahmadshah Farhat
2013-12-01
How to cite this article: Farhat A, Mohammadzadeh A, Balali-Mood M, Aghajanpoor-Pasha M, Ravanshad Y. Correlation of Blood Lead Level in Mothers and Exclusively Breastfed Infants: A Study on Infants Aged Less Than Six Months. Asia Pac J Med Toxicol 2013;2:150-2.
African Journals Online (AJOL)
abp
2013-01-27
Jan 27, 2013 ... Intensive Care Department, Sahloul Hospital, Sousse, Tunisia, 3Assistant professor of Dermatology, Farhat Hached University Hospital, Sousse,. Tunisia. &Corresponding ... corticosteroid and skin care. The outcome was favourable. The .... 8. Khalili B, Bahna SL. Pathogenesis and recent therapeutic trends.
Influence of micro-structural parameters and thermal cycling on the ...
Indian Academy of Sciences (India)
However, in view of the high cost of this material primarily because of the ... to lead to a reduction in strength of the resulting mixes. ..... Farhat F A, Nicolaides D, Kanellopoulos A D and Karihaloo B L 2007 CARDIFRC—Performance and.
Genetic diversity in barley landraces (Hordeum vulgare L. subsp.
Indian Academy of Sciences (India)
Genetic diversity in barley landraces (Hordeum vulgare L. subsp. vulgare) originated from Crescent Fertile region as detected by seed storage proteins. RIM MZID FARHAT CHIBANI RAYDA BEN AYED MOHSEN HANANA JOELLE BREIDI RABIH KABALAN SAMIH EL-HAJJ HASSAN MACHLAB AHMED REBAI LAMIS ...
Appel à propositions pour le concours de 2018 du Programme ...
International Development Research Centre (IDRC) Digital Library (Canada)
23 nov. 2017 ... Zipline uses drone technology to save lives. Sarah Farhat / Banque mondiale. Le CRDI, l'Israel Science Foundation, la Fondation Azrieli et les Instituts de recherche en santé du Canada annoncent l'appel de propositions pour la quatrième ronde du Programme conjoint canado-israélien de recherche en ...
Le traitement de la tuberculose ganglionnaire cervicale a propos de ...
African Journals Online (AJOL)
Patients and methods : A retrospective study concerning 361 patients hospitalized for cervical lymph node tuberculosis in the department of Otolaryngology-Head and Neck surgery of the hospial of farhat Hached of Sousse over a period of 30 years (from January 1982 to december 2011) Results : the mean age of our ...
L'esthesioneuroblastome olfactif : a propos de 7 | Kermani | Journal ...
African Journals Online (AJOL)
Material and methods: a retrospective study concerning seven cases of olfactory neuroblastoma treated in the department of otolaryngology- Head and Neck surgery at Farhat Hached Hospital Sousse over a period of 26 years. Results: The mean age of our patients was 36 years. A female predominance was noted. Clinical ...
Karyotype variation and conservation in morphotypes of non-heading Chinese cabbage
Zheng, Jin Shuang; Sun, Cheng Zhen; Xiao, Dong; Zhang, Shu Ning; Bonnema, Guusje; Hou, Xi Lin
2015-01-01
Non-heading Chinese cabbage encompasses a wide diversity of morphotypes, like the well-known Pak-choi, Wu ta cai, Cai xin, Tai cai, and Fen nei cai. Despite recent developments in re-sequencing which results in the detection of SNPs, insertions, deletions and copy number variants, there has been
Hiina kunstnikud kaebavad Veneetsia biennaali kohtusse / Maria-Kristiina Soomre
Soomre, Maria-Kristiina, 1978-
2000-01-01
1999. a. Veneetsia biennaalil auhinna võitnud hiina kunstniku Cai Guo Qiangi teos "Veneetsia maksukoguja hoov" on Hiinas tekitanud diskussiooni autoriõiguste teemal. Kaalutakse kohtuasja algatamist Cai Guo Qiangi, Harald Szeemanni ja Veneetsia biennaali vastu
Research on the Use of Computer-Assisted Instruction.
Craft, C. O.
1982-01-01
Reviews recent research studies related to computer assisted instruction (CAI). The studies concerned program effectiveness, teaching of psychomotor skills, tool availability, and factors affecting the adoption of CAI. (CT)
Sociologie D'une Revolte Armee: Le Cas de Libye
African Journals Online (AJOL)
part, appuyés par la police de l'ordre public, provoquant ainsi des morts parmi les .... Elle garantit aussi au prisonnier de guerre le droit à la dignité, au respect ... 5 Déclaration de l'ancien gouverneur du B.C.l, farhat Ben ghdara à la presse internationale et ..... Une société civile n'est elle pas, par définition, l'antipode, voire.
Le futur du travail | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
12 juin 2017 ... Trois hommes qui travaillent sur le projet de livraison de drone au Rwanda. Sarah Farhat / Banque mondiale. La numérisation, l'automatisation et les communications en réseau façonnent de plus en plus les sociétés, les marchés du travail et les occasions d'emploi à l'échelle mondiale. Les changements ...
伊藤, 寿勝; 島本, 肇; 黒島, 利一; 杉岡, 一郎
1989-01-01
Traditional computer-assisted instruction (CAI) has advantages and also has some of disadvantages that should be improved. To study intelligent CAI (ICAI) is regarded as trial to better CAI by using techniques in knowledge engineering. The system that was constructed in this research consists of three different modules ―a special knowledge module, a student model module and a guide rule module― to solve some problems of conventional CAI. For future researchers, the opportunity for engaging th...
Computer based training for nuclear operations personnel: From concept to reality
International Nuclear Information System (INIS)
Widen, W.C.; Klemm, R.W.
1986-01-01
Computer Based Training (CBT) can be subdivided into two categories: Computer Aided Instruction (CAI), or the actual presentation of learning material; and Computer Managed Instruction (CMI), the tracking, recording, and documenting of instruction and student progress. Both CAI and CMI can be attractive to the student and to the training department. A brief overview of CAI and CMI benefits is given in this paper
NCBI nr-aa BLAST: CBRC-PHAM-01-1277 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-1277 emb|CAI12641.1| caspase 7, apoptosis-related cysteine peptidase [...Homo sapiens] emb|CAI16007.1| caspase 7, apoptosis-related cysteine peptidase [Homo sapiens] CAI12641.1 2e-09 73% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-1632 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-1632 emb|CAI12641.1| caspase 7, apoptosis-related cysteine peptidase [...Homo sapiens] emb|CAI16007.1| caspase 7, apoptosis-related cysteine peptidase [Homo sapiens] CAI12641.1 3e-25 69% ...
NCBI nr-aa BLAST: CBRC-DDIS-03-0067 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-03-0067 emb|CAI21049.1| novel protein similar to vertebrate syntaxin 7 (S...TX7) [Danio rerio] emb|CAI29417.1| novel protein similar to vertebrate syntaxin 7 (STX7) [Danio rerio] CAI21049.1 1e-17 24% ...
KAPSE Interface Team (KIT) Public Report. Volume 8, Part 1
1989-10-01
visitors were introduced. Mike Tedd of the University of Wales represented the United Kingdom on the KIT for Sue Bond , who will be the primary...CAIS subprogram callable by APSE tools.I 2.1 Scope of the CAIS. The CAIS shall provide interfaces sufficient to support the use of APSEs for wide
McKeegan, K D; Leshin, L A; Russell, S S; MacPherson, G J
1998-04-17
The oxygen isotopic compositions of two calcium-aluminum-rich inclusions (CAIs) from the unequilibrated ordinary chondrite meteorites Quinyambie and Semarkona are enriched in 16O by an amount similar to that in CAIs from carbonaceous chondrites. This may indicate that most CAIs formed in a restricted region of the solar nebula and were then unevenly distributed throughout the various chondrite accretion regions. The Semarkona CAI is isotopically homogeneous and contains highly 16O-enriched melilite, supporting the hypothesis that all CAI minerals were originally 16O-rich, but that in most carbonaceous chondrite inclusions some minerals exchanged oxygen isotopes with an external reservoir following crystallization.
Complete Androgen Insensitivity Syndrome in Three Sisters
Directory of Open Access Journals (Sweden)
Levent Verim
2014-01-01
Full Text Available Disorders of sexual development (DSD are congenital anomalies due to atypical development of chromosomes, gonads and anatomy. Complete androgen insensitivity syndrome (CAIS, also known as testicular feminization (TF is a rare DSD disease. The majority of CAIS patients apply to hospital with the complaint of primary amenorrhea or infertility. Given that CAIS patients are all phenotypically female while having 46, XY karyotypes, CAIS diagnosis should be disclosed in an age-appropriate manner preferably by a mental health professional. Cases are reported here for three 46XY siblings consistent with CAIS.
Feedback and Feedforward Control During Walking in Individuals With Chronic Ankle Instability.
Yen, Sheng-Che; Corkery, Marie B; Donohoe, Amy; Grogan, Maddison; Wu, Yi-Ning
2016-09-01
Study Design Controlled laboratory study. Background Recurrent ankle sprains associated with chronic ankle instability (CAI) occur not only in challenging sports but also in daily walking. Understanding whether and how CAI alters feedback and feedforward controls during walking may be important for developing interventions for CAI prevention or treatment. Objective To understand whether CAI is associated with changes in feedback and feedforward control when individuals with CAI are subjected to experimental perturbation during walking. Methods Twelve subjects with CAI and 12 control subjects walked on a treadmill while adapting to external loading that generated inversion perturbation at the ankle joint. Ankle kinematics around heel contact during and after the adaptation were compared between the 2 groups. Results Both healthy and CAI groups showed an increase in eversion around heel contact in early adaptation to the external loading. However, the CAI group adapted back toward the baseline, while the healthy controls showed further increase in eversion in late adaptation. When the external loading was removed in the postadaptation period, healthy controls showed an aftereffect consisting of an increase in eversion around heel contact, but the CAI group showed no aftereffect. Conclusion The results provide preliminary evidence that CAI may alter individuals' feedback and feedforward control during walking. J Orthop Sports Phys Ther 2016;46(9):775-783. Epub 5 Aug 2016. doi:10.2519/jospt.2016.6403.
Plant growth-promoting activities of Streptomyces spp. in sorghum and rice.
Gopalakrishnan, Subramaniam; Srinivas, Vadlamudi; Sree Vidya, Meesala; Rathore, Abhishek
2013-01-01
Five strains of Streptomyces (CAI-24, CAI-121, CAI-127, KAI-32 and KAI-90) were earlier reported by us as biological control agents against Fusarium wilt of chickpea caused by Fusarium oxysporum f. sp. ciceri (FOC). In the present study, the Streptomyces were characterized for enzymatic activities, physiological traits and further evaluated in greenhouse and field for their plant growth promotion (PGP) of sorghum and rice. All the Streptomyces produced lipase, β-1-3-glucanase and chitinase (except CAI-121 and CAI-127), grew in NaCl concentrations of up to 6%, at pH values between 5 and 13 and temperatures between 20 and 40°C and were highly sensitive to Thiram, Benlate, Captan, Benomyl and Radonil at field application level. When the Streptomyces were evaluated in the greenhouse on sorghum all the isolates significantly enhanced all the agronomic traits over the control. In the field, on rice, the Streptomyces significantly enhanced stover yield (up to 25%; except CAI-24), grain yield (up to 10%), total dry matter (up to 18%; except CAI-24) and root length, volume and dry weight (up to 15%, 36% and 55%, respectively, except CAI-24) over the control. In the rhizosphere soil, the Streptomyces significantly enhanced microbial biomass carbon (except CAI-24), nitrogen, dehydrogenase (except CAI-24), total N, available P and organic carbon (up to 41%, 52%, 75%, 122%, 53% and 13%, respectively) over the control. This study demonstrates that the selected Streptomyces which were antagonistic to FOC also have PGP properties.
Pell, Jennifer; Russell, James K.; Zhang, Shunxin
2018-03-01
Kimberlite pipes from Chidliak, Baffin Island, Nunavut, Canada host surface-derived Paleozoic carbonate xenoliths containing conodonts. Conodonts are phosphatic marine microfossils that experience progressive, cumulative and irreversible colour changes upon heating that are experimentally calibrated as a conodont colour alteration index (CAI). CAI values permit us to estimate the temperatures to which conodont-bearing rocks have been heated. Conodonts have been recovered from 118 samples from 89 carbonate xenoliths collected from 12 of the pipes and CAI values within individual carbonate xenoliths show four types of CAI distributions: (1) CAI values that are uniform throughout the xenolith; (2) lower CAIs in core of a xenolith than the rim; (3) CAIs that increase from one side of the xenolith to the other; and, (4) in one xenolith, higher CAIs in the xenolith core than at the rim. We have used thermal models for post-emplacement conductive cooling of kimberlite pipes and synchronous heating of conodont-bearing xenoliths to establish the temperature-time history of individual xenoliths within the kimberlite bodies. Model results suggest that the time-spans for xenoliths to reach the peak temperatures recorded by CAIs varies from hours for the smallest xenoliths to 2 or 3 years for the largest xenoliths. The thermal modelling shows the first three CAI patterns to be consistent with in situ conductive heating of the xenoliths coupled to the cooling host kimberlite. The fourth pattern remains an anomaly.
EVIDENCE FOR MULTIPLE SOURCES OF 10Be IN THE EARLY SOLAR SYSTEM
International Nuclear Information System (INIS)
Wielandt, Daniel; Krot, Alexander N.; Bizzarro, Martin; Nagashima, Kazuhide; Huss, Gary R.; Ivanova, Marina A.
2012-01-01
Beryllium-10 is a short-lived radionuclide (t 1/2 = 1.4 Myr) uniquely synthesized by spallation reactions and inferred to have been present when the solar system's oldest solids (calcium-aluminum-rich inclusions, CAIs) formed. Yet, the astrophysical site of 10 Be nucleosynthesis is uncertain. We report Li-Be-B isotope measurements of CAIs from CV chondrites, including CAIs that formed with the canonical 26 Al/ 27 Al ratio of ∼5 × 10 –5 (canonical CAIs) and CAIs with Fractionation and Unidentified Nuclear isotope effects (FUN-CAIs) characterized by 26 Al/ 27 Al ratios much lower than the canonical value. Our measurements demonstrate the presence of four distinct fossil 10 Be/ 9 Be isochrons, lower in the FUN-CAIs than in the canonical CAIs, and variable within these classes. Given that FUN-CAI precursors escaped evaporation-recondensation prior to evaporative melting, we suggest that the 10 Be/ 9 Be ratio recorded by FUN-CAIs represents a baseline level present in presolar material inherited from the protosolar molecular cloud, generated via enhanced trapping of galactic cosmic rays. The higher and possibly variable apparent 10 Be/ 9 Be ratios of canonical CAIs reflect additional spallogenesis, either in the gaseous CAI-forming reservoir, or in the inclusions themselves: this indicates at least two nucleosynthetic sources of 10 Be in the early solar system. The most promising locale for 10 Be synthesis is close to the proto-Sun during its early mass-accreting stages, as these are thought to coincide with periods of intense particle irradiation occurring on timescales significantly shorter than the formation interval of canonical CAIs.
Propagation properties of the chirped Airy beams through the gradient-index medium
Feng, Liyan; Zhang, Jianbin; Pang, Zihao; Wang, Linyi; Zhong, Tianfen; Yang, Xiangbo; Deng, Dongmei
2017-11-01
Through analytical derivation and numerical analysis, the propagation properties of the chirped Airy(CAi) beams in the gradient-index medium are investigated. The intensity and the phase distributions, the propagation trajectory and the Poynting vector of the CAi beams are demonstrated to investigate the propagation properties. Owing to the special and symmetrical refractive index profile of the gradient-index medium, the CAi beams propagate periodically. The effects of the distribution factor and the chirped parameter on the propagation of the CAi beams are analyzed. As the increasing of the distribution factor, the intensity distribution of the CAi beams is more scattering. However, with the chirped parameter increasing, the focusing property of the CAi beams strengthens. The variation of the chirped parameter can change the position of the peak intensity maximum, but it cannot alter the period of the peak intensity. The variations of the initial phase and the energy of the beams in the transverse plane expedite accordingly.
Schuck, Sabrina E B; Emmerson, Natasha A; Fine, Aubrey H; Lakes, Kimberley D
2015-02-01
The objective of this study was to provide preliminary findings from an ongoing randomized clinical trial using a canine-assisted intervention (CAI) for 24 children with ADHD. Project Positive Assertive Cooperative Kids (P.A.C.K.) was designed to study a 12-week cognitive-behavioral intervention delivered with or without CAI. Children were randomly assigned to group therapy with or without CAI. Parents of children in both groups simultaneously participated in weekly parent group therapy sessions. Across both treatment groups, parents reported improvements in children's social skills, prosocial behaviors, and problematic behaviors. In both groups, the severity of ADHD symptoms declined during the course of treatment; however, children who received the CAI model exhibited greater reductions in the severity of ADHD symptoms than did children who received cognitive-behavioral therapy without CAI. Results suggest that CAI offers a novel therapeutic strategy that may enhance cognitive-behavioral interventions for children with ADHD. © 2013 SAGE Publications.
Potvin Kent, Monique; Dubois, Lise; Wanless, Alissa
2011-10-01
To examine the efficacy of self-regulation of food marketing to children by comparing, during children's preferred viewing on television, the differences in food/beverage marketing between two groups of corporations: 17 corporations participating in the Canadian Children's Food and Beverage Advertising Initiative (CAI) and 35 corporations not participating (non-CAI) in this initiative. The food/beverage marketing activities of CAI and non-CAI corporations during 99.5 hours of children's preferred viewing on television were compared. First, the preferred television viewing of 272 children aged 10-12 years from Ontario and Quebec who completed TV viewing journals for a seven-day period was determined. A total of 32 television stations were simultaneously recorded, and a content analysis of children's preferred viewing was conducted and included coding all food/beverage promotions and their nutritional content. Each food/beverage promotion was classified by corporation type (i.e., CAI or non-CAI). The CAI was responsible for significantly more food/beverage promotions, and used media characters and repetition more frequently in their food/beverage promotions than the non-CAI group. Nutritionally, the CAI food/beverage promotions were higher in fats, sugar, sodium and energy per 100 grams. A significantly greater proportion of the CAI food/beverage promotions were considered 'less healthy' compared to the non-CAI promotions. With the exception of the four corporations that did not market to children at all, the commitments that have been made in the CAI are not having a significant impact on the food and beverage marketing environment on television which is viewed by 10-12-year-olds.
Publications | Page 232 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
O cerco flutuante e os caiçaras do litoral norte de São Paulo, com ênfase à pesca de trindade, RJ (open access). O cerco flutuante, armadilha fixa de pesca, é utilizado por caiçaras do litoral sudeste do Brasil na pesca artesanal. Essa técnica faz parte de um conjunto de influências históricas que formou a cultura caiçara e ...
Digital Repository Service at National Institute of Oceanography (India)
Rudraswami, N.G.; ShyamPrasad, M.; Nagashima, K.; Jones, R.H.
aluminium rich inclusions (CAIs), amoeboid olivine aggregates (AOAs), and some porphyritic chondrules from carbonaceous chondrites. These grains appear to have recorded the initial oxygen isotopic composition of the inner solar nebula. Three olivine... to the major components of meteorites such as chondrules and calcium-aluminium-rich inclusions (CAIs). CAIs, the first solar system objects in the solar nebula, are formed by condensation of refractory minerals at high temperatures. They are 16O...
2018-04-27
was partially supported by EOARD Grant 15IOE011. 1 L. Ju, B. Geng, J. Horng, C. Girit, M. Martin , Z. Hao, H. A. Bechtel, X. Liang, A. Zettl, Y. R... Martin -Moreno, and A. Yu. Nikitin, J. Opt. 15, 114008 (2013). 7 R. Alaee, M. Farhat, C. Rockstuhl, and F. Lederer, Opt. Express 20, 28017 (2012). 8 Y...Chaves, J. D. Caldwell, A. Kumar, N. X. Fang, P. Avouris, T. F. Heinz, F. Guinea, L. Martin -Moreno, and F. Koppens, Nature Materials 16, 182 (2017
International Nuclear Information System (INIS)
Cinabro, David
2016-01-01
The major goals of our work on Belle II were to complete our contributions, a 64-channel PIN diode-based radiation monitor, to the precursor detector called Beast II and the electronics for the endcap K-Long/Muon (E-KLM) detector. This was done by Professor Cinabro, Technician Gutierrez, and undergraduate labor supported by US-Japan funds. Professor Bonvicini through US-Japan funds led the development and installation of a beamstrahlung monitor system in the Belle II interaction region. Graduate students Farhat and DiCarlo worked on this. We also worked on charm physics analysis.
EDITORIAL: Focus on Cloaking and Transformation Optics
Leonhardt, Ulf; Smith, David R.
2008-11-01
multi-frequency cloaking Andrea Alù and Nader Engheta Electromagnetic cloaking devices for TE and TM polarizations Filiberto Bilotti, Simone Tricarico and Lucio Vegni An aberration-free lens with zero F-number D Schurig Transformational optics of plasmonic metamaterials I I Smolyaninov An acoustic metafluid: realizing a broadband acoustic cloak J B Pendry and Jensen Li On the possibility of metamaterial properties in spin plasmas G Brodin and M Marklund A homogenization route towards square cylindrical acoustic cloaks Mohamed Farhat, Sébastien Guenneau, Stefan Enoch, Alexander Movchan, Frédéric Zolla and André Nicolet Transformation optics: approaching broadband electromagnetic cloaking A V Kildishev, W Cai, U K Chettiar and V M Shalaev Generalized field-transforming metamaterials Sergei A Tretyakov, Igor S Nefedov and Pekka Alitalo Electromagnetic beam modulation through transformation optical structures Xiaofei Xu, Yijun Feng and Tian Jiang Superantenna made of transformation media Ulf Leonhardt and Tomáš Tyc Material parameters and vector scaling in transformation acoustics Steven A Cummer, Marco Rahm and David Schurig Isotropic transformation optics: approximate acoustic and quantum cloaking Allan Greenleaf, Yaroslav Kurylev, Matti Lassas and Gunther Uhlmann Transformation optical designs for wave collimators, flat lenses and right-angle bends Do-Hoon Kwon and Douglas H Werner Alternative derivation of electromagnetic cloaks and concentrators A D Yaghjian and S Maci Solutions in folded geometries, and associated cloaking due to anomalous resonance Graeme W Milton, Nicolae-Alexandru P Nicorovici, Ross C McPhedran, Kirill Cherednichenko and Zubin Jacob Finite wavelength cloaking by plasmonic resonance N-A P Nicorovici, R C McPhedran, S Enoch and G Tayeb
Chu, Jen-Hao; Huang, Jiun-Hau
2017-11-28
In recent years, men who have sex with men (MSM) have accounted for over 80% of all new HIV cases in Taiwan. More than 70% of new cases have occurred in those aged 15-34 years. Condomless anal intercourse (CAI) has been identified as the main route of HIV transmission among MSM. To systematically examine CAI intention and associated factors among young MSM in Taiwan, an anonymous online survey based on the Theory of Planned Behavior (TPB) was conducted. Data from 694 MSM aged 15-39 years were included in the analysis. This study found that, overall, all five TPB factors (i.e., attitudes toward positive and negative outcomes regarding CAI, perceived support for CAI from important others, and perceived behavioral control of CAI under facilitating and constraining conditions) were significantly associated with CAI intention. When data were stratified by sexual role (i.e., receptive, versatile, and insertive), the associations between TPB factors and CAI intention varied. Of the five TPB factors, positive attitudes toward positive outcomes regarding CAI were most strongly associated with high CAI intention (AOR 5.68 for all young MSM; AOR 3.80-15.93, depending on sexual role). Findings from this study could inform the development of theory-driven HIV prevention programs as well as future research and practice. These results also highlight the importance of tailoring HIV prevention initiatives for young MSM of different sexual roles to optimize the program effectiveness.
Directory of Open Access Journals (Sweden)
Janas Janas
2012-09-01
Full Text Available A one year prospective study was conducted at the Infectious Diseases Hospital (IDH of Jakarta in 1982-1983 to survey the rate of community acquired infection (CAI. Blood culture, rectal swab, urine culture and in some patients cerebro spinal fluid culture were obtained randomly from hospitalized patient at the time of admission. From 723 patients with age 2 months-70 years, who were examined and fulfilled the study criteria, 504 (69,7% patients were positive for CAI resulted in total of 611 CAIs. Based on anatomical location, this number consists of 53.5% CAI of GI Tract, 20.9% CAI of Urinary Tract, 9.5% CAI bacteremia and 0.6% CAI involving central nervous system. Incidence rate was significantly higher in female (74.1% compared to male (65.7% (p<0.02. It was also higher in >12 years patients (73.9% compared to children <12 years (p<0,01. Diarrhea patients had significantly higher CAI (77.4% compared to febrile patients (55.2% (p<0,01. Patients who had not received antibiotic prior to admission had higher rate of CAI (70.9% compared to who received it prior to admission (67.1% Etiologic agents most commonly recovered were gram negative bacterias (94.9% with Vibrio cholerae (48.6% as the leading cause, and only 5.1% were gram positive. Some of bacteria found as the etiologic agent of CAI, were Salmonella group D, Salmonella group E4, Proteus vulgaris and ruttgerii, Klebsiella pneumoniae, Mima polymorpha, Alkaligenes sp showed high rate of resistancy to commonly used antibiotics. (Ampicillin, Tetracycline, Chloramphenicol and Trimethoprim + Sulfamethoxazole. Average duration of hospitalization for CAI cases (6,4 days was longer than in cases without CAI (4,3 days. There were 11 deaths (2.2% in cases with CAI and 2 deaths (1.4% in patients without CAI, with death rate was higher in males (2.4% compared to female (1.9%, and highest was in less than 1 year old age group patient (13.6%, also significantly higher in febrile patients compared to
Shollenberger, Quinn R.; Borg, Lars E.; Render, Jan; Ebert, Samuel; Bischoff, Addi; Russell, Sara S.; Brennecka, Gregory A.
2018-05-01
Calcium-aluminum-rich inclusions (CAIs) are the oldest dated materials in the Solar System and numerous previous studies have revealed nucleosynthetic anomalies relative to terrestrial rock standards in many isotopic systems. However, most of the isotopic data from CAIs has been limited to the Allende meteorite and a handful of other CV3 chondrites. To better constrain the isotopic composition of the CAI-forming region, we report the first Sr, Mo, Ba, Nd, and Sm isotopic compositions of two CAIs hosted in the CK3 desert meteorites NWA 4964 and NWA 6254 along with two CAIs from the CV3 desert meteorites NWA 6619 and NWA 6991. After consideration of neutron capture processes and the effects of hot-desert weathering, the Sr, Mo, Ba, Nd, and Sm stable isotopic compositions of the samples show clearly resolvable nucleosynthetic anomalies that are in agreement with previous results from Allende and other CV meteorites. The extent of neutron capture, as manifested by shifts in the observed 149Sm-150Sm isotopic composition of the CAIs is used to estimate the neutron fluence experienced by some of these samples and ranges from 8.40 × 1013 to 2.11 × 1015 n/cm2. Overall, regardless of CAI type or host meteorite, CAIs from CV and CK chondrites have similar nucleosynthetic anomalies within analytical uncertainty. We suggest the region that CV and CK CAIs formed was largely uniform with respect to Sr, Mo, Ba, Nd, and Sm isotopes when CAIs condensed and that CAIs hosted in CV and CK meteorites are derived from the same isotopic reservoir.
Calcium and titanium isotopes in refractory inclusions from CM, CO, and CR chondrites
Kööp, Levke; Davis, Andrew M.; Krot, Alexander N.; Nagashima, Kazuhide; Simon, Steven B.
2018-05-01
Previous studies have shown that CV and CM chondrites incorporated Ca, Al-rich inclusions (CAIs) with different isotopic characteristics, which may represent different snapshots in the isotopic evolution of the early Solar System. To better understand how the isotopic characteristics of CAIs vary between different chondrite groups, we have studied calcium and titanium isotopes in CAIs from CM, CO, and CR chondrites. We show that all three chondrite groups contain CAIs with large anomalies in 48Ca and/or 50Ti (10s of ‰ or 100s of ε-units) as well as CAIs with no anomalies resolved beyond measurement uncertainties. Isotopically, the anomalous CO and CR chondrite CAIs resemble the platy hibonite crystals (PLACs) from CM chondrites, but they are more mineralogically complex. The new data are consistent with the well-established mutual exclusivity relationship between incorporation of 26Al and the presence of large anomalies in 48Ca and 50Ti. The two highly anomalous CO chondrite CAIs have correlated anomalies in 46Ti and 50Ti, while most other highly anomalous CAIs do not. This result could indicate that the reservoir with coupled 46Ti and 50Ti that was sampled by bulk meteorites and CV chondrite CAIs already existed before arrival and/or homogeneous distribution of 26Al in the protoplanetary disk. Among the studied CM chondrite CAIs are ten spinel-hibonite inclusions (SHIBs) with known oxygen isotopic compositions. Our results show that these objects sampled a reservoir that was well-mixed in oxygen, calcium, and titanium isotopes. We further show that SHIBs tend to be slightly enriched in the heavy calcium isotopes, suggesting that their formation history was different from CV chondrite CAIs.
A Method for Evaluating Competency in Assessment and Management of Suicide Risk
Hung, Erick K.; Binder, Renee L.; Fordwood, Samantha R.; Hall, Stephen E.; Cramer, Robert J.; McNiel, Dale E.
2012-01-01
Objective: Although health professionals increasingly are expected to be able to assess and manage patients' risk for suicide, few methods are available to evaluate this competency. This report describes development of a competency-assessment instrument for suicide risk-assessment (CAI-S), and evaluates its use in an objective structured clinical…
Mwei, Philip K.; Wando, Dave; Too, Jackson K.
2012-01-01
This paper reports the results of research conducted in six classes (Form IV) with 205 students with a sample of 94 respondents. Data represent students' statements that describe (a) the role of Mathematics teachers in a computer-assisted instruction (CAI) environment and (b) effectiveness of CAI in Mathematics instruction. The results indicated…
Stultz, Sherry L.
2017-01-01
This review was conducted to evaluate the current body of scholarly research regarding the use of computer-assisted instruction (CAI) to teach mathematics to students with specific learning disability (SLD). For many years, computers are utilized for educational purposes. However, the effectiveness of CAI for teaching mathematics to this specific…
Computer-Assisted Instruction in the N.W.T.
Garraway, Tom
For the past seven years, the Division of Educational Research Services at the University of Alberta has been operating an IBM 1500 CAI system. This paper describes demonstration projects set up in anticipation of the establishment of remote CAI in the North West Territories. These include a moon landing simulation program; a diagnostic program in…
Intracellular calcium modulation of voltage-gated sodium channels in ventricular myocytes
Casini, Simona; Verkerk, Arie O.; van Borren, Marcel M. G. J.; van Ginneken, Antoni C. G.; Veldkamp, Marieke W.; de Bakker, Jacques M. T.; Tan, Hanno L.
2009-01-01
AIMS: Cardiac voltage-gated sodium channels control action potential (AP) upstroke and cell excitability. Intracellular calcium (Ca(i)(2+)) regulates AP properties by modulating various ion channels. Whether Ca(i)(2+) modulates sodium channels in ventricular myocytes, is unresolved. We studied
The absolute chronology and thermal processing of solids in the solar protoplanetary disk
DEFF Research Database (Denmark)
Connelly, James; Bizzarro, Martin; Krot, Alexander N.
2012-01-01
Transient heating events that formed calcium-aluminum - rich inclusions (CAIs) and chondrules are fundamental processes in the evolution of the solar protoplanetary disk, but their chronology is not understood. Using U-corrected Pb-Pb dating, we determined absolute ages of individual CAIs and cho...
A companion agent for automated training systems
Buiël, E.F.T.; Lubbers, J.
2007-01-01
TNO Defence, Security & Safety has a long history of applied research in the area of automated simulator-based training by means of Computer-Assisted Instruction (CAI). Traditionally, a CAI system does not enable a true dialogue between the learner and the virtual instructor. Most frequently, the
Di Fiore, Anna; Vergara, Alessandro; Caterino, Marco; Alterio, Vincenzo; Monti, Simona M; Ombouma, Joanna; Dumy, Pascal; Vullo, Daniela; Supuran, Claudiu T; Winum, Jean-Yves; De Simone, Giuseppina
2015-07-21
Hydroxylamine-O-sulfonamide, a molecule incorporating two zinc-binding groups (ZBGs), has been investigated as a carbonic anhydrase inhibitor (CAI) by means of kinetic, crystallographic and Raman spectroscopy studies, highlighting interesting results on its mechanism of action. These data can be exploited to design new, effective and selective CAIs.
Ionized calcium measurements are influenced by albumin - should ionized calcium be corrected?
DEFF Research Database (Denmark)
Larsen, Trine R; Galthen-Sørensen, Mathias; Antonsen, Steen
2014-01-01
Abstract Measurement of ionized calcium (CaI) has been reported to be dependent on albumin concentration. We examined the correlation between albumin and CaI measured on different ion selective electrode analyzers and in different groups of patients in a large dataset, extracted from the laboratory...
Lilley, Thomas; Herb, Christopher C; Hart, Joseph; Hertel, Jay
2018-06-01
Chronic ankle instability (CAI) is a condition resulting from a lateral ankle sprain. Shank-rearfoot joint-coupling variability differences have been found in CAI patients; however, joint-coupling variability (VCV) of the ankle and proximal joints has not been explored. Our purpose was to analyse VCV in adults with and without CAI during gait. Four joint-coupling pairs were analysed: knee sagittal-ankle sagittal, knee sagittal-ankle frontal, hip frontal-ankle sagittal and hip frontal-ankle frontal. Twenty-seven adults participated (CAI:n = 13, Control:n = 14). Lower extremity kinematics were collected during walking (4.83 km/h) and jogging (9.66 km/h). Vector-coding was used to assess the stride-to-stride variability of four coupling pairs. During walking, CAI patients exhibited higher VCV than healthy controls for knee sagittal-ankle frontal in latter parts of stance thru mid-swing. When jogging, CAI patients demonstrated lower VCV with specific differences occurring across various intervals of gait. The increased knee sagittal-ankle frontal VCV in CAI patients during walking may indicate an adaptation to deal with the previously identified decrease in variability in transverse plane shank and frontal plane rearfoot coupling during walking; while the decreased ankle-knee and ankle-hip VCV identified in CAI patients during jogging may represent a more rigid, less adaptable sensorimotor system ambulating at a faster speed.
Baker, Justine C.
1978-01-01
Historic perspective of computer manufacturers and their contribution to CAI. Corporate CAI products and services are mentioned, as is a forecast for educational involvement by computer corporations. A chart of major computer corporations shows gross sales, net earnings, products and services offered, and other corporate information. (RAO)
Stotter, Philip L.; Culp, George H.
An experimental course in organic chemistry utilized computer-assisted instructional (CAI) techniques. The CAI lessons provided tutorial drill and practice and simulated experiments and reactions. The Conversational Language for Instruction and Computing was used, along with a CDC 6400-6600 system; students scheduled and completed the lessons at…
Computer-Assisted Instruction: A Case Study of Two Charter Schools
Keengwe, Jared; Hussein, Farhan
2013-01-01
The purpose of this study was to examine the relationship in achievement gap between English language learners (ELLs) utilizing computer-assisted instruction (CAI) in the classroom, and ELLs relying solely on traditional classroom instruction. The study findings showed that students using CAI to supplement traditional lectures performed better…
A Comparison of Computer-Assisted Instruction and Tutorials in Hematology and Oncology.
Garrett, T. J.; And Others
1987-01-01
A study comparing the effectiveness of computer-assisted instruction (CAI) and small group instruction found no significant difference in medical student achievement in oncology but higher achievement through small-group instruction in hematology. Students did not view CAI as more effective, but saw it as a supplement to traditional methods. (MSE)
Keeping the Focus on Underserved Students, Privilege, and Power: A Reaction to Clements and Sarama
Kitchen, Richard; Berk, Sarabeth
2017-01-01
In our response to Clements and Sarama (2017), we address the 5 issues that they identify as criticisms of our Research Commentary (Kitchen & Berk, 2016). As in our original commentary, we highlight concerns we have regarding the delivery of [computer-assisted instruction] CAI programs and potential misuses of CAI, particularly at Title I…
An Evaluation of Computer-Aided Instruction in an Introductory Biostatistics Course.
Forsythe, Alan B.; Freed, James R.
1979-01-01
Evaluates the effectiveness of computer assisted instruction for teaching biostatistics to first year students at the UCLA School of Dentistry. Results do not demonstrate the superiority of CAI but do suggest that CAI compares favorably to conventional lecture and programed instruction methods. (RAO)
Directory of Open Access Journals (Sweden)
McKay SiripoomV
2010-03-01
Full Text Available Background. Late transient neonatal hypocalcemia with hyperphosphatemia is potentially life-threatening. The use of dihydroxycholecalciferol in the management of neonatal hypocalcemia is unexplored. Objective. We hypothesized adding dihydroxycholecalciferol to intravenous continuous calcium infusion (CaI will achieve accelerated correction of hypocalcemia. Design/Methods. A controlled double-blind randomized placebo group was organized to compare the addition of dihydroxycholecalciferol to CaI in 3–14 day old neonates presenting with hypocalcemia, hyperphosphatemia and seizures. Ionized calcium and phosphorus were measured to adjust CaI and maintain eucalcemia. Time to resolution of hypocalcemia was defined as time from starting CaI to the first ionized calcium of mmol/L. CaI was discontinued when ionized calcium levels were mmol/L on two measurements and the infant tolerated feeds. Results. Fourteen neonates were studied without statistical difference between groups. Time to correction of hypocalcemia for 1,25 dihydroxycholecalciferol versus placebo was versus hours respectively (. The duration of CaI was versus hours respectively (. Conclusions. The addition of dihydroxycholecalciferol to standard CaI therapy reduced the duration of CaI, but did not reduce the time to correct hypocalcemia in neonates with late transient hypocalcemia.
Dede, Christopher J.; And Others
The first of five sections in this report places intelligent computer-assisted instruction (ICAI) in its historical context through discussions of traditional computer-assisted instruction (CAI) linear and branching programs; TICCIT and PLATO IV, two CAI demonstration projects funded by the National Science Foundation; generative programs, the…
Brower, Mary Jo
A study was conducted to determine the advantages and disadvantages of using computer-assisted instruction (CAI) with learning disabled (LD) adults attending California community colleges. A questionnaire survey of the directors of the LD programs solicited information on the availability of CAI for LD adults, methods of course advertisement,…
Computer-Assisted Instruction to Teach DOS Commands: A Pilot Study.
McWeeney, Mark G.
1992-01-01
Describes a computer-assisted instruction (CAI) program used to teach DOS commands. Pretest and posttest results for 65 graduate students using the program are reported, and it is concluded that the CAI program significantly aided the students. Sample screen displays for the program and several questions from the pre/posttest are included. (nine…
Adaptive Machine Aids to Learning.
Starkweather, John A.
With emphasis on man-machine relationships and on machine evolution, computer-assisted instruction (CAI) is examined in this paper. The discussion includes the background of machine assistance to learning, the current status of CAI, directions of development, the development of criteria for successful instruction, meeting the needs of users,…
Computer-Assisted Instruction: Authoring Languages. ERIC Digest.
Reeves, Thomas C.
One of the most perplexing tasks in producing computer-assisted instruction (CAI) is the authoring process. Authoring is generally defined as the process of turning the flowcharts, control algorithms, format sheets, and other documentation of a CAI program's design into computer code that will operationalize the simulation on the delivery system.…
DEFF Research Database (Denmark)
Holst, Jesper Christian; Olsen, Mia Bjørg Stolberg; Paton, Chad
2013-01-01
provide a unique window into the earliest Solar System, including the origin of short-lived radioisotopes. However, their chronology is unknown. Using the 182Hf–182W chronometer, we show that a FUN CAI recording a condensation origin from a solar gas formed coevally with canonical CAIs, but with 26Al/27Al......Refractory inclusions [calcium–aluminum-rich inclusions, (CAIs)] represent the oldest Solar System solids and provide information regarding the formation of the Sun and its protoplanetary disk. CAIs contain evidence of now extinct short-lived radioisotopes (e.g., 26Al, 41Ca, and 182Hf) synthesized...... in one or multiple stars and added to the protosolar molecular cloud before or during its collapse. Understanding how and when short-lived radioisotopes were added to the Solar System is necessary to assess their validity as chronometers and constrain the birthplace of the Sun. Whereas most CAIs formed...
Ready, set,...quit exclamation point A review of the controlled-air incinerator
International Nuclear Information System (INIS)
Reader, G.E.
1996-01-01
The Los Alamos National Laboratory (LANL) Controlled-Air Incinerator (CAI) has had a long and productive past as a research and development tool. It now appears that use of the CAI to treat LANL legacy and other wastes under the Federal Facilities Compliance Act is no longer viable due to numerous programmatic problems. This paper will review the history of the CAI. Various aspects associated with the CAI and how those aspects resulted in the loss of this Department of Energy asset as a viable waste treatment option will also be discussed. Included are past missions and tests-CAI capabilities, emissions, and permits; Federal Facility Compliance Act and associated Agreement; National Environmental Policy Act coverage; cost; budget impacts; public perception; the U.S. Environmental Protection Agency Combustion Strategy; Independent Technical Review open-quotes Redclose quotes Team review; waste treatment alternative technologies; the New Mexico Environment Department; and future options and issues
Junqueira, Beatriz L P; Connolly, Bairbre; Abla, Oussama; Tomlinson, George; Amaral, Joao G
2010-09-15
The objective of this study was to determine whether severe neutropenia on the day of port-a-catheter (PORT) insertion was a risk factor for catheter-associated infection (CAI) in children with acute lymphoblastic leukemia (ALL). This was a retrospective study of children with ALL who had a PORT insertion between January 2005 and August 2008. Early (≤ 30 days) and late (>30 days) postprocedure complications were reviewed. The length of follow-up ranged between 7 months and 42 months. In total, 192 PORTs were inserted in 179 children. There were 43 CAIs (22%), and the infection rate was 0.35 per 1000 catheter-days. The CAI rate (15%) in children who had severe neutropenia on the day of the procedure did not differ statistically from the CAI rate (24%) in children who did not have severe neutropenia (P = .137). Conversely, patients with severe neutropenia who had a CAI were more likely to have their PORT removed (P = .019). The most common organisms to cause catheter removal were coagulase-negative Staphylococcus and Staphylococcus aureus. Patients with high-risk ALL had a statistically significant higher incidence of late CAI than patients with standard-risk ALL (P = .012). Age (P = .272), positive blood culture preprocedure (P = 1.0), and dexamethasone use (P = .201) were not risk factors for CAI. Patients who had an early CAI did not have a greater chance of having a late CAI. The catheter infection-free survival rate at 1 year was 88.6%. The current results indicated that severe neutropenia on the day of PORT insertion does not increase the risk of CAI in children with ALL. © 2010 American Cancer Society.
Coded aperture imaging of alpha source spatial distribution
International Nuclear Information System (INIS)
Talebitaher, Alireza; Shutler, Paul M.E.; Springham, Stuart V.; Rawat, Rajdeep S.; Lee, Paul
2012-01-01
The Coded Aperture Imaging (CAI) technique has been applied with CR-39 nuclear track detectors to image alpha particle source spatial distributions. The experimental setup comprised: a 226 Ra source of alpha particles, a laser-machined CAI mask, and CR-39 detectors, arranged inside a vacuum enclosure. Three different alpha particle source shapes were synthesized by using a linear translator to move the 226 Ra source within the vacuum enclosure. The coded mask pattern used is based on a Singer Cyclic Difference Set, with 400 pixels and 57 open square holes (representing ρ = 1/7 = 14.3% open fraction). After etching of the CR-39 detectors, the area, circularity, mean optical density and positions of all candidate tracks were measured by an automated scanning system. Appropriate criteria were used to select alpha particle tracks, and a decoding algorithm applied to the (x, y) data produced the de-coded image of the source. Signal to Noise Ratio (SNR) values obtained for alpha particle CAI images were found to be substantially better than those for corresponding pinhole images, although the CAI-SNR values were below the predictions of theoretical formulae. Monte Carlo simulations of CAI and pinhole imaging were performed in order to validate the theoretical SNR formulae and also our CAI decoding algorithm. There was found to be good agreement between the theoretical formulae and SNR values obtained from simulations. Possible reasons for the lower SNR obtained for the experimental CAI study are discussed.
The cardiac anesthetic index of isoflurane in green iguanas.
Mosley, Craig A E; Dyson, Doris; Smith, Dale A
2003-06-01
To determine the cardiac anesthetic index (CAI) of isoflurane in green iguanas and whether butorphanol affected the CAI. Prospective randomized controlled trial. 7 healthy mature iguanas. In 5 iguanas, CAI was determined after induction of anesthesia with isoflurane alone, and in 5 iguanas, CAI was determined after induction of anesthesia with isoflurane and IM administration of butorphanol (1 mg/kg [0.45 mg/lb]). Three iguanas underwent both treatments. Animals were equilibrated for 20 minutes at 1.5 times the minimum alveolar concentration (MAC) of isoflurane and observed for evidence of cardiovascular arrest. If there was no evidence of cardiovascular arrest, end-tidal isoflurane concentration was increased by 20%, and animals were allowed to equilibrate for another 20 minutes. This process was repeated until cardiovascular arrest occurred or vaporizer output could no longer be consistently increased. The CAI was calculated by dividing the highest end-tidal isoflurane concentration by the MAC. None of the iguanas developed cardiovascular arrest and all survived. Mean +/- SD highest end-tidal isoflurane concentration during anesthesia with isoflurane alone (9.2 +/- 0.60%) was not significantly different from mean concentration during anesthesia with isoflurane and butorphanol (9.0 +/- 0.43%). The CAI was > 4.32. Results suggest that the CAI of isoflurane in green iguanas is > 4.32 and not affected by administration of butorphanol. Isoflurane appears to be a safe anesthetic in green iguanas.
Gabriner, Michael L; Braun, Brittany A; Houston, Megan N; Hoch, Matthew C
2015-02-01
Chronic ankle instability (CAI) is a condition commonly experienced by physically active individuals. It has been suggested that foot orthotics may increase a CAI patient's postural control. For patients with CAI, is there evidence to suggest that an orthotic intervention will help improve postural control? The literature was searched for studies of level 2 evidence or higher that investigated the effects of foot orthotics on postural control in patients with CAI. The search of the literature produced 5 possible studies for inclusion; 2 studies met the inclusion criteria and were included. One randomized controlled trial and 1 outcomes study were included. Foot orthotics appear to be effective at improving postural control in patients with CAI. There is moderate evidence to support the use of foot orthotics in the treatment of CAI to help improve postural control. There is grade B evidence that foot orthotics help improve postural control in people with CAI. The Centre of Evidence Based Medicine recommends a grade of B for level 2 evidence with consistent findings.
Bastida, F.; Brime, C.; García-López, S.; Sarmiento, G. N.
The palaeotemperature distribution in the transition from diagenesis to metamorphism in the western nappes of the Cantabrian Zone (Somiedo, La Sobia and Aramo Units) are analysed by conodont colour alteration index (CAI) and illite crystallinity (IC). Structural and stratigraphic control in distribution of CAI and IC values is observed. Both CAI and IC value distributions show that anchizonal conditions are reached in the lower part of the Somiedo Unit. A disruption of the thermal trend by basal thrusts is evidenced by CAI and IC values. There is an apparent discrepancy between the IC and CAI values in Carboniferous rocks of the Aramo Unit; the IC has mainly anchizonal values, whereas the CAI has diagenetic values. Discrepant IC values are explained as a feature inherited from the source area. In the Carboniferous rocks of the La Sobia Unit, both IC and CAI indicate diagenetic conditions. The anchimetamorphism predated completion of emplacement of the major nappes; it probably developed previously and/or during the early stages of motion of the units. Temperature probably decreased when the metamorphosed zones of the sheets rose along ramps and were intensely eroded. In the context of the Iberian Variscan belt, influence of tectonic factors on the metamorphism is greater in the internal parts, where the strain and cleavage are always present, than in the external parts (Cantabrian Zone), where brittle deformation and rock translation are dominant, with an increasing role of the burial on the metamorphism.
International Nuclear Information System (INIS)
Kim, Seonguk; Min, Kyoungdoug
2008-01-01
The CAI (controlled auto ignition) engine ignites fuel and air mixture by trapping high temperature burnt gas using a negative valve overlap. Due to auto ignition in CAI combustion, efficiency improvements and low level NO x emission can be obtained. Meanwhile, the CAI combustion regime is restricted and control parameters are limited. The start of combustion data in the compressed ignition engine are most critical for controlling the overall combustion. In this research, the engine block vibration signal is transformed by the Meyer wavelet to analyze CAI combustion more easily and accurately. Signal acquisition of the engine block vibration is a more suitable method for practical use than measurement of in-cylinder pressure. A new method for detecting combustion start in CAI engines through wavelet transformation of the engine block vibration signal was developed and results indicate that it is accurate enough to analyze the start of combustion. Experimental results show that wavelet transformation of engine block vibration can track the start of combustion in each cycle. From this newly developed method, the start of combustion data in CAI engines can be detected more easily and used as input data for controlling CAI combustion
Diameter dependent electron transfer kinetics in semiconductor-enzyme complexes.
Brown, Katherine A; Song, Qing; Mulder, David W; King, Paul W
2014-10-28
Excited state electron transfer (ET) is a fundamental step for the catalytic conversion of solar energy into chemical energy. To understand the properties controlling ET between photoexcited nanoparticles and catalysts, the ET kinetics were measured for solution-phase complexes of CdTe quantum dots and Clostridium acetobutylicum [FeFe]-hydrogenase I (CaI) using time-resolved photoluminescence spectroscopy. Over a 2.0-3.5 nm diameter range of CdTe nanoparticles, the observed ET rate (kET) was sensitive to CaI concentration. To account for diameter effects on CaI binding, a Langmuir isotherm and two geometric binding models were created to estimate maximal CaI affinities and coverages at saturating concentrations. Normalizing the ET kinetics to CaI surface coverage for each CdTe diameter led to k(ET) values that were insensitive to diameter, despite a decrease in the free energy for photoexcited ET (ΔGET) with increasing diameter. The turnover frequency (TOF) of CaI in CdTe-CaI complexes was measured at several molar ratios. Normalization for diameter-dependent changes in CaI coverage showed an increase in TOF with diameter. These results suggest that k(ET) and H2 production for CdTe-CaI complexes are not strictly controlled by ΔG(ET) and that other factors must be considered.
New directions in e-learning research in health professions education: Report of two symposia.
Triola, Marc M; Huwendiek, Sören; Levinson, Anthony J; Cook, David A
2012-01-01
The use of Computer Assisted Instruction (CAI) is rising across health professions education. Research to date is of limited use in guiding the implementation and selection of CAI innovations. In the context of two symposia, systemic reviews were discussed that evaluate literature in Internet-based learning, Virtual Patients, and animations. Each session included a debate with the goal of reaching consensus on best current practices and future research. Thematic analysis of the discussions was performed to arrange the questions by theme, eliminate redundancy, and craft them into a cohesive narrative. The question analysis revealed that there are clear advantages to the use of CAI, and that established educational theories should certainly inform the future development and selection of CAI tools. Schools adopting CAI need to carefully consider the benefits, cost, available resources, and capacity for teachers and learners to accept change in their practice of education. Potential areas for future research should focus on the effectiveness of CAI instructional features, integration of e-learning into existing curricula and with other modalities like simulation, and the use of CAI in assessment of higher-level outcomes. There are numerous opportunities for future research and it will be important to achieve consensus on important themes.
Kim, Seonguk; Min, Kyoungdoug
2008-08-01
The CAI (controlled auto ignition) engine ignites fuel and air mixture by trapping high temperature burnt gas using a negative valve overlap. Due to auto ignition in CAI combustion, efficiency improvements and low level NOx emission can be obtained. Meanwhile, the CAI combustion regime is restricted and control parameters are limited. The start of combustion data in the compressed ignition engine are most critical for controlling the overall combustion. In this research, the engine block vibration signal is transformed by the Meyer wavelet to analyze CAI combustion more easily and accurately. Signal acquisition of the engine block vibration is a more suitable method for practical use than measurement of in-cylinder pressure. A new method for detecting combustion start in CAI engines through wavelet transformation of the engine block vibration signal was developed and results indicate that it is accurate enough to analyze the start of combustion. Experimental results show that wavelet transformation of engine block vibration can track the start of combustion in each cycle. From this newly developed method, the start of combustion data in CAI engines can be detected more easily and used as input data for controlling CAI combustion.
International Nuclear Information System (INIS)
Liu, Zhe; Geng, Yong; Adams, Michelle; Dong, Liang; Sun, Lina; Zhao, Jingjing; Dong, Huijuan; Wu, Jiao; Tian, Xu
2016-01-01
Highlights: • Energy-related GHG emission trajectories, features and driving forces of CAI are analyzed from the perspective of LCA. • CAI experienced a rapid growth of energy-related GHG emissions from 2004 to 2013. • Energy-scale effect is the main driving force for energy-related GHG emissions increase in CAI. • Construction and transportation-related activities account for more than 40% of the total embodied emissions. • Policy implications such as developing secondary aluminum industry, improving energy mix etc, are raised. - Abstract: With the rapid growth of aluminum production, reducing greenhouse gas (GHG) emissions in China’s aluminum industry (CAI) is posing a significant challenge. In this study, the energy-related GHG emission trajectories, features and driving forces of CAI are analyzed from the perspective of life cycle analysis (LCA) from 2004 to 2013. Results indicate that CAI experienced a rapid growth of energy-related GHG emissions with an average annual growth of 28.5 million tons CO_2e from 2004 to 2013. Energy-scale effect is the main driving force for energy-related GHG emissions increase in CAI, while emission-factor effect of secondary aluminum production plays a marginal effect. Construction and transportation-related activities account for the bulk of the embodied emissions, accounting for more than 40% of the total embodied emissions from CAI. Policy implications for GHG mitigation within the CAI, such as developing secondary aluminum industry, improving energy mix and optimizing resource efficiency of production, are raised.
Holst, Jesper C; Olsen, Mia B; Paton, Chad; Nagashima, Kazuhide; Schiller, Martin; Wielandt, Daniel; Larsen, Kirsten K; Connelly, James N; Jørgensen, Jes K; Krot, Alexander N; Nordlund, Ake; Bizzarro, Martin
2013-05-28
Refractory inclusions [calcium-aluminum-rich inclusions, (CAIs)] represent the oldest Solar System solids and provide information regarding the formation of the Sun and its protoplanetary disk. CAIs contain evidence of now extinct short-lived radioisotopes (e.g., (26)Al, (41)Ca, and (182)Hf) synthesized in one or multiple stars and added to the protosolar molecular cloud before or during its collapse. Understanding how and when short-lived radioisotopes were added to the Solar System is necessary to assess their validity as chronometers and constrain the birthplace of the Sun. Whereas most CAIs formed with the canonical abundance of (26)Al corresponding to (26)Al/(27)Al of ∼5 × 10(-5), rare CAIs with fractionation and unidentified nuclear isotope effects (FUN CAIs) record nucleosynthetic isotopic heterogeneity and (26)Al/(27)Al of Solar System, including the origin of short-lived radioisotopes. However, their chronology is unknown. Using the (182)Hf-(182)W chronometer, we show that a FUN CAI recording a condensation origin from a solar gas formed coevally with canonical CAIs, but with (26)Al/(27)Al of ∼3 × 10(-6). The decoupling between (182)Hf and (26)Al requires distinct stellar origins: steady-state galactic stellar nucleosynthesis for (182)Hf and late-stage contamination of the protosolar molecular cloud by a massive star(s) for (26)Al. Admixing of stellar-derived (26)Al to the protoplanetary disk occurred during the epoch of CAI formation and, therefore, the (26)Al-(26)Mg systematics of CAIs cannot be used to define their formation interval. In contrast, our results support (182)Hf homogeneity and chronological significance of the (182)Hf-(182)W clock.
Mautone, Jennifer A; DuPaul, George J; Jitendra, Asha K
2005-08-01
The present study examines the effects of computer-assisted instruction (CAI) on the mathematics performance and classroom behavior of three second-through fourth-grade students with ADHD. A controlled case study is used to evaluate the effects of the computer software on participants' mathematics performance and on-task behavior. Participants' mathematics achievement improve and their on-task behavior increase during the CAI sessions relative to independent seatwork conditions. In addition, students and teachers consider CAI to be an acceptable intervention for some students with ADHD who are having difficulty with mathematics. Implications of these results for practice and research are discussed.
Peroneal electromechanical delay and fatigue in patients with chronic ankle instability.
Flevas, Dimitrios A; Bernard, Manfred; Ristanis, Stavros; Moraiti, Constantina; Georgoulis, Anastasios D; Pappas, Evangelos
2017-06-01
The purpose of this study was to investigate the effect of chronic ankle instability (CAI) on electromechanical delay times (EMD) before and after fatigue. Understanding the mechanisms that contribute to CAI is essential for the development of effective rehabilitation programmes. It was hypothesized that patients with CAI will demonstrate prolonged EMD times compared to healthy subjects and that fatigue will cause greater increases in EMD times in the CAI group. Twenty-one male volunteers participated in the study providing data on 16 ankles with CAI and 26 with no history of ankle injury. EMD was measured on an isokinetic dynamometer. Measurements were taken with the ankle in neutral (0°) and at 30° of inversion. All subjects followed an isokinetic fatigue protocol until eversion torque fell below 50 % of initial torque for three consecutive repetitions. A 2 × 2 × 2 ANOVA was used to calculate the effect of ankle status (CAI vs. healthy), fatigue, angle (0° vs. 30°) and their interactions on EMD. Fatigue caused a significant increase on EMD [non-fatigued: 122(29)ms vs. fatigue 155(54)ms; p ankle status and angle was found (p = 0.026) with CAI ankles demonstrating longer EMD [CAI: 156(45)ms vs. healthy: 133(40)ms] in neutral but not at 30° of inversion [CAI: 133(46)ms vs. 132(33)ms]. Patients with CAI had longer EMD times in neutral, but not when the ankle was placed in inversion. This suggests that rehabilitation programmes may be more effective when retraining occurs with the ankle in neutral position. It is likely that low EMD times prevent ankle acceleration at the beginning of the mechanism of injury, but they are less important when the ankle has already inverted at 30°. Both CAI and healthy subjects demonstrated longer EMD after fatigue, emphasizing the importance of proper conditioning in the prevention of delayed peroneal response and subsequent ankle injury. Improving resistance to fatigue of the peroneals may prove to be an effective
NCBI nr-aa BLAST: CBRC-FCAT-01-1153 [SEVENS
Lifescience Database Archive (English)
Full Text Available 1| polycystic kidney and hepatic disease 1 [Homo sapiens] emb|CAH73867.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAH72781.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI16676.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI20324.1| polycystic kidney and hepatic disease 1 (autosomal r...ecessive) [Homo sapiens] emb|CAI20233.1| polycystic kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] NP_619639.3 0.0 76% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1207 [SEVENS
Lifescience Database Archive (English)
Full Text Available 1| polycystic kidney and hepatic disease 1 [Homo sapiens] emb|CAH73867.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAH72781.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI16676.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI20324.1| polycystic kidney and hepatic disease 1 (autosomal r...ecessive) [Homo sapiens] emb|CAI20233.1| polycystic kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] NP_619639.3 0.0 87% ...
Trace Element Abundances in an Unusual Hibonite-Perovskite Refractory Inclusion from Allende
Mane, Prajkta; Wadhwa, M.; Keller, L. P.
2013-01-01
Calcium-aluminum-rich refractory inclusions (CAIs) are thought to be the first-formed solids in the Solar protoplanetary disk and can provide information about the earliest Solar System processes (e.g., [1]). A hibonite-perovskitebearing CAI from the Allende CV3 chondrite (SHAL, [2]) contains a single of 500 micrometers hibonite grain and coarse-grained perovskite. The mineralogy and oxygen isotopic composition of this CAI shows similarities with FUN inclusions, especially HAL [2]. Here we present trace element abundances in SHAL.
Hypopituitarism: growth hormone and corticotropin deficiency.
Capatina, Cristina; Wass, John A H
2015-03-01
This article presents an overview of adult growth hormone deficiency (AGHD) and corticotropin deficiency (central adrenal failure, CAI). Both conditions can result from various ailments affecting the hypothalamus or pituitary gland (most frequently a tumor in the area or its treatment). Clinical manifestations are subtle in AGHD but potentially life-threatening in CAI. The diagnosis needs dynamic testing in most cases. Treatment of AGHD is recommended in patients with documented severe deficiency, and treatment of CAI is mandatory in all cases. Despite significant progress in replacement hormonal therapy, more physiologic treatments and more reliable indicators of treatment adequacy are still needed. Copyright © 2015 Elsevier Inc. All rights reserved.
A Controversial Role Model for Pakistani Women
Directory of Open Access Journals (Sweden)
Faiza Mushtaq
2012-03-01
Full Text Available Al-Huda is a movement of Islamic education and reform with a dedicated female following in Pakistani cities. Its founder and leader is a woman, Dr. Farhat Hashmi, who has become a well-known public figure in Pakistan. This paper explores how Hashmi derives her authority, displays it, and defends it against challenges. Women who become active participants in her classes claim she transforms their understanding of Islam and inspires them to change their lives. However she is criticized by the secular-liberal elites of the country and by the traditional male leadership of Islamic institutions, who question her religious expertise and are uncomfortable with the role of both gender and class in this movement. This analysis highlights the collective interactions and organizational innovations through which Hashmi’s teachings acquire an authoritative status for selected women.
Computer-assisted instruction: a library service for the community teaching hospital.
McCorkel, J; Cook, V
1986-04-01
This paper reports on five years of experience with computer-assisted instruction (CAI) at Winthrop-University Hospital, a major affiliate of the SUNY at Stony Brook School of Medicine. It compares CAI programs available from Ohio State University and Massachusetts General Hospital (accessed by telephone and modem), and software packages purchased from the Health Sciences Consortium (MED-CAPS) and Scientific American (DISCOTEST). The comparison documents one library's experience of the cost of these programs and the use made of them by medical students, house staff, and attending physicians. It describes the space allocated for necessary equipment, as well as the marketing of CAI. Finally, in view of the decision of the National Board of Medical Examiners to administer the Part III examination on computer (the so-called CBX) starting in 1988, the paper speculates on the future importance of CAI in the community teaching hospital.
Erratum: Quantum corrections and black hole spectroscopy
Jiang, Qing-Quan; Han, Yan; Cai, Xu
2012-06-01
In my paper [Qing-Quan Jiang, Yan Han, Xu Cai, Quantum corrections and black hole spectroscopy, JHEP 08 (2010) 049], there was an error in deriving the black hole spectroscopy. In this erratum, we attempt to rectify them.
International Nuclear Information System (INIS)
Raufman, J.P.; Berger, S.; Cosowsky, L.; Straus, E.
1986-01-01
Intracellular calcium concentration ([Ca]i) and pepsinogen secretion from dispersed chief cells from guinea pig stomach were determined before and after stimulation with calcium ionophores. [Ca]i was measured using the fluorescent probe quin2. Basal [Ca]i was 105 +/- 4 nM. Pepsinogen secretion was measured with a new assay using 125 I-albumin substrate. This assay is 1000-fold more sensitive than the widely-used spectrophotometric assay, technically easy to perform, rapid, and relatively inexpensive. The kinetics and stoichiometry of ionophore-induced changes in [Ca]i and pepsinogen secretion were similar. These data support a role for calcium as a cellular mediator of pepsinogen secretion
Oxygen isotope exchange between refractory inclusion in allende and solar nebula Gas
Yurimoto; Ito; Nagasawa
1998-12-04
A calcium-aluminum-rich inclusion (CAI) from the Allende meteorite was analyzed and found to contain melilite crystals with extreme oxygen-isotope compositions ( approximately 5 percent oxygen-16 enrichment relative to terrestrial oxygen-16). Some of the melilite is also anomalously enriched in oxygen-16 compared with oxygen isotopes measured in other CAIs. The oxygen isotopic variation measured among the minerals (melilite, spinel, and fassaite) indicates that crystallization of the CAI started from oxygen-16-rich materials that were probably liquid droplets in the solar nebula, and oxygen isotope exchange with the surrounding oxygen-16-poor nebular gas progressed through the crystallization of the CAI. Additional oxygen isotope exchange also occurred during subsequent reheating events in the solar nebula.
Brennecka, Gregory A; Borg, Lars E; Wadhwa, Meenakshi
2013-10-22
The isotopic composition of our Solar System reflects the blending of materials derived from numerous past nucleosynthetic events, each characterized by a distinct isotopic signature. We show that the isotopic compositions of elements spanning a large mass range in the earliest formed solids in our Solar System, calcium-aluminum-rich inclusions (CAIs), are uniform, and yet distinct from the average Solar System composition. Relative to younger objects in the Solar System, CAIs contain positive r-process anomalies in isotopes A 140. This fundamental difference in the isotopic character of CAIs around mass 140 necessitates (i) the existence of multiple sources for r-process nucleosynthesis and (ii) the injection of supernova material into a reservoir untapped by CAIs. A scenario of late supernova injection into the protoplanetary disk is consistent with formation of our Solar System in an active star-forming region of the galaxy.
Origin of opaque assemblages in C3V meteorites - Implications for nebular and planetary processes
Blum, Joel D.; Wasserburg, G. J.; Hutcheon, I. D.; Beckett, J. R.; Stolper, E. M.
1989-01-01
The results of analyses of meteoritic opaque assemblages (OAs) are presented and used in conjunction with literature data on phase equilibria and diffusion to further develop the hypothesis of Blum et al. (1989) for the origin of OAs in Ca,Al-rich inclusions (CAIs). Based on the results of the analyses, it is suggested that OAs formed after the crystallization of host CAIs by exsolution, sulfidation, and oxidation of precursor alloys at low temperatures (about 770 K) and higher than solar gas sulfur and oxygen fugacities. This model contrasts with previous models that call upon the formation of CAI OAs by aggregation of previously formed phases in the solar nebula prior to the crystallization of CAIs.
Directory of Open Access Journals (Sweden)
Janis Grabis
2015-12-01
Full Text Available The 5th issue of the journal on Complex Systems Informatics and Modeling (CSIMQ presents extended versions of five papers selected from the CAiSE Forum 2015. The forum was part of the 27th edition of international Conference on Advanced Information Systems engineering (CAiSE 2015, which took place in June 2015 in Stockholm, Sweden. Information systems engineering draws its foundation from various interrelated disciplines including, e.g., conceptual modeling, database systems, business process management, requirements engineering, human computer interaction, and enterprise computing to address various practical challenges in development and application of information systems. The guiding subjects of CAiSE 2015 were Creativity, Ability, and Integrity. The CAiSE Forum aimed at presenting and discussing new ideas and tools related to information systems Engineering.
African Journal of Biotechnology - Vol 12, No 31 (2013)
African Journals Online (AJOL)
induced fatty liver model of consecutive extracts from Rosa davurica Pall · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ying Wei, Muyi Cai, Ruizeng Gu, Jun Lu, Feng Lin, Baoping Ji ...
hydrochemical assessment of groundwater quality in sagamu area ...
African Journals Online (AJOL)
ABDULRASHEED
alkaline indices (CAI), were calculated for irrigation purposes. The results were presented as spatial distribution maps for interpretation and further inferences. Comparison of the groundwater quality in the area with local and international ...
Lifescience Database Archive (English)
Full Text Available ) ... AUTHORS ... Akizu N, Cantagrel V, Schroth J, Cai N, Vaux K, McCloskey D, Naviaux RK, Van Vleet J, Fenstermaker AG, Silhavy JL, Sche...liga JS, Toyama K, Morisaki H, Sonmez FM, Celep F, Oraby
Codon-optimized antibiotic resistance gene improves efficiency of ...
Indian Academy of Sciences (India)
2013-10-01
Oct 1, 2013 ... transient transformation and cell growth in selective culture were significantly increased by use of fgmR ... Our result shows that similarity in codon usage pattern is an important factor ... Codon adaptation index (CAI) (Sharp.
Protective effect of rhamnopyranosyl vanilloyl isolated from ...
African Journals Online (AJOL)
Cai Tian Di Wang in 2013 and authenticated by. Chang-Wu Wang, a ... purchased from Abcam (Cambridge, UK) and ..... Hosaka T, Suzuki F, Kobayashi M, Seko Y, Kawamura Y, ... Han JJ, Ning N. Research progress on pharmacological.
Antimycobacterial and cytotoxic activities of extracts from fungal ...
African Journals Online (AJOL)
Science, Technology and Innovation through Science, Technology and Innovations (NACOSTI/RCD/ST&I) 5th ... Lake Fuxian, Yunnan China (Cai et al., 2002). Lake Magadi which is ..... some fungi indigenous to Tanzania. Tanz. J. Heal. Res.
Stephenson, Rob; Finneran, Catherine
2017-08-01
Intimate partner violence (IPV) rates are disproportionately high among sexual minority populations, with increasing evident that gay men experience IPV at the same rates as heterosexual women. This study examines the relationship between self-reported condomless anal intercourse (CAI) and IPV among a sample of 750 gay and bisexual men. Participants answered questions regarding recent receipt and perpetration of IPV using the IPV-GBM Scale (Cronbach Alpha 0.90). Of the sample, 46.1% reported recent receipt of any type of IPV and 33.6% reported recent perpetration of any type of IPV. Overall, 55.1% of participants reported CAI at last sex. Significant associations were determined between several forms of IPV and increased odds of reporting CAI at last sex. These findings suggest that IPV may be a risk factor for CAI among men who have sex with men, and highlight the need to understand the IPV prevention and care needs of this population.
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available [Azoarcus sp. EbN1] emb|CAI06629.1| nudix hydrolase ... [Azoarcus sp. EbN1] ... Length = 151 ... Query: 5 ... EGYRPNVGIILVNT...RNEVFWGKRIREHSWQFPQGGIKHGESPEQAMFRELFEEVGLRPEH 64 ... EGYRPNVGIILVNTRNEVFWGK...RIREHSWQFPQGGIKHGESPEQAMFRELFEEVGLRPEH Sbjct: 1 ... EGYRPNVGIILVNTRNEVFWGKRIREHSWQF
Miller, John; Weil, Gordon
1986-01-01
The interactive feature of computers is used to incorporate a guided inquiry method of learning introductory economics, extending the Computer Assisted Instruction (CAI) method beyond drills. (Author/JDH)
sources and use of extension information among maize farmers in ...
African Journals Online (AJOL)
DR ADESOPE
This paper highlights the potentials of agro-tourism for rural development in Nigeria and ... promotion of entrepreneurship and industrialization, economic advancement, ..... Cai, J. (2003), 'Peri-urban Agriculture Development in China, Urban.
Clinical and genetic characterization of 6 cases with complete ...
Indian Academy of Sciences (India)
Navya
2016-12-16
Dec 16, 2016 ... secondary sex characters (partial AIS) to a complete AIS (CAIS) (Ferlin et al., 2006;. Zuccarello et al., 2008). ... The physical examination and the .... 2004 Residual activity of mutant androgen receptors explains wolffian duct.
DEFF Research Database (Denmark)
Belhage, B; Hansen, Gert Helge; Schousboe, A
1993-01-01
differences in the mode of action of the two depolarizing stimuli were reflected in the properties of the increase in [Ca++]i elicited by 55 mM K+ and 100 microM glutamate, respectively. The K(+)-induced increase in [Ca++]i was reduced by both verapamil and Ca(++)-free media whereas the corresponding...... neurotransmitter glutamate (100 microM). Both depolarizing stimuli exerted prompt increases in the release of preloaded [3H]GABA as well as in [Ca++]i. However, the basic properties of transmitter release and the increase in [Ca++]i under a variety of conditions were different during stimulation with K...... was also reduced by organic (verapamil) and inorganic (Co++) Ca++ channel blockers but was insensitive to the GABA transport inhibitor SKF 89976A. In contrast, the second phase was less sensitive to nocodazole and Ca++ channel antagonists but could be inhibited by SKF 89976A. The glutamate-induced [3H...
ORF Alignment: NC_002516 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_002695 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_004337 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_004578 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_005966 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_006085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_003197 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_004431 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_004741 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1
Higgins, Paul
1976-01-01
Methodology for developing a computer assisted instruction (CAI) lesson (scripting, programing, and testing) is reviewed. A project done by Informatics Education Ltd. (IEL) for the Department of National Defense (DND) is used as an example. (JT)
Continuum Modeling of Biological Network Formation
Albi, Giacomo; Burger, Martin; Haskovec, Jan; Markowich, Peter A.; Schlottbom, Matthias
2017-01-01
We present an overview of recent analytical and numerical results for the elliptic–parabolic system of partial differential equations proposed by Hu and Cai, which models the formation of biological transportation networks. The model describes
Characterization and identification of in vitro metabolites of ...
African Journals Online (AJOL)
Characterization and identification of in vitro metabolites of (-)-epicatechin using ultra-high performance liquid chromatography-mass spectrometry. Rui Jun Cai, Xiao Ling Yin, Jing Liu, Da Xu Qin, Gui Zhen Zhao ...
Asjade tegemisest / Mari Laaniste
Laaniste, Mari, 1977-
1999-01-01
Issey Miyake (s. 1938) näitus "Making Things" Cartier' moodsa kunsti keskuses Raspail' bulvaril Pariisis. Külaliskunstnikud Yasumasa Morimura, Nobuyoshi Araki (fotograaf), Tim Hawkinson, Cai Guo-Qiang.
Mathematical Analysis of a PDE System for Biological Network Formation
Haskovec, Jan; Markowich, Peter A.; Perthame, Benoit
2015-01-01
Motivated by recent physics papers describing rules for natural network formation, we study an elliptic-parabolic system of partial differential equations proposed by Hu and Cai [13, 15]. The model describes the pressure field thanks to Darcy's type
Biological transportation networks: Modeling and simulation
Albi, Giacomo; Artina, Marco; Foransier, Massimo; Markowich, Peter A.
2015-01-01
We present a model for biological network formation originally introduced by Cai and Hu [Adaptation and optimization of biological transport networks, Phys. Rev. Lett. 111 (2013) 138701]. The modeling of fluid transportation (e.g., leaf venation
Lifescience Database Archive (English)
Full Text Available Z, Cai B, Hostetler EM, Moran R, Liang D, Estrera A, Safi HJ, Leal SM, Bamshad MJ, Shendure J, Nickerson DA,... ... AUTHORS ... Guo DC, Regalado ES, Gong L, Duan X, Santos-Cortez RL, Arnaud P, Ren
Choi, Ho-Suk; Shin, Won-Seob
2015-01-01
[Purpose] The purpose of this study was to provide evidence of construct validity for the lower extremity functional movement screen (LE-FMS) based on hypothesis testing in patients with chronic ankle instability (CAI). [Subjects] The subjects were 20 healthy subjects and 20 patients with CAI who had a history of ankle sprain with pain for more than 1 day. [Methods] All participants were measured using the Foot and Ankle Disability Index (FADI) and evaluated with the LE-FMS. The screen includ...
Effect of metabolic and respiratory acidosis on intracellular calcium in osteoblasts.
Frick, Kevin K; Bushinsky, David A
2010-08-01
In vivo, metabolic acidosis {decreased pH from decreased bicarbonate concentration ([HCO(3)(-)])} increases urine calcium (Ca) without increased intestinal Ca absorption, resulting in a loss of bone Ca. Conversely, respiratory acidosis [decreased pH from increased partial pressure of carbon dioxide (Pco(2))] does not appreciably alter Ca homeostasis. In cultured bone, chronic metabolic acidosis (Met) significantly increases cell-mediated net Ca efflux while isohydric respiratory acidosis (Resp) does not. The proton receptor, OGR1, appears critical for cell-mediated, metabolic acid-induced bone resorption. Perfusion of primary bone cells or OGR1-transfected Chinese hamster ovary (CHO) cells with Met induces transient peaks of intracellular Ca (Ca(i)). To determine whether Resp increases Ca(i), as does Met, we imaged Ca(i) in primary cultures of bone cells. pH for Met = 7.07 ([HCO(3)(-)] = 11.8 mM) and for Resp = 7.13 (Pco(2) = 88.4 mmHg) were similar and lower than neutral (7.41). Both Met and Resp induced a marked, transient increase in Ca(i) in individual bone cells; however, Met stimulated Ca(i) to a greater extent than Resp. We used OGR1-transfected CHO cells to determine whether OGR1 was responsible for the greater increase in Ca(i) in Met than Resp. Both Met and Resp induced a marked, transient increase in Ca(i) in OGR1-transfected CHO cells; however, in these cells Met was not different than Resp. Thus, the greater induction of Ca(i) by Met in primary bone cells is not a function of OGR1 alone, but must involve H(+) receptors other than OGR1, or pathways sensitive to Pco(2), HCO(3)(-), or total CO(2) that modify the effect of H(+) in primary bone cells.
Evidence for Widespread 26Al in the Solar Nebula and Constraints for Nebula Time Scales
Russell; Srinivasan; Huss; Wasserburg; MacPherson
1996-08-09
A search was made for 26Mg (26Mg*) from the decay of 26Al (half-life = 0.73 million years) in Al-rich objects from unequilibrated ordinary chondrites. Two Ca-Al-rich inclusions (CAIs) and two Al-rich chondrules (not CAIs) were found that contained 26Al when they formed. Internal isochrons for the CAIs yielded an initial 26Al/27Al ratio [(26Al/27Al)0] of 5 x 10(-5), indistinguishable from most CAIs in carbonaceous chondrites. This result shows that CAIs with this level of 26Al are present throughout the classes of chondrites and strengthens the notion that 26Al was widespread in the early solar system. The two Al-rich chondrules have lower 26Mg*, corresponding to a (26Al/27Al)0 ratio of approximately 9 x 10(-6). Five other Al-rich chondrules contain no resolvable 26Mg*. If chondrules and CAIs formed from an isotopically homogeneous reservoir, then the chondrules with 26Al must have formed or been last altered approximately2 million years after CAIs formed; the 26Mg*-free chondrules formed >1 to 3 million years later still. Because 26Mg*-containing and 26Mg*-free chondrules are both found in Chainpur, which was not heated to more than approximately400°C, it follows that parent body metamorphism cannot explain the absence of 26Mg* in some of these chondrules. Rather, its absence indicates that the lifetime of the solar nebula over which CAIs and chondrules formed extended over approximately5 million years.
Mirror Neurons, Embodied Cognitive Agents and Imitation Learning
Czech Academy of Sciences Publication Activity Database
Wiedermann, Jiří
2003-01-01
Roč. 22, č. 6 (2003), s. 545-559 ISSN 1335-9150 R&D Projects: GA ČR GA201/02/1456 Institutional research plan: CEZ:AV0Z1030915 Keywords : complete agents * mirror neurons * embodied cognition * imitation learning * sensorimotor control Subject RIV: BA - General Mathematics Impact factor: 0.254, year: 2003 http://www.cai.sk/ojs/index.php/cai/article/view/468
Bull, Daniel; Spearing, Simon; Sinclair, Ian
2015-01-01
This study applies mechanisms observed from previous work (the undamaged cone, toughness and extent of permanent out-of-plane deformation) to parametrically study their effects on residual compression after impact (CAI) strength using finite element models. Based on previous experimental work, tougher material systems exhibited up to 30% greater CAI strength for a given damage area. Based on this, it is necessary to understand what other parameters, beyond damage area, contribute to a loss in...
Deviations in gait metrics in patients with chronic ankle instability: a case control study.
Gigi, Roy; Haim, Amir; Luger, Elchanan; Segal, Ganit; Melamed, Eyal; Beer, Yiftah; Nof, Matityahu; Nyska, Meir; Elbaz, Avi
2015-01-01
Gait metric alterations have been previously reported in patients suffering from chronic ankle instability (CAI). Previous studies of gait in this population have been comprised of relatively small cohorts, and the findings of these studies are not uniform. The objective of the present study was to examine spatiotemporal gait metrics in patients with CAI and examine the relationship between self-reported disease severity and the magnitude of gait abnormalities. Forty-four patients with CAI were identified and compared to 53 healthy controls. Patients were evaluated with spatiotemporal gait analysis via a computerized mat and with the Short Form (SF) - 36 health survey. Patients with CAI were found to walk with approximately 16% slower walking velocity, 9% lower cadence and approximately 7% lower step length. Furthermore, the base of support, during walking, in the CAI group was approximately 43% wider, and the single limb support phase was 3.5% shorter compared to the control group. All of the SF-36 8-subscales, as well as the SF-36 physical component summary and SF-36 mental component summary, were significantly lower in patients with CAI compared to the control group. Finally, significant correlations were found between most of the objective gait measures and the SF-36 mental component summary and SF-36 physical component summary. The results outline a gait profile for patients suffering from CAI. Significant differences were found in most spatiotemporal gait metrics. An important finding was a significantly wider base of support. It may be speculated that these gait alterations may reflect a strategy to deal with imbalance and pain. These findings suggest the usefulness of gait metrics, alongside with the use of self-evaluation questionnaires, in assessing disease severity of patients with CAI.
Vehicle/Guideway Interaction in Maglev Systems
1992-03-01
Technology Division Materials and Components in Maglev Systems Technology Division Materials and Components Technology Division byY. Cai, S. S. Chen, and D. M...Transportation Systems Reports (UC-330, Vehicle/Guideway Interaction in Maglev Systems by Y. Cai and S. S. Chen Materials and Components Technology Division D. M...Surface Irregularities ...................................... 32 4 Vehicle/Guideway Interaction in Transrapid Maglev System .................. 34 4.1
On the Unsteady-Motion Theory of Magnetic Forces for Maglev
1993-11-01
DivisionEnergy Technology Division Forces for Maglev Energy Technology DivisionEnergy Technology Division by S. S. Chen, S. Zhu, and Y. Cai APQ 4 袲...On the Unsteady-Motion Theory of Magnetic Forces for Maglev by S. S. Chen, S. Zhu, and Y. Cai Energy Technology Division November 1993 Work supported...vi On The Unsteady-Motion Theory of Magnetic Forces for Maglev by S. S
Directory of Open Access Journals (Sweden)
Lefkothea Karaviti
2010-01-01
Full Text Available Background. Late transient neonatal hypocalcemia with hyperphosphatemia is potentially life-threatening. The use of 1.25 dihydroxycholecalciferol in the management of neonatal hypocalcemia is unexplored. Objective. We hypothesized adding 1.25 dihydroxycholecalciferol to intravenous continuous calcium infusion (CaI will achieve accelerated correction of hypocalcemia. Design/Methods. A controlled double-blind randomized placebo group was organized to compare the addition of 1.25 dihydroxycholecalciferol to CaI in 3–14 day old neonates presenting with hypocalcemia, hyperphosphatemia and seizures. Ionized calcium and phosphorus were measured to adjust CaI and maintain eucalcemia. Time to resolution of hypocalcemia was defined as time from starting CaI to the first ionized calcium of ≥1.1 mmol/L. CaI was discontinued when ionized calcium levels were ≥1.1 mmol/L on two measurements and the infant tolerated feeds. Results. Fourteen neonates were studied without statistical difference between groups. Time to correction of hypocalcemia for 1,25 dihydroxycholecalciferol versus placebo was 7.2 ± 1.9 versus 11.5 ± 3.4 hours respectively (p=.26. The duration of CaI was 15.0 ± 1.5 versus 24.8 ± 4.4 hours respectively (p=.012. Conclusions. The addition of 1.25 dihydroxycholecalciferol to standard CaI therapy reduced the duration of CaI, but did not reduce the time to correct hypocalcemia in neonates with late transient hypocalcemia.
The discriminant validity of the culture assessment instrument: A comparison of company sub-cultures
Directory of Open Access Journals (Sweden)
Leo Petkoon
2004-10-01
Full Text Available The primary purpose of this study was to assess the discriminant validity of the Culture Assessment Instrument (CAI; that is to distinguish between company mean sub-culture scores and between mean scores of a target company and that of a norm group. The primary data was obtained by a sample of convenience (N = 593 from a transport organisation. The secondary data of the norm group was constituted by convenience samples (N = 4066 from various companies originating from different industries. The 56 item scores of the CAI were factor analysed on two levels followed by iterative item analyses. Although significant differences were detected between mean culture scores, only a small proportion of the variance in these scores could be attributed to culture differences. On these grounds, the CAI does not possess discriminant validity. Suggestions for improving the CAI were made. Opsomming Die primêre doel van die studie was om die diskriminante geldigheid van die ‘Culture Assessment Instrument’ (CAI te beoordeel; dit is om tussen ondernemings se gemiddelde kultuur-subtelling te onderskei en tussen die gemiddelde tellings van ‘n teiken onderneming en ’n normgroep. Die primêre data is verkry van ’n geleentheidsteekproef (N = 593 uit ’n transport-onderneming. Die sekondêre data van die normgroep is saamgestel uit geleentheidsteekproewe (N = 4066 van verskillende ondernemings afkomstig uit verskeie industrieë. Die 56 itemtellings van die CAI is op twee vlakke gefaktoranaliseer, gevolg deur iteratiewe itemontledings. Ofskoon beduidende verskille tussen gemiddelde kultuurtellings gevind is, kon slegs ’n klein proporsie van die variansie in die tellings aan kultuurverskille toegeskryf word. Op hierdie gronde beskik die CAI nie oor diskriminante geldigheid nie. Voorstelle ter verbetering van die CAI is gemaak.
Indian Academy of Sciences (India)
Cao Ceo.BalaCuO showed a drop in T. to 43K while the Ca-excess compound. Cai BaLaCuO showed an improvement in T. to 72K. The decrease of T. in Ce- doped compound may be due to the tetravalent nature of Ce-ion. Substitution of tetravalent Ce for divalent Cais likely to bring down considerably the number of holes.
Major and trace element geochemistry of S-type cosmic spherules
Digital Repository Service at National Institute of Oceanography (India)
Rudraswami, N.G.; ShyamPrasad, M.; Babu, E.V.S.S.K.; VijayaKumar, T.
that pass through the Earth’s atmosphere undergo changes in their chemical compositions thereby making it difficult to understand if they are sourced from the matrix, chondrules or calcium aluminium rich inclusions (CAIs). These components have..., the nature of their precursors, their thermal history while they were a part of parent bodies, and their relation to the chondrites or components such as calcium aluminium rich inclusions (CAIs), chondrules and matrix is masked by ambiguity. There is ample...
2015-03-01
by non-commercial enti- ties. HostiP is a community-driven geolocation service. It provides an Application Pro- gramming Interface ( API ) for...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS IP INFRASTRUCTURE GEOLOCATION Thesis Advisor: Second Reader: by Guan Yan Cai March...FUNDING NUMBERS IP INFRASTRUCfURE GEOLOCATION N66001-2250-59231 6. AUTHOR(S) Guan Yan Cai 7. PERFORMING ORGANIZATION NAME(S) AND AOORESS(ES) 9
Student Study Choices in the Principles of Economics: A Case Study of Computer Usage
Grimes, Paul W.; Sanderson, Patricia L.; Ching, Geok H.
1996-01-01
Principles of Economics students at Mississippi State University were provided the opportunity to use computer assisted instruction (CAI) as a supplemental study activity. Students were free to choose the extent of their computer work. Throughout the course, weekly surveys were conducted to monitor the time each student spent with their textbook, computerized tutorials, workbook, class notes, and study groups. The surveys indicated that only a minority of the students actively pursued CAI....
Maksut, Jessica L.; Eaton, Lisa A.; Siembida, Elizabeth J.; Driffin, Daniel D.; Baldwin, Robert
2016-01-01
Background In the United States, rates of human immunodeficiency virus (HIV) infection are highest among Black men who have sex with men (BMSM). Prior research indicates that younger BMSM in particular (i.e., BMSM 29 years of age and younger) are most at risk for HIV infection and that HIV incidence in this subpopulation has risen in recent years. It remains unclear, however, why younger BMSM, relative to BMSM 30 years of age and older, are at increased risk for HIV infection. Methods For the current study, we surveyed 450 BMSM located in the Atlanta, GA metropolitan and surrounding areas. We assessed BMSM’s depressive symptoms, substance use during sex, psychosocial risk factors (i.e., HIV risk perceptions, condom use self-efficacy, internalized homophobia, and perceived HIV stigmatization), and sexual risk taking (i.e., condomless anal intercourse [CAI]). Results We found that younger BMSM (YBMSM) and older BMSM (OBMSM) differed with respect to factors associated with CAI. In multivariable models, alcohol use before or during sex, lower educational attainment, and sexual orientation (i.e., bisexual sexual orientation) were significantly associated with increased CAI for YBMSM, while HIV risk perceptions and internalized homophobia were significantly, negatively associated with CAI among OBMSM. Discussion Rates of engaging in CAI were similar across the two age cohorts; however, factors related to CAI varied by these two groups. Findings emphasize the need to consider targeted interventions for different generational cohorts of BMSM. PMID:27001255
Simpson, Jeffrey D; Stewart, Ethan M; Macias, David M; Chander, Harish; Knight, Adam C
2018-06-13
To evaluate the literature regarding unilateral landing biomechanics and dynamic postural stability in individuals with and without chronic ankle instability (CAI). Four online databases (PubMed, ScienceDirect, Scopus, and SportDiscus) were searched from the earliest records to 31 January 2018, as well as reference sections of related journal articles, to complete the systematic search. Studies investigating the influence of CAI on unilateral landing biomechanics and dynamic postural stability were systematically reviewed and evaluated. Twenty articles met the criteria and were included in the systematic review. Individuals with CAI were found to have deficits in dynamic postural stability on the affected limb with medium to large effect sizes and altered lower extremity kinematics, most notably in the ankle and knee, with medium to large effect sizes. Additionally, greater loading rates and peak ground reaction forces, in addition to reductions in ankle muscle activity were also found in individuals with CAI during unilateral jump-landing tasks. Individuals with CAI demonstrate dynamic postural stability deficits, lower extremity kinematic alterations, and reduced neuromuscular control during unilateral jump-landings. These are likely factors that contribute recurrent lateral ankle sprain injuries during dynamic activity in individuals with CAI. Copyright © 2018 Elsevier Ltd. All rights reserved.
Conodont color alteration index and upper Paleozoic thermal history of the Amazonas Basin, Brazil
Cardoso, Cassiane Negreiros; Sanz-López, Javier; Blanco-Ferrera, Silvia; Lemos, Valesca Brasil; Scomazzon, Ana Karina
2015-12-01
The conodont color alteration index (CAI) was determined in elements from core samples of the Frasnian Barreirinha Formation (one well) and of the Pennsylvanian-Permian Tapajós Group (twenty three wells and one limestone quarry) in the Amazonas Basin. The thermal history of the basin is analyzed using the CAI value distribution represented in maps and stratigraphic sections through correlation schemes, and in conjunction with previously published data. The pattern of palaeotemperatures for CAI values of 1.5-3 is coincident with organic matter maturation under a sedimentary overburden providing diagenetic conditions in the oil/gas window. Locally, conodonts show metamorphism (CAI value of 6-7) in relation to the intrusion of diabase bodies in beds including high geothermal gradient evaporites. Microtextural alteration on the surface conodonts commonly shows several types of overgrowth microtextures developed in diagenetic conditions. Locally, recrystallization in conodonts with a high CAI value is congruent with contact metamorphism in relation to Mesozoic intrusions. The CAI values of 1.5 or 2 observed close to the surface in several areas of the basin may be interpreted in relation to a high thermal palaeogradient derived from the magmatic episode or/and to the local denudation of the upper part of the Paleozoic succession prior to this thermal event.
Khorashad, Behzad S; Roshan, Ghasem M; Reid, Alistair G; Aghili, Zahra; Hiradfar, Mehran; Afkhamizadeh, Mozhgan; Talaei, Ali; Aarabi, Azadeh; Ghaemi, Nosrat; Taghehchian, Negin; Saberi, Hedieh; Farahi, Nazanin; Abbaszadegan, Mohammad Reza
2017-01-01
To report sexual orientation, relationship status and medical history of Iranian people with Differences of Sex Development (DSD) who were raised female. Our participants consisted of nineteen 46,XY individuals with Complete Androgen Insensitivity Syndrome (CAIS) and eighteen 46,XX individuals with Congenital Adrenal Hyperplasia (CAH) who were raised as females and older than 13years. As well as their relationship status and detailed medical history, an expert psychiatrist assessed their sexual orientation by a semi-structured psychiatric interview with them and, where applicable, their parents. Five percent of CAH participants and 42% of CAIS participants were in a relationship, which was significantly different. All CAH individuals had been diagnosed at birth; 89% of CAIS had been diagnosed after puberty and due to primary amenorrhea and 11% were diagnosed in childhood due to inguinal hernia. Genital reconstructive surgery had been performed in 100% of CAH participants and 37% of CAIS. Regarding sexual contact experiences and sexual fantasies (androphilic, gynephilic or both), no significant differences were found. However, CAH females had significantly more gynephilic dreams (P=0.045). This study, notable as one of the rare from a non-western culture, described sexual, medical and socioeconomic status of 46,XX CAH and 46,XY CAIS individuals living in Iran. Although broadly in line with previous findings from Western cultures, Iranian CAH individuals had fewer romantic relationships, but in contrast to previous studies their sexual orientation was only different from CAIS in the contents of sexual dreams. Copyright © 2016 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Luchetti CG
2016-12-01
Full Text Available The post-cervical artificial insemination (PCAI in sows increases semen performance compared to cervical artificial insemination (CAI. In Argentina the use of the PCAI is restricted to multiparous while it is not applied to nulliparous. The aim of this study was to compare porcine CAI and PCAI in nulliparous and multiparous. Pregnancy rates and number of live pups with CAI and PCAI in nulliparous and multiparous, assessing advantages and disadvantages of each method were compared. This is a small-scale work (4 CAI and 7 PCAI in nulliparous, 3 CAI and 3 PCAI in multiparous in a small field productive site in the Province of Buenos Aires. Here the boar was omitted for heat detection and to stimulate the sow during AI. Pregnancy rates and the number of pups born alive per pregnant sow were similar with the two techniques and two categories. The PCAI is a good practice in nulliparous and multiparous because this technique increases semen performance compared to CAI and it is omitted the presence of the boar.
Computer aided information system for a PWR
International Nuclear Information System (INIS)
Vaidian, T.A.; Karmakar, G.; Rajagopal, R.; Shankar, V.; Patil, R.K.
1994-01-01
The computer aided information system (CAIS) is designed with a view to improve the performance of the operator. CAIS assists the plant operator in an advisory and support role, thereby reducing the workload level and potential human errors. The CAIS as explained here has been designed for a PWR type KLT- 40 used in Floating Nuclear Power Stations (FNPS). However the underlying philosophy evolved in designing the CAIS can be suitably adopted for other type of nuclear power plants too (BWR, PHWR). Operator information is divided into three broad categories: a) continuously available information b) automatically available information and c) on demand information. Two in number touch screens are provided on the main control panel. One is earmarked for continuously available information and the other is dedicated for automatically available information. Both the screens can be used at the operator's discretion for on-demand information. Automatically available information screen overrides the on-demand information screens. In addition to the above, CAIS has the features of event sequence recording, disturbance recording and information documentation. CAIS design ensures that the operator is not overburdened with excess and unnecessary information, but at the same time adequate and well formatted information is available. (author). 5 refs., 4 figs
Rhenium-osmium systematics of calcium-aluminium-rich inclusions in carbonaceous chondrites
Becker, H.; Morgan, J.W.; Walker, R.J.; MacPherson, G.J.; Grossman, J.N.
2001-01-01
The Re-Os isotopic systematics of calcium-aluminium-rich inclusions (CAIs) in chondrites were investigated in order to shed light on the behavior of the Re-Os system in bulk chondrites, and to constrain the timing of chemical fractionation in primitive chondrites. CAIs with relatively unfractionated rare earth element (REE) patterns (groups I, III, V, VI) define a narrow range of 187Re/188Os (0.3764-0.4443) and 187Os/188Os (0.12599-0.12717), and high but variable Re and Os abundances (3209-41,820 ppb Os). In contrast, CAIs that show depletions in highly refractory elements and strongly fractionated REE patterns (group II) also show a much larger range in 187Re/188Os (0.409-0.535) and 187Os/188Os (0.12695-0.13770), and greater than an order of magnitude lower Re and Os abundances than other groups (e.g., 75.7-680.2 ppb Os). Sixteen bulk CAIs and CAI splits plot within analytical uncertainty of a 4558 Ga reference isochron, as is expected for materials of this antiquity. Eight samples, however, plot off the isochron. Several possible reasons for these deviations are discussed. Data for multiple splits of one CAI indicate that the nonisochronous behavior for at least this CAI is the result of Re-Os reequilibration at approximately 1.6 Ga. Thus, the most likely explanation for the deviations of most of the nonisochronous CAIs is late-stage open-system behavior of Re and Os in the asteroidal environment. The 187Os/188Os-Os systematics of CAIs are consistent with previous models that indicate group II CAIs are mixtures of components that lost the bulk of their highly refractory elements in a previous condensation event and a minor second component that provided refractory elements at chondritic relative proportions. The high Re/Os of group II CAIs relative to other CAIs and chondrite bulk rocks may have been caused by variable mobilization of Re and Os during medium- to low-temperature parent body alteration ??4.5 Ga ago. This model is favored over nebular models, which
Spatiotemporal postural control deficits are present in those with chronic ankle instability
Directory of Open Access Journals (Sweden)
McKeon Patrick O
2008-06-01
Full Text Available Abstract Background Postural control deficits have been purported to be a potential contributing factor in chronic ankle instability (CAI. Summary forceplate measures such as center of pressure velocity and area have not consistently detected postural control deficits associated with CAI. A novel measurement technique derived from the dynamical systems theory of motor control known as Time-to-boundary (TTB has shown promise in detecting deficits in postural control related to chronic ankle instability (CAI. In a previous study, TTB deficits were detected in a sample of females with CAI. The purpose of this study was to examine postural control in sample of males and females with and without CAI using TTB measures. Methods This case-control study was performed in a research laboratory. Thirty-two subjects (18 males, 14 females with self-reported CAI were recruited and matched to healthy controls. All subjects performed three, ten-second trials of single-limb stance on a forceplate with eyes open and eyes closed. Main outcome measures included the TTB absolute minimum (s, mean of TTB minima (s, and standard deviation of TTB minima (s in the anteroposterior and mediolateral directions. A series of group by gender analyses of variance were conducted to evaluate the differences in postural control for all TTB variables separately with eyes open and eyes closed. Results There were no significant group by gender interactions or gender main effects for any of the measures. There, however, significant group main effects for 4 of the 6 measures with eyes closed as the CAI group demonstrated significant deficits in comparison to the control group. There were no significant differences between groups in any of the TTB measures with eyes open. Conclusion TTB deficits were present in the CAI group compared to the control group. These deficits were detected with concurrent removal of visual input. CAI may place significantly greater constraints on the
Dynamic ankle control in athletes with ankle instability during sports maneuvers.
Lin, Cheng-Feng; Chen, Chin-Yang; Lin, Chia-Wei
2011-09-01
Ankle sprain is a common sports injury. While the effects of static constraints in stabilizing the ankle joint are relatively well understood, those of dynamic constraints are less clear and require further investigation. This study was undertaken to evaluate the dynamic stability of the ankle joint during the landing phase of running and stop-jump maneuvers in athletes with and without chronic ankle instability (CAI). Controlled laboratory study. Fifteen athletes with CAI and 15 age-matched athletes without CAI performed running and stop-jump landing tasks. The dynamic ankle joint stiffness, tibialis anterior (TA)/peroneus longus (PL) and TA/gastrocnemius lateralis (GL) co-contraction indices, ankle joint angle, and root-mean-square (RMS) of the TA, PL, and GL electromyographic signals were measured during each task. During running, the CAI group exhibited a greater ankle inversion angle than the control group in the pre-landing phase (P = .012-.042) and a lower dynamic ankle joint stiffness in the post-landing phase (CAI: 0.109 ± 0.039 N·m/deg; control: 0.150 ± 0.068 N·m/deg; P = .048). In the stop-jump landing task, athletes with CAI had a significantly lower TA/PL co-contraction index during the pre-landing phase (CAI: 49.1 ± 19; control: 64.8 ± 16; P = .009). In addition, the CAI group exhibited a greater ankle inversion (P = .049), a lower peak eversion (P = .04), and a smaller RMS of the PL electromyographic signal in the post-landing phase (CAI: 0.73 ± 0.32; control: 0.51 ± 0.22; P = .04). Athletes with CAI had a relatively inverted ankle, reduced muscle co-contraction, and a lower dynamic stiffness in the ankle joint during the landing phase of sports maneuvers and this may jeopardize the stability of the ankle. Sports training or rehabilitation programs should differentiate between the pre-landing and post-landing phases of sports maneuvers, and should educate athletes to land with an appropriate ankle position and muscle recruitment.
MacPherson, G. J.; Defouilloy, C.; Kita, N. T.
2018-06-01
The Allende CAI USNM 3898 is the basis for "ALL", the lowest measured initial 87Sr/86Sr value in any solar system material including other CAIs (Gray et al., 1973). If the value ALL is correct (debated), then USNM 3898 must be 1-2 million years older than other CAIs (Podosek et al., 1991). This would require in turn that it have a much higher initial 26Al/27Al value than other CAIs, on the order of 4 × 10-4. Podosek et al. (1991) showed that this is not the case, with initial 26Al/27Al = (4.5 ± 0.7) × 10-5, but their Mg-isotopic data had large error bars and there was clear isotopic disturbance in the data having the highest 27Al/24Mg. Without the latter data, the slope of their isochron is higher (5.10 ± 1.19) × 10-5) and within (large) error of being supracanonical. We used high-precision SIMS to re-determine the initial 26Al/27Al in this CAI and obtained a value of (5.013 ± 0.099) × 10-5, with an intercept δ26Mg* = - 0.008 ± 0.048 and MSWD = 1.3. This value is indistinguishable from that measured in many other CAIs and conclusively shows that USNM 3898 is not uniquely ancient. We also confirmed evidence of later isotopic disturbance, similar to what Podosek et al. found, indicating a re-melting and evaporation event some 200,000 years after initial CAI solidification.
International Nuclear Information System (INIS)
Niemeyer, S.
1988-01-01
Average Ti isotopic patterns are derived for each class of carbonaceous chondrite from a chemically characterized suite of whole-rock samples. There is a well-resolved excess of 50 Ti in a subset of CI meteorites. Mean values of the 50 Ti excess for the four classes span a range of only 2 ε-units, with an apparent positive correlation with Al content. Previous evidence for anomalies in chondrules is augmented here by demonstrating that: (1) the more pristine Ca-Al-rich inclusions (CAIs) in Efremovka show the same isotopic pattern as the typical Allende CAI; and, (2) CM and CV matrix carry 50 Ti excesses of about 2 ε-units. The distribution of Ti isotopic anomalies among matrix, chondrules, and CAIs suggests a model in which all three constituents formed from precursor-assemblages in which some chemical memories were still intact; the isotopic differences reflect fractionations among the carrier phases of the different isotopic components. Chondrules formed by a mostly closed-system melting of their precursors, and thus provide a recording of the extent of nebular heterogeneity on the mg-size scale. The larger anomalies in CAIs, compared to matrix and most (but not all) chondrules, are attributed primarily to an open- rather than closed-system processing of the CAI precursors. Precursors of both FUN and normal CAIs experienced an episode of intense processing, perhaps partial melting, that created the FUN characteristics, but for normal CAIs the FUN effects were erased by subsequent isotopic equilibration and exchange
Condomless anal intercourse among males and females at high risk for heterosexual HIV infection
German, Danielle; Nguyen, Trang; Ogbue, Christine Powell; Flynn, Colin
2015-01-01
Background Understanding and addressing heterosexual HIV transmission requires attention to the range and context of heterosexual sexual behaviors. We sought to determine population-based prevalence of condomless anal intercourse (CAI) among individuals at increased heterosexual HIV risk in Baltimore and to identify demographic, behavioral, and health related correlates. Methods Data were from a cross-sectional study of 185 males and 198 females at increased heterosexual risk for HIV recruited using respondent driven sampling as part of CDC's National HIV Behavioral Surveillance Project in Baltimore, August-December 2010. Bivariate and multivariate logistic regression examined factors associated with heterosexual CAI. Results The sample was majority African-American, with mean age of 38 among men and 34 among women. Forty-two percent of men (95% C.I.: 30.9, 52.0%) and 38% of women (95% C.I.: 29.4, 47.2%) reported any CAI in the past year, with variance by partner type and gender. Among men, CAI was significantly associated with homelessness, casual and exchange partners, same sex partner in past year, and substance use. Among women, CAI was significantly associated with lower education, casual and exchange partners, same sex partner in past year, multiple partners, and substance use. In adjusted gender-specific models, males and females with increasing numbers of partners were more likely to engage in CAI. Conclusions It is important to recognize the efficiency of transmission of HIV and other STIs through CAI. There is a need to broaden heterosexual sexual health promotion and HIV/STI prevention to adequately and appropriately address risks and prevention strategies for anal intercourse. PMID:25970308
Developing a Framework for Ankle Function: A Delphi Study
Snyder, Kelli R.; Evans, Todd A.; Neibert, Peter J.
2014-01-01
Context: Addressing clinical outcomes is paramount to providing effective health care, yet there is no consensus regarding the appropriate outcomes to address after ankle injuries. Compounding the problem is the repetitive nature of lateral ankle sprains, referred to as functional (FAI) or chronic (CAI) ankle instability. Although they are commonly used terms in practice and research, FAI and CAI are inconsistently defined and assessed. Objective: To establish definitions of a healthy/normal/noninjured ankle, FAI, and CAI, as well as their characteristics and assessment techniques. Design: Delphi study. Setting: Telephone interviews and electronic surveys. Patients or Other Participants: Sixteen experts representing the fields of ankle function and treatment, ankle research, and outcomes assessment and research were selected as panelists. Data Collection and Analysis: A telephone interview produced feedback regarding the definition of, functional characteristics of, and assessment techniques for a healthy/normal/noninjured ankle, an unhealthy/acutely injured ankle, and FAI/CAI. Those data were compiled, reduced, and returned through electronic surveys and were either included by reaching consensus (80% agreement) or excluded. Results: The definitions of a healthy/normal/noninjured ankle and FAI reached consensus. Experts did not agree on a definition of CAI. Eleven functional characteristics of a healthy/normal/noninjured ankle, 32 functional characteristics of an unhealthy/acutely injured ankle, and 13 characteristics of FAI were agreed upon. Conclusions: Although a consensus was reached regarding the definitions and functional characteristics of a healthy/normal/noninjured ankle and FAI, the experts could only agree on 1 characteristic to include in the FAI definition. Several experts did, however, provide additional comments that reinforced the differences in the interpretation of those concepts. Although the experts could not agree on the definition of CAI, its
Zelasko, Nancy; Antunez, Beth
This guide, in English, Spanish, and Vietnamese, aims to inform parents of students who have learned or are learning English as a Second Language about appropriate approaches for educating children so that they can work with schools to ensure a high quality education for their children. The emphasis is on explaining the laws, schools, and research…
Chronic Ankle Instability and Neural Excitability of the Lower Extremity.
McLeod, Michelle M; Gribble, Phillip A; Pietrosimone, Brian G
2015-08-01
Neuromuscular dysfunction of the leg and thigh musculature, including decreased strength and postural control, is common in patients with chronic ankle instability (CAI). Understanding how CAI affects specific neural pathways may provide valuable information for targeted therapies. To investigate differences in spinal reflexive and corticospinal excitability of the fibularis longus and vastus medialis between limbs in patients with unilateral CAI and between CAI patients and participants serving as healthy controls. Case-control study. Research laboratory. A total of 56 participants volunteered, and complete data for 21 CAI patients (9 men, 12 women; age = 20.81 ± 1.63 years, height = 171.57 ± 11.44 cm, mass = 68.84 ± 11.93 kg) and 24 healthy participants serving as controls (7 men, 17 women; age = 22.54 ± 2.92 years, height = 172.35 ± 10.85 cm, mass = 69.15 ± 12.30 kg) were included in the final analyses. Control participants were matched to CAI patients on sex, age, and limb dominance. We assigned "involved" limbs, which corresponded with the involved limbs of the CAI patients, to control participants. Spinal reflexive excitability was assessed via the Hoffmann reflex and normalized to a maximal muscle response. Corticospinal excitability was assessed using transcranial magnetic stimulation. Active motor threshold (AMT) was defined as the lowest transcranial magnetic stimulation intensity required to elicit motor-evoked potentials equal to or greater than 100 μV in 5 of 10 consecutive stimuli. We obtained motor-evoked potentials (MEPs) at percentages ranging from 100% to 140% of AMT. Fibularis longus MEP amplitudes were greater in control participants than in CAI patients bilaterally at 100% AMT (control involved limb: 0.023 ± 0.031; CAI involved limb: 0.014 ± 0.008; control uninvolved limb: 0.021 ± 0.022; CAI uninvolved limb: 0.015 ± 0.007; F1,41 = 4.551, P = .04) and 105% AMT (control involved limb: 0.029 ± 0.026; CAI involved limb: 0.021 ± 0
Kim, Kyung-Min; Hart, Joseph M.; Saliba, Susan A.; Hertel, Jay
2016-01-01
Context: Individuals with chronic ankle instability (CAI) present with decreased modulation of the Hoffmann reflex (H-reflex) from a simple to a more challenging task. The neural alteration is associated with impaired postural control, but the relationship has not been investigated in individuals with CAI. Objective: To determine differences in H-reflex modulation and postural control between individuals with or without CAI and to identify if they are correlated in individuals with CAI. Design: Descriptive laboratory study. Setting: Laboratory. Patients or Other Participants: A total of 15 volunteers with CAI (9 males, 6 females; age = 22.6 ± 5.8 years, height = 174.7 ± 8.1 cm, mass = 74.9 ± 12.8 kg) and 15 healthy sex-matched volunteers serving as controls (9 males, 6 females; age = 23.8 ± 5.8 years, height = 171.9 ± 9.9 cm, mass = 68.9 ± 15.5 kg) participated. Intervention(s): Maximum H-reflex (Hmax) and motor wave (Mmax) from the soleus and fibularis longus were recorded while participants lay prone and then stood in unipedal stance. We assessed postural tasks of unipedal stance with participants' eyes closed for 10 seconds using a forceplate. Main Outcome Measure(s): We normalized Hmax to Mmax to obtain Hmax : Mmax ratios for the 2 positions. For each muscle, H-reflex modulation was quantified using the percentage change scores in Hmax : Mmax ratios calculated from prone position to unipedal stance. Center-of-pressure data were used to compute 4 time-to-boundary variables. Separate independent-samples t tests were performed to determine group differences. Pearson product moment correlation coefficients were calculated between the modulation and balance measures in the CAI group. Results: The CAI group presented less H-reflex modulation in the soleus (t26 = −3.77, P = .001) and fibularis longus (t25 = −2.59, P = .02). The mean of the time-to-boundary minima in the anteroposterior direction was lower in the CAI group (t28 = −2.06, P = .048
Evolution of Ca-Al-rich bodies in the earliest solar system: growth by incorporation
International Nuclear Information System (INIS)
Wark, D.A.; Lovering, J.F.
1982-01-01
Many Type B Ca-Al-rich inclusions (CAI's) in the Allende carbonaceous chondrite contain two types of spinel structures, 'framboids' and 'palisades'. Framboids are clumps of spinel grains generally < 100 μm across. Experimental studies show that they probably formed in situ by solid state growth processes. Palisades are texturally different and consist of ovoid shells of spinel grains that appear in thin sections as long arcs or rings with diameters ranging from approx. 50 μm up to 2 cm. No in situ formation process seems able to explain the variety of sizes and morphologies of palisades nor the different compositions and textures of the enclosed and enclosing materials. We therefore suggest that palisades are the spinel rims of smaller, earlier-formed Type B CAI's that were incorporated into other CAI material in various ways - by capture into liquid drops, by solid condensate overgrowths and by the partial melting or welding of agglomerates containing the bodies. As some Type B bodies have been found inside Type A host material it appears that in at least some regions, and probably generally, Type A CAI's formed after Type B. Proposals are made concerning the origin of the CAI material. (author)
Song, Kyeongtak; Kang, Tae Kyu; Wikstrom, Erik A; Jun, Hyung-Pil; Lee, Sae Yong
2017-10-01
The purpose of this study was to determine how reduced plantar cutaneous sensation influences static postural control in individuals with and without CAI. A case-control study design. Twenty-six individuals with self-reported CAI and 26 matched healthy controls participated in this study. The plantar aspect of the participants' foot was then submersed in ice water (0°C) for 10min to reduce plantar sensation. Before and after the cooling procedure, plantar cutaneous sensation thresholds and single leg balance with eyes open and closed were assessed. Significantly, higher scores were observed in both groups after ice water submersion (ppostural control improvement in both groups post-cooling. In single limb balance with eyes closed, Group×Intervention interactions were observed for the TTB AP mean (p=0.003) and TTB AP SD (p=0.017); indicating postural control deficits in CAI group post-cooling, but no changes in the control group. The main finding of this study was that reduced plantar cutaneous sensation induced by an ice submersion procedure caused eyes closed postural control impairments in those with CAI but not healthy controls. The present investigation demonstrated that the ability to dynamically reweight among sensory inputs to maintain postural stability appears to be diminished in CAI patients compared to healthy controls. Copyright © 2016. Published by Elsevier Ltd.
Härtl, Roger; Alimi, Marjan; Abdelatif Boukebir, Mohamed; Berlin, Connor D; Navarro-Ramirez, Rodrigo; Arnold, Paul M; Fehlings, Michael G; Mroz, Thomas E; Riew, K Daniel
2017-04-01
Retrospective study and literature review. To provide more comprehensive data about carotid artery injury (CAI) or cerebrovascular accident (CVA) related to anterior cervical spine surgery. We conducted a retrospective, multicenter, case series study involving 21 high-volume surgical centers from the AOSpine North America Clinical Research Network. Medical records of 17 625 patients who went through cervical spine surgery (levels from C2 to C7) between January 1, 2005, and December 31, 2011, were analyzed. Also, we performed a literature review using Medline and PubMed databases. The following terms were used alone, and in combination, to search for relevant articles: cervical, spine, surgery, complication, iatrogenic, carotid artery, injury, cerebrovascular accident, CVA, and carotid stenosis. Among 17 625 patients that were analyzed, no cases were reported to experienced CAI or CVA after cervical spine surgery. Nevertheless, in our PubMed search we found 157 articles, but only 5 articles matched our study objective criteria; 2 cases were reported to present CAI and 3 cases presented CVA. CAI and CVA related to anterior cervical spine surgeries are extremely rare. We were not able to find neither in our retrospective study nor in our literature research a correlation between the type or length of anterior cervical spine procedure with CVA or CAI complications. However, surgeons should be aware of the possibility of vascular complications and minimize intraoperative direct vascular manipulations or retraction. Preoperative screening for underlying vascular pathology and risk factors is also important.
Pionnier, Raphaël; Découfour, Nicolas; Barbier, Franck; Popineau, Christophe; Simoneau-Buessinger, Emilie
2016-03-01
The purpose of this study was to quantitatively and qualitatively assess dynamic balance with accuracy in individuals with chronic ankle instability (CAI). To this aim, a motion capture system was used while participants performed the Star Excursion Balance Test (SEBT). Reached distances for the 8 points of the star were automatically computed, thereby excluding any dependence to the experimenter. In addition, new relevant variables were also computed, such as absolute time needed to reach each distance, lower limb ranges of motion during unipodal stance, as well as absolute error of pointing. Velocity of the center of pressure and range of variation of ground reaction forces have also been assessed during the unipodal phase of the SEBT thanks to force plates. CAI group exhibited smaller reached distances and greater absolute error of pointing than the control group (p<0.05). Moreover, the ranges of motion of lower limbs joints, the velocity of the center of pressure and the range of variation of the ground reaction forces were all significantly smaller in the CAI group (p<0.05). These reduced quantitative and qualitative performances highlighted a lower dynamic postural control. The limited body movements and accelerations during the unipodal stance in the CAI group could highlight a protective strategy. The present findings could help clinicians to better understand the motor strategies used by CAI patients during dynamic balance and may guide the rehabilitation process. Copyright © 2016 Elsevier B.V. All rights reserved.
Bączkowicz, Dawid; Falkowski, Krzysztof; Majorczyk, Edyta
2017-08-01
Study Design Controlled laboratory study, cross-sectional. Background Lateral ankle sprains are among the most common injuries encountered during athletic participation. Following the initial injury, there is an alarmingly high risk of reinjury and development of chronic ankle instability (CAI), which is dependent on a combination of factors, including sensorimotor deficits and changes in the biomechanical environment of the ankle joint. Objective To evaluate CAI-related disturbances in arthrokinematic motion quality and postural control and the relationships between them. Methods Sixty-three male subjects (31 with CAI and 32 healthy controls) were enrolled in the study. For arthrokinematic motion quality analysis, the vibroarthrographic signals were collected during ankle flexion/extension motion using an acceleration sensor and described by variability (variance of mean squares [VMS]), amplitude (mean of 4 maximal and 4 minimal values [R4]), and frequency (vibroarthrographic signal bands of 50 to 250 Hz [P1] and 250 to 450 Hz [P2]) parameters. Using the Biodex Balance System, single-leg dynamic balance was measured by overall, anteroposterior, and mediolateral stability indices. Results Values of vibroarthrographic parameters (VMS, R4, P1 and P2) were significantly higher in the CAI group than those in the control group (Pankle arthrokinematic motion and postural control were present. Therefore, physical therapy interventions focused on improving ankle neuromuscular control and arthrokinematic function are necessary in CAI patient care. J Orthop Sports Phys Ther 2017;47(8):570-577. Epub 4 Nov 2016. doi:10.2519/jospt.2017.6836.
Hip strength and star excursion balance test deficits of patients with chronic ankle instability.
McCann, Ryan S; Crossett, Ian D; Terada, Masafumi; Kosik, Kyle B; Bolding, Brenn A; Gribble, Phillip A
2017-11-01
To examine isometric hip strength in those with and without CAI, and determine the degree of Star Excursion Balance Test (SEBT) variance explained by isometric hip strength. Single-blinded, cross-sectional, case-control study. Thirty individuals with CAI, 29 lateral ankle sprain (LAS) copers, and 26 healthy controls participated. We assessed dynamic postural control with the SEBT anterior (SEBT-ANT), posteromedial (SEBT-PM), and posterolateral (SEBT-PL) reaches, and isometric hip extension (EXT), abduction (ABD) and external rotation (ER) strength with hand-held dynamometry. The CAI and LAS coper groups' involved limbs and randomly selected limbs in controls were tested. Separate Kruskal-Wallis tests compared SEBT scores and isometric hip strength between groups. Backwards linear regression models determined the degree of SEBT variance explained by isometric hip strength. Statistical significance was set a priori at Phip strength compared to LAS copers and controls. Additionally, the CAI group's isometric hip strength significantly influenced dynamic postural control performance. Future CAI rehabilitation strategies should consider hip muscular strengthening to facilitate improvements in dynamic postural control. Copyright © 2017 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.
Effectiveness of Using Computer-Assisted Supplementary Instruction for Teaching the Mole Concept
Yalçinalp, Serpil; Geban, Ömer; Özkan, Ilker
This study examined the effect of computer-assisted instruction (CAI), used as a problem-solving supplement to classroom instruction, on students' understanding of chemical formulas and mole concept, their attitudes toward chemistry subjects, and CAI. The objective was to assess the effectiveness of CAI over recitation hours when both teaching methods were used as a supplement to the traditional chemistry instruction. We randomly selected two classes in a secondary school. Each teaching strategy was randomly assigned to one class. The experimental group received supplementary instruction delivered via CAI, while the control group received similar instruction through recitation hours. The data were analyzed using two-way analysis of variance and t-test. It was found that the students who used the CAI accompanied with lectures scored significantly higher than those who attended recitation hours, in terms of school subject achievement in chemistry and attitudes toward chemistry subjects. In addition, there was a significant improvement in the attitudes of students in the experimental group toward the use of computers in a chemistry course. There was no significant difference between the performances of females versus males in each treatment group.Received: 26 April 1994; Revised: 6 April 1995;
Energy Technology Data Exchange (ETDEWEB)
Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang, E-mail: hart.chen@bristol.ac.uk [Institute of Earth Sciences, Academia Sinica, Taipei, Taiwan, ROC (China)
2015-06-10
Precise determinations of {sup 48}Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive {sup 48}Ca/{sup 44}Ca anomalies in all analyzed CAIs after normalization to {sup 42}Ca/{sup 44}Ca, and it is clearly shown that there is no simple correlation between {sup 48}Ca/{sup 44}Ca and {sup 50}Ti/{sup 48}Ti anomalies, in agreement with Jungck et al. Compared to the {sup 48}Ca/{sup 44}Ca versus {sup 50}Ti/{sup 48}Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated {sup 50}Ti/{sup 48}Ti. Assuming the {sup 48}Ca/{sup 44}Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess {sup 50}Ti anomalies in CAIs can be calculated by subtracting the part associated with {sup 48}Ca/{sup 44}Ca. These excesses show a linear correlation with {sup 138}La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system {sup 48}Ca, {sup 50}Ti, and {sup 138}La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II.
CORRELATION OF 48Ca, 50Ti, AND 138La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS
International Nuclear Information System (INIS)
Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang
2015-01-01
Precise determinations of 48 Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive 48 Ca/ 44 Ca anomalies in all analyzed CAIs after normalization to 42 Ca/ 44 Ca, and it is clearly shown that there is no simple correlation between 48 Ca/ 44 Ca and 50 Ti/ 48 Ti anomalies, in agreement with Jungck et al. Compared to the 48 Ca/ 44 Ca versus 50 Ti/ 48 Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated 50 Ti/ 48 Ti. Assuming the 48 Ca/ 44 Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess 50 Ti anomalies in CAIs can be calculated by subtracting the part associated with 48 Ca/ 44 Ca. These excesses show a linear correlation with 138 La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system 48 Ca, 50 Ti, and 138 La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II
Controlled air incineration of hazardous chemical and mixed waste at Los Alamos
International Nuclear Information System (INIS)
Borduin, L.C.; Hutchins, D.A.; Vavruska, J.J.; Warner, C.L.
1987-01-01
The Los Alamos National Laboratory (LANL) Controlled Air Incineration (CAI) system, originally developed for transuranic (TRU) waste volume reduction studies, is currently being qualified for hazardous chemical and mixed waste treatment under provisions of the Resource Conservation and Recovery Act (RCRA). The objective is to obtain a permanent RCRA Part B permit for thermal disposal of hazardous and mixed wastes generated by LANL. Constructed in the mid-1970s as a demonstration project for incineration of TRU solid wastes, the CAI process was substantially modified and tested in 1980-1983 for acceptance of both liquid and solid hazardous chemicals. Successful demonstration of TRU solid waste processing objectives in 1979 and later chemical waste incineration studies have been documented in several publications. In 1984, the LANL CAI became the first US Dept. of Energy (DOE) incinerator to be permitted for polychlorinated biphenyl disposal under the Toxic Substances Control Act. Following establishment of Environmental Protection Agency (EPA) jurisdiction over DOE chemical waste management in 1984, LANL sought and was granted interim status for the CAI and applied for a trial burn permit in the overall laboratory RCRA Part B application. A trial burn and final report have been completed; results have been submitted to EPA and the New Mexico Environmental Improvement Division. This paper provides an overview of trial burn planning and results together with the operational status of LANL's CAI
Needham, A. W.; Messenger, S.
2013-01-01
Calcium, Aluminum-rich inclusions (CAIs) are composed of the suite of minerals predicted to be the first to condense from a cooling gas of solar composition [1]. Yet, the first phase to condense, corundum, is rare in CAIs, having mostly reacted to form hibonite followed by other phases at lower temperatures. Many CAIs show evidence of complex post-formational histories, including condensation, evaporation, and melting [e.g. 2, 3]. However, the nature of these thermal events and the nebular environments in which they took place are poorly constrained. Some corundum and corundum-hibonite grains appear to have survived or avoided these complex CAI reprocessing events. Such ultra-refractory CAIs may provide a clearer record of the O isotopic composition of the Sun and the evolution of the O isotopic composition of the planet-forming region [4-6]. Here we present in situ O and Mg isotopic analyses of two corundum/hibonite inclusions that record differing formation histories.
SOLAR WIND IMPLANTATION MODEL FOR 10Be IN CALCIUM-ALUMINUM INCLUSIONS
International Nuclear Information System (INIS)
Bricker, Glynn E.; Caffee, Marc W.
2010-01-01
We propose a model for the incorporation of 10 Be within calcium-aluminum inclusions (CAIs) in primitive carbonaceous meteorites. In this model, 10 Be is produced by energetic particle reactions in the proto-solar atmosphere of a more active proto-Sun characterized by energetic particle fluxes higher than contemporary particle fluxes. This 10 Be is incorporated into the solar wind that is then implanted into CAI precursor material. This production mechanism is operational in the contemporary solar system implanting 10 Be in lunar materials. The contemporary production rate of 10 Be at the surface of the Sun is ∼0.1 10 Be cm -2 s -1 . Scaling up the contemporary 10 Be production in the proto-Sun by a factor of 10 5 would increase the production rate to 10 410 Be cm -2 s -1 . Using this enhanced production value in conjunction with refractory mass inflow rates at 0.06 AU from the proto-Sun we model 10 Be concentrations in CAI precursors. We calculate the content of solar-wind-implanted 10 Be would have been of the order of 10 1210 Be g -1 in CAIs, consistent with initial 10 Be content found from boron-beryllium isotopic systematics in CAIs.
Normalization of Impact Energy by Laminate Thickness for Compression After Impact Testing
Nettles, A. T.; Hromisin, S. M.
2013-01-01
The amount of impact energy used to damage a composite laminate is a critical parameter when assessing residual strength properties. The compression after impact (CAI) strength of impacted laminates is dependent upon how thick the laminate is and this has traditionally been accounted for by normalizing (dividing) the impact energy by the laminate's thickness. However, when comparing CAI strength values for a given lay-up sequence and fiber/resin system, dividing the impact energy by the specimen thickness has been noted by the author to give higher CAI strength values for thicker laminates. A study was thus undertaken to assess the comparability of CAI strength data by normalizing the impact energy by the specimen thickness raised to a power to account for the higher strength of thicker laminates. One set of data from the literature and two generated in this study were analyzed by dividing the impact energy by the specimen thickness to the 1, 1.5, 2, and 2.5 powers. Results show that as laminate thickness and damage severity decreased, the value which the laminate thickness needs to be raised to in order to yield more comparable CAI data increases.
Geiger, Ashley M; Pitts, Kenneth P; Feldkamp, Joachim; Kirschbaum, Clemens; Wolf, Jutta M
2015-11-01
Chronic adrenal insufficiency (CAI) is characterized by a lack of glucocorticoid and mineralocorticoid production due to destroyed adrenal cortex cells. However, elevated cortisol secretion is thought to be a central part in a well-orchestrated immune response to stress. This raises the question to what extent lack of cortisol in CAI affects stress-related changes in immune processes. To address this question, 28 CAI patients (20 females) and 18 healthy individuals (11 females) (age: 44.3 ± 8.4 years) were exposed to a psychosocial stress test (Trier Social Stress Test: TSST). Half the patients received a 0.03 mg/kg body weight injection of hydrocortisone (HC) post-TSST to mimic a healthy cortisol stress response. Catecholamines and immune cell composition were assessed in peripheral blood and free cortisol measured in saliva collected before and repeatedly after TSST. CAI patients showed norepinephrine (NE) stress responses similar to healthy participants, however, epinephrine (E) as well as cortisol levels were significantly lower. HC treatment post-TSST resulted in cortisol increases comparable to those observed in healthy participants (interaction effects--NE: F=1.05, p=.41; E: F=2.56, p=.045; cortisol: F=13.28, pcortisol's central involvement in post-stress lymphocyte migration from blood into immune-relevant body compartments. As such, future studies should investigate whether psychosocial stress exposure may put CAI patients at an increased health risk due to attenuated immune responses to pathogens. Copyright © 2015. Published by Elsevier Inc.
Psychological outcomes and gender-related development in complete androgen insensitivity syndrome.
Hines, Melissa; Ahmed, S Faisal; Hughes, Ieuan A
2003-04-01
We evaluated psychological outcomes and gender development in 22 women with complete androgen insensitivity syndrome (CAIS). Participants were recruited through a medical database (n = 10) or through a patient support group (n = 12). Controls included 14 males and 33 females, of whom 22 were matched to women with CAIS for age, race, and sex-of-rearing. Outcome measures included quality of life (self-esteem and psychological general well-being), gender-related psychological characteristics (gender identity, sexual orientation, and gender role behavior in childhood and adulthood), marital status, personality traits that show sex differences, and hand preferences. Women recruited through the database versus the support group did not differ systematically, and there were no statistically significant differences between the 22 women with CAIS and the matched controls for any psychological outcome. These findings argue against the need for two X chromosomes or ovaries to determine feminine-typical psychological development in humans and reinforce the important role of the androgen receptor in influencing masculine-typical psychological development. They also suggest that psychological outcomes in women with CAIS are similar to those in other women. However, additional attention to more detailed aspects of psychological well-being in CAIS is needed.
Directory of Open Access Journals (Sweden)
Denise M. Mota
2005-06-01
Full Text Available OBJETIVO: Descrever os hábitos miccionais e suas disfunções em uma amostra populacional de crianças de 3 a 9 anos. MÉTODOS: Delineamento transversal, incluindo 580 crianças. Uma amostra probabilística de domicílios da zona urbana da cidade de Pelotas (RS foi selecionada em múltiplos estágios. Os hábitos miccionais e fecais foram avaliados com o escore de disfunção miccional proposto por Farhat et al. e modificado pela equipe de pesquisa com acréscimo do sintoma freqüência urinária superior a oito vezes ao dia. Os meninos com pontuação maior que oito e as meninas com pontuação maior que cinco foram reavaliados clinicamente, assim como uma subamostra dos demais. RESULTADOS: Os sintomas miccionais mais freqüentes foram noctúria (60,4%, urgência miccional (49,7% e manobras de contenção (42,1%. A prevalência de enurese foi de 20,1% em meninos e 15,1% em meninas. A prevalência de disfunção miccional pelo escore Farhat et al. foi de 24,2%. A maioria dos sintomas foi mais freqüente entre as meninas e entre crianças mais jovens. As meninas de nível econômico baixo apresentaram maior freqüência de enurese e força para urinar, enquanto que, entre os meninos, a urgência miccional foi mais comum entre os mais pobres. Apenas 10,5% dos pais de crianças com disfunção haviam levado seu filho ao médico por causa dos sintomas. CONCLUSÕES: Os sintomas miccionais apresentam prevalências altas e devem ser investigados ativamente nas consultas de rotina, com perguntas diretas sobre cada sintoma isoladamente, objetivando o diagnóstico de disfunção miccional.OBJECTIVE: To describe voiding patterns and related dysfunctions in a population-based sample of children aged 3 to 9 years. METHODS: A cross-sectional population-based survey including 580 children. A probabilistic sample of households in the urban area of Pelotas in southern Brazil was selected following a multiple-stage protocol. Voiding and fecal patterns were
Existence of an 16O-rich gaseous reservoir in the solar nebula.
Krot, Alexander N; McKeegan, Kevin D; Leshin, Laurie A; MacPherson, Glenn J; Scott, Edward R D
2002-02-08
Carbonaceous chondrite condensate olivine grains from two distinct petrographic settings, calcium-aluminum-rich inclusion (CAI) accretionary rims and amoeboid olivine aggregates (AOAs), are oxygen-16 (16O) enriched at the level previously observed inside CAIs. This requires that the gas in the nebular region where these grains condensed was 16O-rich. This contrasts with an 16O-poor gas present during the formation of chondrules, suggesting that CAIs and AOAs formed in a spatially restricted region of the solar nebula containing 16O-rich gas. The 16O-rich gas composition may have resulted either from mass-independent isotopic chemistry or from evaporation of regions with enhanced dust/gas ratios, possibly in an X-wind environment near the young Sun.
Directory of Open Access Journals (Sweden)
S.M.A. Rahman
2014-11-01
Full Text Available Bangladesh is one the worst sufferers of climate change. Climate change awareness creation is pivotal to adaptation and mitigation strategies. Effective dissemination of knowledge among the citizens during high school years is crucial to that end. In Bangladesh, secondary school students follow common curricula which include entries on climate change. This paper investigates the role of the diverse demographic profiles and inherent scholastic background of students on their informedness. The research is based on responses from secondary schools students in Chittagong, Bangladesh. Based on their understanding of climate change, we have constructed the Climate Awareness Index (CAI. Then the relative roles of demographic determinants of the awareness have been compared using the CAI. The quality of schools, and grade, major and merit position of students have affected the CAI values. Besides, the study concluded that the religion, gender, parental education, occupation and income, etc. could affect students’ climate change informedness in Bangladesh.
Directory of Open Access Journals (Sweden)
YAN Shi
2017-12-01
Full Text Available The low-velocity impact and compression after impact (CAI properties of three-dimensional (3D five-directional carbon fiber/epoxy resin braided composites were experimentally investigated. Specimens prepared with different braiding angles were tested at the same impact energy level. Residual post-impact mechanical properties of the different configurations were characterized by compression after impact tests. Results show that the specimens with bigger braiding angle sustain higher peak loads, and smaller impact damage area, mainly attributes to a more compact space construction. The CAI strength and damage mechanism are found to be mainly dependent on the axial support of the braiding fiber tows. With the increase of braiding angle, the CAI strength decreases, and the damage mode of the composites is changed from transverse fracture to shear failure.
Los Alamos Controlled Air Incinerator for hazardous chemical and mixed radioactive wastes
International Nuclear Information System (INIS)
Vavruska, J.S.; Borduin, L.C.; Hutchins, D.A.; Koenig, R.A.; Warner, C.L.
1986-01-01
The Los Alamos Controlled Air Incinerator (CAI) is currently the only radioactive waste incineration facility in the US permitted to treat polychlorinated biphenyls (PCBs). The CAI was developed in the mid-1970's as a demonstration system for volume reduction of transuranic (TRU) contaminated combustible solid wastes. It has since undergone additions and modifications to accommodate hazardous chemical wastes in response to a need within the Department of Energy (DOE) to treat mixed radioactive/chemical wastes. An overview of these additions which include a liquid feed system, a high intensity liquid injection burner, and an activated carbon adsorption unit is presented here. Also included is a discussion of the procedures required for Toxic Substances Control Act (TSCA) and Resource Conservation and Recovery Act (RCRA) permitting of the CAI
Novel matrix resins for composites for aircraft primary structures, phase 1
Woo, Edmund P.; Puckett, P. M.; Maynard, S.; Bishop, M. T.; Bruza, K. J.; Godschalx, J. P.; Mullins, M. J.
1992-01-01
The objective of the contract is the development of matrix resins with improved processability and properties for composites for primarily aircraft structures. To this end, several resins/systems were identified for subsonic and supersonic applications. For subsonic aircraft, a series of epoxy resins suitable for RTM and powder prepreg was shown to give composites with about 40 ksi compressive strength after impact (CAI) and 200 F/wet mechanical performance. For supersonic applications, a thermoplastic toughened cyanate prepreg system has demonstrated excellent resistance to heat aging at 360 F for 4000 hours, 40 ksi CAI and useful mechanical properties at greater than or equal to 310 F. An AB-BCB-maleimide resin was identified as a leading candidate for the HSCT. Composite panels fabricated by RTM show CAI of approximately 50 ksi, 350 F/wet performance and excellent retention of mechanical properties after aging at 400 F for 4000 hours.
A First Look at Harm Toward Animals by Bahamians in Childhood
Directory of Open Access Journals (Sweden)
William J. Fielding
2011-05-01
Full Text Available This paper reports the first known study on childhood cruelty towards animals in The Bahamas. An internet survey involving 1,558 respondents allowed childhood cruelty, using the Children and Animals Inventory (CAI, to be investigated in the context of other violent behaviours in the child’s home. The homes of children who did no harm animals were less violent than the homes of children who harmed animals. Consistent with other studies, males were more likely to harm animals than females. Males were more likely than females to harm sentient animals. While the use of violence to train children was not associated with a higher CAI score, domestic violence and the presence of a gun in the home were associated with a higher CAI score. The implications of these findings as they relate to the treatment of living creatures are discussed.
The Discriminant Validity Of The Culture Assessment Instrument: A Comparison Of Company Cultures
Directory of Open Access Journals (Sweden)
Willie Du Toit
2003-11-01
Die doel van die studie was om die diskriminante geldigheid van die ‘Culture Assessment Instrument’ (CAI te beoordeel; dit is om tussen gemiddelde kultuurtellings van verskillende ondernemings te onderskei. Die geleentheidsteekproef het bestaan uit 4066 respondente uit vyf verskillende ondernemings afkomstig uit verskeie industrieë. CAI-tellings van 56 items is op twee vlakke gefaktoranaliseer, gevolg deur iteratiewe itemontledings. Beduidende verskille tussen ondernemings se gemiddelde kultuurtellings is gevind, maar slegs ’n klein proporsie van die variansie in die tellings kon aan kultuurverskille toegeskryf word. Gebaseer op hierdie bevindinge, is daar tot die slotsom gekom dat die CAI in sy huidige vorm nie oor diskriminante geldigheid beskik nie. Daar is aanbeveel dat items gerig op dieper kultuurvlakke, gebaseer op Schein se drievlaktipologie, tot die instrument gevoeg word.
A First Look at Harm Toward Animals by Bahamians in Childhood
Directory of Open Access Journals (Sweden)
Fielding, William J.
2011-10-01
Full Text Available This paper reports the first known study on childhood cruelty towards animals in The Bahamas. An internet survey involving 1,558 respondents allowed childhood cruelty, using the Children and Animals Inventory (CAI, to be investigated in the context of other violent behaviours in the child’s home. The homes of children who did no harm animals were less violent than the homes of children who harmed animals. Consistent with other studies, males were more likely to harm animals than females. Males were more likely than females to harm sentient animals. While the use of violence to train children was not associated with a higher CAI score, domestic violence and the presence of a gun in the home were associated with a higher CAI score. The implications of these findings as they relate to the treatment of living creatures are discussed.
Cryptanalysis on a modified Baptista-type cryptosystem with chaotic masking algorithm
International Nuclear Information System (INIS)
Chen Yong; Liao Xiaofeng
2005-01-01
Based on chaotic masking algorithm, an enhanced Baptista-type cryptosystem is proposed by Li et al. to resist all known attacks [S. Li, X. Mou, Z. Ji, J. Zhang, Y. Cai, Phys. Lett. A 307 (2003) 22; S. Li, G. Chen, K.-W. Wong, X. Mou, Y. Cai, Phys. Lett. A 332 (2004) 368]. In this Letter, we show that the second class bit extracting function in [S. Li, X. Mou, Z. Ji, J. Zhang, Y. Cai, Phys. Lett. A 307 (2003) 22] still leak partial information on the current chaotic state and reduce the security of cryptosystem. So, this type bit extracting function is not a good candidate for the masking algorithm
Evans, Rachel; Thirlwall, Kerstin; Cooper, Peter; Creswell, Cathy
2017-07-01
Questionnaires are widely used in routine clinical practice to assess treatment outcomes for children with anxiety disorders. This study was conducted to determine whether 2 widely used child and parent report questionnaires of child anxiety symptoms and interference (Spence Child Anxiety Scale [SCAS-C/P] and Child Anxiety Impact Scale [CAIS-C/P]) accurately identify recovery from common child anxiety disorder diagnoses as measured by a 'gold-standard' diagnostic interview. Three hundred thirty-seven children (7-12 years, 51% female) and their parents completed the ADIS-IV-C/P diagnostic interview and questionnaire measures (SCAS-C/P and CAIS-C/P) before (Time 1) and after (Time 2) treatment or wait-list. Time 2 parent reported interference (CAIS-P) was found to be a good predictor of absence of any diagnoses (area under the curve [AUC] = .81). In terms of specific diagnoses, Time 2 SCAS-C/P separation anxiety subscale (SCAS-C/P-SA) identified recovery from separation anxiety disorder well (SCAS-C-SA, AUC = .80; SCAS-P-SA, AUC = .82) as did the CAIS-P (AUC = .79). The CAIS-P also successfully identified recovery from social phobia (AUC = .78) and generalized anxiety disorder (AUC = .76). These AUC values were supported by moderate to good sensitivity (.70-.78) and specificity (.70-.73) at the best identified cut-off scores. None of the measures successfully identified recovery from specific phobia. The results suggest that questionnaire measures, particularly the CAIS-P, can be used to identify whether children have recovered from common anxiety disorders, with the exception of specific phobias. Cut-off scores have been identified that can guide the use of routine outcome measures in clinical practice. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Internet marketing directed at children on food and restaurant websites in two policy environments.
Kent, M Potvin; Dubois, L; Kent, E A; Wanless, A J
2013-04-01
Food and beverage marketing has been associated with childhood obesity yet little research has examined the influence of advertising policy on children's exposure to food/beverage marketing on the Internet. The purpose of this study was to assess the influence of Quebec's Consumer Protection Act and the self-regulatory Canadian Children's Food and Beverage Advertising Initiative (CAI) on food manufacturer and restaurant websites in Canada. A content analysis of 147 French and English language food and restaurant websites was undertaken. The presence of child-directed content was assessed and an analysis of marketing features, games and activities, child protection features, and the promotion of healthy lifestyle messages was then examined on those sites with child-directed content. There were statistically no fewer French language websites (n = 22) with child-directed content compared to English language websites (n = 27). There were no statistically significant differences in the number of the various marketing features, or in the average number of marketing features between the English and French websites. There were no fewer CAI websites (n = 14) with child-directed content compared to non-CAI websites (n = 13). The CAI sites had more healthy lifestyle messages and child protection features compared to the non-CAI sites. Systematic surveillance of the Consumer Protection Act in Quebec is recommended. In the rest of Canada, the CAI needs to be significantly expanded or replaced by regulatory measures to adequately protect children from the marketing of foods/beverages high in fat, sugar, and sodium on the Internet. Copyright © 2012 The Obesity Society.
Directory of Open Access Journals (Sweden)
Po-Cheng Chang
Full Text Available L-type calcium current reactivation plays an important role in development of early afterdepolarizations (EADs and torsades de pointes (TdP. Secondary intracellular calcium (Cai rise is associated with initiation of EADs.To test whether inhibition of sarcoplasmic reticulum (SR Ca2+ cycling suppresses secondary Cai rise and genesis of EADs.Langendorff perfusion and dual voltage and Cai optical mapping were conducted in 10 rabbit hearts. Atrioventricular block (AVB was created by radiofrequency ablation. After baseline studies, E4031, SR Ca2+ cycling inhibitors (ryanodine plus thapsigargin and nifedipine were then administrated subsequently, and the protocols were repeated.At baseline, there was no spontaneous or pacing-induced TdP. After E4031 administration, action potential duration (APD was significantly prolonged and the amplitude of secondary Cai rise was enhanced, and 7 (70% rabbits developed spontaneous or pacing-induced TdP. In the presence of ryanodine plus thapsigargin, TdP inducibility was significantly reduced (2 hearts, 20%, p = 0.03. Although APD was significantly prolonged (from 298 ± 30 ms to 457 ± 75 ms at pacing cycle length of 1000 m, p = 0.007 by ryanodine plus thapsigargin, the secondary Cai rise was suppressed (from 8.8 ± 2.6% to 1.2 ± 0.9%, p = 0.02. Nifedipine inhibited TdP inducibility in all rabbit hearts.In this AVB and long QT rabbit model, inhibition of SR Ca2+ cycyling reduces the inducibility of TdP. The mechanism might be suppression of secondary Cai rise and genesis of EADs.
Joung, Boyoung; Park, Hyung-Wook; Maruyama, Mitsunori; Tang, Liang; Song, Juan; Han, Seongwook; Piccirillo, Gianfranco; Weiss, James N; Lin, Shien-Fong; Chen, Peng-Sheng
2011-01-01
Anodal stimulation hyperpolarizes the cell membrane and increases the intracellular Ca(2+) (Ca(i)) transient. This study tested the hypothesis that the maximum slope of the Ca(i) decline (-(dCa(i)/dt)(max)) corresponds to the timing of anodal dip on the strength-interval curve and the initiation of repetitive responses and ventricular fibrillation (VF) after a premature stimulus (S(2)). We simultaneously mapped the membrane potential (V(m)) and Ca(i) in 23 rabbit ventricles. A dip in the anodal strength-interval curve was observed. During the anodal dip, ventricles were captured by anodal break excitation directly under the S(2) electrode. The Ca(i) following anodal stimuli is larger than that following cathodal stimuli. The S(1)-S(2) intervals of the anodal dip (203±10 ms) coincided with the -(dCa(i)/dt)(max) (199±10 ms, P=NS). BAPTA-AM (n=3), inhibition of the electrogenic Na(+)-Ca(2+) exchanger current (I(NCX)) by low extracellular Na(+) (n=3), and combined ryanodine and thapsigargin infusion (n=2) eliminated the anodal supernormality. Strong S(2) during the relative refractory period (n=5) induced 29 repetitive responses and 10 VF episodes. The interval between S(2) and the first non-driven beat was coincidental with the time of -(dCa(i)/dt)(max). Larger Ca(i) transient and I(NCX) activation induced by anodal stimulation produces anodal supernormality. The time of maximum I(NCX) activation is coincidental to the induction of non-driven beats from the Ca(i) sinkhole after a strong premature stimulation. All rights are reserved to the Japanese Circulation Society.
Gait kinematics of subjects with ankle instability using a multisegmented foot model.
De Ridder, Roel; Willems, Tine; Vanrenterghem, Jos; Robinson, Mark; Pataky, Todd; Roosen, Philip
2013-11-01
Many patients who sustain an acute lateral ankle sprain develop chronic ankle instability (CAI). Altered ankle kinematics have been reported to play a role in the underlying mechanisms of CAI. In previous studies, however, the foot was modeled as one rigid segment, ignoring the complexity of the ankle and foot anatomy and kinematics. The purpose of this study was to evaluate stance phase kinematics of subjects with CAI, copers, and controls during walking and running using both a rigid and a multisegmented foot model. Foot and ankle kinematics of 77 subjects (29 subjects with self-reported CAI, 24 copers, and 24 controls) were measured during barefoot walking and running using a rigid foot model and a six-segment Ghent Foot Model. Data were collected on a 20-m-long instrumented runway embedded with a force plate and a six-camera optoelectronic system. Groups were compared using statistical parametric mapping. Both the CAI and the coper group showed similar differences during midstance and late stance compared with the control group (P foot segment showed a more everted position during walking compared with the control group. Based on the Ghent Foot Model, the rear foot also showed a more everted position during running. The medial forefoot showed a more inverted position for both running and walking compared with the control group. Our study revealed significant midstance and late stance differences in rigid foot, rear foot, and medial forefoot kinematics The multisegmented foot model demonstrated intricate behavior of the foot that is not detectable with rigid foot modeling. Further research using these models is necessary to expand knowledge of foot kinematics in subjects with CAI.
Kinetic Compensations due to Chronic Ankle Instability during Landing and Jumping.
Kim, Hyunsoo; Son, S Jun; Seeley, Matthew K; Hopkins, J Ty
2018-02-01
Skeletal muscles absorb and transfer kinetic energy during landing and jumping, which are common requirements of various forms of physical activity. Chronic ankle instability (CAI) is associated with impaired neuromuscular control and dynamic stability of the lower extremity. Little is known regarding an intralimb, lower-extremity joint coordination of kinetics during landing and jumping for CAI patients. We investigated the effect of CAI on lower-extremity joint stiffness and kinetic and energetic patterns across the ground contact phase of landing and jumping. One hundred CAI patients and 100 matched able-bodied controls performed five trials of a landing and jumping task (a maximal vertical forward jump, landing on a force plate with the test leg only, and immediate lateral jump toward the contralateral side). Functional analyses of variance and independent t-tests were used to evaluate between-group differences for lower-extremity net internal joint moment, power, and stiffness throughout the entire ground contact phase of landing and jumping. Relative to the control group, the CAI group revealed (i) reduced plantarflexion and knee extension and increased hip extension moments; (ii) reduced ankle and knee eccentric and concentric power, and increased hip eccentric and concentric power, and (iii) reduced ankle and knee joint stiffness and increased hip joint stiffness during the task. CAI patients seemed to use a hip-dominant strategy by increasing the hip extension moment, stiffness, and eccentric and concentric power during landing and jumping. This apparent compensation may be due to decreased capabilities to produce sufficient joint moment, stiffness, and power at the ankle and knee. These differences might have injury risk and performance implications.
Simon, Janet; Hall, Emily; Docherty, Carrie
2014-01-01
Previous investigations have established that dancers suffer a large number of injuries to the lower leg, foot, and ankle, with a portion of these being significant time loss injuries or in some cases career ending. Lateral ankle sprain is a common injury in dancers and can often lead to recurrent instability and repetitive injuries. Research in other active populations has linked ankle sprains to the development of chronic ankle instability (CAI). Therefore, the purpose of this study was to identify the prevalence of CAI and related symptoms of ankle sprain in a student dance population. Individuals were included if they were currently a modern or ballet dance major at the investigators' university (exclusion criterion: a history of fracture or surgery in the lower extremities). A self-reported demographic questionnaire and the Identification of Functional Ankle Instability survey were used to identify the presence and characteristics of CAI. A total of 83 questionnaires were collected, and after exclusions, 77 participants remained: 43 modern dancers and 34 ballet dancers (10 males and 67 females, mean age 19.61 ± 2.53 years, mean dance experience 13.61 ± 3.16 years). Of all dancers surveyed, 41 (53.2%) had CAI, and of those 24 (58.5%) were modern dancers, and 17 (41.5%) were ballet dancers. When looking only at those dancers who had a previous lateral ankle sprain, 75.9% were identified as having CAI. Chronic Ankle Instability can create long-term problems for anyone but especially female dancers, who place extreme stress on their feet and ankles from being en pointe or demi-pointe. It is important to educate dancers, instructors, and medical staff of the importance of recognizing CAI and seeking medical care for ankle sprains and their residual symptoms.
Miranda-Casas, A; Marco-Taverner, R; Soriano-Ferrer, M; Melià de Alba, A; Simó-Casañ, P
2008-01-01
Different procedures have demonstrated efficacy to teach cognitive and metacognitive strategies to problem solving in mathematics. Some studies have used computer-based problem solving instructional programs. To analyze in students with learning disabilities the efficacy of a cognitive strategies training for problem solving, with three instructional delivery formats: a teacher-directed program (T-D), a computer-assisted instructional (CAI) program, and a combined program (T-D + CAI). Forty-four children with mathematics learning disabilities, between 8 and 10 years old participated in this study. The children were randomly assigned to one of the three instructional formats and a control group without cognitive strategies training. In the three instructional conditions which were compared all the students learnt problems solving linguistic and visual cognitive strategies trough the self-instructional procedure. Several types of measurements were used for analysing the possible differential efficacy of the three instructional methods implemented: solving problems tests, marks in mathematics, internal achievement responsibility scale, and school behaviours teacher ratings. Our findings show that the T-D training group and the T-D + CAI group improved significantly on math word problem solving and on marks in Maths from pre- to post-testing. In addition, the results indicated that the students of the T-D + CAI group solved more real-life problems and developed more internal attributions compared to both control and CAI groups. Finally, with regard to school behaviours, improvements in school adjustment and learning problems were observed in the students of the group with a combined instructional format (T-D + CAI).
Chang, Po-Cheng; Wo, Hung-Ta; Lee, Hui-Ling; Wen, Ming-Shien; Chou, Chung-Chuan
2015-07-01
Na(+)/Ca(2+) exchanger blockade has been reported to be anti-arrhythmic in different models. The effects of KB-R7943, a Na(+)/Ca(2+) exchanger blocker, on arrhythmogenesis in hearts with chronic myocardial infarction (MI) remain unclear. Dual voltage and intracellular Ca(2+) (Cai) optical mapping was performed in nine rabbit hearts with chronic MI and four control hearts. Electrophysiology studies including inducibility of ventricular tachyarrhythmias, ventricular fibrillation dominant frequency, action potential, Cai alternans, Cai decay, and conduction velocity were performed. The same protocol was repeated in the presence of KB-R7943 (0.5, 1, and 5μM) after the baseline studies. KB-R7943 was effective in suppressing afterdepolarizations and spontaneous ventricular tachyarrhythmias in hearts with chronic MI. Surprisingly, KB-R7943 increased the inducibility of ventricular tachyarrhythmias in a dose-dependent manner (11%, 11%, 22%, and 56% at baseline and with 0.5, 1, and 5μM KB-R7943, respectively, p=0.02). Optical mapping analysis revealed that the underlying mechanisms of the induced ventricular tachyarrhythmias were probably spatially discordant alternans with wave breaks and rotors. Further analysis showed that KB-R7943 significantly enhanced both action potential (p=0.033) and Cai (p=0.001) alternans, prolonged Cai decay (tau value) in a dose-dependent manner (p=0.004), and caused heterogeneous conduction delay especially at peri-infarct zones during rapid burst pacing. In contrast, KB-R7943 had insignificant effects in control hearts. In this chronic MI rabbit model, KB-R7943 has contrasting effects on arrhythmogenesis, suppressing afterdepolarizations and spontaneous ventricular tachyarrhythmias, but enhancing the inducibility of tachyarrhythmias. The mechanism is probably the enhanced spatially discordant alternans because of prolonged Cai decay and heterogeneous conduction delay. Copyright © 2014 Japanese College of Cardiology. Published by Elsevier
Complete Androgen Insensitivity Syndrome: A Rare Case of Disorder of Sex Development
Directory of Open Access Journals (Sweden)
Alfonsa Pizzo
2013-01-01
Full Text Available Androgen Insensitivity Syndrome (AIS could be considered as a disease that causes resistance to androgens actions, influencing both the morphogenesis and differentiation of the body structures, and systems in which this hormone exerts its effects. It depends on an X-linked mutations in the Androgen Receptor (AR gene that express a variety of phenotypes ranging from male infertility to completely normal female external genitalia. The clinical phenotypes of AIS could vary and be classified into three categories, as complete (CAIS, partial (PAIS, and mild (MAIS forms, according to the severity of androgen resistance. We will describe a case of CAIS in a 16-year-old patient.
Impact Characteristics of Candidate Materials for Single-Stage-to-Orbit (SSTO) Technology
Nettles, Alan
1995-01-01
Four fiber/resin systems were compared for resistance to damage and damage tolerance. One toughened epoxy and three toughened bismaleimide (BMI) resins were used., all with IM7 carbon fiber reinforcement. A statistical design of experiments technique was used to evaluate the effects of impact energy, specimen thickness and tup diameter on the damage area and residual compression-after-impact (CAI) strength. Results showed that two of the BMI systems sustained relatively large damage areas yet had an excellent retention of CAI strength.
International Nuclear Information System (INIS)
Neuls, A.S.; Draper, W.E.; Koenig, R.A.; Newmyer, J.M.; Warner, C.L.
1982-11-01
This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawings specifications, calculations, and costs. It aids duplication of the process at other facilities
International Nuclear Information System (INIS)
Neuls, A.S.; Draper, W.E.; Koenig, R.A.; Newmyer, J.M.; Warner, C.L.
1982-08-01
This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawing, specifications, calculations, and costs. It aids duplication of the process at other facilities
Recent developments on models and inclusion criteria for chronic ankle instability
Institute of Scientific and Technical Information of China (English)
Songning; Zhang
2012-01-01
<正>In the most recent report of injury data on 15 sports from the U.S.National Collegiate Athletic Association(NCAA) Injury Surveillance System over a span of 16 years (1988-2004),ankle ligament sprains were the most common injury.Residual symptoms such as recurrent sprains,pain, instability,and giving way are common after an initial,acute ligament sprain.Chronic ankle instability(CAI) is one of these common problems,and has enjoyed increased interest in the recent literature.However,CAI remains a poorly-defined and understood condition.
Lessons Learned from the ECML/PKDD Discovery Challenge on the Atherosclerosis Risk Factors Data
Czech Academy of Sciences Publication Activity Database
Berka, Petr; Rauch, Jan; Tomečková, Marie
2007-01-01
Roč. 26, č. 3 (2007), s. 329-344 ISSN 1335-9150 R&D Projects: GA MŠk(CZ) 1M06014; GA ČR GA201/05/0325 Grant - others:GA VŠE(CZ) 25/05 Institutional research plan: CEZ:AV0Z10300504 Keywords : atherosclerosis risk * data mining * discovery challenge Subject RIV: IN - Informatics, Computer Science Impact factor: 0.349, year: 2007 http://www.cai.sk/ojs/index.php/cai/article/view/313
Controlled air incinerator for radioactive waste. Volume II. Engineering design references manual
International Nuclear Information System (INIS)
Koenig, R.A.; Draper, W.E.; Newmyer, J.M.; Warner, C.L.
1982-11-01
This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawings, specifications, calculations, and costs. It aids duplication of the process at other facilities
The computer aided education and training system for accident management
International Nuclear Information System (INIS)
Yoneyama, Mitsuru; Kubota, Ryuji; Fujiwara, Tadashi; Sakuma, Hitoshi
1999-01-01
The education and training system for Accident Management was developed by the Japanese BWR group and Hitachi Ltd. The education and training system is composed of two systems. One is computer aided instruction (CAI) education system and the education and training system with computer simulations. Both systems are designed to be executed on personal computers. The outlines of the CAI education system and the education and training system with simulator are reported below. These systems provides plant operators and technical support center staff with the effective education and training for accident management. (author)
Energy Technology Data Exchange (ETDEWEB)
Koenig, R.A.; Draper, W.E.; Newmyer, J.M.; Warner, C.L.
1982-10-01
This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawings, specifications, calculations, and costs. It aids duplication of the process at other facilities.
Energy Technology Data Exchange (ETDEWEB)
Neuls, A.S.; Draper, W.E.; Koenig, R.A.; Newmyer, J.M.; Warner, C.L.
1982-08-01
This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawing, specifications, calculations, and costs. It aids duplication of the process at other facilities.
NCBI nr-aa BLAST: CBRC-PHAM-01-0677 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-0677 ref|NP_055456.2| mediator of DNA-damage checkpoint 1 [Homo sapien...tor with BRCT domains 1 emb|CAI17440.1| mediator of DNA damage checkpoint 1 [Homo sapiens] emb|CAI18195.1| mediator... of DNA damage checkpoint 1 [Homo sapiens] gb|EAX03321.1| mediator of DNA ...damage checkpoint 1 [Homo sapiens] emb|CAQ06814.1| mediator of DNA damage checkpoint 1 [Homo sapiens] emb|CAQ06770.1| mediator... of DNA damage checkpoint 1 [Homo sapiens] emb|CAQ07572.1| mediator of DNA damage checkpoi
Commercial incineration demonstration
International Nuclear Information System (INIS)
Vavruska, J.S.; Borduin, L.C.
1982-01-01
Low-level radioactive wastes (LLW) generated by nuclear utilities presently are shipped to commercial burial grounds for disposal. Increasing transportation and disposal costs have caused industry to consider incineration as a cost-effective means of volume reduction of combustible LLW. Repeated inquiries from the nuclear industry regarding the applicability of the Los Alamos controlled air incineration (CAI) design led the DOE to initiate a commercial demonstration program in FY-1980. Development studies and results in support of this program involving ion exchange resin incineration and fission/activation product distributions within the Los Alamos CAI are described
International Nuclear Information System (INIS)
Koenig, R.A.; Draper, W.E.; Newmyer, J.M.; Warner, C.L.
1982-10-01
This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawings, specifications, calculations, and costs. It aids duplication of the process at other facilities
Damage tolerance of candidate thermoset composites for use on single stage to orbit vehicles
Nettles, A. T.; Lance, D.; Hodge, A.
1994-01-01
Four fiber/resin systems were compared for resistance to damage and damage tolerance. One toughened epoxy and three toughened bismaleimide (BMI) resins were used, all with IM7 carbon fiber reinforcement. A statistical design of experiments technique was used to evaluate the effects of impact energy, specimen thickness, and impactor diameter on the damage area, as computed by C-scans, and residual compression-after-impact (CAI) strength. Results showed that two of the BMI systems sustained relatively large damage zones yet had an excellent retention of CAI strength.
International Nuclear Information System (INIS)
2011-12-01
As previous works performed by the CODIRPA proposed the creation of Centres for public reception and information (CAIs) within the population protection area, and as local groups have been created in three districts (Vienne, Haut-Rhin, Drome) to work on the preparation of the implementation of such centres, this report proposes a synthesis of these previous works, examines the doctrine related to the support to victims of collective accidents by the ministry of interior and by the ministry of justice, and finally makes recommendations and proposals for the implementation of CAIs in a post-accidental situation
International Nuclear Information System (INIS)
Limozin, Nicole; Filippi, Danielle; Dalmasso, Christiane; Laurent, Georgette
1979-01-01
A specific radioimmunoassay method for rat erythrocyte carbonic anhydrases I and II was developed using a double antibody system. Its sensitivity was in the nanogram range for each of the two isozymes. The method has been applied to the assay of cerebral carbonic anhydrase. Only CAII has been found in brain extracts of perfused rats. Accordingly, the assay of CAI in cerebral tissue can be used to quantify erythrocyte contamination on condition that the ratio CAII/CAI in blood had been worked out. The developmental change in the soluble and the Triton X-100 solubilized brain CAII from birth to adult is reported [fr
El Kissi, Yousri; Romdhane, Asma Ben; Hidar, Samir; Bannour, Souhail; Ayoubi Idrissi, Khadija; Khairi, Hedi; Ben Hadj Ali, Bechir
2013-04-01
To compare measures of psychological distress between men and women undergoing ART in the Unit of Reproductive Medicine "UMR" in the Department of Obstetrics and Gynecology at "Farhat Hached" Hospital in Sousse, Tunisia. We conducted a gender comparative study of psychological profile in infertile couples. Recruitment was done during period from January to May 2009. 100 infertile couples with primary infertility were recruited. Scores of general psychopathology, depression, anxiety and self-esteem were evaluated. We administrated questionnaires on psychological factors among infertile couples before starting a new infertility treatment cycle. Psychological factors included the symptom check-list (SCL-90-R), the hospital anxiety and depression scale (HAD-S) and the Rosenberg self-esteem scale (RSE). Infertile women had higher scores than their spouses in the three global scores of the SCL-90-R and in several items such as somatisation, obsessive symptoms, interpersonal sensitivity and phobias. Scores of HADS were higher among women for both depression and anxiety. Scores of self-esteem were lower among women. Women endorsed higher psychological distress than men across multiple symptoms domains: general psychopathology, anxiety, depression and self esteem. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Analysis of flexural wave cloaks
Directory of Open Access Journals (Sweden)
Alfonso Climente
2016-12-01
Full Text Available This work presents a comprehensive study of the cloak for bending waves theoretically proposed by Farhat et al. [see Phys. Rev. Lett. 103, 024301 (2009] and later on experimentally realized by Stenger et al. [see Phys. Rev. Lett. 108, 014301 (2012]. This study uses a semi-analytical approach, the multilayer scattering method, which is based in the Kirchoff-Love wave equation for flexural waves in thin plates. Our approach was unable to reproduce the predicted behavior of the theoretically proposed cloak. This disagreement is here explained in terms of the simplified wave equation employed in the cloak design, which employed unusual boundary conditions for the cloaking shell. However, our approach reproduces fairly well the measured displacement maps for the fabricated cloak, indicating the validity of our approach. Also, the cloak quality has been here analyzed using the so called averaged visibility and the scattering cross section. The results obtained from both analysis let us to conclude that there is room for further improvements of this type of flexural wave cloak by using better design procedures.
Healthcare-associated infections in a tunisian university hospital: from analysis to action
Mahjoub, Mohamed; Bouafia, Nebiha; Bannour, Waadia; Masmoudi, Tasnim; Bouriga, Rym; Hellali, Radhia; Cheikh, Asma Ben; Ezzi, Olfa; Abdeljellil, Amel Ben; Mansour, Njah
2015-01-01
Introduction Our study was conducted, in university hospital center (UHC) Farhat Hached of Sousse (city in Tunisian center-east), within healthcare-associated infections (HAI) epidemiological surveillance (ES) program, based, among others, on HAI regular prevalence surveys. Our objectives are to resituate HAI prevalence rate and to identify their risk factors (RF) in order to adjust, in our hospital, prevention programs. Methods It is a transversal descriptive study, including all patients who had been hospitalized for at least 48 hours, measuring prevalence of HAI a “given day”, with only one passage by service. Risk factors were determined using Epiinfo 6.0, by uni-varied analysis, then, logistic regression stepwise descending for the variables whose p Results The study focused on 312 patients. Infected patients prevalence was 12.5% and that of HAI was 14.5%. Infections on peripheral venous catheter (PVC) dominated (42.2%) among all HAI identified. HAI significant RF were neutropenia (p < 10−4) for intrinsic factors, and PVC for extrinsic factors (p = 0,003). Conclusion Predominance of infections on PVC should be subject of specific prevention actions, including retro-information strategy, prospective ES, professional practices evaluation and finally training and increasing awareness of health personnel with hygiene measures. Finally, development of a patient safety culture with personnel ensures best adherence to hygiene measures and HAI prevention. PMID:26113928
Directory of Open Access Journals (Sweden)
Ahlam Bouirane
2015-06-01
Full Text Available This study investigates the relationship between metacognitive language learning strategies (MLLS and gender and achievement of EFL students. Metacognitive language learning strategies are crucial for students of English as a foreign language to learn effectively. The theoretical issues discuss metacognitive language learning strategies in particular, and language learning strategies (LLS in general. The practical research took place at the English language department at Farhat Abbes University, Sétif, Algeria, with third year students learning English as a foreign language. The study hypothesized that there is a positive correlation between metacognitive language learning strategies use and achievement. Two main parts following a qualitative design constitute the body of the present research. The first part uses the Metacognitive Language Learning Strategies Questionnaire (MLLSQ to account for differences in the reported frequency of metacognitive strategies use across all the students, and across gender differences. The second part uses interviews to account for the use of these strategies at the individual level, in their relation to the students’ gender and achievement in language learning. The results of the first part revealed a significant use of metacognitive strategies among all the students and significant differences between male students and female students in the frequency of use of these strategies. Moreover, the results of the second part reflected more significant differences in the use of Metacognitive strategies at the level of gender and learning achievement. The study concludes by bringing together key findings and some suggestions for further research.
Directory of Open Access Journals (Sweden)
Maher Maoua
2018-06-01
Full Text Available Methyldibromoglutaronitrile (MDBGN is a preservative found in cosmetics as well as in products for industrial use. It caused an outbreak of allergic contact dermatitis in Europe in the 1990s and early 2000s. To assess the prevalence of MDBGN sensitization among consultants in the occupational dermato-allergology unit of Farhat Hached University Hospital in Sousse-Tunisia, we carried out a study of all cases of contact dermatitis to MDBGN confirmed by patch-tests from 1 January 2011 to 31 December 2015. The prevalence of allergic contact dermatitis to MDBGN was 4.5% of all cases of contact dermatitis recorded during the same period with an increase from 1.7% in 2011 to 5.4% in 2015. Associated allergens with contact dermatitis to MDBGN were the Peru balsam in 4 cases, nickel sulfate and kathon CG in 3 cases each. Contact dermatitis to Dibromodicyanobutane was associated with sensitization to other preservatives in 4 cases and cosmetic allergens in 6 cases. An increasing rates of sensitization are noticed in our region. The absence of legal restrictions regarding this preservative agent may explain an increase of its use in non-European countries.
A one-level FETI method for the drift–diffusion-Poisson system with discontinuities at an interface
Baumgartner, Stefan
2013-06-01
A 3d feti method for the drift-diffusion-Poisson system including discontinuities at a 2d interface is developed. The motivation for this work is to provide a parallel numerical algorithm for a system of PDEs that are the basic model equations for the simulation of semiconductor devices such as transistors and sensors. Moreover, discontinuities or jumps in the potential and its normal derivative at a 2d surface are included for the simulation of nanowire sensors based on a homogenized model. Using the feti method, these jump conditions can be included with the usual numerical properties and the original Farhat-Roux feti method is extended to the drift-diffusion-Poisson equations including discontinuities. We show two numerical examples. The first example verifies the correct implementation including the discontinuities on a 2d grid divided into eight subdomains. The second example is 3d and shows the application of the algorithm to the simulation of nanowire sensors with high aspect ratios. The Poisson-Boltzmann equation and the drift-diffusion-Poisson system with jump conditions are solved on a 3d grid with real-world boundary conditions. © 2013 Elsevier Inc..
Kirshner, David, Ed.
This PME-NA proceedings volume contains the full text of 41 research papers. In addition, brief usually one-page reports, are provided for 11 oral presentations and 13 poster sessions. The full research reports are as follows: "Cognitive Analysis of Chinese Students' Mathematical Problem Solving" (J. Cai and E. A. Silver); (2)…
Using Virtual Reality with and without Gaming Attributes for Academic Achievement
Vogel, Jennifer J.; Greenwood-Ericksen, Adams; Cannon-Bowers, Jan; Bowers, Clint A.
2006-01-01
A subcategory of computer-assisted instruction (CAI), games have additional attributes such as motivation, reward, interactivity, score, and challenge. This study used a quasi-experimental design to determine if previous findings generalize to non simulation-based game designs. Researchers observed significant improvement in the overall population…
Indian Academy of Sciences (India)
Jian Zeng and Shunv Cai. J. Biosci. 42(1), March 2017 © Indian Academy of Sciences. Supplementary material. Supplementary figure 1. Overexpression of miR-7 enhanced A549 cell apoptosis in response to BVP (100 µM). A TUNEL assay was performed according to the manufacturer's instructions (Promega Corporation, ...
Armour-Thomas, Eleanor; And Others
The effects of different types of feedback in computer assisted instruction (CAI) on relational concept learning by young children were compared in this study. Subjects were 89 kindergarten students whose primary language was English, and whose performance on the Boehm Test of Basic Concepts was within the average range chosen from classes in a…
Erratum: Back reaction, emission spectrum and entropy spectroscopy
Jiang, Qing-Quan; Cai, Xu
2012-06-01
In our paper [Qing-Quan Jiang and Xu Cai, Back reaction, emission spectrum and entropy spectroscopy, JHEP 11 (2010) 066], there was an error in using the first law of black hole thermodynamic and the Bohr-Sommerfeld quantization rule. In this erratum, we attempt to rectify them.
Enhanced Thermal Transport of Surfaces with Superhydrophobic Coatings
2015-07-01
resistance conferred by superhydrophobic fluorinated polyacrylate-silica composite coatings on cold-rolled steel. Journal of Applied Polymer Science... thiolates on metals as a form of nanotechnology. ChemInform. 2005:36. doi: 10.1002/chin.200532281. 9. Chen C-H, Cai Q, Tsai C, Chen C-L, Xiong G
Plasmonic and Magnetically Responsive Gold ShellMagnetic Nanorod Hybrids
2017-10-10
including bio -targeting/sensing,1,2 structural enhancement/health monitoring,3,4 and energy harvesting/storage.5,6 Typical approaches to achieve...Mirshahghassemi S, Ebner AD, Cai B, Lead JR, Application of high gradient magnetic separation for oil remediation using polymer-coated magnetic
Losco, C Dominique; Grant, William D; Armson, Anthony; Meyer, Amanda J; Walker, Bruce F
2017-03-01
Anatomy is a subject essential to medical practice, yet time committed to teaching is on the decline, and resources required to teach anatomy is costly, particularly dissection. Advances in technology are a potential solution to the problem, while maintaining the quality of teaching required for eventual clinical application. To identify methods used to teach anatomy, including those demonstrated to enhance knowledge acquisition and retention. PubMed, CINAHL, ERIC, Academic OneFile, ProQuest, SAGE journals and Scopus were search from the earliest entry of each database to 31 August 2015. All included articles were assessed for methodological quality and low quality articles were excluded from the study. Studies were evaluated by assessment scores, qualitative outcomes where included as well as a modified Kirkpatrick model. A total of 17,820 articles were initially identified, with 29 included in the review. The review found a wide variety of teaching interventions represented in the range of studies, with CAI/CAL studies predominating in terms of teaching interventions, followed by simulation. In addition to this, CAI/CAL and simulation studies demonstrated better results overall compared to traditional teaching methods and there is evidence to support CAI/CAL as a partial replacement for dissection or a valuable tool in conjunction with dissection. This review provides evidence in support of the use of alternatives to traditional teaching methods in anatomy, in particular, the use of CAI/CAL with a number of high quality, low risk of bias studies supporting this.
KAPSE (Kernel ADA Programming Support Environment) Interface Team Public Report. Volume 5.
1985-08-01
terination of a child . It was pointed out, .howmver, that CAIS processes are closely analogous to Ada programs, which may include nwiny tasks, so this...NMlc)) - Write a single haractesr end cojp; end PM;/ 5.3.8.10 Easing a qualified area pr~zocedueRSEA( PORN : in ont PO TYP); Purposes This procedure
CO self-shielding as the origin of oxygen isotope anomalies in the early solar nebula.
Lyons, J R; Young, E D
2005-05-19
The abundances of oxygen isotopes in the most refractory mineral phases (calcium-aluminium-rich inclusions, CAIs) in meteorites have hitherto defied explanation. Most processes fractionate isotopes by nuclear mass; that is, 18O is twice as fractionated as 17O, relative to 16O. In CAIs 17O and 18O are nearly equally fractionated, implying a fundamentally different mechanism. The CAI data were originally interpreted as evidence for supernova input of pure 16O into the solar nebula, but the lack of a similar isotope trend in other elements argues against this explanation. A symmetry-dependent fractionation mechanism may have occurred in the inner solar nebula, but experimental evidence is lacking. Isotope-selective photodissociation of CO in the innermost solar nebula might explain the CAI data, but the high temperatures in this region would have rapidly erased the signature. Here we report time-dependent calculations of CO photodissociation in the cooler surface region of a turbulent nebula. If the surface were irradiated by a far-ultraviolet flux approximately 10(3) times that of the local interstellar medium (for example, owing to an O or B star within approximately 1 pc of the protosun), then substantial fractionation of the oxygen isotopes was possible on a timescale of approximately 10(5) years. We predict that similarly irradiated protoplanetary disks will have H2O enriched in 17O and 18O by several tens of per cent relative to CO.
A WebGIS-Based Teaching Assistant System for Geography Field Practice (TASGFP)
Wang, Jiechen; Ni, Haochen; Rui, Yikang; Cui, Can; Cheng, Liang
2016-01-01
Field practice is an important part of training geography research talents. However, traditional teaching methods may not adequately manage, share and implement instruction resources and thus may limit the instructor's ability to conduct field instruction. A possible answer is found in the rapid development of computer-assisted instruction (CAI),…
NCBI nr-aa BLAST: CBRC-ACAR-01-0832 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0832 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-142 60% ...
NCBI nr-aa BLAST: CBRC-GGAL-06-0009 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-06-0009 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-152 65% ...
NCBI nr-aa BLAST: CBRC-CPOR-01-1682 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CPOR-01-1682 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 86% ...
NCBI nr-aa BLAST: CBRC-MMUS-19-0100 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-19-0100 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 90% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1073 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MEUG-01-1073 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor [Homo sapiens] emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-132 85% ...
NCBI nr-aa BLAST: CBRC-RMAC-09-0031 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RMAC-09-0031 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1521 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PVAM-01-1521 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor [Homo sapiens] emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 88% ...
NCBI nr-aa BLAST: CBRC-TGUT-09-0014 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-09-0014 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-144 67% ...
NCBI nr-aa BLAST: CBRC-CFAM-28-0009 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-28-0009 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 84% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-0531 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-0531 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 88% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0895 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0895 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 87% ...
NCBI nr-aa BLAST: CBRC-PTRO-11-0036 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-11-0036 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 98% ...
NCBI nr-aa BLAST: CBRC-HSAP-10-0037 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-10-0037 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-MDOM-01-0094 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-01-0094 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor [Homo sapiens] emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 75% ...
African Journals Online (AJOL)
Vol 11, No 33 (2012), Chemical modification of β-endoglucanase from Trichoderma viridin by methanol and determination of the catalytic functional groups, Abstract PDF. Feng Cai, Yangang Xie, Xiaochun He, Tiejun Li. Vol 11, No 51 (2012), Chemical, physical, microbiological and quality attributes studies on River Nile ...
2012-05-14
...'s Scallop Plan Development Team (PDT) meeting on January 5, 2012, staff from the Northeast Fisheries... area rotation program for future years. New Information Regarding Current Scallop Biomass Levels in CAI... this area is essential for the future success of area rotation to maximize yield and economic benefits...
Unsupervised MDP Value Selection for Automating ITS Capabilities
Stamper, John; Barnes, Tiffany
2009-01-01
We seek to simplify the creation of intelligent tutors by using student data acquired from standard computer aided instruction (CAI) in conjunction with educational data mining methods to automatically generate adaptive hints. In our previous work, we have automatically generated hints for logic tutoring by constructing a Markov Decision Process…
James Monroe High School Proyecto Nuevos Horizontes, 1986-1987. OEA Evaluation Report.
Martinez, Ana L.; And Others
In its second year of Title VII funding, James Monroe High Schools's Proyecto Nuevos Horizontes (Project New Horizons) served 344 limited-English-speaking recent arrivals from Latin America and the Caribbean, in grades 9 through 12. The program has built on the strengths of the high school's extensive computer-assisted instruction (CAI) program,…
Hiram-Bab, Sahar; Shapira, Yuval; Gershengorn, Marvin C; Oron, Yoram
2012-03-01
This study aimed to investigate whether the previously described differentiating islet-like aggregates of human pancreatic adenocarcinoma cells (PANC-1) develop glucose response and exhibit intercellular communication. Fura 2-loaded PANC-1 cells in serum-free medium were assayed for changes in cytosolic free calcium ([Ca]i) induced by depolarization, tolbutamide inhibition of K(ATP) channels, or glucose. Dye transfer, assayed by confocal microscopy or by FACS, was used to detect intercellular communication. Changes in messenger RNA (mRNA) expression of genes of interest were assessed by quantitative real-time polymerase chain reaction. Proliferation was assayed by the MTT method. Serum-deprived PANC-1 cell aggregates developed [Ca]i response to KCl, tolbutamide, or glucose. These responses were accompanied by 5-fold increase in glucokinase mRNA level and, to a lesser extent, of mRNAs for K(ATP) and L-type calcium channels, as well as increase in mRNA levels of glucagon and somatostatin. Trypsin, a proteinase-activated receptor 2 agonist previously shown to enhance aggregation, modestly improved [Ca]i response to glucose. Glucose-induced coordinated [Ca]i oscillations and dye transfer demonstrated the emergence of intercellular communication. These findings suggest that PANC-1 cells, a pancreatic adenocarcinoma cell line, can be induced to express a differentiated phenotype in which cells exhibit response to glucose and form a functional syncytium similar to those observed in pancreatic islets.
Soil water dynamics and evapotranspiration of forage cactus clones under rainfed conditions
Directory of Open Access Journals (Sweden)
Thieres George Freire da Silva
2015-07-01
Full Text Available Abstract: The objective of this work was to evaluate soil water dynamics in areas cultivated with forage cactus clones and to determine how environmental conditions and crop growth affect evapotranspiration. The study was conducted in the municipality of Serra Talhada, in the state of Pernambuco, Brazil. Crop growth was monitored through changes in the cladode area index (CAI and through the soil cover fraction, calculated at the end of the cycle. Real evapotranspiration (ET of the three evaluated clones was obtained as the residual term in the soil water balance method. No difference was observed between soil water balance components, even though the evaluated clones were of different genus and had different CAI increments. Accumulated ET was of 1,173 mm during the 499 days of the experiment, resulting in daily average of 2.35 mm. The CAI increases the water consumption of the Orelha de Elefante Mexicana clone. In dry conditions, the water consumption of the Miúda clone responds more slowly to variation in soil water availability. The lower evolution of the CAI of the IPA Sertânia clone, during the rainy season, leads to a higher contribution of the evaporation component in ET. The atmospheric demand controls the ET of clones only when there is higher soil water availability; in this condition, the water consumption of the Miúda clone decreases more rapidly with the increase of atmospheric demand.
Managing ankle ligament sprains and tears: current opinion
McGovern, Ryan P; Martin, RobRoy L
2016-01-01
The purpose of this paper is to present a current review of pathoanatomical features, differential diagnosis, objective assessment, intervention, and clinical course associated with managing lateral ankle ligament sprains. Proper diagnosis and identification of affected structures should be obtained through history and objective assessment. From this information, an individualized evidence-based intervention plan can be developed to enable recovery while decreasing the risk of reinjury. An appropriate evaluation is needed not only to determine the correct diagnosis but also to allow for grading and determining the prognosis of the injury in those with an acute lateral ankle sprain. Examination should include an assessment of impairments as well as a measure of activity and participation. Evidence-based interventions for those with an acute lateral ankle sprain should include weight bearing with bracing, manual therapy, progressive therapeutic exercises, and cryotherapy. For those with chronic ankle instability (CAI), interventions should include manual therapy and a comprehensive rehabilitation program. It is essential to understand the normal clinical course for athletes who sustain a lateral ankle sprain as well as risk factors for an acute injury and CAI. Risk factors for both an acute lateral ankle sprain and CAI include not using an external support and not participating in an appropriate exercise program. Incorporating the latest evidence-based rehabilitation techniques provides the best course of treatment for athletes with an acute ankle sprain or CAI. PMID:27042147
DEFF Research Database (Denmark)
Holst, Jesper Christian; Paton, Chad; Wielandt, Daniel Kim Peel
2015-01-01
We present high precision, low- and high-resolution tungsten isotope measurements of iron meteorites Cape York (IIIAB), Rhine Villa (IIIE), Bendego (IC), and the IVB iron meteorites Tlacotepec, Skookum, and Weaver Mountains, as well as CI chondrite Ivuna, a CV3 chondrite refractory inclusion (CAI...
Non-LTE profiles of strong solar lines
Schneeberger, T. J.; Beebe, H. A.
1976-01-01
The complete linearization method is applied to the formation of strong lines in the solar atmosphere. Transitions in Na(I), Mg(I), Ca(I), Mg(II), and Ca(II) are computed with a standard atmosphere and microturbulent velocity model. The computed profiles are compared to observations at disk center.
2012-10-01
inflammatory response. As a marker of oxidative stress, elevated levels of nitrotyrosine have been found in alcoholics, smokers, diabetes , athero- sclerosis...Jones, J. L. Carlson, V. C. Mody , J. Cai, M. J. Lynn, and P. Sternberg, “Redox state of glutathione in human plasma,” Free Radical Biology and Medicine
Mapping of genes for flower-related traits and QTLs for flowering ...
Indian Academy of Sciences (India)
Mapping of genes for flower-related traits and QTLs for flowering time in an interspecific population of Gossypium hirsutum × G. darwinii. Shuwen Zhang, Qianqian Lan, Xiang Gao, Biao Yang, Caiping Cai, Tianzhen Zhang and Baoliang Zhou. J. Genet. 95, 197–201. Table 1. Loci composition and recombination distances of ...
Blended Learning: An Innovative Approach
Lalima; Dangwal, Kiran Lata
2017-01-01
Blended learning is an innovative concept that embraces the advantages of both traditional teaching in the classroom and ICT supported learning including both offline learning and online learning. It has scope for collaborative learning; constructive learning and computer assisted learning (CAI). Blended learning needs rigorous efforts, right…
Association of polymorphisms in folate metabolic genes and ...
Indian Academy of Sciences (India)
cancer risk: a case–control study in a Chinese population. DAWEI CAI1, LIN ... 1Department of Urology, Shengjing Hospital of China Medical University, Sanhao Street 36, ... low folate intake and an increased cancer risk. Folate ... labile protein (Weisberg et al. 2001). ..... control study, systematic review, and meta-analysis.
Clinical and genetic characterization of six cases with complete ...
Indian Academy of Sciences (India)
JING HE
2017-08-31
Aug 31, 2017 ... The molecular study of the AR gene facilitated the understanding of the mechanism of CAIS and provided the genetic ... recessive genetic disease, which is characterized by par- .... the interaction of AR protein and androgenic hormone. .... in a brazilian cohort: Five novel mutations in the androgen receptor ...
Rabiner, David L.; Murray, Desiree W.; Skinner, Ann T; Malone, Patrick S.
2010-01-01
Few studies have examined whether attention can be improved with training, even though attention difficulties adversely affect academic achievement. The present study was a randomized-controlled trial evaluating the impact of Computerized Attention Training (CAT) and Computer Assisted Instruction (CAI) on attention and academic performance in 77…
Discovery of dmisteinbergite (hexagonal CaAl2Si2O8) in the Allende meteorite
DEFF Research Database (Denmark)
Ma, Chi; Krot, Alexander N.; Bizzarro, Martin
2013-01-01
Dmisteinbergite, CaAlSiO with P63/mcm structure, was identified in a rounded coarse-grained igneous Type B2 Ca-,Al-rich inclusion (CAI) STP-1 from the Allende CV3 carbonaceous chondrite. STP-1 belongs to a very rare type of refractory inclusions, Fractionation and Unknown Nuclear effects (FUN) CA...
Statistical analysis to assess automated level of suspicion scoring methods in breast ultrasound
Galperin, Michael
2003-05-01
A well-defined rule-based system has been developed for scoring 0-5 the Level of Suspicion (LOS) based on qualitative lexicon describing the ultrasound appearance of breast lesion. The purposes of the research are to asses and select one of the automated LOS scoring quantitative methods developed during preliminary studies in benign biopsies reduction. The study has used Computer Aided Imaging System (CAIS) to improve the uniformity and accuracy of applying the LOS scheme by automatically detecting, analyzing and comparing breast masses. The overall goal is to reduce biopsies on the masses with lower levels of suspicion, rather that increasing the accuracy of diagnosis of cancers (will require biopsy anyway). On complex cysts and fibroadenoma cases experienced radiologists were up to 50% less certain in true negatives than CAIS. Full correlation analysis was applied to determine which of the proposed LOS quantification methods serves CAIS accuracy the best. This paper presents current results of applying statistical analysis for automated LOS scoring quantification for breast masses with known biopsy results. It was found that First Order Ranking method yielded most the accurate results. The CAIS system (Image Companion, Data Companion software) is developed by Almen Laboratories and was used to achieve the results.
Meteorite Dichotomy Implies that Jupiter Formed Early
Kruijer, T. S.; Burkhardt, C.; Budde, G.; Kleine, T.
2018-05-01
Meteorites derive from two distinct nebular reservoirs that co-existed and remained spatially separated between 1 and 3–4 Ma after CAIs. This can most easily be explained if Jupiter acted as a barrier and formed early, within less than 1 Ma.
African Journals Online (AJOL)
Items 501 - 550 of 1309 ... HH Tamboura, B Bayala, M Lompo, IP Guissou, L Sawadogo ... X Wang, Y-G Chen, L Ma, Z-H Li, J-Y Li, X-G Liu, J-L Zou, J-H Wu. Vol 11, No 2 ... Zhi-Jiang Wang, Wei Xu, Jian-Wen Liang, Cai-Sheng Wang, Yani Kang.
The effects of growth time on the quality of graphene synthesized by ...
Indian Academy of Sciences (India)
by LPCVD. A JAFARI, R ALIPOUR∗ and M GHORANNEVISS ..... Li T, Hass J, Marchenkoy A N, Conrad E H, First P N and de ... Ni Z H, Chen W, Fan X F, Kuo J L, Yu T, Wee A T S ... Chen S, Cai W, Piner R D, Suk J W, Wu Y, Ren Y, Kang Y.
1985-06-01
cotticu, ~ toflm-tOsensofly area //cn Vo cps LSV lur sepal nu, intreit CAl rfid CAI of Anmmon’s horn Gcon genus , fnulocs En endopiriform nu LSV It...those associated with partial seizure activity, with stereotyped head bobbing. Convulsive episodes were preceded and followed by maintenance of a flat
Geochemical characteristics of Mesoproterozoic metabasite dykes ...
Indian Academy of Sciences (India)
High Mg# observed in a number of samples indicates their derivation from .... show characteristic of orangeites, lamproites or ail- ... ite, and iron oxides. .... while preparing powder for the chemical analy- ses. ..... Cai K, Sun M, Yuan C, Zhao G, Xiao W, Long X and Wu .... Mallik A K, Gupta S N and Ray Barman T 1991 Dating.
A model of propagating calcium-induced calcium release mediated by calcium diffusion
Backx, P. H.; de Tombe, P. P.; van Deen, J. H.; Mulder, B. J.; ter Keurs, H. E.
1989-01-01
The effect of sudden local fluctuations of the free sarcoplasmic [Ca++]i in cardiac cells on calcium release and calcium uptake by the sarcoplasmic reticulum (SR) was calculated with the aid of a simplified model of SR calcium handling. The model was used to evaluate whether propagation of calcium
Energy Technology Data Exchange (ETDEWEB)
DeNovio, Nicole M.; Bryant, Nathan; King, Chrissi B.; Bhark, Eric; Drellack, Sigmund L.; Pickens, John F.; Farnham, Irene; Brooks, Keely M.; Reimus, Paul; Aly, Alaa
2005-04-01
This report documents pertinent transport data and data analyses as part of the Phase II Corrective Action Investigation (CAI) for Frenchman Flat (FF) Corrective Action Unit (CAU) 98. The purpose of this data compilation and related analyses is to provide the primary reference to support parameterization of the Phase II FF CAU transport model.
If You Meet the Computer Guru on the Road, Kill Him (or Her).
Gore, Kay
1989-01-01
Discusses problems and misconceptions concerning the appropriate use of computers in K-12 classrooms. The use of software to support computer-assisted instruction (CAI) is described, teacher-written software is discussed, telecommunications issues are considered, and the role of administrators and teachers is examined. (two references) (LRW)
Choi, Eue-Keun; Chang, Po-Cheng; Lee, Young-Soo; Lin, Shien-Fong; Zhu, Wuqiang; Maruyama, Mitsunori; Fishbein, Michael C.; Chen, Zhenhui; der Lohe, Michael Rubart-von; Field, Loren J.; Chen, Peng-Sheng
2013-01-01
Background Calcium transient triggered firing (CTTF) is induced by large intracellular calcium (Cai) transient and short action potential duration (APD). We hypothesized that CTTF underlies the mechanisms of early afterdepolarization (EAD) and spontaneous recurrent atrial fibrillation (AF) in transgenic (Tx) mice with overexpression of transforming growth factor β1 (TGF-β1). Methods and Results MHC-TGFcys33ser Tx mice develop atrial fibrosis because of elevated levels of TGF-β1. We studied membrane potential and Cai transients of isolated superfused atria from Tx and wild-type (Wt) littermates. Short APD and persistently elevated Cai transients promoted spontaneous repetitive EADs, triggered activity and spontaneous AF after cessation of burst pacing in Tx but not Wt atria (39% vs. 0%, P=0.008). We were able to map optically 4 episodes of spontaneous AF re-initiation. All first and second beats of spontaneous AF originated from the right atrium (4/4, 100%), which is more severely fibrotic than the left atrium. Ryanodine and thapsigargin inhibited spontaneous re-initiation of AF in all 7 Tx atria tested. Western blotting showed no significant changes of calsequestrin or sarco/endoplasmic reticulum Ca2+-ATPase 2a. Conclusions Spontaneous AF may occur in the Tx atrium because of CTTF, characterized by APD shortening, prolonged Cai transient, EAD and triggered activity. Inhibition of Ca2+ release from the sarcoplasmic reticulum suppressed spontaneous AF. Our results indicate that CTTF is an important arrhythmogenic mechanism in TGF-β1 Tx atria. PMID:22447020
Indian Academy of Sciences (India)
Ni(C4H6 N2)4]Br2. HONG WANGa, BIN LUb, JINGXIANG ZHAO b and QINGHAI CAI b,*. aSchool of Chemical and Environmental Engineering, Harbin University of science and technology, Harbin 150080, P. R. China. bSchool of Chemistry ...
Los Alamos controlled air incinerator upgrade for TRU/mixed waste operations
International Nuclear Information System (INIS)
Vavruska, J.S.; Borduin, L.C.; Hutchins, D.A.; Warner, C.L.; Thompson, T.K.
1989-01-01
The Los Alamos Controlled Air Incinerator (CAI) is undergoing a major process upgrade to accept Laboratory-generated transuranic (TRU) and TRU mixed wastes on a production basis. In the interim,prior to the scheduled 1992 operation of a new on-site LLW/mixed waste incinerator, the CAI will also be accepting solid and liquid low-level mixed wastes. This paper describes major modifications that have been made to the process to enhance safety and ensure reliability for long-term, routine waste incineration operations. The regulatory requirements leading to operational status of the system are also briefly described. The CAI was developed in the mid-1970s as a demonstration system for volume reduction of TRU combustible solid wastes. It continues as a successful R and D system well into the 1980s during which incineration tests on a wide variety of radioactive and chemical waste forms were performed. In 1985, a DOE directive required Los Alamos to reduce the volume of its TRU waste prior to ultimate placement in the geological repository at the Waste Isolation Pilot Project (WIPP). With only minor modifications to the original process flowsheet, the Los Alamos CAI was judged capable of conversion to a TRU waste operations mode. 9 refs., 1 fig
Optimizing Computer Assisted Instruction By Applying Principles of Learning Theory.
Edwards, Thomas O.
The development of learning theory and its application to computer-assisted instruction (CAI) are described. Among the early theoretical constructs thought to be important are E. L. Thorndike's concept of learning connectisms, Neal Miller's theory of motivation, and B. F. Skinner's theory of operant conditioning. Early devices incorporating those…
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Hong Wang1 Bin Lu2 Jingxiang Zhao2 Qinghai Cai2. School of Chemical and Environmental Engineering, Harbin University of Science and Technology, Harbin 150080, P. R. China; School of Chemistry and Chemical Engineering, Harbin Normal University, No. 1 Shida Road Limin development Zone, ...
Directory of Open Access Journals (Sweden)
Asma Razeghi
2016-05-01
Full Text Available The Star Excursion Balance Test (SEBT is one functional clinical test that widely used to assess dynamic balance in patients with ankle injuries. Since the ability of this test to detect impairments between athletes with and without chronic ankle instability(CAI is not clear, the aim of present study was to determine if the modified SEBT could detect reach deficits in patients with unilateral CAI. A convenience sample of thirty elite and sub elite women athletes were selected and assigned into two groups: CAI group (Mean ± SD: age: 25±3.5 years; height: 1.68±0.09 m; weight: 62.7±7.3kg, and healthy controls (Mean ± SD: age: 26±4.2 years; height: 1.69±0.05 m; weigh t: 62.7±7.3 kg.The dynamic balance test was obtained using modified SEBT from both limbs of each participant. The independent sample t-test was used for both between group and within group inter-limb comparisons. There was no significant difference in any directions of modified SEBT between two groups in both limbs. No significant interlimb differences were also observed within both groups. The modified SEBT may not enough sensitive to differentiate between athletes with and without CAI. Other factors such as ankle range of motion, muscle strength and pain intensity should be considered for better interpretation of the SEBT results.
The Educational Realities of Hmong Communities in Vietnam: The Voices of Teachers
Lavoie, Constance
2011-01-01
This article presents the language policy and sociolinguistic realities of Hmong people in Lao Cai province, Vietnam. Minority children, who have their own mother tongue, are educated in Vietnamese, a language that few understand. In response to this situation, the Ministry of Education and Training of Vietnam in collaboration with UNICEF,…
Gribble, P.A.; Delahunt, E.; Bleakley, C.M.; Caulfield, B.; Docherty, C.L.; Fong, D.T.; Fourchet, F.; Hertel, J.; Hiller, C.E.; Kaminski, T.W.; McKeon, P.O.; Refshauge, K.M.; Wees, P.J. van der; Vicenzino, W.; Wikstrom, E.A.
2014-01-01
While research on chronic ankle instability (CAI) and awareness of its impact on society and health care systems has grown substantially in the last 2 decades, the inconsistency in participant or patient selection criteria across studies presents a potential obstacle to addressing the problem
Gribble, P.A.; Delahunt, E.; Bleakley, C.; Caulfield, B.; Docherty, C.; Fourchet, F.; Fong, D.T.; Hertel, J.; Hiller, C.; Kaminski, T.; McKeon, P.; Refshauge, K.; Wees, P.J. van der; Vincenzino, B.; Wikstrom, E.
2014-01-01
While research on chronic ankle instability (CAI) and awareness of its impact on society and health care systems has grown substantially in the last 2 decades, the inconsistency in participant/patient selection criteria across studies presents a potential obstacle to addressing the problem properly.
Koshino, Yuta; Yamanaka, Masanori; Ezawa, Yuya; Ishida, Tomoya; Kobayashi, Takumi; Samukawa, Mina; Saito, Hiroshi; Takeda, Naoki
2014-11-01
To compare the kinematics of lower limb joints between individuals with and without chronic ankle instability (CAI) during cross-turn and -cutting movements. Cross-sectional study. Motion analysis laboratory. Twelve subjects with CAI and twelve healthy controls. Hip flexion, adduction, and internal rotation, knee flexion, and ankle dorsiflexion and inversion angles were calculated in the 200 ms before initial ground contact and from initial ground contact to toe-off (stance phase) in a cross-turn movement during gait and a cross-cutting movement from a forward jump, and compared across the two groups. In the cross-cutting movement, the CAI group exhibited greater hip and knee flexion than the control group during the stance phase, and more hip abduction during the period before initial contact and the stance phase. In the cross-turn movement the joint kinematics were similar in the two groups. CAI subjects exhibited an altered pattern of the proximal joint kinematics during a cross-cutting movement. It is important for clinicians to assess the function of the hip and knee as well as the ankle, and to incorporate coordination training for the entire lower limb into rehabilitation after lateral ankle sprains. Copyright © 2013 Elsevier Ltd. All rights reserved.
The President's Report, 1983-84.
Bok, Derek
The 1983-84 annual report of the President of Harvard University to members of the Board of Overseers addresses the advantages and disadvantages of the utilization of new technologies by a university, comments on the instructional uses of computers (including computer assisted instruction (CAI)) and video technology, and cites specific examples in…
Effectiveness of a computer-based tutorial for teaching how to make a blood smear.
Preast, Vanessa; Danielson, Jared; Bender, Holly; Bousson, Maury
2007-09-01
Computer-aided instruction (CAI) was developed to teach veterinary students how to make blood smears. This instruction was intended to replace the traditional instructional method in order to promote efficient use of faculty resources while maintaining learning outcomes and student satisfaction. The purpose of this study was to evaluate the effect of a computer-aided blood smear tutorial on 1) instructor's teaching time, 2) students' ability to make blood smears, and 3) students' ability to recognize smear quality. Three laboratory sessions for senior veterinary students were taught using traditional methods (control group) and 4 sessions were taught using the CAI tutorial (experimental group). Students in the control group received a short demonstration and lecture by the instructor at the beginning of the laboratory and then practiced making blood smears. Students in the experimental group received their instruction through the self-paced, multimedia tutorial on a laptop computer and then practiced making blood smears. Data was collected from observation, interview, survey questionnaires, and smear evaluation by students and experts using a scoring rubric. Students using the CAI made better smears and were better able to recognize smear quality. The average time the instructor spent in the room was not significantly different between groups, but the quality of the instructor time was improved with the experimental instruction. The tutorial implementation effectively provided students and instructors with a teaching and learning experience superior to the traditional method of instruction. Using CAI is a viable method of teaching students to make blood smears.
Nguyen, T.H.L.; Ngoan, L.D.; Verstegen, M.W.A.; Hendriks, W.H.
2011-01-01
This study was conducted to determine the effect of the inclusion of different levels of ensiled cassava leaves (variety KM94) in the diets on performance and carcass characteristics of growing pigs in Vietnam. A total of 40 crossbreds pigs (Large White${\\\\times}$Mong Cai, 20 males and 20 females)
Computer-Assisted Instruction Case Study: The Introductory Marketing Course.
Skinner, Steven J.; Grimm, Jim L.
1979-01-01
Briefly reviews research on the effectiveness of CAI in instruction, and describes a study comparing the performance of students using one program for basic marketing--TRMP (Tutorial Review of Marketing Principles)--with or without a study guide, the study guide alone, and a traditional class. (BBM)
Effective Use of New Communication Technologies.
Fauley, Franz E.
Until the last two or three years, three forces inhibited the acceptance of computer-assisted instruction (CAI). These were the fear on the part of traditional trainers of displacement by machines, the poor quality of existing courseware and limited capability of accompanying hardware, and the poor price and performance characteristics of existing…
Culture conditions for the production of a tannase of Aspergillus ...
African Journals Online (AJOL)
STORAGESEVER
2009-06-03
Jun 3, 2009 ... hydrogen bonds in solutions (Spencer et al., 1988) resulting in the ... death at higher levels of intake (Garg et al., 1992; Makkar and Becker ..... Spencer CM, Cai Y, Martin R, Gaffney SH, Goulding PN, Magnolato D,. Lilley TH ...
Soliman, Mamdouh M.; Hilal, Ahmed J.
2016-01-01
This study evaluates the effectiveness of Computer-Assisted Instruction (CAI) compared with traditional classroom instruction of mathematics of seventh graders in Kuwait's public schools. We aimed to compare students learning outcomes between two groups: the control group, taught traditionally without the use of computers, and the experimental…
Energy Technology Data Exchange (ETDEWEB)
John McCord
2004-12-01
This report documents pertinent hydrologic data and data analyses as part of the Phase II Corrective Action Investigation (CAI) for Frenchman Flat (FF) Corrective Action Unit (CAU): CAU 98. The purpose of this data compilation and related analyses is to provide the primary reference to support the development of the Phase II FF CAU groundwater flow model.
Root, Jenny R.; Stevenson, Bradley S.; Davis, Luann Ley; Geddes-Hall, Jennifer; Test, David W.
2017-01-01
Computer-assisted instruction (CAI) is growing in popularity and has demonstrated positive effects for students with disabilities, including those with autism spectrum disorder (ASD). In this review, criteria for group experimental and single case studies were used to determine quality (Horner et al., "Exceptional Children" 71:165-179,…
Using the Computer to Improve Basic Skills.
Bozeman, William; Hierstein, William J.
These presentations offer information on the benefits of using computer-assisted instruction (CAI) for remedial education. First, William J. Hierstein offers a summary of the Computer Assisted Basic Skills Project conducted by Southeastern Community College at the Iowa State Penitentiary. Hierstein provides background on the funding for the…
NCBI nr-aa BLAST: CBRC-CJAC-01-1207 [SEVENS
Lifescience Database Archive (English)
Full Text Available .1| polycystic kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] emb|CAH72782.1| polycystic ...kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] emb|CAI16677.1| polycystic kidney and hepatic disease 1 (autos...ney and hepatic disease 1 (autosomal recessive) [Homo sapiens] NP_733842.2 0.0 87% ...
Solvothermal syntheses, crystal structures, optical and thermal ...
Indian Academy of Sciences (India)
compounds 1–3 exhibit optical band gaps between 2.06 and 2.35 eV. Keywords. .... under a nitrogen stream of 100 mL min. −1 . 2.3 X-ray diffraction. Single-crystal ..... Liu G N, Guo G C, Wang M S, Cai L Z and Huang J S. 2010 Five dimeric ...
Running Behavioral Experiments with Human Participants: A Practical Guide (Revised Version)
2010-01-20
offering to reschedule once. When there are repeated absences, it is often not worth rescheduling . In some cases, you as an experimenter may need...cai’Icer) 0 Institutionalized ildividuals (e.g., patients in state hospitals or nursing homes) 0 Fetus. embcyo, fe~al material in vitro ferti lization 0
EFL Learners' Uses of Adverbs in Argumentative Essays
Yilmaz, Ercan; Dikilitas, Kenan
2017-01-01
Adverbs require a great deal of effort to be mastered, and even the most advanced users of that language have difficulty in using them correctly (Narita & Sugiura, 2006; Peacock, 2010; Lei, 2012; Leedham & Cai, 2013). The purpose of this study is to find out to what extent relatively high proficiency level EFL learners use different types…
Amaral, Jennifer M.; Abrams, Steve; Karaviti, Lefkothea; McKay, Siripoom V.
2010-01-01
Background. Late transient neonatal hypocalcemia with hyperphosphatemia is potentially life-threatening. The use of dihydroxycholecalciferol in the management of neonatal hypocalcemia is unexplored. Objective. We hypothesized adding dihydroxycholecalciferol to intravenous continuous calcium infusion (CaI) will achieve accelerated correction of hypocalcemia. Design/Methods. A controlled double-blind randomized placebo group was organized to compare the addition of dihydroxycholecalciferol ...
Choi, Ho-Suk; Shin, Won-Seob
2015-06-01
[Purpose] The purpose of this study was to provide evidence of construct validity for the lower extremity functional movement screen (LE-FMS) based on hypothesis testing in patients with chronic ankle instability (CAI). [Subjects] The subjects were 20 healthy subjects and 20 patients with CAI who had a history of ankle sprain with pain for more than 1 day. [Methods] All participants were measured using the Foot and Ankle Disability Index (FADI) and evaluated with the LE-FMS. The screen included the deep squat, the hurdle step (HS) and the in-line lunge (ILL). The symmetry ratios (RS) were accurately measured during the deep squat trial. [Results] Between the two groups, there were significant differences in scores on the LE-FMS, HS, ILL, RS, FADI, and FADI-sport. The FADI was strongly correlated with both LE-FMS score (r=0.807) and ILL score (r=0.896). There was a strong relationship (r=0.818) between LE-FMS score and FADI-sport. [Conclusion] These results suggest that the LE-FMS may be used to detect deficits related to CAI. Additionally, this instrument is reliable in detecting functional limitations in patients with CAI.
Host Response to Botulinum Neurotoxins for Developing Diagnostics and Antidotes
2009-09-18
Toxin: Chemistry , Pharmacology, Toxicity, and Immunology. Muscle and Nerve Suppl. (6), S1-S23. Cai, S., Sarkar, H. K., and Singh, B. R., 1999...subsequent refolding by a multichaperone network. J. Biol. Chem. 273, 11032-11037. Vickery, L. E., Silberg , J. J., and Ta, D. T. (1997). Hsc66
Effect of Computer-Based Video Games on Children: An Experimental Study
Chuang, Tsung-Yen; Chen, Wei-Fan
2009-01-01
This experimental study investigated whether computer-based video games facilitate children's cognitive learning. In comparison to traditional computer-assisted instruction (CAI), this study explored the impact of the varied types of instructional delivery strategies on children's learning achievement. One major research null hypothesis was…
The Controlled-Air Incinerator at Los Alamos
Energy Technology Data Exchange (ETDEWEB)
Newmyer, J.N.
1994-04-01
The Controlled-Air Incinerator (CAI) at Los Alamos is being modified and upgraded to begin routine operations treating low-level mixed waste (LLMW), radioactively contaminated polychlorinated biphenyl (PCB) wastes, low-level liquid wastes, and possibly transuranic (TRU) wastes. This paper describes those modifications. Routine waste operations should begin in late FY95.
NCBI nr-aa BLAST: CBRC-PTRO-27-0002 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-27-0002 gb|AAH18471.1| NFS1 nitrogen fixation 1 homolog (S. cerevisiae) [...Homo sapiens] emb|CAI13602.1| NFS1 nitrogen fixation 1 (S. cerevisiae) [Homo sapiens] AAH18471.1 3e-10 83% ...
Connections between the Radio, Optical and Soft X-ray Luminosities ...
Indian Academy of Sciences (India)
for Flat-Spectrum Radio Quasars. Zhi-Fu Chen1, Cai-Juan Pan1,∗, You-Bing Li2 & Yu-Tao Zhou3. 1Department of Physics and Telecommunication Engineering of Baise University,. Baise 533000, China. 2Guangzhou City Construction College, Guangdong 510925, China. 3Center for Astrophysics, Guangzhou University, ...
NCBI nr-aa BLAST: CBRC-FCAT-01-1153 [SEVENS
Lifescience Database Archive (English)
Full Text Available .1| polycystic kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] emb|CAH72782.1| polycystic ...kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] emb|CAI16677.1| polycystic kidney and hepatic disease 1 (autos...ney and hepatic disease 1 (autosomal recessive) [Homo sapiens] NP_733842.2 0.0 76% ...
Computer-Assisted Instruction and Continuing Motivation.
Mosley, Mary Lou; And Others
Effects of two feedback conditions--comment and no comment--on the motivation of sixth grade students to continue with computer assisted instruction (CAI) were investigated, and results for boys and for girls were compared. Subjects were 62 students--29 boys and 33 girls--from a suburban elementary school who were randomly assigned to the comment…
Using dynamic software in mathematics: the case of reflection symmetry
Tatar, Enver; Akkaya, Adnan; Berrin Kağizmanli, Türkan
2014-10-01
This study was carried out to examine the effects of computer-assisted instruction (CAI) using dynamic software on the achievement of students in mathematics in the topic of reflection symmetry. The study also aimed to ascertain the pre-service mathematics teachers' opinions on the use of CAI in mathematics lessons. In the study, a mixed research method was used. The study group of this research consists of 30 pre-service mathematics teachers. The data collection tools used include a reflection knowledge test, a survey and observations. Based on the analysis of the data obtained from the study, the use of CAI had a positive effect on achievement in the topic of reflection symmetry of the pre-service mathematics teachers. The pre-service mathematics teachers were found to largely consider that a mathematics education which is carried out utilizing CAI will be more beneficial in terms of 'visualization', 'saving of time' and 'increasing interest/attention in the lesson'. In addition, it was found that the vast majority of them considered using computers in their teaching on the condition that the learning environment in which they would be operating has the appropriate technological equipment.
Teaching French Transformational Grammar by Means of Computer-Generated Video-Tapes.
Adler, Alfred; Thomas, Jean Jacques
This paper describes a pilot program in an integrated media presentation of foreign languages and the production and usage of seven computer-generated video tapes which demonstrate various aspects of French syntax. This instructional set could form the basis for CAI lessons in which the student is presented images identical to those on the video…
Early accretion of protoplanets inferred from a reduced inner solar system 26Al inventory
DEFF Research Database (Denmark)
Schiller, Martin; Connelly, James; Gad, Aslaug C.
2015-01-01
value of 5.25×10−5. Based on their similar 54Cr/52Cr ratios, most inner solar system materials likely accreted from material containing a similar 26Al/27Al ratio as the APB precursor at the time of CAI formation. To satisfy the abundant evidence for widespread planetesimal differentiation...
Measurement of Cruelty in Children: The Cruelty to Animals Inventory
Dadds, Mark R.; Whiting, Clare; Bunn, Paul; Fraser, Jennifer A.; Charlson, Juliana H.; Pirola-Merlo, Andrew
2004-01-01
Cruelty to animals may be a particularly pernicious aspect of problematic child development. Progress in understanding the development of the problem is limited due to the complex nature of cruelty as a construct, and limitations with current assessment measures. The Children and Animals Inventory (CAI) was developed as a brief self- and…
Steinhaus, Kurt A.
A 12-week study of two groups of 14 college freshmen music majors was conducted to determine which group demonstrated greater achievement in learning auditory discrimination using computer-assisted instruction (CAI). The method employed was a pre-/post-test experimental design using subjects randomly assigned to a control group or an experimental…
Refractory metal nuggets in different types of cosmic spherules.
Digital Repository Service at National Institute of Oceanography (India)
Rudraswami, N.G.; ShyamPrasad, M.; Plane, J.M.C.; Berg, T.; Feng, W.; Balgar, S.
a fremdling-like object in a cosmic spherule which has a nugget encased in Fe–Ni and sulfide phases, similar to those typically observed in CAIs of CV or CO chondrites. The atmospheric entry for this rare cosmic spherule appears to have taken place...
Indian Academy of Sciences (India)
Mengfan Yin. Articles written in Journal of Chemical Sciences. Volume 127 Issue 9 September 2015 pp 1531-1538. Heavy main-group iodometallates hybridized by alkali metal via 1,10-Phenanthroline-5,6-dione · Mengfan Yin Gengxing Cai Peng Wang Xihui Chao Jibo Liu Haohong Li Zhirong Chen · More Details Abstract ...
Canadian Association for Information Science, Ottawa (Ontario).
Seventeen papers from the 1984 annual conference of the Canadian Association for Information Science (CAIS) are presented in four broad topic areas. The first group, which focuses on changing roles in information access, includes the keynote address by Charles Meadow, "Integrating Access to Information Utilities: Promises, Problems, and…
Eesti mood Berliinis / Maarja Tali
Tali, Maarja
1998-01-01
Rahvusvahelise konkursi 'Smirnoff Fashion Awards' finaalvõistlus teemal 'Metamorphosis' 21. juulil Berliinis. Eesti eelvooru võitnud Aldo Järvsoo tööst 'Est', esinemisest. I koht - Elena Zarubina (Venemaa), II - Manija Ismat (Inglismaa), III - Desmond Yang (Hok¡Cai, Singapur). Kommentaar A. Järvsoolt
Potvin Kent, Monique; Pauzé, Elise
2018-06-01
To assess the effectiveness of the self-regulatory Canadian Children's Food and Beverage Advertising Initiative (CAI) in limiting advertising of unhealthy foods and beverages on children's preferred websites in Canada.Design/Setting/SubjectsSyndicated Internet advertising exposure data were used to identify the ten most popular websites for children (aged 2-11 years) and determine the frequency of food/beverage banner and pop-up ads on these websites from June 2015 to May 2016. Nutrition information for advertised products was collected and their nutrient content per 100 g was calculated. Nutritional quality of all food/beverage ads was assessed using the Pan American Health Organization (PAHO) and UK Nutrient Profile Models (NPM). Nutritional quality of CAI and non-CAI company ads was compared using χ 2 analyses and independent t tests. About 54 million food/beverage ads were viewed on children's preferred websites from June 2015 to May 2016. Most (93·4 %) product ads were categorized as excessive in fat, Na or free sugars as per the PAHO NPM and 73·8 % were deemed less healthy according to the UK NPM. CAI-company ads were 2·2 times more likely (OR; 99 % CI) to be excessive in at least one nutrient (2·2; 2·1, 2·2, Pfood and beverage advertising on children's preferred websites in Canada. Mandatory regulations are needed.
Ethnoveterinary Application of Morinda Citrifolia Fruit Puree on a ...
African Journals Online (AJOL)
Ethnoveterinary Application of Morinda Citrifolia Fruit Puree on a Commercial Heifer Rearing Facility with Endemic Salmonellosis. VJ Brooks, TJ De Wolfe, TJ Paulus, J Xu, J Cai, NS Keuler, RG Godbee, SF Peek, SM McGuirk, BJ Dariena ...
Success of Breast Cancer Startup Challenge Inspires Second Challenge | Poster
By Thomas Stackhouse, Joseph Conrad, and Michele Newton, Contributing Writers, and Rosemarie Truman, Guest Writer Sixty-one teams have been accepted into, and are now competing in, the Neuro Startup Challenge, a new collaboration established by the National Institutes of Health (NIH) with The Center for Advancing Innovation (CAI) and Heritage Provider Network, Inc.
Pilot Evaluation of the Career Assessment Inventory for Use in Apprentice Placement.
1986-08-01
241000) (00 S2 ea Heavy Equipment 2850000(0 CD Be a Restaurant CookIPf 195 00000G Q Be an Actor * Actress Operator (bulldozer, 280004e0St ro * 96000 ea... vs . painter). 2. If the CAI is to be used at all, its best use is to counsel shipyard applicants who lack blue collar interests to carefully
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tein, possibly TonB-like energy transducer ... [Azoarcus sp. EbN1] emb|CAI07122.1| hypothetical ... ... ... protein, possibly TonB-like energy transducer [Azoarcus ... sp. EbN1] ... Length = 87 ... Q
Srinivasan, P.; Simon, Justin I.; Cuzzi, J. N.
2013-01-01
Aggregate textures of chondrites reflect accretion of early-formed particles in the solar nebula. Explanations for the size and density variations of particle populations found among chondrites are debated. Differences could have risen out of formation in different locations in the nebula, and/or they could have been caused by a sorting process [1]. Many ideas on the cause of chondrule sorting have been proposed; some including sorting by mass [2,3], by X-winds [4], turbulent concentration [5], and by photophoresis [6]. However, few similar studies have been conducted for Ca-, Al-rich inclusions (CAIs). These particles are known to have formed early, and their distribution could attest to the early stages of Solar System (ESS) history. Unfortunately, CAIs are not as common in chondrites as chondrules are, reducing the usefulness of studies restricted to a few thin sections. Furthermore, the largest sizes of CAIs are generally much larger than chondrules, and therefore rarely present in most studied chondrite thin sections. This study attempts to perform a more representative sampling of the CAI population in the Allende chondrite by investigating a two decimeter-sized slab.
1998-01-01
Moedisaineri Issey Miyake näitus 'Making Things' 17. jaan.-ni 1999 Pariisis Fondation Cartier's. Näitus koosneb neljast osast, teine osa 'Pleats Please Guest Series' on Miyake koostöö nelja kunstikuga: Yasumasa Morimura, Nobuyoshi Araki, Tim Hawkinsoni ja Cai Guo-Qiangiga
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite
Mckay, C. W.; Bown, R. L.
1985-01-01
The paper discusses the importance of linking Ada Run Time Support Environments to the Common Ada Programming Support Environment (APSE) Interface Set (CAIS). A non-stop network operating systems scenario is presented to serve as a forum for identifying the important issues. The network operating system exemplifies the issues involved in the NASA Space Station data management system.
Acute effect of citrate bath on postdialysis alkalaemia
Directory of Open Access Journals (Sweden)
Patricia De Sequera Ortiz
2015-03-01
Conclusion: Dialysis with citrate provides better control of postdialysis acid-base balance, decreases/avoids postdialysis alkalaemia, and lowers the increase in Cac and Cai. This finding is of special interest in patients with predisposing factors for arrhythmia and patients with respiratory failure, carbon dioxide retention, calcifications and advanced liver disease.
Liu, Liyan
2012-01-01
How did an obscure provincial teachers college produce graduates who would go on to become founders and ideologues of the Chinese Communist Party? Mao Zedong, Cai Hesen, Xiao Zisheng, and others attended the Hunan First Normal School. Focusing on their alma mater, this work explores the critical but overlooked role modern schools played in sowing…
Directory of Open Access Journals (Sweden)
Cai Bo-Feng
2014-01-01
Citation: Cai, B.-F., Liu, J.-G., Gao, Q.-X., et al., 2014. Estimation of methane emissions from municipal solid waste landfills in China based on point emission sources. Adv. Clim. Change Res. 5(2, doi: 10.3724/SP.J.1248.2014.081.
Unstructured Spectral Element Model for Dispersive and Nonlinear Wave Propagation
DEFF Research Database (Denmark)
Engsig-Karup, Allan Peter; Eskilsson, Claes; Bigoni, Daniele
2016-01-01
We introduce a new stabilized high-order and unstructured numerical model for modeling fully nonlinear and dispersive water waves. The model is based on a nodal spectral element method of arbitrary order in space and a -transformed formulation due to Cai, Langtangen, Nielsen and Tveito (1998). In...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Yang Zhao1 Haiqing Tong1 Ronghao Cai1 Xiaojian Peng1 Xiaoyu Li1 Defang Gan2 Suwen Zhu1. Key Laboratory of Crop Biology of Anhui Province, School of Life Sciences, Anhui Agricultural University, Hefei 230036, People's Republic of China; School of Horticulture, Anhui Agricultural University, Hefei 230036, People's ...
2012-02-15
... expenses as ``other'' (miscellaneous), a very general categorization that provides FINRA limited visibility... supplemental filing would play with respect to a broker-dealer's annual audit.\\28\\ \\26\\ CAI. \\27\\ Id. \\28\\ Id... any future schedules or reports be done through the more typical self- regulatory organization (``SRO...
Molecular genetic diversity and genetic structure of Vietnamese indigenous pig populations
DEFF Research Database (Denmark)
Pham, L. D.; Do, Duy Ngoc; Nam, L. Q.
2014-01-01
The study characterized genetic diversity and genetic structure of five indigenous pig populations (Ha Lang, Muong Te, Mong Cai, Lung and Lung Pu), two wild pig populations (Vietnamese and Thai wild pigs) and an exotic pig breed (Yorkshire) using FAO/ISAG recommended 16 microsatellite markers...
Breast Cancer Startup Challenge winners
Ten winners of a world-wide competition to bring emerging breast cancer research technologies to market faster were announced today by the Avon Foundation for Women, in partnership with NCI and the Center for Advancing Innovation (CAI). Avon is providing
Identification of seed-related QTL in Brassica rapa
Bagheri, H.; Pino del Carpio, D.; Hanhart, C.J.; Bonnema, A.B.; Keurentjes, J.J.B.; Aarts, M.G.M.
2013-01-01
To reveal the genetic variation, and loci involved, for a range of seed-related traits, a new F2 mapping population was developed by crossing Brassica rapa ssp. parachinensis L58 (CaiXin) with B. rapa ssp. trilocularis R-o-18 (spring oil seed), both rapid flowering and self-compatible. A linkage map
Ruiz, Yumary; Matos, Sergio; Kapadia, Smiti; Islam, Nadia; Cusack, Arthur; Kwong, Sylvia; Trinh-Shevrin, Chau
2012-12-01
Despite the importance of community health workers (CHWs) in strategies to reduce health disparities and the call to enhance their roles in research, little information exists on how to prepare CHWs involved in community-academic initiatives (CAIs). Therefore, the New York University Prevention Research Center piloted a CAI-CHW training program. We applied a core competency framework to an existing CHW curriculum and bolstered the curriculum to include research-specific sessions. We employed diverse training methods, guided by adult learning principles and popular education philosophy. Evaluation instruments assessed changes related to confidence, intention to use learned skills, usefulness of sessions, and satisfaction with the training. Results demonstrated that a core competency-based training can successfully affect CHWs' perceived confidence and intentions to apply learned content, and can provide a larger social justice context of their role and work. This program demonstrates that a core competency-based framework coupled with CAI-research-specific skill sessions (1) provides skills that CAI-CHWs intend to use, (2) builds confidence, and (3) provides participants with a more contextualized view of client needs and CHW roles.
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 90; Online resources. Genotyping of the k-casein and -lactoglobulin genes in Chinese Holstein, Jersey and water buffalo by PCR-RFLP. Da-Xi Ren Shu-Ying Miao You-Liang Chen Cai-Xia Zou Xian-Wei Liang Jian-Xin Liu. Volume 90 Online resources 2011 pp e1-e5 ...
Personal optical disk library (PODL) for knowledge engineering
Wang, Hong; Jia, Huibo; Xu, Duanyi
2001-02-01
This paper describes the structure of Personal Optical Disk Library (PODL), a kind of large capacity (40 GB) optical storage equipment for personal usage. With the knowledge engineering technology integrated in the PODL, it can be used on knowledge query, knowledge discovery, Computer-Aided Instruction (CAI) and Online Analysis Process (OLAP).
Towle, Nelson J.
Research sought to determine whether memorization of rule statements before, during or after instruction in rule application skills would facilitate the acquisition and/or retention of rule-governed behavior as compared to no-rule statement memorization. A computer-assisted instructional (CAI) program required high school students to learn to a…
van Hemmen, J; Saris, I M J; Cohen-Kettenis, P T; Veltman, D J; Pouwels, P J W; Bakker, J
Sex differences have been described regarding several aspects of human brain morphology; however, the exact biological mechanisms underlying these differences remain unclear in humans. Women with the complete androgen insensitivity syndrome (CAIS), who lack androgen action in the presence of a 46,XY
Influence of psychological stress on headache in patients with systemic lupus erythematosus.
Vargas-Hitos, José Antonio; Sabio, José Mario; Martínez-Egea, Isabel; Jiménez-Jáimez, Enrique; Rodríguez-Guzmán, Manuel; Navarrete-Navarrete, Nuria; López-Lozano, Esther; Romero-Alegría, Ángela; de la Calle, Cristina; Jáimez-Gámiz, Laura; Baños-Piñero, Pilar; Nebrera-Navarro, Fernando; Fidalgo, Alba; Caminal, Luis; de Ramón Garrido, Enrique; Ortego-Centeno, Norberto; Expósito, Manuela; Zamora-Pasadas, Mónica; Jiménez-Alonso, Juan
2014-03-01
To compare the prevalence and disability of headache in patients with systemic lupus erythematosus (SLE) with the general population and to assess the role of chronic psychological stress (CPS) in headache development. One hundred seventy patients with SLE and 102 control subjects matched for age, sex, and level of education were included in this multicenter, cross-sectional study. CPS, headache-related disability, and chronic analgesic intake (CAI) were evaluated in all participants. No statistical differences in the prevalence of headache between both groups were observed but headache disability was significantly higher in patients with SLE. In addition, a higher average score in the Cohen Perceived Stress Scale (CPSS) and a higher prevalence of patients with CAI were observed in patients with SLE. In multivariate analysis, CPSS score was positively (OR 1.09; 95% CI: 1.03-1.14; p = 0.001) and CAI negatively (OR 0.43; 95% CI: 0.19-0.99; p = 0.049) associated with headache in patients with SLE. Despite the prevalence of headache in patients with SLE and the general population being similar, headache-related disability may be higher in patients with SLE. Moreover, CPS might play a role in the pathogenesis of SLE headache, whereas CAI might have a protective effect against it.
Gansuwan, Phansamon; Siribunluechai, Athipa
2011-01-01
Thee market-driving approach has been cited by several business academic scholars (Jaworski,Kohli, & Sahay, 2000; Carpenter, Glazer, & Nakamoto, 2000; Kumar, Scheer, & Kotler, 2000;Harris & Cai, 2002; Hills & Sarin, 2003; Carrillat, Jaramillo, & Locander, 2004; Schindehutte,Morris, & Kocak, 2008) as a significant approach of the market-oriented company that canprovide a sustainable competitive advantage. Moreover, the organizational cultures developed bythe transfo...
Ozen, Arzu; Ergenekon, Yasemin; Ulke-Kurkcuoglu, Burcu
2017-01-01
The current study investigated the relation between simultaneous prompting (SP), computer-assisted instruction (CAI), and the receptive identification of target pictures (presented on laptop computer) for four preschool students with developmental disabilities. The students' acquisition of nontarget information through observational learning also…
Tian, Wei; Cai, Li; Thissen, David; Xin, Tao
2013-01-01
In item response theory (IRT) modeling, the item parameter error covariance matrix plays a critical role in statistical inference procedures. When item parameters are estimated using the EM algorithm, the parameter error covariance matrix is not an automatic by-product of item calibration. Cai proposed the use of Supplemented EM algorithm for…
Clinical and genetic characterization of six cases with complete ...
Indian Academy of Sciences (India)
The clinical examinations such as sex hormone test and B ultrasound were performed and the genetic characterization of patients were evaluated by karyotype analysis, polymerase chain reaction and DNA sequencing. The six cases with 46, XY karyotype were diagnosed with CAIS and four novel AR mutations were ...
Effect of Tutorial Mode of Computer-Assisted Instruction on Students ...
African Journals Online (AJOL)
This study investigated the effect of Tutorial Mode of Computer- Assisted Instruction (CAI) on students' academic performance in practical geography in Nigeria, However, the sample population of eighty (80) Senior Secondary School Two geography students that were randomly selected from two privately owned secondary ...
Students' perceptions of a multimedia computer-aided instruction ...
African Journals Online (AJOL)
Objective. To develop an interactive muttimedia-based computer-aided instruction (CAI) programme, to detennine its educational worth and efficacy in a multicuttural academic environment and to evaluate its usage by students with differing levels of computer literacy. Design. A prospective descriptive study evaluating ...
NCBI nr-aa BLAST: CBRC-FRUB-02-0423 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0423 ref|NP_899187.1| progestin and adipoQ receptor family member VIII... [Danio rerio] gb|AAN78114.1| membrane progestin receptor beta [Danio rerio] emb|CAI12035.1| membrane progestin receptor beta [Danio rerio] NP_899187.1 1e-119 59% ...
NCBI nr-aa BLAST: CBRC-DRER-20-0043 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-20-0043 ref|NP_899187.1| progestin and adipoQ receptor family member VIII... [Danio rerio] gb|AAN78114.1| membrane progestin receptor beta [Danio rerio] emb|CAI12035.1| membrane progestin receptor beta [Danio rerio] NP_899187.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-OLAT-24-0038 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-24-0038 ref|NP_899187.1| progestin and adipoQ receptor family member VIII... [Danio rerio] gb|AAN78114.1| membrane progestin receptor beta [Danio rerio] emb|CAI12035.1| membrane progestin receptor beta [Danio rerio] NP_899187.1 1e-124 61% ...
Kocakaya, Serhat; Gonen, Selahattin
2010-01-01
The purpose of this study was to investigate the effects of a Computer-Assisted Instruction designed according to 7E model of constructivist learning(CAI7E) related to "electrostatic'' topic on physics student teachers' cognitive development, misconceptions, self-efficacy perceptions and attitudes. The study was conducted in 2006-2007…
Deignan, Gerard M.; And Others
This report contains a comparative analysis of the differential effectiveness of computer-assisted instruction (CAI), programmed instructional text (PIT), and lecture methods of instruction in three medical courses--Medical Laboratory, Radiology, and Dental. The summative evaluation includes (1) multiple regression analyses conducted to predict…
Directory of Open Access Journals (Sweden)
José Byron Vicente Dias Fernandes
2000-10-01
Full Text Available Objetivo: Apresentam num circuito elétrico auxiliar para a intubação de vias lacrimais. Método: Descreve-se o dispositivo e sua utilização em 40 pacientes com obstrução congênita ou traumática das vias lacrimais. Resultados: O estudo das características elétricas do aparelho mostrou suas vantagens em relação a outros dispositivos citados na literatura. O uso do aparelho facilitou a recuperação das sondas de Crawford em todos os pacientes. Conclusão: O CAI mostrou-se eficiente e seguro sendo que seu emprego permitiu uma rápida localização e apreensão da sonda de Crawford na cavidade nasal.Purpose: To present an auxiliary electrical circuit (CAI for lacrimal system intubation. Method: The device is described as well as its application to 40 patients with congenital and traumatic lacrimal obstruction. Results: An electrical characteristics study of CAI was performed and compared to other instruments reported in the literature, showing its advantages. Its use helped the retrieval of Crawford probes in all patients. Conclusions: CAI is safe and effective. Its use allows a quick localization and retrieval of Crawford probe even when performed by trainee physicians not familiar with lacrimal anatomy.
Wainwright, Camille L.
Four classes of high school chemistry students (N=108) were randomly assigned to experimental and control groups to investigate the effectiveness of a computer assisted instruction (CAI) package during a unit on writing/naming of chemical formulas and balancing equations. Students in the experimental group received drill, review, and reinforcement…
Agegraphic dark energy as a quintessence
International Nuclear Information System (INIS)
Zhang, Jingfei; Liu, Hongya; Zhang, Xin
2008-01-01
Recently, a dark energy model characterized by the age of the universe, dubbed ''agegraphic dark energy'', was proposed by Cai. In this paper, a connection between the quintessence scalar-field and the agegraphic dark energy is established, and accordingly, the potential of the agegraphic quintessence field is constructed. (orig.)
Wikstrom, Erik A; McKeon, Patrick O
2017-04-01
Therapeutic modalities that stimulate sensory receptors around the foot-ankle complex improve chronic ankle instability (CAI)-associated impairments. However, not all patients have equal responses to these modalities. Identifying predictors of treatment success could improve clinician efficiency when treating patients with CAI. To conduct a response analysis on existing data to identify predictors of improved self-reported function in patients with CAI. Secondary analysis of a randomized controlled clinical trial. Sports medicine research laboratories. Fifty-nine patients with CAI, which was defined in accordance with the International Ankle Consortium recommendations. Participants were randomized into 3 treatment groups (plantar massage [PM], ankle-joint mobilization [AJM], or calf stretching [CS]) that received six 5-minute treatments over 2 weeks. Treatment success, defined as a patient exceeding the minimally clinically important difference of the Foot and Ankle Ability Measure-Sport (FAAM-S). Patients with ≤5 recurrent sprains and ≤82.73% on the Foot and Ankle Ability Measure had a 98% probability of having a meaningful FAAM-S improvement after AJM. As well, ≥5 balance errors demonstrated 98% probability of meaningful FAAM-S improvements from AJM. Patients <22 years old and with ≤9.9 cm of dorsiflexion had a 99% probability of a meaningful FAAM-S improvement after PM. Also, those who made ≥2 single-limb-stance errors had a 98% probability of a meaningful FAAM-S improvement from PM. Patients with ≤53.1% on the FAAM-S had an 83% probability of a meaningful FAAM-S improvement after CS. Each sensory-targeted ankle-rehabilitation strategy resulted in a unique combination of predictors of success for patients with CAI. Specific indicators of success with AJM were deficits in self-reported function, single-limb balance, and <5 previous sprains. Age, weight-bearing-dorsiflexion restrictions, and single-limb balance
Energy Technology Data Exchange (ETDEWEB)
USDOE/NV
1999-07-01
This Corrective Action Investigation Plan (CAIP) has been developed for Frenchman Flat Corrective Action Unit (CAU) 98. The Frenchman Flat CAU is located along the eastern border of the Nevada Test Site (NTS) and includes portions of Areas 5 and 11. The Frenchman Flat CAU constitutes one of several areas of the Nevada Test Site used for underground nuclear testing in the past. The nuclear tests resulted in groundwater contamination in the vicinity as well as downgradient of the underground test areas. The CAIP describes the Corrective Action Investigation (CAI) to be conducted at the Frenchman Flat CAU to evaluate the extent of contamination in groundwater due to the underground nuclear testing. The Frenchman Flat CAI will be conducted by the Underground Test Area (UGTA) Project which is a part of the U.S. Department of Energy, Nevada Operations Office (DOE/NV) Environmental Restoration Project. The CAIP is a requirement of the Federal Facility Agreement and Consent Order (FFACO) (1996 ) agreed to by the U.S. Department of Energy (DOE), the Nevada Division of Environmental Protection (NDEP), and the U.S. Department of Defense (DoD). Based on the general definition of a CAI from Section IV.14 of the FFACO, the purpose of the CAI is ''...to gather data sufficient to characterize the nature, extent, and rate of migration or potential rate of migration from releases or discharges of pollutants or contaminants and/or potential releases or discharges from corrective action units identified at the facilities...'' (FFACO, 1996). However, for the Underground Test Area (UGTA) CAUs, ''...the objective of the CAI process is to define boundaries around each UGTA CAU that establish areas that contain water that may be unsafe for domestic and municipal use.'', as stated in Appendix VI of the FFACO (1996). According to the UGTA strategy (Appendix VI of the FFACO), the CAI of a given CAU starts with the evaluation of the existing data. New
Croy, Theodore; Saliba, Susan A; Saliba, Ethan; Anderson, Mark W; Hertel, Jay
2012-07-01
Cross-sectional. To use stress ultrasonography to measure the change in anterior talofibular ligament length during the simulated anterior drawer and ankle inversion stress tests. In approximately 30% of individuals, ankle sprains may eventually develop into chronic ankle instability (CAI) with recurrent symptoms. Individuals with CAI and those who have a history of ankle sprain (greater than 1 year prior) without chronic instability (copers) may or may not have mechanical laxity. Sixty subjects (n=60 ankles) were divided into 3 groups: 1) Control subjects without ankle injury history (n=20; mean ± SD age; 24.8 ± 4.8 years; height, 173.7 ± 9.4 cm; weight, 77.2 ± 19.5 kg), ankle sprain copers (n=20; 22.3 ± 2.9 years; 172.8 ± 11.3 cm; 72.4 ± 14.3 kg), and subjects with CAI (n=20; 23.5 ± 4.2 years; 174.6 ± 9.6 cm; 74.8 ± 17.3 kg). Ligament length change with the anterior drawer and end range ankle inversion was calculated from ultrasound images. The Foot and Ankle Ability Measure (FAAM) was used to quantify self-reported function on activities-of-daily living (ADL) and sports. The anterior drawer test resulted in length changes that were greater (F₂,₅₇=6.2, P=.004) in the CAI (mean ± SD length change, 15.6 ± 15.1%, P=.006) and the coper groups (14.0 ± 15.9%, P=.016) compared to the control group (1.3 ± 10.7%); however the length change for the CAI and coper groups were not different (P=.93). Ankle inversion similarly resulted in greater ligament length change (F₂,₅₇=6.5, P=.003) in the CAI (25.3 ± 15.5%, P=.003) and coper groups (20.2 ± 19.6%, P=.039) compared to the control group (7.4 ± 12.9%); with no difference in length change between the copers and CAI groups (P=.59). The CAI group had a lower score on the FAAM-ADL (87.4 ± 13.4%) and FAAM-Sports (74.2 ± 17.8%) when compared to the control (98.8 ± 2.9% and 98.9 ± 3.1%, P<.0001) and coper groups (99.4 ± 1.8% and 94.6 ± 8.8%, P<.0001). Stress ultrasonography identified greater
Dhiman, R.; Kalbar, P.; Inamdar, A. B.
2017-12-01
Coastal area classification in India is a challenge for federal and state government agencies due to fragile institutional framework, unclear directions in implementation of costal regulations and violations happening at private and government level. This work is an attempt to improvise the objectivity of existing classification methods to synergies the ecological systems and socioeconomic development in coastal cities. We developed a Geographic information system coupled Multi-criteria Decision Making (GIS-MCDM) approach to classify urban coastal areas where utility functions are used to transform the costal features into quantitative membership values after assessing the sensitivity of urban coastal ecosystem. Furthermore, these membership values for costal features are applied in different weighting schemes to derive Coastal Area Index (CAI) which classifies the coastal areas in four distinct categories viz. 1) No Development Zone, 2) Highly Sensitive Zone, 3) Moderately Sensitive Zone and 4) Low Sensitive Zone based on the sensitivity of urban coastal ecosystem. Mumbai, a coastal megacity in India is used as case study for demonstration of proposed method. Finally, uncertainty analysis using Monte Carlo approach to validate the sensitivity of CAI under specific multiple scenarios is carried out. Results of CAI method shows the clear demarcation of coastal areas in GIS environment based on the ecological sensitivity. CAI provides better decision support for federal and state level agencies to classify urban coastal areas according to the regional requirement of coastal resources considering resilience and sustainable development. CAI method will strengthen the existing institutional framework for decision making in classification of urban coastal areas where most effective coastal management options can be proposed.
Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Delahunt, Eamonn
2016-04-01
Impairments in motor control may predicate the paradigm of chronic ankle instability (CAI) that can develop in the year after an acute lateral ankle sprain (LAS) injury. No prospective analysis is currently available identifying the mechanisms by which these impairments develop and contribute to long-term outcome after LAS. To identify the motor control deficits predicating CAI outcome after a first-time LAS injury. Cohort study (diagnosis); Level of evidence, 2. Eighty-two individuals were recruited after sustaining a first-time LAS injury. Several biomechanical analyses were performed for these individuals, who completed 5 movement tasks at 3 time points: (1) 2 weeks, (2) 6 months, and (3) 12 months after LAS occurrence. A logistic regression analysis of several "salient" biomechanical parameters identified from the movement tasks, in addition to scores from the Cumberland Ankle Instability Tool and the Foot and Ankle Ability Measure (FAAM) recorded at the 2-week and 6-month time points, were used as predictors of 12-month outcome. At the 2-week time point, an inability to complete 2 of the movement tasks (a single-leg drop landing and a drop vertical jump) was predictive of CAI outcome and correctly classified 67.6% of cases (sensitivity, 83%; specificity, 55%; P = .004). At the 6-month time point, several deficits exhibited by the CAI group during 1 of the movement tasks (reach distances and sagittal plane joint positions at the hip, knee and ankle during the posterior reach directions of the Star Excursion Balance Test) and their scores on the activities of daily living subscale of the FAAM were predictive of outcome and correctly classified 84.8% of cases (sensitivity, 75%; specificity, 91%; P < .001). An inability to complete jumping and landing tasks within 2 weeks of a first-time LAS and poorer dynamic postural control and lower self-reported function 6 months after a first-time LAS were predictive of eventual CAI outcome. © 2016 The Author(s).
Lower Limb Interjoint Postural Coordination One Year after First-Time Lateral Ankle Sprain.
Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Sweeney, Kevin; Patterson, Matthew R; Delahunt, Eamonn
2015-11-01
Longitudinal analyses of participants with a history of lateral ankle sprain are lacking. This investigation combined measures of lower limb interjoint coordination and stabilometry to evaluate static unipedal stance with the eyes open (condition 1) and closed (condition 2) in a group of participants with chronic ankle instability (CAI) compared to lateral ankle sprain "copers" (both recruited 12 months after sustaining an acute first-time lateral ankle sprain) and a group of noninjured controls. Twenty-eight participants with CAI, 42 lateral ankle sprain "copers," and 20 noninjured controls completed three 20-s single-limb stance trials in conditions 1 and 2. An adjusted coefficient of multiple determination statistic was used to compare stance limb three-dimensional kinematic data for similarity to establish patterns of interjoint coordination. The fractal dimension of the stance limb center of pressure path was also calculated. Between-group analyses revealed that participants with CAI displayed notable increases in ankle-hip linked coordination compared with both lateral ankle sprain "copers" (-0.52 (1.05) vs 0.28 (0.9), P = 0.007) and controls (-0.52 (1.05) vs 0.63 (0.64), P = 0.006) in condition 1 and compared with controls only (0.62 (1.92) vs 0.1 (1.0) P = 0.002) in condition 2. Participants with CAI also exhibited a decrease in the fractal dimension of the center-of-pressure path during condition 2 compared with both controls and lateral ankle sprain "copers." Participants with CAI present with a hip-dominant strategy of eyes-open and eyes-closed static unipedal stance. This coincided with reduced complexity of the stance limb center of pressure path in the eyes-closed condition.
Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Sweeney, Kevin; Patterson, Matthew R; Delahunt, Eamonn
2016-08-01
The drop vertical jump (DVJ) task has previously been used to identify movement patterns associated with a number of injury types. However, no current research exists evaluating people with chronic ankle instability (CAI) compared with people coping with lateral ankle sprain (LAS) (referred to as "LAS copers") during this task. The aim of this study was to identify the coping movement and motor control patterns of LAS copers in comparison with individuals with CAI during the DVJ task. This was a case-control study. Seventy individuals were recruited at convenience within 2-weeks of sustaining a first-time acute LAS injury. One year following recruitment, these individuals were stratified into 2 groups: 28 with CAI and 42 LAS copers. They attended the testing laboratory to complete a DVJ task. Three-dimensional kinematic and sagittal-plane kinetic profiles were plotted for the lower extremity joints of both limbs for the drop jump phase (phase 1) and drop landing phase (phase 2) of the DVJ. The rate of impact modulation relative to body weight during both phases of the DVJ also was determined. Compared with LAS copers, participants with CAI displayed significant increases in hip flexion on their "involved" limb during phase 1 of the DVJ (23° vs 18°) and bilaterally during phase 2 (15° vs 10°). These movement patterns coincided with altered moment-of-force patterns at the hip on the "uninvolved" limb. It is unknown whether these movement and motor control patterns preceded or occurred as a result of the initial LAS injury. Participants with CAI displayed hip-centered changes in movement and motor control patterns during a DVJ task compared with LAS copers. The findings of this study may give an indication of the coping mechanism underlying outcome following initial LAS injury. © 2016 American Physical Therapy Association.
Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Delahunt, Eamonn
2016-04-01
To compare the movement patterns and underlying energetics of individuals with chronic ankle instability (CAI) to ankle sprain 'copers' during a landing task. Twenty-eight (age 23.2 ± 4.9 years; body mass 75.5 ± 13.9 kg; height 1.7 ± 0.1 m) participants with CAI and 42 (age 22.7 ± 1.7 years; body mass 73.4 ± 11.3 kg; height 1.7 ± 0.1 m) ankle sprain 'copers' were evaluated 1 year after incurring a first-time lateral ankle sprain injury. Kinematics and kinetics of the hip, knee and ankle joints from 200 ms pre-initial contact (IC) to 200 ms post-IC, in addition to the vertical component of the landing ground reaction force, were acquired during performance of a drop land task. The CAI group adopted a position of increased hip flexion during the landing descent on their involved limb. This coincided with a reduced post-IC flexor pattern at the hip and increased overall hip joint stiffness compared to copers (-0.01 ± 0.05 vs. 0.02 ± 0.05°/Nm kg(-1), p = 0.03). Individuals with CAI display alterations in hip joint kinematics and energetics during a unipodal landing task compared to LAS 'copers'. These alterations may be responsible for the increased risk of injury experienced by individuals with CAI during landing manoeuvres. Thus, clinicians must recognise the potential for joints proximal to the affected ankle to contribute to impaired function following an acute lateral ankle sprain injury and to develop rehabilitation protocols accordingly. Level III.
Movement Strategies among Groups of Chronic Ankle Instability, Coper, and Control.
Son, S Jun; Kim, Hyunsoo; Seeley, Matthew K; Hopkins, J Ty
2017-08-01
Comprehensive evaluation of movement strategies during functional movement is a difficult undertaking. Because of this challenge, studied movements have been oversimplified. Furthermore, evaluating movement strategies at only a discrete time point(s) provide limited insight into how movement strategies may change or adapt in chronic ankle instability (CAI) patients. This study aimed to identify abnormal movement strategies in individuals with a history of ankle sprain injury during a sports maneuver compared with healthy controls. Sixty-six participants, consisting of 22 CAI patients, 22 ankle sprain copers, and 22 healthy controls, participated in this study. Functional profiles of lower extremity kinematics, kinetics, and EMG activation from initial contact (0% of stance) to toe-off (100% of stance) were collected and analyzed during a jump landing/cutting task using a functional data analysis approach. Compared with copers, CAI patients displayed landing positions of less plantarflexion, less inversion, more knee flexion, more hip flexion, and less hip abduction during the first 25% of stance. However, restricted dorsiflexion angle was observed in both CAI patients and copers relative to controls during the midlanding to mid-side-cutting phase when the ankle and knee reached its peak range of motion (e.g., dorsiflexion and knee flexion). Reduced EMG activation of tibialis anterior, peroneus longus, medial gastrocnemius, and gluteus medius may be due to altered kinematics that reduce muscular demands on the involved muscles. CAI patients displayed altered movement strategies, perhaps in an attempt to avoid perceived positions of risk. Although sagittal joint positions seemed to increase the external torque on the knee and hip extensors, frontal joint positions appeared to reduce the muscular demands on evertor and hip abductor muscles.
Prenatal testosterone and theory of mind development: Findings from disorders of sex development.
Khorashad, Behzad S; Khazai, Behnaz; Roshan, Ghasem M; Hiradfar, Mehran; Afkhamizadeh, Mozhgan; van de Grift, Tim C
2018-03-01
Women on average perform better than men on the "Reading the Mind in the Eyes" test (RMET) which is a measure of Theory of Mind (ToM). The aim of this study was to assess whether these sex differences are influenced by differences in prenatal testosterone levels through a study on individuals with Disorders of Sex Development and matched controls. ToM performance was examined using the RMET in female-assigned-at-birth individuals with increased prenatal testosterone exposure (Congenital Adrenal Hyperplasia (CAH) and 5-alpha Reductase type-2 Deficiency (5α-RD-2)), female-assigned-at-birth individuals with testosterone insensitivity (Complete Androgen Insensitivity Syndrome (CAIS)), and their age-matched unaffected male and female relatives. A total number of 158 individuals participated in the study; 19 with 5α-RD-2, 17 with CAH, 18 women with CAIS, 52 matched unaffected men and 52 matched unaffected women. All subgroups were around 20 years of age. Women with CAH scored significantly lower on RMET than control women and CAIS individuals. CAIS individuals scored significantly higher than control men and participants with 5α-RD. Statistically, CAIS individuals' performance on RMET was similar to control women's, women with CAH did not differ significantly from control men and 5α-RD-2 individuals scored significantly lower than control men. These results, which are in line with previous theories, illustrate that performance on the RMET, as an index of ToM, may be influenced by variations in prenatal androgens levels. Copyright © 2017 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Akram, W.; Schönbächler, M. [School of Earth, Atmospheric and Environmental Sciences, The University of Manchester, Oxford Road, Manchester, M13 9PL (United Kingdom); Sprung, P. [Institut für Planetologie, Universität Münster, Wilhelm-Klemm-Strasse 10, D-48149 Münster (Germany); Vogel, N. [Institute for Geochemistry and Petrology, ETH, Clausiusstrasse 25, 8092 Zürich (Switzerland)
2013-11-10
Recent work based on analyses of meteorite and terrestrial whole-rock samples showed that the r- and s- process isotopes of Hf were homogeneously distributed throughout the inner solar system. We report new Hf isotope data for Calcium-Aluminum-rich inclusions (CAIs) of the CV3 carbonaceous chondrite Allende, and novel high-precision Zr isotope data for these CAIs and three carbonaceous chondrites (CM, CO, CK). Our Zr data reveal enrichments in the neutron-rich isotope {sup 96}Zr (≤1ε in {sup 96}Zr/{sup 90}Zr) for bulk chondrites and CAIs (∼2ε). Potential isotope effects due to incomplete sample dissolution, galactic and cosmic ray spallation, and the nuclear field shift are assessed and excluded, leading to the conclusion that the {sup 96}Zr isotope variations are of nucleosynthetic origin. The {sup 96}Zr enrichments are coupled with {sup 50}Ti excesses suggesting that both nuclides were produced in the same astrophysical environment. The same CAIs also exhibit deficits in r-process Hf isotopes, which provides strong evidence for a decoupling between the nucleosynthetic processes that produce the light (A ≤ 130) and heavy (A > 130) neutron-rich isotopes. We propose that the light neutron-capture isotopes largely formed in Type II supernovae (SNeII) with higher mass progenitors than the supernovae that produced the heavy r-process isotopes. In the context of our model, the light isotopes (e.g. {sup 96}Zr) are predominantly synthesized via charged-particle reactions in a high entropy wind environment, in which Hf isotopes are not produced. Collectively, our data indicates that CAIs sampled an excess of materials produced in a normal mass (12-25 M{sub ☉}) SNII.
Herrera, M C; Konda, K A; Leon, S R; Deiss, R; Brown, B; Calvo, G M; Salvatierra, H J; Caceres, C F; Klausner, J D
2016-04-01
Alcohol use disorders (AUDs) may enhance the likelihood of risky sexual behaviors and the acquisition of sexually transmitted infections (STIs). Associations between AUDs with condomless anal intercourse (CAI) and STI/HIV prevalence were assessed among men who have sex with men (MSM) and transgender women (TW) in Lima, Peru. MSM and TW were eligible to participate based on a set of inclusion criteria which characterized them as high-risk. Participants completed a bio-behavioral survey. An AUDIT score ≥8 determined AUD presence. Recent STI diagnosis included rectal gonorrhea/chlamydia, syphilis, and/or new HIV infection within 6 months. Prevalence ratios (PR) were calculated using Poisson regression. Among 312 MSM and 89 TW, 45% (181/401) had an AUD. Among those with an AUD, 164 (91%) were hazardous/harmful drinkers, and 17 (9%) had alcohol dependence. Higher CAI was reported by participants with an AUD vs. without, (82% vs. 72% albeit not significant). Reporting anal sex in two or more risky venues was associated with screening AUD positive vs. not (24% vs. 15%, p=0.001). There was no difference in recent STI/HIV prevalence by AUD status (32% overall). In multivariable analysis, screening AUD positive was not associated with CAI or recent STI/HIV infection. In our sample AUDs were not associated with CAI or new HIV infection/recent STI. However higher prevalence of CAI, alcohol use at last sex, and anal sex in risky venues among those with AUDs suggests that interventions to reduce the harms of alcohol should be aimed toward specific contexts. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Bermingham, K. R.; Gussone, N.; Mezger, K.; Krause, J.
2018-04-01
The Ca isotope composition of meteorites and their components may vary due to mass-dependent and/or -independent isotope effects. In order to evaluate the origin of these effects, five amoeboid olivine aggregates (AOAs), three calcium aluminum inclusions (CAIs), five chondrules (C), a dark inclusion from Allende (CV3), two dark fragments from North West Africa 753 (NWA 753; R3.9), and a whole rock sample of Orgueil (CI1) were analyzed. This is the first coupled mass-dependent and -independent Ca isotope dataset to include AOAs, a dark inclusion, and dark fragments. Where sample masses permit, Ca isotope data are reported with corresponding petrographic analyses and rare earth element (REE) relative abundance patterns. The CAIs and AOAs are enriched in light Ca isotopes (δ44/40Ca -5.32 to +0.72, where δ44/40Ca is reported relative to SRM 915a). Samples CAI 5 and AOA 1 have anomalous Group II REE patterns. These REE and δ44/40Ca data suggest that the CAI 5 and AOA 1 compositions were set via kinetic isotope fractionation during condensation and evaporation. The remaining samples show mass-dependent Ca isotope variations which cluster between δ44/40Ca +0.53 and +1.59, some of which are coupled with unfractionated REE abundance patterns. These meteoritic components likely formed through the coaccretion of the evaporative residue and condensate following Group II CAI formation or their chemical and isotopic signatures were decoupled (e.g., via nebular or parent-body alteration). The whole rock sample of Orgueil has a δ44/40Ca +0.67 ± 0.18 which is in agreement with most published data. Parent-body alteration, terrestrial alteration, and variable sampling of Ca-rich meteoritic components can have an effect on δ44/40Ca compositions in whole rock meteorites. Samples AOA 1, CAI 5, C 2, and C 4 display mass-independent 48/44Ca anomalies (ε48/44Ca +6 to +12) which are resolved from the standard composition. Other samples measured for these effects (AOA 5, CAI 1, CAI 2
The Amazon hydrometeorology: Climatology, variability and links to changes in weather patterns
Fernandes, Katia De Avila
My thesis focuses on improving the quantification of the hydrological cycle and understanding the atmospheric processes that link weather to climate in the Amazon River basin. By using ERA40 and independent observations, I assess how well we can estimate the surface water budget in the Amazon River basin. I find that ERA40 basin wide annual precipitation (P) overall agrees with observations showing a slight underestimation of 10% in average, whereas runoff (R) is underestimated by a larger margin (˜25%). Observed residual of precipitation and runoff (denoted as P-R) is better estimated by ERA40 P-R than actual ET which includes soil moisture nudging. The causes for said discrepancies were found to partly relate to soil moisture nudging that needs to be applied during the dry season to produce realistic ET and compensate for the low soil moisture recharge during the previous wet season. Insufficient recharge may in part be caused by underestimation of rainfall amount and intensity; moreover the shallow root layer in the model does not represent the deep soil water reservoir characteristic of the Amazonian forest. Whether the hydrological cycle and weather patterns in the Amazon have changed during the past few decades is a highly debatable but central question for detecting climate change in the region. The second part of my thesis focus on the physical links between rainfall changes detected in observations, and changes of synoptic scale systems as represented by ERA40. My results suggest that an observed delayed wet season onset is consistent with a decreasing number of cold air incursion (CAI) days in southern Amazon for the period 1979--2001. The variability of CAI into southern Amazon is related to the variability of SST upstream of South America in the tropical Pacific and Indian Oceans. A Singular Value Decomposition Analysis (SVD) between CAI days and global SST reveal three main modes of co-variability. The first mode describes the effect of the El Nino
Conceição, Josilene Souza; Schaefer de Araújo, Felipe Gustavo; Santos, Gilmar Moraes; Keighley, John
2016-01-01
Context: Rehabilitation programs for patients with chronic ankle instability (CAI) generally involve balance-perturbation training (BPT). Anticipatory postural adjustments (APAs) and compensatory postural adjustments (CPAs) are the primary strategies used to maintain equilibrium during body perturbations. Little is known, however, about how APAs and CPAs are modified to promote better postural control for individuals with CAI after BPT. Objective: To investigate the effect of BPT that involves kicking a ball on postural-control strategies in individuals with CAI. Design: Randomized controlled clinical trial. Setting: Laboratory. Patients or Other Participants: We randomly assigned 44 volunteers with CAI to either a training group (TG; 11 women, 11 men; age = 24 ± 4 years, height = 173.0 ± 9.8 cm, mass = 72.64 ± 11.98 kg) or control group (CG; 11 women, 11 men; age = 22 ± 3 years, height = 171.0 ± 9.7 cm, mass = 70.00 ± 11.03 kg). Intervention(s): The TG performed a single 30-minute training session that involved kicking a ball while standing on 1 foot. The CG received no intervention. Main Outcome Measure(s): The primary outcome was the sum of the integrated electromyographic activity (∑∫EMG) of the lower extremity muscles in the supporting limb that were calculated during typical intervals for APAs and CPAs. A secondary outcome was center-of-pressure displacement during similar intervals. Results: In the TG after training, the ∑∫EMG decreased in both dorsal and ventral muscles during compensatory adjustment (ie, the time interval that followed lower limb movement). During this interval, muscle activity (∑∫EMG) was less in the TG than in the CG. Consequently, center-of-pressure displacement increased during the task after training. Conclusions: A single session of ball-kicking BPT promoted changes in postural-control strategies in individuals with CAI. These results should stimulate new and more comprehensive studies to
International Nuclear Information System (INIS)
1999-01-01
This Corrective Action Investigation Plan (CAIP) describes the U.S. Department of Energy's (DOE's) planned environmental investigation of the subsurface Central Nevada Test Area (CNTA) Corrective Action Unit (CAU) No. 443. The CNTA is located in Hot Creek Valley in Nye County, Nevada, adjacent to U.S. Highway 6, about 48 kilometers (km) (30 miles[mi]) north of Warm Springs, Nevada. The CNTA was the site of Project Faultless, a nuclear device detonated in the subsurface by the U.S. Atomic Energy Commission (AEC) in January 1968. The purposes of this test were to gauge the seismic effects of a relatively large, high-yield detonation completed in Hot Creek Valley (outside the Nevada Test Site) and to determine the suitability of the site for future large detonations. The yield of the Faultless test was between 200 kilotons and 1 megaton. Two similar tests were planned for the CNTA, but neither of them was completed. Based on the general definition of a corrective action investigation (CAI) from Section IV.14 of the Federal Facility Agreement and Consent Order (FFACO), the purpose of the CAI is ''to gather data sufficient to characterize the nature, extent, and rate of migration or potential rate of migration from releases or discharges of pollutants or contaminants and/or potential releases or discharges from corrective action units identified at the facilities''. For CNTA CAU 443 the concepts developed for the Underground Test Area (UGTA) CAUs will be applied on a limited scale. For the UGTA CAUs, ''the objective of the CAI process is to define boundaries around each UGTA CAU that establish areas that contain water that may be unsafe for domestic and municipal use,'' as stated in Appendix VI of the FFACO (1996). Based on this strategy the CAI for CAU 443 will start with modeling using existing data. New data collection activities are generally contingent upon the results of the modeling and may or may not be part of the CAI. Specific objectives of the CAI ar e as
Webster, Kathryn A.; Pietrosimone, Brian G.; Gribble, Phillip A.
2016-01-01
Context: Ankle instability is a common condition in physically active individuals. It often occurs during a jump landing or lateral motion, particularly when participants are fatigued. Objective: To compare muscle activation during a lateral hop prefatigue and postfatigue in individuals with or without chronic ankle instability (CAI). Design: Cross-sectional study. Setting: Sports medicine research laboratory. Patients or Other Participants: A total of 32 physically active participants volunteered for the study. Sixteen participants with CAI (8 men, 8 women; age = 20.50 ± 2.00 years, height = 172.25 ± 10.87 cm, mass = 69.13 ± 13.31 kg) were matched with 16 control participants without CAI (8 men, 8 women; age = 22.00 ± 3.30 years, height = 170.50 ± 9.94 cm, mass = 69.63 ± 14.82 kg) by age, height, mass, sex, and affected side. Intervention(s): Electromyography of the tibialis anterior, peroneus longus, gluteus medius, and gluteus maximus was measured before and after a functional fatigue protocol. Main Outcome Measure(s): Activation of 4 lower extremity muscles was measured 200 milliseconds before and after landing from a lateral hop. Results: We observed no interactions. The group main effects for the peroneus longus demonstrated higher muscle activation in the CAI group (52.89% ± 11.36%) than in the control group (41.12% ± 11.36%) just before landing the lateral hop (F1,30 = 8.58, P = .01), with a strong effect size (d = 1.01). The gluteus maximus also demonstrated higher muscle activation in the CAI group (45.55% ± 12.08%) than in the control group (36.81% ± 12.08%) just before landing the lateral hop (F1,30 = 4.19, P = .049), with a moderate effect size (d = 0.71). We observed a main effect for fatigue for the tibialis anterior, with postfatigue activation higher than prefatigue activation (F1,30 = 7.45, P = .01). No differences were present between groups for the gluteus medius. Conclusions: Our results support the presence of a centralized feed
International Nuclear Information System (INIS)
Tatischeff, Vincent; Duprat, Jean; De Séréville, Nicolas
2014-01-01
The presence of short-lived radionuclides (t 1/2 < 10 Myr) in the early solar system provides important information about the astrophysical environment in which the solar system formed. The discovery of now extinct 10 Be (t 1/2 = 1.4 Myr) in calcium-aluminum-rich inclusions (CAIs) with Fractionation and Unidentified Nuclear isotope anomalies (FUN-CAIs) suggests that a baseline concentration of 10 Be in the early solar system was inherited from the protosolar molecular cloud. In this paper, we investigate various astrophysical contexts for the nonthermal nucleosynthesis of 10 Be by cosmic-ray-induced reactions. We first show that the 10 Be recorded in FUN-CAIs cannot have been produced in situ by irradiation of the FUN-CAIs themselves. We then show that trapping of Galactic cosmic rays (GCRs) in the collapsing presolar cloud core induced a negligible 10 Be contamination of the protosolar nebula, the inferred 10 Be/ 9 Be ratio being at least 40 times lower than that recorded in FUN-CAIs ( 10 Be/ 9 Be ∼ 3 × 10 –4 ). Irradiation of the presolar molecular cloud by background GCRs produced a steady-state 10 Be/ 9 Be ratio ≲ 1.3 × 10 –4 at the time of the solar system formation, which suggests that the presolar cloud was irradiated by an additional source of CRs. Considering a detailed model for CR acceleration in a supernova remnant (SNR), we find that the 10 Be abundance recorded in FUN-CAIs can be explained within two alternative scenarios: (1) the irradiation of a giant molecular cloud by CRs produced by ≳ 50 supernovae exploding in a superbubble of hot gas generated by a large star cluster of at least 20,000 members, and (2) the irradiation of the presolar molecular cloud by freshly accelerated CRs escaped from an isolated SNR at the end of the Sedov-Taylor phase. In the second picture, the SNR resulted from the explosion of a massive star that ran away from its parent OB association, expanded during most of its adiabatic phase in an intercloud medium of
Erysipèle du membre inférieur: étude de 400 cas [Erysipelas of the lower limb: study of 400 cases
Directory of Open Access Journals (Sweden)
Amina Aounallah
2017-11-01
Full Text Available Introduction: Erysipelas is an acute, non-necrotizing dermo-hypodermitis of predominantly streptococcal origin. Objective: To clarify the epidemiological and evolutionary features of the lower limb erysipelas through a hospital series. Materiels and Methods: We retrospectively analyzed all cases of lower limb erysipelas hospitalized in the Department of Dermatology of the Farhat Hached Hospital of Sousse between January 2000 and December 2015 (10 years. Results: Four hundred cases of erysipelas of the lower limb were recorded. The mean age of the patients was 55.82 years. The sex ratio was 1.51. The main predisposing factors were sedentarity, diabetes and obesity. In 96.75% of cases, entry lesion, like mycoses or traumatic injuries was noted. Clinically, a classic presentation of erysipelas was described in all cases. Erysipela was unilateral in 96% of cases. Treatment was based on intravenous penicillin G in 86.5% of cases, on an average of 9.75 days. The evolution was favorable in 83.25% of cases. Antibioprophylaxis was prescribed in 38% of cases. Loco-regional and general complications were noted in 10.25% of cases. Three patients died. Late complications were dominated by relapses and persistence of sequelled lymphedema. RÉSUMÉ Introduction: L’érysipèle est une dermo-hypodermite aigue, non nécrosante, d’origine principalement streptococcique. Objectif: préciser les particularités épidémio-cliniques et évolutives de l’Erysipèle du membre inferieur à travers une série hospitalière. Matériel et Méthodes: Nous avons rétrospectivement analysé tous les cas d’érysipèle du membre inférieur hospitalisés dans le service de dermatologie de l’hôpital Farhat Hached de Sousse entre janvier 2000 et décembre 2015 (10 ans. Résultats: Quatre cents cas d’érysipèle du membre inférieur ont été recensés. L’âge moyen des patients était de 55.82 ans. Le sexe ratio était de 1.51. Les principaux facteurs favorisants
Fermions tunneling from apparent horizon of FRW universe
International Nuclear Information System (INIS)
Li Ran; Ren Jirong; Shi Dunfu
2009-01-01
In the paper [R.-G. Cai, L.-M. Cao, Y.-P. Hu, (arXiv: 0809.1554)], the scalar particles' Hawking radiation from the apparent horizon of Friedmann-Robertson-Walker (FRW) universe was investigated by using the tunneling formalism. They obtained the Hawking temperature associated with the apparent horizon, which was extensively applied in investigating the relationship between the first law of thermodynamics and Friedmann equations. In this Letter, we calculate fermions' Hawking radiation from the apparent horizon of FRW universe via tunneling formalism. Applying WKB approximation to the general covariant Dirac equation in FRW spacetime background, the radiation spectrum and Hawking temperature of apparent horizon are correctly recovered, which supports the arguments presented in the paper [R.-G. Cai, L.-M. Cao, Y.-P. Hu, (arXiv: 0809.1554)
Energy Technology Data Exchange (ETDEWEB)
Krauss, Mark J
2007-03-01
The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation for closure of CAU 137 with no further corrective action. To achieve this, corrective action investigation (CAI) activities were performed from February 28 through August 17, 2006, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 137: Waste Disposal Sites. The purpose of the CAI was to fulfill the following data needs as defined during the data quality objective process: • Determine whether contaminants of concern (COCs) are present. • If COCs are present, determine their nature and extent. • Provide sufficient information and data to complete appropriate corrective actions. ROTC-1: Downgrade FFACO UR at CAU 137, CAS 07-23-02, Radioactive Waste Disposal Site to an Administrative UR. ROTC-2: Downgrade FFACO UR at CAU 137, CAS 01-08-01, Waste Disposal Site to an Administrative UR.
Controlled-air incineration studies at the Los Alamos Scientific Laboratory
International Nuclear Information System (INIS)
Borduin, L.C.; Neuls, A.S.; Thompson, T.K.; Warner, C.L.
1978-01-01
An overview of the LASL controlled-air incineration (CAI) program is provided through a description of the process, a summary of component selection and system design criteria, a statement of project status, and discussion of experimental and process improvement study plans. The results of the program will be used to formulate the design criteria and operating parameters for a production model controlled-air transuranic (TRU) waste incineration system and govern the construction and operation of a facility for this purpose. The objective of the LASL CAI project is to develop and demonstrate an effective, safe, and reliable process for volume reduction and chemical stabilization of TRU solid wastes using proven technology whenever possible. The benefits of this process will be realized in reduced handling and storage hazards potentials, lower packaging, transportation, and storage expenses, less storage space requirements, and fewer monitoring needs
International Nuclear Information System (INIS)
Furuhama, Yutaka; Furuta, Kazuo; Kondo, Shunsuke
1995-01-01
This paper proposes a methodology to identify causes of human error in the operation of plant systems to support the development of CAI system for operator training. The target task of this methodology is goal-driven and knowledge-based planning behaviour, the cognitive process of which is assumed to be modeled as means-end analysis. The methodology uses four criteria to classify errors in an operation into eight groups, and then asks the trainee several questions to prune the causes. To confirm the usefulness of this methodology, a prototype CAI system is developed for the operation of filling up sodium into the primary coolant system of a liquid-metal-cooled fast reactor. The experimental result indicates that the system has the capability of identifying causes of the trainee's error, and consequently of figuring out the characteristics of his/her defect. As a result of this study, several issues are identified for future research
Freeform surface measurement and characterisation using a toolmakers microscope
International Nuclear Information System (INIS)
Wong, Francis Seung-yin; Chauh, Kong-Bieng; Venuvinod, Patri K
2014-01-01
Current freeform surface (FFS) characterization systems mainly cover aspects related to computer-aided design/manufacture (CAD/CAM). This paper describes a new approach that extends into computer-aided inspection (CAI).The following novel features are addressed: - ◼ Feature recognition and extraction from surface data; - ◼ Characterisation of properties of the surface's M and N vectors at individual vertex; - ◼ Development of a measuring plan using a toolmakers microscope for the inspection of the FFS; - ◼ Inspection of the actual FFS produced by CNC milling; - ◼ Verification of the measurement results and comparison with the CAD design data; Tests have shown that the deviations between the CAI and CAD data were within the estimated uncertainty limits
Gribble, Phillip A; Bleakley, Chris M; Caulfield, Brian M; Docherty, Carrie L; Fourchet, François; Fong, Daniel Tik-Pui; Hertel, Jay; Hiller, Claire E; Kaminski, Thomas W; McKeon, Patrick O; Refshauge, Kathryn M; Verhagen, Evert A; Vicenzino, Bill T; Wikstrom, Erik A; Delahunt, Eamonn
2016-12-01
The Executive Committee of the International Ankle Consortium presents this 2016 position paper with recommendations for information implementation and continued research based on the paradigm that lateral ankle sprain (LAS), and the development of chronic ankle instability (CAI), serve as a conduit to a significant global healthcare burden. We intend our recommendations to serve as a mechanism to promote efforts to improve prevention and early management of LAS. We believe this will reduce the prevalence of CAI and associated sequelae that have led to the broader public health burdens of decreased physical activity and early onset ankle joint post-traumatic osteoarthritis. Ultimately, this can contribute to healthier lifestyles and promotion of physical activity. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.
Climatology (communication arising): Rural land-use change and climate
Trenberth, Kevin E.
2004-01-01
Kalnay and Cai claim that urbanization and land-use change have a major effect on the climate in the United States. They used surface temperatures obtained from NCEP/NCAR 50-year reanalyses (NNR) and their difference compared with observed station surface temperatures as the basis for their conclusions, on the grounds that the NNR did not include these anthropogenic effects. However, we note that the NNR also overlooked other factors, such as known changes in clouds and in surface moisture, which are more likely to explain Kalnay and Cai's findings. Although urban heat-island effects are real in cities, direct estimates of the effects of rural land-use change indicate a cooling rather than a warming influence that is due to a greater reflection of sunlight.
Commercial incineration demonstration
International Nuclear Information System (INIS)
Borduin, L.C.; Neuls, A.S.
1981-01-01
Low-level radioactive wastes (LLW) generated by nuclear utilities presently are shipped to commercial burial grounds for disposal. Substantially increasing shipping and disposal charges have sparked renewed industry interest in incineration and other advanced volume reduction techniques as potential cost-saving measures. Repeated inquiries from industry sources regarding LLW applicability of the Los Alamos controlled-air incineration (CAI) design led DOE to initiate this commercial demonstration program in FY-1980. The selected program approach to achieving CAI demonstration at a utility site is a DOE sponsored joint effort involving Los Alamos, a nuclear utility, and a liaison subcontractor. Required development tasks and responsibilities of the particpants are described. Target date for project completion is the end of FY-1985
Evidence for multiple sources of 10Be in the early solar system
DEFF Research Database (Denmark)
Wielandt, Daniel Kim Peel; Nagashima, Kazuhide; Krot, Alexander N.
2012-01-01
Beryllium-10 is a short-lived radionuclide (t 1/2 = 1.4 Myr) uniquely synthesized by spallation reactions and inferred to have been present when the solar system's oldest solids (calcium-aluminum-rich inclusions, CAIs) formed. Yet, the astrophysical site of 10Be nucleosynthesis is uncertain. We...... in the gaseous CAI-forming reservoir, or in the inclusions themselves: this indicates at least two nucleosynthetic sources of 10Be in the early solar system. The most promising locale for 10Be synthesis is close to the proto-Sun during its early mass-accreting stages, as these are thought to coincide...
Macpherson, Glenn J.; Davis, Andrew M.
1993-01-01
A Type B Ca-, Al-rich 6-m-diam inclusion (CAI) found in the Vigarano C3V chondrite was inspected using optical and scanning electron microscopies and ion microprobe analyses. It was found that the primary constituents of the CAI inclusion are (in percent), melilite (52), fassaite, (20), anorthite (18), spinel (10), and trace Fe-Ni metal. It is noted that, while many of the properties of the inclusion indicate solidification from a melt droplet, the Al-26/Mg-26 isotopic systematics and some textural relationships are incompatible with single-stage closed system crystallization of a homogeneous molten droplet, indicating that the history of this inclusion must have been more complex than melt solidification alone. Moreover, there was unusually high content of Na in melilite, suggesting that the droplet did not form by melting of pristine high-temperature nebular condensates.
Climatology (communication arising): rural land-use change and climate.
Trenberth, Kevin E
2004-01-15
Kalnay and Cai claim that urbanization and land-use change have a major effect on the climate in the United States. They used surface temperatures obtained from NCEP/NCAR 50-year reanalyses (NNR) and their difference compared with observed station surface temperatures as the basis for their conclusions, on the grounds that the NNR did not include these anthropogenic effects. However, we note that the NNR also overlooked other factors, such as known changes in clouds and in surface moisture, which are more likely to explain Kalnay and Cai's findings. Although urban heat-island effects are real in cities, direct estimates of the effects of rural land-use change indicate a cooling rather than a warming influence that is due to a greater reflection of sunlight.
PSYCHE: An Object-Oriented Approach to Simulating Medical Education
Mullen, Jamie A.
1990-01-01
Traditional approaches to computer-assisted instruction (CAI) do not provide realistic simulations of medical education, in part because they do not utilize heterogeneous knowledge bases for their source of domain knowledge. PSYCHE, a CAI program designed to teach hypothetico-deductive psychiatric decision-making to medical students, uses an object-oriented implementation of an intelligent tutoring system (ITS) to model the student, domain expert, and tutor. It models the transactions between the participants in complex transaction chains, and uses heterogeneous knowledge bases to represent both domain and procedural knowledge in clinical medicine. This object-oriented approach is a flexible and dynamic approach to modeling, and represents a potentially valuable tool for the investigation of medical education and decision-making.
Yusepa, B. G. P.; Kusumah, Y. S.; Kartasasmita, B. G.
2018-01-01
The aim of this study is to get an in-depth understanding of students’ abstract-thinking ability in mathematics learning. This study was an experimental research with pre-test and post-test control group design. The subject of this study was eighth-grade students from two junior high schools in Bandung. In each schools, two parallel groups were selected and assigned into control and experimental groups. The experimental group was exposed to Cognitive Apprenticeship Instruction (CAI) treatment, whereas the control group was exposed to conventional learning. The results showed that abstract-thinking ability of students in experimental group was better than that of those in control group in which it could be observed from the overall and school level. It could be concluded that CAI could be a good alternative learning model to enhance students’ abstract-thinking ability.
Mutaciones culturales de Chiloé: los mitos y las leyendas en la modernidad neoliberal isleña
Directory of Open Access Journals (Sweden)
Sergio Mansilla Torres
2009-01-01
Full Text Available El conflicto entre tradición y modernidad cultural de las islas de Chiloé, Chile, agudizado a partir de la década de 1980 cuando Chiloé se convierte en un centro de producción acuícola para la exportación a gran escala, re vive, en los umbrales del siglo XXI, el mito fundacional de las islas: Ten-ten Vilú, la serpiente de la tierra que defiende a los humanos, y Cai-cai Vilú, la serpiente del agua que quiere exterminarlos. Chiloé se halla en una etapa si no refundacional sí de profundas mutaciones de su identidad, etapa en la que, nuevamente, como en los orígenes mitológicos, se enfrentan fuerzas, al parecer irreconciliables, que tensionan el modo de ser, de habitar y de soñar de los chilotes.
Directory of Open Access Journals (Sweden)
Nanette Edeiken-Cooperman
2014-10-01
Full Text Available This article discusses the use of computer-assisted instruction (CAI to teach Social Stories as a method of positively affecting the social understanding and behaviors of learners who have been diagnosed on the autism spectrum. As the diagnosis rate for those with ASD continues to rise along with the practice of including these learners in the general education environment, there is an increasing need to identify evidence-based practices that focus on the acquisition and remediation of social-communication skills, social skills, and social competence. A variety of strategies have been developed and implemented to remediate deficits in these areas. The use of CAI is an approach that has been proven to accommodate both the needs and the visual learning styles of these learners.
Zhao, H.; Zhang, S.
2008-01-01
One of the most effective means to achieve controlled auto-ignition (CAI) combustion in a gasoline engine is by the residual gas trapping method. The amount of residual gas and mixture composition have significant effects on the subsequent combustion process and engine emissions. In order to obtain quantitative measurements of in-cylinder residual gas concentration and air/fuel ratio, a spontaneous Raman scattering (SRS) system has been developed recently. The optimized optical SRS setups are presented and discussed. The temperature effect on the SRS measurement is considered and a method has been developed to correct for the overestimated values due to the temperature effect. Simultaneous measurements of O2, H2O, CO2 and fuel were obtained throughout the intake, compression, combustion and expansion strokes. It shows that the SRS can provide valuable data on this process in a CAI combustion engine.
International Nuclear Information System (INIS)
Zhao, H; Zhang, S
2008-01-01
One of the most effective means to achieve controlled auto-ignition (CAI) combustion in a gasoline engine is by the residual gas trapping method. The amount of residual gas and mixture composition have significant effects on the subsequent combustion process and engine emissions. In order to obtain quantitative measurements of in-cylinder residual gas concentration and air/fuel ratio, a spontaneous Raman scattering (SRS) system has been developed recently. The optimized optical SRS setups are presented and discussed. The temperature effect on the SRS measurement is considered and a method has been developed to correct for the overestimated values due to the temperature effect. Simultaneous measurements of O 2 , H 2 O, CO 2 and fuel were obtained throughout the intake, compression, combustion and expansion strokes. It shows that the SRS can provide valuable data on this process in a CAI combustion engine
Complete Genome Sequence of the Endophytic Biocontrol Strain Bacillus velezensis CC09.
Cai, Xunchao; Kang, Xingxing; Xi, Huan; Liu, Changhong; Xue, Yarong
2016-09-29
Bacillus velezensis is a heterotypic synonym of B. methylotrophicus, B. amyloliquefaciens subsp. plantarum, and Bacillus oryzicola, and has been used to control plant fungal diseases. In order to fully understand the genetic basis of antimicrobial capacities, we did a complete genome sequencing of the endophytic B. velezensis strain CC09. Genes tightly associated with biocontrol ability, including nonribosomal peptide synthetases, polyketide synthetases, iron acquisition, colonization, and volatile organic compound synthesis were identified in the genome. Copyright © 2016 Cai et al.
In Silico Genome Mismatch Scanning to Map Breast Cancer Genes in Extended Pedigrees
2009-07-01
of ASPM, a Brain Size Determinant in Homo sapiens . This manuscript was prepared with the AAS LATEX macros v5.2. – 14 – 6. Figures and Tables – 15...Cai et al. 2009) describing, and ex- plaining, some anomalous features that could have let to false positive results if left unin- vestigated. This...are well behaved, tractable and flexible. This class is defined and the main features of estimation methods are described below. The Markov graph of a
NCBI nr-aa BLAST: CBRC-CINT-01-0131 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CINT-01-0131 ref|NP_149421.1| central cannabinoid receptor isoform b [Homo sap...iens] emb|CAA57019.1| central cannabinoid receptor [Homo sapiens] emb|CAI19916.1| cannabinoid receptor 1 (br...ain) [Homo sapiens] gb|EAW48575.1| cannabinoid receptor 1 (brain), isoform CRA_b [Homo sapiens] NP_149421.1 6e-31 29% ...
Effect of water content and organic carbon on remote sensing of crop residue cover
Serbin, G.; Hunt, E. R., Jr.; Daughtry, C. S. T.; McCarty, G. W.; Brown, D. J.; Doraiswamy, P. C.
2009-04-01
Crop residue cover is an important indicator of tillage method. Remote sensing of crop residue cover is an attractive and efficient method when compared with traditional ground-based methods, e.g., the line-point transect or windshield survey. A number of spectral indices have been devised for residue cover estimation. Of these, the most effective are those in the shortwave infrared portion of the spectrum, situated between 1950 and 2500 nm. These indices include the hyperspectral Cellulose Absorption Index (CAI), and advanced multispectral indices, i.e., the Lignin-Cellulose Absorption (LCA) index and the Shortwave Infrared Normalized Difference Residue Index (SINDRI), which were devised for the NASA Terra Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) sensor. Spectra of numerous soils from U.S. Corn Belt (Indiana and Iowa) were acquired under wetness conditions varying from saturation to oven-dry conditions. The behavior of soil reflectance with water content was also dependent on the soil organic carbon content (SOC) of the soils, and the location of the spectral bands relative to significant water absorptions. High-SOC soils showed the least change in spectral index values with increase in soil water content. Low-SOC soils, on the other hand, showed measurable difference. For CAI, low-SOC soils show an initial decrease in index value followed by an increase, due to the way that water content affects CAI spectral bands. Crop residue CAI values decrease with water content. For LCA, water content increases decrease crop residue index values and increase them for soils, resulting in decreased contrast. SINDRI is also affected by SOC and water content. As such, spatial information on the distribution of surface soil water content and SOC, when used in a geographic information system (GIS), will improve the accuracy of remotely-sensed crop residue cover estimates.
A task-driven design model for collaborative AmI systems
Arroyo, Roberto F.; Gea, Miguel; Garrido, José Luis; Haya, Pablo A.
2006-01-01
Proceedings of the CAISE*06 Workshop on Ubiquitous Mobile Information and Collaboration Systems UMICS '06. Luxemburg, June 5-9, 2006. The proceedings of this workshop also appeared in printed version In T. Latour and M. Petit (eds), Proceedings of Workshops and Doctoral Consortium, The 18th International Conference on Advanced Information Systems Engineering - Trusted Information Systems (CAiSE'06), June 5-9, 2006, Presses Universitaires de Namur, 2006, ISBN 2-87037-525. Also publishe...
U. S. Naval Forces, Vietnam Monthly Historical Supplement for November 1966
1967-02-16
the mouth of the Cai Lon River near Rach Gia on the Ca Mau Peninsula 65 » alea east of An Thoi. Five Viet Cong were killed while the Coastal Group...force, moved through Jungles and over mountains under heavy monsoon rains without enemy contact. This operation, which ended on 18 November, marked...crash. The battalion also constructed an all-weather road to the top of Monkey Mountain and built an Air Force radar site there. MCB-11 replaced
Computer training, present and future.
Smith, G. A.
1972-01-01
The products of educational firms today lead toward a multimedia approach to the education and training of commercial programmers and systems analysts. Computer-assisted instruction or CAI is a relatively new medium to augment the other media. The government use of computers is discussed together with the importance of computer pretests. Pretests can aid in determining a person's ability to absorb a particular instructional level. The material presented in a number of computer courses is listed.
International Nuclear Information System (INIS)
US Department of Energy Nevada Operations Office
1999-01-01
This Corrective Action Decision Document/Closure Report (CADD/CR) has been prepared for Corrective Action Unit (CAU) 232, Area 25 Sewage Lagoons, in accordance with the Federal Facility Agreement and Consent Order. Located at the Nevada Test Site in Nevada, approximately 65 miles northwest of Las Vegas, CAU 232 is comprised of Corrective Action Site 25-03-01, Sewage Lagoon. This CADD/CR identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's (DOE/NV's) recommendation that no corrective action is deemed necessary for CAU 232. The Corrective Action Decision Document and Closure Report have been combined into one report because sample data collected during the July 1999 corrective action investigation (CAI) activities disclosed no evidence of contamination at the site. Contaminants of potential concern (COPCs) addressed during the CAI included total volatile organic compounds, total semivolatile organic compounds, total Resource Conservation and Recovery Act metals, total pesticides, total herbicides, total petroleum hydrocarbons (gasoline and diesel/oil range), polychlorinated biphenyls, isotopic uranium, isotopic plutonium, strontium-90, and gamma-emitting radionuclides. The data confirmed that none of the COPCs identified exceeded preliminary action levels outlined in the CAIP; therefore, no corrective actions were necessary for CAU 232. After the CAI, best management practice activities were completed and included installation of a fence and signs to limit access to the lagoons, cementing Manhole No. 2 and the diverter box, and closing off influent and effluent ends of the sewage lagoon piping. As a result of the CAI, the DOE/NV recommended that: (1) no further actions were required; (2) no Corrective Action Plan would be required; and (3) no use restrictions were required to be placed on the CAU
Reza Kalantari; Javad Gholami
2017-01-01
This longitudinal case study explored Iranian EFL learners’ lexical complexity (LC) through the lenses of Dynamic Systems Theory (DST). Fifty independent essays written by five intermediate to advanced female EFL learners in a TOEFL iBT preparation course over six months constituted the corpus of this study. Three Coh-Metrix indices (Graesser, McNamara, Louwerse, & Cai, 2004; McNamara & Graesser, 2012), three Lexical Complexity Analyzer indices (Lu, 2010, 2012; Lu & Ai, 2011...
H?rtl, Roger; Alimi, Marjan; Abdelatif Boukebir, Mohamed; Berlin, Connor D.; Navarro-Ramirez, Rodrigo; Arnold, Paul M.; Fehlings, Michael G.; Mroz, Thomas E.; Riew, K. Daniel
2017-01-01
Study Design: Retrospective study and literature review. Objective: To provide more comprehensive data about carotid artery injury (CAI) or cerebrovascular accident (CVA) related to anterior cervical spine surgery. Methods: We conducted a retrospective, multicenter, case series study involving 21 high-volume surgical centers from the AOSpine North America Clinical Research Network. Medical records of 17?625 patients who went through cervical spine surgery (levels from C2 to C7) between Januar...
IEEE Conference Record of 1976 Twelfth Modulator Symposium, New York City, 4-5 February 1976.
1976-01-01
volt, 7 ampere compactness, no standby power, and competitive economi - rms, thyristor in a TO-S can) was also considered. cally. Correspondence with...VI V, J* t2 OA WN.T18 MM EGMLS WMPL MW .TAE Fts Puuu 2B - GeEMTinn nP CLOSEY WACED PULSE BY A SHAM. SCRTNAEY IIIs~ 2 T Sv1 cAi 4.-JI j 1f -W J1YL’ LJ
Doherty, Cailbhe; Bleakley, Chris; Delahunt, Eamonn; Holden, Sinead
2017-01-01
Ankle sprains are highly prevalent with high risk of recurrence. Consequently, there are a significant number of research reports examining strategies for treating and preventing acute and recurrent sprains (otherwise known as chronic ankle instability (CAI)), with a coinciding proliferation of review articles summarising these reports. To provide a systematic overview of the systematic reviews evaluating treatment strategies for acute ankle sprain and CAI. Overview of intervention systematic reviews. Individuals with acute ankle sprain/CAI. The primary outcomes were injury/reinjury incidence and function. 46 papers were included in this systematic review. The reviews had a mean score of 6.5/11 on the AMSTAR quality assessment tool. There was strong evidence for bracing and moderate evidence for neuromuscular training in preventing recurrence of an ankle sprain. For the combined outcomes of pain, swelling and function after an acute sprain, there was strong evidence for non-steroidal anti-inflammatory drugs and early mobilisation, with moderate evidence supporting exercise and manual therapy techniques. There was conflicting evidence regarding the efficacy of surgery and acupuncture for the treatment of acute ankle sprains. There was insufficient evidence to support the use of ultrasound in the treatment of acute ankle sprains. For the treatment of acute ankle sprain, there is strong evidence for non-steroidal anti-inflammatory drugs and early mobilisation, with moderate evidence supporting exercise and manual therapy techniques, for pain, swelling and function. Exercise therapy and bracing are supported in the prevention of CAI. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.
Carbonic anhydrase inhibition increases retinal oxygen tension and dilates retinal vessels
DEFF Research Database (Denmark)
Pedersen, Daniella Bach; Koch Jensen, Peter; la Cour, Morten
2005-01-01
Carbonic anhydrase inhibitors (CAIs) increase blood flow in the brain and probably also in the optic nerve and retina. Additionally they elevate the oxygen tension in the optic nerve in the pig. We propose that they also raise the oxygen tension in the retina. We studied the oxygen tension in the...... in the pig retina and optic nerve before and after dorzolamide injection. Also the retinal vessel diameters during carbonic anhydrase inhibition were studied....
Willoughby, Karen A.; Desrocher, Mary; Levine, Brian; Rovet, Joanne F.
2012-01-01
Few studies have examined both episodic and semantic autobiographical memory (AM) performance during late childhood and early adolescence. Using the newly developed Children’s Autobiographical Interview (CAI), the present study examined the effects of age and sex on episodic and semantic AM and everyday memory in 182 children and adolescents. Results indicated that episodic and semantic AM both improved between 8 and 16 years of age; however, age-related changes were larger for episodic AM th...