Coherent atomic and molecular spectroscopy in the far infrared

International Nuclear Information System (INIS)

Inguscio, M.

1988-01-01

Recent advances in far infrared spectroscopy of atoms (fine structure transitions) and molecules (rotational transitions) are reviewed. Results obtained by means of Laser Magnetic Resonance, using fixed frequency lasers, and Tunable Far Infrared spectrometers are illustrated. The importance of far infrared spectroscopy for several fields, including astrophysics, atmospheric physics, atomic structure and metology, is discussed. (orig.)

The new CHESS wiggler

International Nuclear Information System (INIS)

Finkelstein, K.D.

1992-01-01

A 25-pole permanent magnet hybrid wiggler has been built at CHESS and installed on the CESR (Cornell Electron Storage Ring). This device has a magnetic period of 19.6 cm, a peak on-axis field of 1.2 T at the nominal operating gap of 4.0 cm, and a K parameter of 22. The wiggler has been designed to provide radiation for two new experimental stations with approximately four times the flux available from the present CHESS six-pole electromagnet wiggler. Under normal running conditions at 100 mA currents, the total power radiated should exceed 6 kW making this one of the highest flux x-ray sources below 1 A critical wavelength. In this paper an overview of the development of the wiggler is given, including the unique features in its design and construction as well as results of measurements obtained on its magnetic and spectral properties

Polarized wiggler for NSLS X-ray ring

International Nuclear Information System (INIS)

Friedman, A.; Zhang, X.; Krinsky, S.; Blum, E.B.

1993-01-01

We examine the properties of an elliptically polarized wiggler that will generate circularly polarized photons with energy spectrum of 3--12 KeV. The vertical wiggler magnetic field is produced by permanent magnets while the horizontal wiggler field is generated by electric coils capable of AC excitation. The radiation parameters of the wiggler is discussed. We consider AC excitation of the wiggler to produce the time modulation of the elliptic polarization. The power is dissipated in the vacuum chamber due to the eddy current

Far-infrared spectroscopy of neutral interstellar clouds

International Nuclear Information System (INIS)

Watson, D.M.

1984-01-01

A summary is presented of airborne observations of the far-infrared fine structure lines of neutral atomic oxygen and singly-ionized carbon, and of the far-infrared rotational lines of CO, OH, NH 3 and HD, together with a brief description of the analysis and interpretation of the spectra. The 'state of the art' in instrument performance and the prospects for improved sensitivity and resolution are also surveyed. (Auth.)

Josephson effect far-infrared detector

International Nuclear Information System (INIS)

Shapiro, S.

1971-01-01

Four Josephson effect schemes for detection of far-infrared radiation are reviewed: Video broad-band detection, regenerative detection, conventional mixing for monochromatic signals, and self-mixing or frequency conversion. (U.S.)

New wiggler beam line for SSRL

International Nuclear Information System (INIS)

Hoyer, E.

1982-08-01

A new high-intensity-beam line with a wiggler magnet source is described. This project, in final stages of design, is a joint effort between Lawrence Berkeley Laboratory (LBL), the Exxon Research and Engineering Company (EXXON), and the Stanford Synchrotron Radiation Laboratory (SSRL). Installation at SSRL will begin in the summer of 1982. The goal of this project is to provide extremely high-brightness synchrotron radiation beams over a broad spectral range from 50 eV to 40 keV. The radiation source is a 27 period (i.e., 55 pole) permanent magnet wiggler of a new design. The wiggler utilizes rare-earth cobalt (REC) material in the steel hybrid configuration to achieve high magnetic fields with short periods. An analysis has been made of the polarization, angular distribution and power density of the radiation produced by the wiggler. Details of the wiggler design are presented. The magnet is outside a thin walled (1mm) variable gap stainless steel vacuum chamber. The chamber gap will be opened to 1.8 cm for beam injection into SPEAR and then closed to 1.0 cm (or less) for operation. Five remotely controlled drives are provided; to change the wiggler gap, to change the vacuum chamber aperture and to position the wiggler. Details of the beam line optics and end stations are presented. Thermal loading on beam line components is severe. The peak power density at 7.5 m is 5 kW/cm 2 for the nominal wiggler field and present SPEAR beam currents and will approach 20 kW/cm 2 with the maximum wiggler field and projected SPEAR beam currents

Symplectic integration for complex wigglers

International Nuclear Information System (INIS)

Forest, E.; Ohmi, K.

1992-01-01

Using the example of the helical wiggler proposed for the KEK photon factory, we show how to integrate the equation of motion through the wiggler. The integration is performed in cartesian coordinates. For the usual expanded Hamiltonian (without square root), we derive a first order symplectic integrator for the purpose of tracking through a wiggler in a ring. We also show how to include classical radiation for the computation of the damping decrement

Nonlinear analysis of wiggler-imperfections in free-electron lasers

Energy Technology Data Exchange (ETDEWEB)

Freund, H.P. [Naval Research Lab., Washington, DC (United States); Yu, L.H. [Brookhaven National Lab., Upton, NY (United States)

1995-12-31

We present an analysis of the effect of wiggler imperfections in FELs using a variety of techniques. Our basic intention is to compare wiggler averaged nonlinear simulations to determine the effect of various approximations on the estimates of gain degradation due to wiggler imperfections. The fundamental assumption in the wiggler-averaged formulations is that the electrons are described by a random walk model, and an analytic representation of the orbits is made. This is fundamentally different from the approach taken for the non-wiggler-averaged formulation in which the wiggler imperfections are specified at the outset, and the orbits are integrated using a field model that is consistent with the Maxwell equations. It has been conjectured on the basis of prior studies using the non-wiggler-averaged formalism that electrons follow a {open_quotes}meander line{close_quotes} through the wiggler governed by the specific imperfections; hence, the electrons behave more as a ball-in-groove than as a random walk. This conjecture is tested by comparison of the wiggler-averaged and non-wiggler-averaged simulations. In addition, two different wiggler models are employed in the non-wiggler-averaged simulation: one based upon a parabolic pole face wiggler which is not curl and divergence free in the presence of wiggler imperfections, and a second model in which the divergence and z-component of the curl vanish identically. This will gauge the effect of inconsistencies in the wiggler model on the estimation of the effect of the imperfections. Preliminary results indicate that the inconsistency introduced by the non-vanishing curl and divergence result in an overestimation of the effect of wiggler imperfections on the orbit. The wiggler-averaged simulation is based upon the TDA code, and the non-wiggler-averaged simulation is a variant of the ARACHNE and WIGGLIN codes called MEDUSA developed to treat short-wavelength Gauss-Hermite modes.

A novel micro wiggler

International Nuclear Information System (INIS)

Liu Qingxiang; Xu Yong

1995-01-01

A novel structure of the micro-wiggler is presented. The authors developed a simplified theoretical model of the micro-wiggler. According to the model, an analytic formula of the magnetic field in two dimensions is got. A calculated program (PWMW-I) is developed from the formula. PWMW-I can calculate the field on the axis and the off-axis for the number of periods N, and the entrance or the exit of the micro-wiggler. Three model with different period (10 mm, 5 mm and 3 mm) is designed on the program. The 5T peak field for the period of 3 mm at the gap of 1 mm is got

Far-infrared observations of Large Magellanic Cloud H II regions

International Nuclear Information System (INIS)

Werner, M.W.; Becklin, E.E.; Gatley, I.; Ellis, M.J.; Hyland, A.R.; Robinson, G.; Thomas, J.A.

1978-01-01

Far-infrared emission has been measured from four Large Magellanic Cloud H II regions: the 30 Doradus nebula, MC75, MC76 and MC77. The far-infrared radiation is thermal emission from dust heated by starlight. The results show that the LMC H II regions, like H II regions in the Galaxy, have far-infrared luminosities comparable to the total luminosity of their exciting stars. (author)

Development of a strong electromagnet wiggler

International Nuclear Information System (INIS)

Burns, M.J.; Deis, G.A.; Holmes, R.H.; Van Maren, R.D.; Halbach, K.

1987-01-01

The Strong Electromagnet (SEM) wiggler is a permanent magnet-assisted electromagnet under development at the Lawrence Livermore National Laboratory (LLNL) as part of the Induction Linac Free-Electron-Laser (IFEL) program. This concept uses permanent magnets within the wiggler to provide a reverse bias flux in the iron and thus delay the onset of magnetic saturation. The electromagnet coils determine the wiggler field and operate at low current densities by virtue of their placement away from the midplane. We describe here the design approach used and test data from a 7-period wiggler prototype that includes curved pole tips to provide wiggle-plane focusing. 7 refs

Conceptual thermal design and analysis of a far-infrared/mid-infrared remote sensing instrument

Science.gov (United States)

Roettker, William A.

1992-07-01

This paper presents the conceptual thermal design and analysis results for the Spectroscopy of the Atmosphere using Far-Infrared Emission (SAFIRE) instrument. SAFIRE has been proposed for Mission to Planet Earth to study ozone chemistry in the middle atmosphere using remote sensing of the atmosphere in the far-infrared (21-87 microns) and mid-infrared (9-16 microns) spectra. SAFIRE requires that far-IR detectors be cooled to 3-4 K and mid-IR detectors to 80 K for the expected mission lifetime of five years. A superfluid helium dewar and Stirling-cycle cryocoolers provide the cryogenic temperatures required by the infrared detectors. The proposed instrument thermal design uses passive thermal control techniques to reject 465 watts of waste heat from the instrument.

Progress in far-infrared spectroscopy: Approximately 1890 to 1970

Science.gov (United States)

Mitsuishi, Akiyoshi

2014-03-01

The history of far-infrared spectroscopy from its beginning to around 1970 is reviewed. Before World War II, the size of the community investigating this topic was limited. During this period, in particular before 1925, about 90% of the papers were published by H. Rubens and his co-workers in Germany. One or two researchers from the US joined the Rubens group per year from 1890 to the beginning of 1910. During the next year or two, some researchers joined M. Czerny, who is seen as the successor of Rubens. After World War II, far-infrared techniques progressed further in the US, which did not suffer damage during the war. The advanced techniques of far-infrared grating spectroscopy were transferred from the US (R. A. Oetjen) to Japan (H. Yoshinaga). Yoshinaga and his co-workers expanded the techniques by themselves. This paper describes the historical development of far-infrared spectroscopy before Fourier transform spectroscopy became popular around 1970.

Wiggler magnets at SSRL

International Nuclear Information System (INIS)

Winick, H.

1980-01-01

A wiggler magnet has been installed in SPEAR and has been routinely used as a radiation source for Beam Line IV at SSRL since March, 1979. The magnets is 1.22 m long. It has five full central poles and two end half-poles producing a total of three complete small amplitude (<= 1 mm) oscillations of the electron beam in traversing the magnet. The magnet has been operated with the peak field in the central full poles at 17.2 kG and produces an intense beam of synchrotron radiation extending to 12 keV and beyond even at the lowest operating energies of SPEAR (1.5 GeV). It is compatible with all phases of colliding-beam operation of SPEAR and has improved the colliding-beam luminosity. The results of measurements on the spectrum and intensity of the radiation produced by the Wiggler will be presented. The measured effects of the wiggler on the stored beam tunes, energy spread and emittance will also be presented. Plans will also be described for installing additional high field wiggler magnets in SPEAR and also weak-field, many-period undulator magnets in both SPEAR and PEP. (orig.)

Prediction of the diffuse far-infrared flux from the galactic plane

International Nuclear Information System (INIS)

Fazio, G.G.; Stecker, F.W.

1976-01-01

A basic model and simple numerical relations useful for future far-infrared studies of the Galaxy are presented. Making use of recent CO and other galactic surveys, we then predict the diffuse far-infrared flux distribution from the galactic plane as a function of galactic longitude l for 4degree< or =l< or =90degree and the far-infrared emissivity as a function of galactocentric distance. Future measurements of the galactic far-infrared flux would yield valuable information on the physical properties and distribution of dust and molecular clouds in the Galaxy, particulary the inner region

Development of a laced electromagnetic wiggler

International Nuclear Information System (INIS)

Christensen, T.C.; Burns, M.J.; Deis, G.A.; Parkison, C.D.; Prosnitz, D.; Halbach, K.

1987-01-01

The laced electromagnetic wiggler is a new concept being developed to attain higher magnetic fields, shorter wavelengths, and larger gaps for the induction-linear accelerator, free-electron-laser (FEL) program. In the laced wiggler design, permanent magnets are located (''laced'') between the electromagnetic coils to increase the reverse-bias flux in the iron pole beyond that possible with only pole-edge (''side'') permanent magnets. This increase in reverse-bias flux allows wiggler operation at midplane magnetic field intensities comparable to those of a hybrid permanent magnet/steel wiggler, but with field adjustability over a specified range. The maximum field intensity and tuning range are selected, within limits, for specific design requirements. We have designed and tested a one-period prototype of this concept with promising results

Multichannel far-infrared phase imaging for fusion plasmas

International Nuclear Information System (INIS)

Young, P.E.; Neikirk, D.P.; Tong, P.P.; Rutledge, D.B.; Luhmann, N.C. Jr.

1985-01-01

A 20-channel far-infrared imaging interferometer system has been used to obtain single-shot density profiles in the UCLA Microtor tokamak. This system differs from conventional multichannel interferometers in that the phase distribution produced by the plasma is imaged onto a single, monolithic, integrated microbolometer linear detector array and provides significantly more channels than previous far-infrared interferometers. The system has been demonstrated to provide diffraction-limited phase images of dielectric targets

Polarized wiggler for NSLS x-ray ring design considerations

International Nuclear Information System (INIS)

Friedman, A.; Krinsky, S.; Blum, E.

1992-03-01

We examine the properties of an elliptically polarized wiggler that will generate circularly polarized photons with energy spectrum of 3--12 KeV. The vertical wiggler magnetic field is produced by permanent magnets while the horizontal wiggler field is generated by electric coils capable of AC excitation. The radiation parameters of the wiggler are presented, including photon flux, circular and linear polarization and spectrum. These parameters are compared to the synchrotron radiation from a bending magnet. Numerical values are calculated for radiation from the wiggler and bending magnet for the NSLS X-ray ring parameters. A conceptual design for such a wiggler is discussed and several different alternatives are analyzed. We consider AC excitation of the wiggler to produce the time modulation of the elliptic polarization, and also to produce time modulated linearly polarized radiation

Far infrared peculiar behavior of quasars

International Nuclear Information System (INIS)

Liu Yulin; Liu Jiying

1988-09-01

Many quasars possibly have nebulous envelopes with far infrared radiation. These nebulosities may be similar to fuzz in the optical region in morphology. These quasars have many properties in common. (author). Refs, 3 figs

Brightness of synchrotron radiation from wigglers

International Nuclear Information System (INIS)

Geloni, Gianluca; Kocharyan, Vitali; Saldin, Evgeni

2014-12-01

According to literature, while calculating the brightness of synchrotron radiation from wigglers, one needs to account for the so called 'depth-of-field' effects. In fact, the particle beam cross section varies along the wiggler. It is usually stated that the effective photon source size increases accordingly, while the brightness is reduced. Here we claim that this is a misconception originating from an analysis of the wiggler source based on geometrical arguments, regarded as almost self-evident. According to electrodynamics, depth-of-field effects do not exist: we demonstrate this statement both theoretically and numerically, using a well-known first-principle computer code. This fact shows that under the usually accepted approximations, the description of the wiggler brightness turns out to be inconsistent even qualitatively. Therefore, there is a need for a well-defined procedure for computing the brightness from a wiggler source. We accomplish this task based on the use of a Wigner function formalism. In the geometrical optics limit computations can be performed analytically. Within this limit, we restrict ourselves to the case of the beam size-dominated regime, which is typical for synchrotron radiation facilities in the X-ray wavelength range. We give a direct demonstration of the fact that the apparent horizontal source size is broadened in proportion to the beamline opening angle and to the length of the wiggler. While this effect is well-understood, a direct proof appears not to have been given elsewhere. We consider the problem of the calculation of the wiggler source size by means of numerical simulations alone, which play the same role of an experiment. We report a significant numerical disagreement between exact calculations and approximations currently used in literature.

New system for wiggler fabrication and testing

International Nuclear Information System (INIS)

Warren, R.W.; Elliott, C.J.

1988-01-01

A system approach is taken for fabrication and testing of wigglers for free-electron lasers. Emphasis is placed on convenient, practical, assembly procedures that produce wigglers with high fields, two-plane focusing, and facilities for in-place adjustments. Equal emphasis is placed on rapid and precise techniques for measuring field errors, both before final assembly and afterward, during wiggler operation. (author). 10 refs, 12 figs

Single wavelength standard wiggler for PEP

International Nuclear Information System (INIS)

Brunk, W.; Fischer, G.; Spencer, J.

1979-03-01

A 1lambda planar wiggler has been designed that will be used for the initial operation of the 4 to 18 GeV storage ring PEP. Three of these wigglers will be installed symmetrically around the ring at 120 0 intervals in three of six available 5 m straight sections with the purpose of providing: (1) beam size control to obtain better luminosities below 15 GeV, and (2) decreased damping times to obtain better injection rates at lower energies. Design goals are discussed and a description of the final system including cost estimates is given. Expected results and usage in PEP are discussed. Some possibilities for production of synchrotron radiation and beam monitoring with shorter wavelength, multiple-period wigglers at PEP energies are also discussed. Comparison to a wiggler now operating in SPEAR is given

The far-infrared spectrum of the OH radical

Science.gov (United States)

Brown, J. M.; Schubert, J. E.; Evenson, K. M.; Radford, H. E.

1982-01-01

It is thought likely that the study of spectral lines in the far-infrared might provide at least as much information about the physics and chemistry of the interstellar environment as radioastronomy. However, by comparison with the microwave region, the far-infrared is largely unexplored. There is a pressing need for good laboratory data to aid searches and assignments of spectra from the interstellar clouds and nebulae. Brown et al. (1981) have conducted a study of the laser magnetic resonance (LMR) spectrum of the OH radical in its ground state at far-infrared wavelengths. The present investigation is concerned with the computation of the frequencies of individual hyperfine transitions involving all rotational levels up to J = 4 1/2. The results of the calculation are presented in a table. The results are summarized in a diagram which shows the low-lying energy levels of OH. The frequencies of transitions between levels studied directly in the LMR spectrum are quite reliable.

Drying characteristics of rough rice by far-infrared radiation heating

International Nuclear Information System (INIS)

Matsuoka, T.

1990-01-01

The relationship between the heat radiation characteristics of a far-infrared radiation heater and the drying characteristics of rough rice was investigated to determine the basic data required for utilization of far-infrared rays for drying rough rice. Results of investigations are discussed in detail

Wigglers: the newest profession

International Nuclear Information System (INIS)

Spencer, J.E.

1981-01-01

Wiggler systems have been used in storage rings within the last year to increase the intensity of synchrotron radiation available for experiments as well as to increase the reaction rates in high energy physics experiments. Multiperiod wigglers or undulators have also been used recently to make quasi-monochromatic photon beams as well as amplify existing photon beams such as in the free electron laser. If one defines a wiggler to be any system of transverse, periodic electromagnetic fields, then recent results on photon production via charged particle channeling in crystals also fall within this sphere. Of course, any periodic modulation of a charge or magnetic moment (e.g., by a laser) could produce coherent radiation or, conversely, passage through a periodic aperture (e.g., a metal bellows). This discussion is limited to a typical, active, macroscopic device and how it provides some unique advantages which are practical to achieve in storage rings. As implied, the subject divides into two basic parts - one related to the radiation from the wiggler and the other related to machine physics applications, e.g., tailoring the phase space of the particle beam, modifying its damping rates or possibly optimizing a ring for production of radiation. Neither area is exhausted nor hopefully the reader, since our goal is only to present enough information to allow one to make reasonable estimates of some important effects

Far Infrared spectroscopy of proteinogenic and other less common amino acids

Science.gov (United States)

Iglesias-Groth, S.; Cataldo, F.

2018-05-01

Far infrared spectroscopy is a powerful tool complementing the potential of mid infrared spectroscopy for the search and identification of organic molecules in space. The far infrared spectra of a total of 29 amino acids are reported in this study. In addition to the spectra of 20 common proteinogenic amino acids, spectra of a selection of 9 non-proteinogenic amino acids are also reported, including the 2-aminoisobutyric acid or α-aminoisobutyric acid which, with glycine, it is one of the most abundant amino acids found in meteorites. The present database of 29 far infrared spectra may serve as reference in the search for amino acids in space environments, given the new apportunities that JWST offers for mid and far IR spectroscopy.

Plasma diagnostics in infrared and far-infrared range for Heliotron E

International Nuclear Information System (INIS)

Sudo, S.; Zushi, H.; Hondo, K.; Takeiri, Y.; Sano, F.; Besshou, S.; Suematsu, H.; Motojima, O.; Iiyoshi, A.; Muraoka, K.; Tsukishima, T.; Tsunawaki, Y.

1989-01-01

In this paper diagnostics in infrared and far-infrared range for Heliotron E are described: FIR interferometer for measuring electron density profile and ECE for electron temperature profile as routine work, and Fraunhofer diffraction method with a CO 2 laser for density fluctuation and Thomson scattering with a D 2 O laser (λ = 385 μm) for ion temperature, as new methods

Synchrotron-based far-infrared spectroscopy of nickel tungstate

International Nuclear Information System (INIS)

Kalinko, A.; Kuzmin, A.; Roy, P.; Evarestov, R.A.

2016-01-01

Monoclinic antiferromagnetic NiWO 4 was studied by far-infrared (30-600 cm -1 ) absorption spectroscopy in the temperature range of 5-300 K using the synchrotron radiation from SOLEIL source. Two isomorphous CoWO 4 and ZnWO 4 tungstates were investigated for comparison. The phonon contributions in the far-infrared range of tungstates were interpreted using the first-principles spin-polarized linear combination of atomic orbital calculations. No contributions from magnetic excitations were found in NiWO 4 and CoWO 4 below their Neel temperatures down to 5 K.

Studies on heat transfer in agricultural products by far-infrared ray

International Nuclear Information System (INIS)

Liu, H.; Mohri, K.; Namba, K.

1998-01-01

Heat is transferred when the object being heated has temperature differences. In this research, the difference of two heating methods (far-infrared ray heating and hot wind heating) was analyzed. To compare their differences, the heat flux was measured by setting a heat flux meter beneath the surface of the object at different depths, then the heat conductivities and heat diffusion rates were analyzed. 1) Compared with hot wind, far-infrared ray heating has more heat flux before reaching a definite depth. 2) The heat conductivity and heat diffusion rates by hot wind heating have specific properties with special objects. The heat conductivity and heat diffusion rate of far-infrared heating are higher than those of hot wind heating. The differences are considered to be caused by far-infrared rays

Far-infrared observations of Sagittarius B2 - reconsideration of source structure

International Nuclear Information System (INIS)

Thronson, H.A. Jr.; Harper, D.A.; Yerkes Observatory, Williams Bay, WI)

1986-01-01

New moderate-angular-resolution far-infrared observations of the Sagittarius B2 star-forming region are presented, discussed, and compared with recent radio molecular and continuum observations of this source. In contrast to previous analyses, its far-infrared spectrum is interpreted as the result of a massive frigid cloud overlying a more-or-less normal infrared source, a natural explanation for the object's previously-noted peculiarities. The characteristics derived for the obscuring cloud are similar to those found for the W51 MAIN object. Both sources have high sub-millimeter surface brightness, a high ratio of sub-millimeter to far-infrared flux, and numerous regions of molecular maser emission. 28 references

Far-infared spectroscopic observations with a Balloon-Borne infrared telescope

International Nuclear Information System (INIS)

Maihara, Toshinori; Takami, Hideki; Mizutani, Kohei

1986-01-01

The first observations of far-infrared celestial objects using the 50-cm Balloon-Borne Infrared Telescope were made in Alice Springs, Australia. Far-infrared spectrophotometric data between 45 and 115 μm were taken for the Orion-KL region, Saturn and a southern H II region RCW 38. The data including high excitation transition lines of CO for Orion-KL, O III lines for RCW 38 and a PH 3 absorption feature of Saturn will be presented. (author)

Conceptual Design of ILC Damping Ring Wiggler Straight Vacuum System

International Nuclear Information System (INIS)

Marks, S.; Kennedy, K.; Plate, D.; Schlueter, R.D.; Zisman, M.

2007-01-01

The positron and electron damping rings for the International Linear Collider will contain long straight sections consisting of twenty wiggler/quadrupole pairs. The wigglers will be based upon the CESR superconducting design. There are a number of challenges associated with the design of the wiggler straight vacuum system, in particular, the absorption of photon power generated by the wigglers. This paper will present the overall conceptual design of the wiggler straight vacuum system developed for the ILC Reference Design Report. Particular emphasis will be placed on photon power load calculations and the absorber design

Science with High Spatial Resolution Far-Infrared Data

Science.gov (United States)

Terebey, Susan (Editor); Mazzarella, Joseph M. (Editor)

1994-01-01

The goal of this workshop was to discuss new science and techniques relevant to high spatial resolution processing of far-infrared data, with particular focus on high resolution processing of IRAS data. Users of the maximum correlation method, maximum entropy, and other resolution enhancement algorithms applicable to far-infrared data gathered at the Infrared Processing and Analysis Center (IPAC) for two days in June 1993 to compare techniques and discuss new results. During a special session on the third day, interested astronomers were introduced to IRAS HIRES processing, which is IPAC's implementation of the maximum correlation method to the IRAS data. Topics discussed during the workshop included: (1) image reconstruction; (2) random noise; (3) imagery; (4) interacting galaxies; (5) spiral galaxies; (6) galactic dust and elliptical galaxies; (7) star formation in Seyfert galaxies; (8) wavelet analysis; and (9) supernova remnants.

Far infrared polarimetry of W51A and M42

Energy Technology Data Exchange (ETDEWEB)

Cudlip, W; Furniss, I; King, K J; Jennings, R E [University Coll., London (UK). Dept. of Physics and Astronomy

1982-09-01

A far infrared polarimeter has been designed for use with a balloon-borne telescope. It uses a rapidly rotating wire grid polarizer with the chopping secondary mirror of the telescope synchronized to the rate of rotation. Observations of M42 using this system show a far infrared polarization of 2.2 +- 0.4 per cent, nearly orthogonal to the near infrared polarization which is usually attributed to dust absorption. Observations of W51A show a much smaller value of the polarization of 0.8 +- 0.5 per cent.

High-resolution far-infrared observations of the galactic center

International Nuclear Information System (INIS)

Harvey, P.M.; Campbell, M.F.; Hoffmann, W.F.

1976-01-01

A map at 53 μ with 17'' resolution and three-color observations at 53 μ, 100 μ, and 175 μ with approx.30'' beams of Sgr A are presented. Sagittarius A is resolved into two main sources, one associated with the cluster of strong 10 μ sources and another approx.45'' to the southwest coincident with a weak 10 μ source. The dust temperature peaks near the strong 10 μ sources, but the 100 μ and 175 μ fluxes and the far-infrared optical depth are greatest near the southwest source. The amount of dust required to explain the far-infrared emission is comparable to that observed in absorption in the near-infrared

Kinetic inductance detectors for far-infrared spectroscopy

International Nuclear Information System (INIS)

Barlis, A.; Aguirre, J.; Stevenson, T.

2016-01-01

The star formation mechanisms at work in the early universe remain one of the major unsolved problems of modern astrophysics. Many of the luminous galaxies present during the period of peak star formation (at redshift of about 2.5) were heavily enshrouded in dust, which makes observing their properties difficult at optical wavelengths. However, many spectral lines exist at far-infrared wavelengths that serve as tracers of star formation. Here, we describe a detector system suitable for a balloon-borne spectroscopic intensity mapping experiment at far-infrared wavelengths. The system uses lumped-element kinetic inductance detectors (KIDs), which have the potential to achieve high sensitivity and low noise levels. KIDs consist of separate capacitive and inductive elements, and use the inductive element as the radiation absorber. We describe the design considerations, fabrication process, and readout scheme for a prototype LEKID array of 1600 pixels. - Highlights: • We describe a concept for a balloon-borne telescope for far-IR wavelengths. • Telescope would use high-sensitivity kinetic inductance detectors. • Design considerations and fabrication process for prototype detectors.

Kinetic inductance detectors for far-infrared spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Barlis, A., E-mail: abarlis@physics.upenn.edu [University of Pennsylvania Department of Physics and Astronomy, Philadelphia, Pennsylvania (United States); Aguirre, J. [University of Pennsylvania Department of Physics and Astronomy, Philadelphia, Pennsylvania (United States); Stevenson, T. [NASA Goddard Space Flight Center, Greenbelt, Maryland (United States)

2016-07-11

The star formation mechanisms at work in the early universe remain one of the major unsolved problems of modern astrophysics. Many of the luminous galaxies present during the period of peak star formation (at redshift of about 2.5) were heavily enshrouded in dust, which makes observing their properties difficult at optical wavelengths. However, many spectral lines exist at far-infrared wavelengths that serve as tracers of star formation. Here, we describe a detector system suitable for a balloon-borne spectroscopic intensity mapping experiment at far-infrared wavelengths. The system uses lumped-element kinetic inductance detectors (KIDs), which have the potential to achieve high sensitivity and low noise levels. KIDs consist of separate capacitive and inductive elements, and use the inductive element as the radiation absorber. We describe the design considerations, fabrication process, and readout scheme for a prototype LEKID array of 1600 pixels. - Highlights: • We describe a concept for a balloon-borne telescope for far-IR wavelengths. • Telescope would use high-sensitivity kinetic inductance detectors. • Design considerations and fabrication process for prototype detectors.

Modeling a horizontal wiggler in an electron storage ring

International Nuclear Information System (INIS)

Helm, R.H.

1979-02-01

The effects of a wiggler on the beam parameters depend on several integrals involving the machine functions and the field distribution in the wiggler. It is shown that these integrals are separable into sums of products of terms containing only the initial values of the machine functions, and terms containing integrals over the wiggler fields. The field-dependent integrals may be determined by numerical integrations based on measured field distribution. In typical wiggler designs, the energy and excitation dependencies of the integrals may be modeled mathematically by simple power series

Far-infrared spectroscopy of lanthanide-based molecular magnetic materials

Energy Technology Data Exchange (ETDEWEB)

Haas, Sabrina

2015-05-13

This thesis demonstrates the applicability of far-infrared spectroscopy for the study of the crystal-field splitting of lanthanides in single-molecular magnetic materials. The far-infrared studies of three different kinds of single-molecular-magnetic materials, a single-ion magnet, a single-chain magnet and an exchange-coupled cluster, yielded a deeper understanding of the crystal-field splitting of the lanthanides in these materials. In addition, our results offered the opportunity to gain a deeper insight into the relaxation processes of these materials.

Properties and Applications of High Emissivity Composite Films Based on Far-Infrared Ceramic Powder.

Science.gov (United States)

Xiong, Yabo; Huang, Shaoyun; Wang, Wenqi; Liu, Xinghai; Li, Houbin

2017-11-29

Polymer matrix composite materials that can emit radiation in the far-infrared region of the spectrum are receiving increasing attention due to their ability to significantly influence biological processes. This study reports on the far-infrared emissivity property of composite films based on far-infrared ceramic powder. X-ray fluorescence spectrometry, Fourier transform infrared spectroscopy, thermogravimetric analysis, and X-ray powder diffractometry were used to evaluate the physical properties of the ceramic powder. The ceramic powder was found to be rich in aluminum oxide, titanium oxide, and silicon oxide, which demonstrate high far-infrared emissivity. In addition, the micromorphology, mechanical performance, dynamic mechanical properties, and far-infrared emissivity of the composite were analyzed to evaluate their suitability for strawberry storage. The mechanical properties of the far-infrared radiation ceramic (cFIR) composite films were not significantly influenced ( p ≥ 0.05) by the addition of the ceramic powder. However, the dynamic mechanical analysis (DMA) properties of the cFIR composite films, including a reduction in damping and shock absorption performance, were significant influenced by the addition of the ceramic powder. Moreover, the cFIR composite films showed high far-infrared emissivity, which has the capability of prolonging the storage life of strawberries. This research demonstrates that cFIR composite films are promising for future applications.

Development of solenoid-induced helical wiggler with four poles per period

International Nuclear Information System (INIS)

Ohigashi, N.; Tsunawaki, Y.; Kiyochi, M.; Nakao, N.; Fujita, M.; Imasaki, K.; Nakai, S.; Mima, K.

1999-01-01

A new type of helical wiggler consisting of two staggered-iron arrays inserted into a solenoid field has been developed. The field measured by a test wiggler showed linear increment with the period. It was seen that 24% of the solenoid field contributed to the induced wiggler field when the gap length and the period of the wiggler were 16 and 24 mm, respectively. This wiggler would be useful for an FEL with a low-energy electron beam propagating in a strong axial guiding field

Development of solenoid-induced helical wiggler with four poles per period

CERN Document Server

Ohigashi, N; Kiyochi, M; Nakao, N; Fujita, M; Imasaki, K; Nakai, S; Mima, K

1999-01-01

A new type of helical wiggler consisting of two staggered-iron arrays inserted into a solenoid field has been developed. The field measured by a test wiggler showed linear increment with the period. It was seen that 24% of the solenoid field contributed to the induced wiggler field when the gap length and the period of the wiggler were 16 and 24 mm, respectively. This wiggler would be useful for an FEL with a low-energy electron beam propagating in a strong axial guiding field.

Design of a vertical wiggler with superconducting coils

International Nuclear Information System (INIS)

Huke, K.; Yamakawa, T.

1980-01-01

A vertical wiggler has been designed, which will be installed in the 2.5 GeV electron storage ring under construction at KEK-PF. The wiggler magnet with superconducting coils produces magnetic fields of 6 T and wiggles electron beams in a vertical plane. Synchrotron radiation generated by the wiggler has a critical wavelength of 0.5 Angstroem and has an electric field-vector in the vertical direction, which is very important for precise experiments in various fields of the material sciences. The wiggler consists of three pairs of superconducting coils, an iron magnetic shield, a beam pipe and a liquid helium cryogenic system and is contained in a vacuum vessel which can move up and down together with the wiggler. During the injection time, the vessel is pushed up, so that electron beams with a large spatial spread go through the lower part of the beam pipe, where the aperture of the beam pipe is large enough. After the beam size becomes small due to radiation damping, the vessel is pushed down so that the electron beams go through the narrow gap of the wiggler magnet. Using the iron magnetic shield with iron pole pieces, the ratio between the magnetic field in the gap and the maximum field on the superconductor coils is reduced to 1.1. (orig.)

Far-Infrared Absorption of PbSe Nanorods

KAUST Repository

Hyun, Byung-Ryool; Bartnik, A. C.; Koh, Weon-kyu; Agladze, N. I.; Wrubel, J. P.; Sievers, A. J.; Murray, Christopher B.; Wise, Frank W.

2011-01-01

Measurements of the far-infrared absorption spectra of PbSe nanocrystals and nanorods are presented. As the aspect ratio of the nanorods increases, the Fröhlich sphere resonance splits into two peaks. We analyze this splitting with a classical

Effects of wigglers and undulators on beam dynamics

International Nuclear Information System (INIS)

Smith, L.

1986-08-01

Synchrotron light facilities are making ever increasing use of wigglers and undulators, to the extent that these devices are becoming a significant part of the beam optical system of the storage ring itself. This paper presents a theoretical formulation for investigating the effect of wigglers and undulators on beam dynamics in the approximation that the wiggler parameter, K, divided by γ is a small number and that the number of wiggler periods in one device is large. In addition to the linear forces which must be taken into account when tuning and matching the ring, nonlinear stop bends are created, with even orders more serious than odd orders. Some numerical examples are given for devices similar to those proposed for the 1-2 GeV Synchrotron Radiation Source at Lawrence Berkeley Laboratory

Far-infrared elastic scattering proposal for the Avogadro Project's silicon spheres

Science.gov (United States)

Humayun, Muhammad Hamza; Khan, Imran; Azeem, Farhan; Chaudhry, Muhammad Rehan; Gökay, Ulaş Sabahattin; Murib, Mohammed Sharif; Serpengüzel, Ali

2018-05-01

Avogadro constant determines the number of particles in one mole of a substance, thus relating the molar mass of the substance to the mass of this substance. Avogadro constant is related to Système Internationale base units by defining the very concept of chemical quantity. Revisions of the base units created a need to redefine the Avogadro constant, where a collaborative work called the Avogadro Project is established to employ optical interferometry to measure the diameter of high quality 100 mm silicon spheres. We propose far-infrared spectroscopy for determining the Avogadro constant by using elastic scattering from the 100 mm Avogadro Project silicon spheres. Similar spectroscopic methods are already in use in the near-infrared, relating whispering gallery modes of the 1 mm silicon spheres to the diameter of the spheres. We present numerical simulations in the far-infrared and the near-infrared, as well as spatially scaled down elastic scattering measurements in the near-infrared. These numerical and experimental results show that, the diameter measurements of 100 mm single crystal silicon spheres with elastic scattering in the far-infrared can be considered as an alternative to optical interferometry.

Design of a superconducting wiggler system

International Nuclear Information System (INIS)

Shen, S.S.; Miller, J.R.; Heim, J.R.; Slack, D.S.

1988-01-01

We present a wiggler system based on currently available superconducting technology. The system is designed to provide maximum central field of 4.4 tesla with a specified period length of 160 mm and a gap of 40 mm, while meeting the field quality requirements along all axes. Also included are preliminary cost estimates and a survey of world-wide RandD efforts on superconducting wiggler systems. 12 refs., 6 figs., 3 tabs

Far infrared spectroscopy of H II regions

International Nuclear Information System (INIS)

Ward, D.B.

1976-01-01

A fully liquid helium cooled grating spectrometer has been developed for far infrared observations from the NASA Lear Jet. This instrument has been used in observations of the galactic HII regions M42 and M17. The instrument is described, and the results of various performance tests and calibrations are presented. The methods employed in observations from the Lear Jet are described, and the data analysis procedures are discussed. The results of a search for the (O III) 88.16 micron fine structure line are presented. The intensity of the line in M17 is reported, and an upper limit given for the intensity in M42. These results are compared with theoretical predictions, and future applications of infrared line observations are discussed. Coarse resolution spectra of M42 and M17 from 45 to 115 microns are also presented. The emission from M42 is shown to be a very smooth function of wavelength, closely fitting the wavelength dependence of a 105 0 K graybody. The spectrum of M17 is very different, having a bump at approximately 75 microns and a general far infrared excess. The observed spectrum is compared to the predictions of models for M17

Multi-layer Far-Infrared Component Technology, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — This Phase I SBIR will demonstrate the feasibility of a process to create multi-layer thin-film optics for the far-infrared/sub-millimeter wave spectral region. The...

Far-infrared and CO observations of NGC 6357 and regions surrounding NGC 6357 and NGC 6334

International Nuclear Information System (INIS)

McBreen, B.; Jaffe, D.T.; Fazio, G.G.

1983-01-01

We have surveyed two 1.7 square degree sections of the galactic plane at 70 μm with one-arcminute resolution. The scanned areas included the giant southern H II region complexes NGC 6357 and NGC 6334. Nineteen far-infrared sources were observed. The sources range in luminosity from 1.6 x 10 4 to 5.5 x 10 5 L/sub sun/ . We present far-infrared continuum and CO line observations of NGC 6357. Four far-infrared sources were found in this complex and for one of these sources the exciting stars are identified. We present far-infrared and CO observations of sources in the field surrounding NGC 6357 and NGC 6334. The far-infrared sources coincide frequently with CO line temperature peaks. The CO clouds which surround the far-infrared sources have similar 13 CO column densities. Two of the far-infrared sources in the field have associated OH and H 2 O maser emission and compact H II regions

CESR-c Performance of a Wiggler-Dominated Storage Ring

CERN Document Server

Temnykh, Alexander

2005-01-01

CESR-c operates now as a Wiggler-Dominated Storage Ring extending the lowest operating energy to 1.5GeV/beam. To improve beam stability at low energy, 12 super-ferric wiggler magnets with total length of 15m and 2.1T maximum field were installed in the ring. They cause ~90% of total beam radiation lost and increase radiation damping rate by factor 10 from ~3 to 40 Hz. However, the field of the wiggler magnets not only initiates the radiation, but potentially affects beam dynamics. The latter was an issue of a great concern from the planning the CESR-c project. In this paper we describe general performance of CESR-c and report the results of an experimental study on some aspects of beam dynamics. Comparisons are made between the experimental data and the model prediction. We find that all parameters, which are critically dependent on wigglers, such as beam properties and ring nonlinearity, are in good agreement with those calculated from the model. This validates the ring and wiggler models and justifies our d...

Performance of the SRRC storage ring and wiggler commissioning

International Nuclear Information System (INIS)

Kuo, C.C.; Hsu, K.T.; Luo, G.H.

1995-01-01

A 1.3 GeV synchrotron radiation storage ring at SRRC has been operated for more than a year since October 1993. Starting from April 1994, the machine has been open to the user community. In February 1995, the authors installed a wiggler magnet of 1.8 tesla 25-pole in the ring and successfully commissioned. The machine was scheduled for the users' runs from the middle of April this year. The authors describe the performance of the machine without wiggler magnet system and then report the wiggler effects on the beam dynamics of the storage ring, e.g., tune shift, beta-beating, orbit change, nonlinear dynamics effect, etc. Some measurements are compared with the model prediction and agreement between them was fairly good. Possible actions to minimize wiggler effects have been taken, such as orbit correction as a function wiggler gap change. The machine improvement projects, such as longitudinal and transverse damping systems as well as orbit stability feedback system are under construction and will be in use soon

Studies on the hyperthermic effect of the body on utilization of far infrared radiation

Energy Technology Data Exchange (ETDEWEB)

Ryu, Yong Wun; Cho, Chul Ku; Kim, Kyung Jung [Korea Cancer Center Hospital, Seoul (Korea, Republic of)

1996-12-01

This study investigated that strong heat reaction of far infrared radiation material could have the possibility for hyperthermia in patients. Objective was CaSki cell, human uterocervical cancer cell line and they observed descending effect remarkably to compare the effect of cell death by high temperature due to far infrared radiation, platelet numbers of experimental group to compare the control were increased 7 {approx} 17%, and lymphocyte numbers 20 {approx} 40 %. High acidity in tumor tissue due to the concentration of lactic acid, so the effects of far infrared had the result to the possibility to reduce the fatigue stuff. The secretion of endorphin as cerebroneuron substance than epinephrine, sympathetic nerve substance could be reduction of pain in cancer patients because of the effect of far infrared. Above data of experiment, we were found multiple the biological efficacy of far infrared about the possibility of medical utilization. (author). 10 refs., 4 tabs., 3 figs.

Studies on the hyperthermic effect of the body on utilization of far infrared radiation

International Nuclear Information System (INIS)

Ryu, Yong Wun; Cho, Chul Ku; Kim, Kyung Jung

1996-12-01

This study investigated that strong heat reaction of far infrared radiation material could have the possibility for hyperthermia in patients. Objective was CaSki cell, human uterocervical cancer cell line and they observed descending effect remarkably to compare the effect of cell death by high temperature due to far infrared radiation, platelet numbers of experimental group to compare the control were increased 7 ∼ 17%, and lymphocyte numbers 20 ∼ 40 %. High acidity in tumor tissue due to the concentration of lactic acid, so the effects of far infrared had the result to the possibility to reduce the fatigue stuff. The secretion of endorphin as cerebroneuron substance than epinephrine, sympathetic nerve substance could be reduction of pain in cancer patients because of the effect of far infrared. Above data of experiment, we were found multiple the biological efficacy of far infrared about the possibility of medical utilization. (author). 10 refs., 4 tabs., 3 figs

Meso-ester and carboxylic acid substituted BODIPYs with far-red and near-infrared emission for bioimaging applications

KAUST Repository

Ni, Yong; Zeng, Lintao; Kang, Namyoung; Huang, Kuo-Wei; Wang, Liang; Zeng, Zebing; Chang, Young-Tae; Wu, Jishan

2014-01-01

-6) become partially soluble in water, and their absorptions and emissions are located in the far-red or near-infrared region. Three synthetic approaches are attempted to access the meso-carboxylic acid (COOH)-substituted BODIPYs 7 and 8 from the meso

A dual far-infrared laser diagnostic of magnetized plasmas

International Nuclear Information System (INIS)

Darrow, D.S.; Park, H.K.

1988-02-01

A dual far-infrared laser has been constructed and its properties have been exploited to probe tokamak-like discharges in the CDX toroidal device. Thermal variation of the difference frequency between the two far-infrared cavities is slow, though the cavities lack thermal stabilization, simply because their assembly on the same chassis exposes them to virtually identical temperature changes. The optical arrangement beyond the laser permits conversion within minutes between interferometry and density fluctuation observation, and within an hour between different operating wavelengths. Line-average densities of 2 /times/ 10 13 cm -3 and coherent fluctuations in the neighborhood of 20 kHz have been measured with this diagnostic. 15 refs., 5 figs., 2 tabs

The Far-Infrared Surveyor (FIS) for AKARI

NARCIS (Netherlands)

Kawada, Mitsunobu; Baba, Hajime; Barthel, Peter D.; Clements, David; Cohen, Martin; Doi, Yasuo; Figueredo, Elysandra; Fujiwara, Mikio; Goto, Tomotsugu; Hasegawa, Sunao; Hibi, Yasunori; Hirao, Takanori; Hiromoto, Norihisa; Jeong, Woong-Seob; Kaneda, Hidehiro; Kawai, Toshihide; Kawamura, Akiko; Kester, Do; Kii, Tsuneo; Kobayashi, Hisato; Kwon, Suk Minn; Lee, Hyung Mok; Makiuti, Sin'itirou; Matsuo, Hiroshi; Matsuura, Shuji; Mueller, Thomas G.; Murakami, Noriko; Nagata, Hirohisa; Nakagawa, Takao; Narita, Masanao; Noda, Manabu; Oh, Sang Hoon; Okada, Yoko; Okuda, Haruyuki; Oliver, Sebastian; Ootsubo, Takafumi; Pak, Soojong; Park, Yong-Sun; Pearson, Chris P.; Rowan-Robinson, Michael; Saito, Toshinobu; Salama, Alberto; Sato, Shinji; Savage, Richard S.; Serjeant, Stephen; Shibai, Hiroshi; Shirahata, Mai; Sohn, Jungjoo; Suzuki, Toyoaki; Takagi, Toshinobu; Takahashi, Hidenori; Thomson, Matthew; Usui, Fumihiko; Verdugo, Eva; Watabe, Toyoki; White, Glenn J.; Wang, Lingyu; Yamamura, Issei; Yamauchi, Chisato; Yasuda, Akiko

2007-01-01

The Far-Infrared Surveyor (FIS) is one of two focal-plane instruments on the AKARI satellite. FIS has four photometric bands at 65, 90, 140, and 160 mu m, and uses two kinds of array detectors. The FIS arrays and optics are designed to sweep the sky with high spatial resolution and redundancy. The

Field distribution in a coaxial electrostatic wiggler

Directory of Open Access Journals (Sweden)

Shi-Chang Zhang

2010-09-01

Full Text Available The field distribution in a coaxial electrostatic wiggler corresponds to the special solution of a Laplace equation in a cylindrical coordinate system with a boundary value problem of sinusoidal ripples. This paper is devoted to the physical and mathematical treatment for an analytical solution of the field distribution in the coaxial electrostatic wiggler. The explicit expression of the solution indicates that the field distribution in the coaxial electrostatic wiggler varies according to a periodic function in the longitudinal direction, and is related to the first and second kinds of modified Bessel functions in the radial direction, respectively. Comparison shows excellent agreement between the analytical formula and the computer simulation technology (CST results. The physical application of the considered system and its analytical solution are discussed.

Bolometers for far-infrared and submillimetre astronomy

International Nuclear Information System (INIS)

Griffin, M.J.

2000-01-01

Important scientific goals of far-infrared and submillimetre astronomy include measurements of anisotropies in the cosmic background radiation, deep imaging surveys for detection of high-red-shift galaxies, and imaging and spectroscopy of star formation regions and the interstellar medium in the milky way and nearby galaxies. Use of sensitive bolometer arrays leads to very large improvements in observing speed. Recent progress in the development of bolometric detector systems for ground-based and space-borne far-infrared and submillimetre astronomical observations is reviewed, including spider-web NTD bolometers, transition-edge superconducting sensors, and micromachined planar arrays of ion-implanted silicon bolometers. Future arrays may be based on planar absorbers without feedhorns, which offer potential advantages including more efficient use of space in the focal plane and improved instantaneous sampling of the telescope point spread function, but present challenges in suppression of stray light and RF interference. FIRST and Planck Surveyor are planned satellite missions involving passively cooled (∼70 K) telescopes, and bolometer array developments for these missions are described

Method for generation of tunable far infrared radiation from two-dimensional plasmons

Science.gov (United States)

Katz, Joseph (Inventor)

1989-01-01

Tunable far infrared radiation is produced from two-dimensional plasmons in a heterostructure, which provides large inversion-layer electron densities at the heterointerface, without the need for a metallic grating to couple out the radiation. Instead, a light interference pattern is produced on the planar surface of the heterostructure using two coherent laser beams of a wavelength selected to be strongly absorbed by the heterostructure in order to penetrate through the inversion layer. The wavelength of the far infrared radiation coupled out can then be readily tuned by varying the angle between the coherent beams, or varying the wavelength of the two interfering coherent beams, thus varying the periodicity of the photoconductivity grating to vary the wavelength of the far infrared radiation being coupled out.

FAR-INFRARED EXTINCTION MAPPING OF INFRARED DARK CLOUDS

Energy Technology Data Exchange (ETDEWEB)

Lim, Wanggi [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Tan, Jonathan C. [Departments of Astronomy and Physics, University of Florida, Gainesville, FL 32611 (United States)

2014-01-10

Progress in understanding star formation requires detailed observational constraints on the initial conditions, i.e., dense clumps and cores in giant molecular clouds that are on the verge of gravitational instability. Such structures have been studied by their extinction of near-infrared and, more recently, mid-infrared (MIR) background light. It has been somewhat more of a surprise to find that there are regions that appear as dark shadows at far-infrared (FIR) wavelengths as long as ∼100 μm! Here we develop analysis methods of FIR images from Spitzer-MIPS and Herschel-PACS that allow quantitative measurements of cloud mass surface density, Σ. The method builds on that developed for MIR extinction mapping by Butler and Tan, in particular involving a search for independently saturated, i.e., very opaque, regions that allow measurement of the foreground intensity. We focus on three massive starless core/clumps in the Infrared Dark Cloud (IRDC) G028.37+00.07, deriving mass surface density maps from 3.5 to 70 μm. A by-product of this analysis is the measurement of the spectral energy distribution of the diffuse foreground emission. The lower opacity at 70 μm allows us to probe to higher Σ values, up to ∼1 g cm{sup –2} in the densest parts of the core/clumps. Comparison of the Σ maps at different wavelengths constrains the shape of the MIR-FIR dust opacity law in IRDCs. We find that it is most consistent with the thick ice mantle models of Ossenkopf and Henning. There is tentative evidence for grain ice mantle growth as one goes from lower to higher Σ regions.

FAR-INFRARED EXTINCTION MAPPING OF INFRARED DARK CLOUDS

International Nuclear Information System (INIS)

Lim, Wanggi; Tan, Jonathan C.

2014-01-01

Progress in understanding star formation requires detailed observational constraints on the initial conditions, i.e., dense clumps and cores in giant molecular clouds that are on the verge of gravitational instability. Such structures have been studied by their extinction of near-infrared and, more recently, mid-infrared (MIR) background light. It has been somewhat more of a surprise to find that there are regions that appear as dark shadows at far-infrared (FIR) wavelengths as long as ∼100 μm! Here we develop analysis methods of FIR images from Spitzer-MIPS and Herschel-PACS that allow quantitative measurements of cloud mass surface density, Σ. The method builds on that developed for MIR extinction mapping by Butler and Tan, in particular involving a search for independently saturated, i.e., very opaque, regions that allow measurement of the foreground intensity. We focus on three massive starless core/clumps in the Infrared Dark Cloud (IRDC) G028.37+00.07, deriving mass surface density maps from 3.5 to 70 μm. A by-product of this analysis is the measurement of the spectral energy distribution of the diffuse foreground emission. The lower opacity at 70 μm allows us to probe to higher Σ values, up to ∼1 g cm –2 in the densest parts of the core/clumps. Comparison of the Σ maps at different wavelengths constrains the shape of the MIR-FIR dust opacity law in IRDCs. We find that it is most consistent with the thick ice mantle models of Ossenkopf and Henning. There is tentative evidence for grain ice mantle growth as one goes from lower to higher Σ regions

Design of High Field Multipole Wiggler at PLS

International Nuclear Information System (INIS)

Kim, D. E.; Park, K. H.; Lee, H. G.; Suh, H. S.; Han, H. S.; Jung, Y. G.; Chung, C. W.

2007-01-01

Pohang Accelerator Laboratory (PAL) is developing a high field multipole wiggler for new EXAFS beamline. The beamline is planning to utilize very high photon energy (∼40keV) synchrotron radiation at Pohang Light Source (PLS). To achieve higher critical photon energy, the wiggler field need to be maximized. A magnetic structure with wedged pole and blocks with additional side blocks which are similar to asymmetric wiggler of ESRF are designed to achieve higher flux density. The end structures were designed to be asymmetric along the beam direction to ensure systematic zero 1st field integral. The thickness of the last magnets were adjusted to minimize the transition sequence to the fully developed periodic field. This approach is more convenient to control than adjusting the strength of the end magnets. The final design features 140mm period, 2.5 Tesla peak flux density at 12mm pole gap, 1205mm magnetic structure length with 16 full field poles. In this article, all the design, engineering efforts for the HFMSII wiggler will be described

Synchrotron radiation in the Far-Infrared: Adsorbate-substrate vibrations and resonant interactions

International Nuclear Information System (INIS)

Hoffmann, F.M.; Williams, G.P.; Hirschmugl, C.J.; Chabal, Y.J.

1991-01-01

Synchrotron radiation in the Far Infrared offers the potential for a broadband source of high brightness and intensity. Recent development of a Far-Infrared Beamline at the NSLS in Brookhaven provides an unique high intensity source in the FIR spectral range (800-10 cm -1 ). This talk reviews its application to surface vibrational spectroscopy of low frequency adsorbate-substrate vibrations and resonant interactions on metal surfaces

Far-infrared spectroscopic study of CeO2 nanocrystals

International Nuclear Information System (INIS)

Popović, Z. V.; Grujić-Brojčin, M.; Paunović, N.; Radonjić, M. M.; Araújo, V. D.; Bernardi, M. I. B.; Lima, M. M. de; Cantarero, A.

2015-01-01

We present the far-infrared reflectivity spectra of 5 nm-sized pure and copper-doped Ce 1−x Cu x O 2−y (x = 0; 0.01 and 0.10) nanocrystals measured at room temperature in the 50–650 cm −1 spectral range. Reflectivity spectra were analyzed using the factorized form of the dielectric function, which includes the phonon and the free carriers contribution. Four oscillators with TO energies of approximately 135, 280, 370, and 490 cm −1 were included in the fitting procedure. These oscillators represent local maxima of the CeO 2 phonon density of states, which is also calculated using the density functional theory. The lowest energy oscillator represents TA(L)/TA(X) phonon states, which become infrared-active E u modes at the L and X points of the Brillouin zone (BZ). The second oscillator originates from TO(Γ) phonon states. The oscillator at ∼400 cm −1 originates from Raman mode phonon states, which at the L point of BZ also becomes infrared-active E u mode. The last oscillator describes phonons with dominantly LO(Γ) infrared mode character. The appearance of phonon density of states related oscillators, instead of single F 2u infrared-active mode in the far-infrared reflectivity spectra, is a consequence of the nanosized dimension of the CeO 2 particles. The best fit spectra are obtained using the generalized Bruggeman model for inhomogeneous media, which takes into account the nanocrystal volume fraction and the pore shape

Far-infrared spectroscopic study of CeO2 nanocrystals

Science.gov (United States)

Popović, Z. V.; Grujić-Brojčin, M.; Paunović, N.; Radonjić, M. M.; Araújo, V. D.; Bernardi, M. I. B.; de Lima, M. M.; Cantarero, A.

2015-01-01

We present the far-infrared reflectivity spectra of 5 nm-sized pure and copper-doped Ce1- x Cu x O2- y ( x = 0; 0.01 and 0.10) nanocrystals measured at room temperature in the 50-650 cm-1 spectral range. Reflectivity spectra were analyzed using the factorized form of the dielectric function, which includes the phonon and the free carriers contribution. Four oscillators with TO energies of approximately 135, 280, 370, and 490 cm-1 were included in the fitting procedure. These oscillators represent local maxima of the CeO2 phonon density of states, which is also calculated using the density functional theory. The lowest energy oscillator represents TA(L)/TA(X) phonon states, which become infrared-active E u modes at the L and X points of the Brillouin zone (BZ). The second oscillator originates from TO(Γ) phonon states. The oscillator at 400 cm-1 originates from Raman mode phonon states, which at the L point of BZ also becomes infrared-active E u mode. The last oscillator describes phonons with dominantly LO(Γ) infrared mode character. The appearance of phonon density of states related oscillators, instead of single F 2uinfrared-active mode in the far-infrared reflectivity spectra, is a consequence of the nanosized dimension of the CeO2 particles. The best fit spectra are obtained using the generalized Bruggeman model for inhomogeneous media, which takes into account the nanocrystal volume fraction and the pore shape.

Near-infrared observations of the far-infrared source V region in NGC 6334

International Nuclear Information System (INIS)

Fischer, J.; Joyce, R.R.; Simon, M.; Simon, T.

1982-01-01

We have observed a very red near-infrared source at the center of NGC 6334 FIRS V, a far-infrared source suspected of variability by McBreen et al. The near-infrared source has deep ice and silicate absorption bands, and its half-power size at 20 μm is approx.15'' x 10''. Over the past 2 years we have observed no variability in the near-infrared flux. We have also detected an extended source of H 2 line emission in this region. The total luminosity in the H 2 v-1--0 S(1) line, uncorrected for extinction along the line of sight, is 0.3 L/sub sun/. Detection of emission in high-velocity wings of the J = 1--0 12 CO line suggests that the H 2 emission is associated with a supersonic gas flow

Microwave, Millimeter, Submillimeter, and Far Infrared Spectral Databases

Science.gov (United States)

Pearson, J. C.; Pickett, H. M.; Drouin, B. J.; Chen, P.; Cohen, E. A.

2002-01-01

The spectrum of most known astrophysical molecules is derived from transitions between a few hundred to a few hundred thousand energy levels populated at room temperature. In the microwave and millimeter wave regions. spectroscopy is almost always performed with traditional microwave techniques. In the submillimeter and far infrared microwave technique becomes progressively more technologically challenging and infrared techniques become more widely employed as the wavelength gets shorter. Infrared techniques are typically one to two orders of magnitude less precise but they do generate all the strong features in the spectrum. With microwave technique, it is generally impossible and rarely necessary to measure every single transition of a molecular species, so careful fitting of quantum mechanical Hamiltonians to the transitions measured are required to produce the complete spectral picture of the molecule required by astronomers. The fitting process produces the most precise data possible and is required in the interpret heterodyne observations. The drawback of traditional microwave technique is that precise knowledge of the band origins of low lying excited states is rarely gained. The fitting of data interpolates well for the range of quantum numbers where there is laboratory data, but extrapolation is almost never precise. The majority of high resolution spectroscopic data is millimeter or longer in wavelength and a very limited number of molecules have ever been studied with microwave techniques at wavelengths shorter than 0.3 millimeters. The situation with infrared technique is similarly dire in the submillimeter and far infrared because the black body sources used are competing with a very significant thermal background making the signal to noise poor. Regardless of the technique used the data must be archived in a way useful for the interpretation of observations.

Preliminary design for a pierce wiggler beamstick and addendum

International Nuclear Information System (INIS)

Pirkle, D.

1988-05-01

Lawrence Livermore National Laboratory is developing a fast tunable microwave source for operation at 250 GHz and 10kW peak output power. This report presents the preliminary design of a Pierce gun and solenoid magnet that will be compatible with a Pierce-wiggler electron beam formation system (beamstick). The beamstick will be an appropriate power source for a tunable gyro-BWO at 250 GHz. Figure 1 presents the major components of the Pierce-wiggler beamstick: the electron gun, solenoid, beam tunnel, wiggler, and vacuum valve. Figure 2 shows an artistic conception of how the beamstick will interface with the interaction magnet, modulator and gyro-BWO circuit at MIT. 15 figs

Far-infrared spectroscopy of thermally annealed tungsten silicide films

International Nuclear Information System (INIS)

Amiotti, M.; Borghesi, A.; Guizzetti, G.; Nava, F.; Santoro, G.

1991-01-01

The far-infrared transmittance spectrum of tungsten silicide has been observed for the first time. WSi 2 polycrystalline films were prepared by coevaporation and chemical-vapour deposition on silicon wafers, and subsequently thermally annealed at different temperatures. The observed structures are interpreted, on the basis of the symmetry properties of the crystal, such as infrared-active vibrational modes. Moreover, the marked lineshape dependence on annealing temperature enables this technique to analyse the formation of the solid silicide phases

Magnetic field simulation of wiggler on LUCX accelerator facility using Radia

Science.gov (United States)

Sutygina, Y. N.; Harisova, A. E.; Shkitov, D. A.

2016-11-01

A flat wiggler consisting of NdFeB permanent magnets was installed on a compact linear electron accelerator LUCX (KEK) in Japan. After installing the wiggler on LUCX, the experiments on the generation of undulator radiation (UR) in the terahertz wavelength range is planned. To perform the detailed calculations and optimization of UR characteristics, it is necessary to know the parameters of the magnetic field generated in the wiggler. In this paper extended simulation results of wiggler magnetic field over the entire volume between the poles are presented. The obtained in the Radia simulation magnetic field is compared with the field calculated by another code, which is based on the finite element method.

Generating Far-Infrared Radiation By Two-Wave Mixing

Science.gov (United States)

Borenstain, Shmuel

1992-01-01

Far-infrared radiation 1 to 6 GHz generated by two-wave mixing in asymmetrically grown GaAs/AlxGa1-xAs multiple-quantum-well devices. Two near-infrared semiconductor diode lasers phase-locked. Outputs amplified, then combined in semiconductor nonlinear multiple-quantum-well planar waveguide. Necessary to optimize design of device with respect to three factors: high degree of confinement of electromagnetic field in nonlinear medium to maximize power density, phase matching to extend length of zone of interaction between laser beams in non-linear medium, and nonlinear susceptibility. Devices used as tunable local oscillators in heterodyne-detection radiometers.

Far infrared reflectivity study of ceramic superconductors

International Nuclear Information System (INIS)

Memon, A.; Khan, M.N.; Al-Dallal, S.; Tanner, D.B.; Porter, C.D.

1992-01-01

In this paper, the authors report on a study of the far-infrared reflectivity of mixed rare earths and lanthnides ceramic superconductors RBa 2 Cu 3 O 7 in the normal state. The authors' results show that the strength of the phonon modes is reduced when yttrium is partially replaced by gadolinium and europium. Also the critical temperature of these mixed materials is reduced as indicated by the four probe technique

Far-infrared spectrophotometer for astronomical observations

Science.gov (United States)

Moseley, H.; Silverberg, R. F.

1981-01-01

A liquid-helium-cooled far infrared spectrophotometer was built and used to make low resolution observations of the continua of several kinds of astronomical objects using the Kuiper Airborne Observatory. This instrument fills a gap in both sensitivity to continuum sources and spectral resolution between the broadband photometers with lambda/Delta lambda approximately 1 and spectrometers with lambda/Delta lambda greater than 50. While designed primarily to study planetary nebulae, the instrument permits study of the shape of the continua of many weak sources which cannot easily be observed with high resolution systems.

Far-infrared spectra of acetanilide revisited

Science.gov (United States)

Spire, A.; Barthes, M.; Kellouai, H.; De Nunzio, G.

2000-03-01

A new investigation of the temperature dependence of the far-infrared spectra of acetanilide and some isotopomers is presented. Four absorption bands are considered at 31, 42, 64, and 80 cm-1, and no significant change of their integrated intensity is observed when reducing the temperature. The temperature induced frequency shift values and other properties of these bands are consistent with an assignment as anharmonic lattice phonons. These results rule out the assignment of the 64, 80, and 106 cm-1 bands as normal modes of the polaronic excitation, as previously suggested.

CALCULATION OF THE COHERENT RADIATION IMPDENACE FROM A WIGGLER

International Nuclear Information System (INIS)

Wu, J

2004-01-01

Most studies of coherent synchrotron radiation (CSR) have considered only the radiation from independent dipole magnets. However, in the damping rings of future linear colliders and many high luminosity factories, a large fraction of the radiation power will be emitted in damping wigglers. In this paper, the longitudinal wakefield and impedance due to CSR in a wiggler are derived in the limit of a large wiggler parameter K. After an appropriate scaling, the results can be expressed in terms of universal functions, which are independent of K. Analytical asymptotic results are obtained for the wakefield in the limit of large and small distances, and for the impedance in the limit of small and high frequencies

Far-infrared spectral studies of magnesium and aluminum co ...

Indian Academy of Sciences (India)

Far-infrared absorption spectroscopy has been used to study the occurrence of var- ... density of the products was found to be about 83% of the X-ray density. ..... [15] B D Cullity, Elements of X-ray diffraction (Addison-Wesley Press, Reading, ...

Electromagnetic wiggler technology development at the Lawrence Livermore National Laboratory

International Nuclear Information System (INIS)

Deis, G.A.; Burns, M.J.; Christensen, T.C.; Coffield, F.E.; Kulke, B.; Prosnitz, D.; Scharlemann, E.T.; Halbach, K.

1987-01-01

As a part of the program at the Lawrence Livermore National Laboratory (LLNL) in induction-linac free-electron laser (IFEL) research, we are conducting a variety of activities addressing the unique requirements imposed on IFEL wiggler systems. We are actively developing improved dc iron-core electromagnetic wiggler designs to attain higher peak fields, greater tunability, and lower random error levels. We are pursuing specialized control systems, such as magnetic-field and beam-position controllers, which can relax requirements on the wiggler itself. We are also pursuing basic studies to establish the effect of radiation on permanent magnets

High resolution spectroscopy in the microwave and far infrared

Science.gov (United States)

Pickett, Herbert M.

1990-01-01

High resolution rotational spectroscopy has long been central to remote sensing techniques in atmospheric sciences and astronomy. As such, laboratory measurements must supply the required data to make direct interpretation of data for instruments which sense atmospheres using rotational spectra. Spectral measurements in the microwave and far infrared regions are also very powerful tools when combined with infrared measurements for characterizing the rotational structure of vibrational spectra. In the past decade new techniques were developed which have pushed high resolution spectroscopy into the wavelength region between 25 micrometers and 2 mm. Techniques to be described include: (1) harmonic generation of microwave sources, (2) infrared laser difference frequency generation, (3) laser sideband generation, and (4) ultrahigh resolution interferometers.

Far infrared radiation promotes rabbit renal proximal tubule cell proliferation and functional characteristics, and protects against cisplatin-induced nephrotoxicity.

Science.gov (United States)

Chiang, I-Ni; Pu, Yeong-Shiau; Huang, Chao-Yuan; Young, Tai-Horng

2017-01-01

Far infrared radiation, a subdivision of the electromagnetic spectrum, is beneficial for long-term tissue healing, anti-inflammatory effects, growth promotion, sleep modulation, acceleration of microcirculation, and pain relief. We investigated if far infrared radiation is beneficial for renal proximal tubule cell cultivation and renal tissue engineering. We observed the effects of far infrared radiation on renal proximal tubules cells, including its effects on cell proliferation, gene and protein expression, and viability. We also examined the protective effects of far infrared radiation against cisplatin, a nephrotoxic agent, using the human proximal tubule cell line HK-2. We found that daily exposure to far infrared radiation for 30 min significantly increased rabbit renal proximal tubule cell proliferation in vitro, as assessed by MTT assay. Far infrared radiation was not only beneficial to renal proximal tubule cell proliferation, it also increased the expression of ATPase Na+/K+ subunit alpha 1 and glucose transporter 1, as determined by western blotting. Using quantitative polymerase chain reaction, we found that far infrared radiation enhanced CDK5R1, GNAS, NPPB, and TEK expression. In the proximal tubule cell line HK-2, far infrared radiation protected against cisplatin-mediated nephrotoxicity by reducing apoptosis. Renal proximal tubule cell cultivation with far infrared radiation exposure resulted in better cell proliferation, significantly higher ATPase Na+/K+ subunit alpha 1 and glucose transporter 1 expression, and significantly enhanced expression of CDK5R1, GNAS, NPPB, and TEK. These results suggest that far infrared radiation improves cell proliferation and differentiation. In HK-2 cells, far infrared radiation mediated protective effects against cisplatin-induced nephrotoxicity by reducing apoptosis, as indicated by flow cytometry and caspase-3 assay.

Electromagnetic modelling of a space-borne far-infrared interferometer

Science.gov (United States)

Donohoe, Anthony; O'Sullivan, Créidhe; Murphy, J. Anthony; Bracken, Colm; Savini, Giorgio; Pascale, Enzo; Ade, Peter; Sudiwala, Rashmi; Hornsby, Amber

2016-02-01

In this paper I will describe work done as part of an EU-funded project `Far-infrared space interferometer critical assessment' (FISICA). The aim of the project is to investigate science objectives and technology development required for the next generation THz space interferometer. The THz/FIR is precisely the spectral region where most of the energy from stars, exo-planetary systems and galaxy clusters deep in space is emitted. The atmosphere is almost completely opaque in the wave-band of interest so any observation that requires high quality data must be performed with a space-born instrument. A space-borne far infrared interferometer will be able to answer a variety of crucial astrophysical questions such as how do planets and stars form, what is the energy engine of most galaxies and how common are the molecule building blocks of life. The FISICA team have proposed a novel instrument based on a double Fourier interferometer that is designed to resolve the light from an extended scene, spectrally and spatially. A laboratory prototype spectral-spatial interferometer has been constructed to demonstrate the feasibility of the double-Fourier technique at far infrared wavelengths (0.15 - 1 THz). This demonstrator is being used to investigate and validate important design features and data-processing methods for future instruments. Using electromagnetic modelling techniques several issues related to its operation at long baselines and wavelengths, such as diffraction, have been investigated. These are critical to the design of the concept instrument and the laboratory testbed.

Wiggler as spin rotators for RHIC

International Nuclear Information System (INIS)

Luccio, A.; Conte, M.

1993-01-01

The spin of a polarized particle in a circular accelerator can be rotated with an arrangement of dipoles with field mutually perpendicular and perpendicular to the orbit. To achieve spin rotation, a given field integral value is required. The device must be designed in a way that the particle orbit is distorted as little as possible. It is shown that wigglers with many periods are suitable to achieve spin rotation with minimum orbit distortions. Wigglers are also more compact than more established structures and will use less electric power. Additional advantages include their use for non distructive beam diagnostics. Results are given for the Relativistic Heavy Ion Collider (RHIC) in the polarized proton mode

Damping Wiggler Study at KEK-ATF

CERN Document Server

Naito, Takashi; Honda, Yosuke; Korostelev, Maxim S; Kubo, Kiyoshi; Kuriki, Masao; Kuroda, Shigeru; Muto, Toshiya; Nakamura, Norio; Ross, Marc; Sakai, Hiroshi; Terunuma, Nobuhiro; Urakawa, Junji; Zimmermann, Frank

2005-01-01

The effects by damping wiggler magnets have been studied at KEK-ATF. The damping ring of the KEK-ATF is a 1.3 GeV storage ring capable of producing ultra-low emittance electron beams. It is significant issue to realize fast damping in the damping ring. The tuning method with 4 sets of wiggler was investigated for the ultra-low emittance beam. The performance on the beam quality, which is related to the transverse (x and y) and the longitudinal (z and dp/p), has been measured by the SR monitor, the laser wire, the streak camera and the energy spread monitor at the extraction line. We report on the operation condition and the measurement results.

Electron cloud dynamics in the Cornell Electron Storage Ring Test Accelerator wiggler

Directory of Open Access Journals (Sweden)

C. M. Celata

2011-04-01

Full Text Available The interference of stray electrons (also called “electron clouds” with accelerator beams is important in modern intense-beam accelerators, especially those with beams of positive charge. In magnetic wigglers, used, for instance, for transverse emittance damping, the intense synchrotron radiation produced by the beam can generate an electron cloud of relatively high density. In this paper the complicated dynamics of electron clouds in wigglers is examined using the example of a wiggler in the Cornell Electron Storage Ring Test Accelerator experiment at the Cornell Electron Storage Ring. Three-dimensional particle-in-cell simulations with the WARP-POSINST computer code show different density and dynamics for the electron cloud at locations near the maxima of the vertical wiggler field when compared to locations near the minima. Dynamics in these regions, the electron cloud distribution vs longitudinal position, and the beam coherent tune shift caused by the wiggler electron cloud will be discussed.

A wiggler magnet for FEL low voltage operation

Energy Technology Data Exchange (ETDEWEB)

Al-Shamma`a, A.; Stuart, R.A.; Lucas, J.

1995-12-31

In low voltage FELs (ie, 200kV), operation is necessarily in the microwave frequency range for wiggler periods of the order of cms., so that a waveguide system is mandatory. Also, because of the relatively low velocity of the electron beam, the wiggle amplitude of the electron beam can be much larger than is normal for highly relativistic FELs. Both these factors mean that the electron trajectory must be carefully controlled to avoid beam collision with the waveguide walls. A wiggler system with half poles at entrance and exit is not an acceptable solution because of the offset is gives rise to the electron trajectory. Consequently, we have designed and constructed a wiggler magnet with exponential entrance and exit tapers for a minimal deflection and displacement of the electron beam. Simulations and experimental measurements showed that an on axis trajectory is easily obtainable.

Commissioning of the LNLS 2 T Hybrid Wiggler

CERN Document Server

Farias, Ruy H A; Aparecida-Gouveia, Ana F; Cabral-Jahnel, Lucia; Citadini, James F; Ferreira, Marcelo J; Franco, J G; Liu, Lin; Neuenschwander, Regis; Resende, Ximenes R; Tavares, Pedro; Tosin, Giancarlo

2005-01-01

We present the results of the commissioning of a 28-pole 2 T Hybrid Wiggler at the 1.37 GeV electron storage ring of the Brazilian Synchrotron Light Source. The wiggler will be used mainly for protein crystallography and was optimized for the production of 12 keV photons. The very high field and relatively large gap (22 mm) of this insertion device led to a magnetic design that includes large main and side magnets and heavily saturated poles. We present the results of the commissioning with beam, with special attention to the correction of the large linear tune-shift perturbations produced by the wiggler as well as on the reduction of beam lifetime at full energy. Since the injection at the LNLS storage ring is performed at 500 MeV we also focus on the effects of non-linearities and their impact on injection efficiency.

ISO far-infrared observations of rich galaxy clusters I. Abell 2670

DEFF Research Database (Denmark)

Hansen, Lene; Jorgensen, H.E.; Nørgaard-Nielsen, Hans Ulrik

1999-01-01

As part of an investigation of far-infrared emission from rich galaxy clusters the central part of Abell 2670 has been mapped with ISO at 60 mu m, 100 mu m, 135 mu m, and 200 mu m using the PHT-C camera. Point sources detected in the field have infrared fluxes comparable to normal spirals...

Reststrahlen Band Optics for the Advancement of Far-Infrared Optical Architecture

Science.gov (United States)

Streyer, William Henderson

The dissertation aims to build a case for the benefits and means of investigating novel optical materials and devices operating in the underdeveloped far-infrared (20 - 60 microns) region of the electromagnetic spectrum. This dissertation and the proposed future investigations described here have the potential to further the advancement of new and enhanced capabilities in fields such as astronomy, medicine, and the petrochemical industry. The first several completed projects demonstrate techniques for developing far-infrared emission sources using selective thermal emitters, which could operate more efficiently than their simple blackbody counterparts commonly used as sources in this wavelength region. The later projects probe the possible means of linking bulk optical phonon populations through interaction with surface modes to free space photons. This is a breakthrough that would enable the development of a new class of light sources operating in the far-infrared. Chapter 1 introduces the far-infrared wavelength range along with many of its current and potential applications. The limited capabilities of the available optical architecture in this range are outlined along with a discussion of the state-of-the-art technology available in this range. Some of the basic physical concepts routinely applied in this dissertation are reviewed; namely, the Drude formalism, semiconductor Reststrahlen bands, and surface polaritons. Lastly, some of the physical challenges that impede the further advancement of far-infrared technology, despite remarkable recent success in adjacent regions of the electromagnetic spectrum, are discussed. Chapter 2 describes the experimental and computational methods employed in this dissertation. Spectroscopic techniques used to investigate both the mid-infrared and far-infrared wavelength ranges are reviewed, including a brief description of the primary instrument of infrared spectroscopy, the Fourier Transform Infrared (FTIR) spectrometer

Calculation of the Coherent Synchrotron Radiation Impedance from a Wiggler

International Nuclear Information System (INIS)

Wu, Juhao

2003-01-01

Most studies of Coherent Synchrotron Radiation (CSR) have only considered the radiation from independent dipole magnets. However, in the damping rings of future linear colliders, a large fraction of the radiation power will be emitted in damping wigglers. In this paper, the longitudinal wakefield and impedance due to CSR in a wiggler are derived in the limit of a large wiggler parameter K. After an appropriate scaling, the results can be expressed in terms of universal functions, which are independent of K. Analytical asymptotic results are obtained for the wakefield in the limit of large and small distances, and for the impedance in the limit of small and high frequencies

Far-infrared Spectroscopic Characterization of Anti-vinyl Alcohol

Science.gov (United States)

Bunn, Hayley; Soliday, Rebekah M.; Sumner, Isaiah; Raston, Paul L.

2017-09-01

We report a detailed analysis of the high-resolution far-infrared spectrum of anti-vinyl alcohol, which has been previously identified toward Sagittarius B2(N). The ν 15 OH torsional fundamental investigated here is more than 200 cm-1 removed from the next nearest vibration, making it practically unperturbed and ideal to help refine the ground state rotational constants that were previously determined from 25 microwave lines. We assigned 1335 lines within the ν 15 fundamental centered at 261.5512 cm-1, with J and K a ranges of 1-59 and 0-16, respectively. The microwave and far-infrared line positions were fit with Watson-type A- and S-reduced Hamiltonians, with the inclusion of quartic and select sextic distortion terms. This resulted in a significant refinement of the ground state constants, in addition to the determination of the {ν }15=1 state constants for the first time. The spectroscopic parameters are in good agreement with the results from anharmonic coupled-cluster calculations, and should be useful in searches for rotationally and/or vibrationally warm anti-vinyl alcohol in interstellar molecular clouds.

Construction of compact FEM using solenoid-induced helical wiggler

International Nuclear Information System (INIS)

Ohigashi, N.; Tsunawaki, Y.; Fujita, M.; Imasaki, K.; Mima, K.; Nakai, S.

2003-01-01

A prototype of compact Free-Electron Maser (FEM) has been designed for the operation in a usual small laboratory which does not have electric source capacity available enough. The electron energy is 60-120 keV. As it is lower, stronger guiding magnetic field is necessary in addition to wiggler field. To fulfil this condition a solenoid-induced helical wiggler is applied from the viewpoint of saving the electric power of restricted source capacity. The wiggler, for example, with the period of 12 mm creates the field of 92 G in the guiding field of 3.2 kG. The whole system of FEM has been just constructed in a small-scale laboratory. It is so small to occupy the area of 0.7x2.9 m 2

Experimental and numerical studies of sheet electron beam propagation through a planar wiggler magnet

International Nuclear Information System (INIS)

Zhang, Ze Xiang; Granatstein, V.L.; Destler, W.W.; Rodgers, J.; Cheng, S.; Antonsen, T.M. Jr.; Levush, B.; Bidwell, S.W.

1993-01-01

Detailed experimental studies on sheet relativistic electron beam propagation through a long planar wiggler are reported and compared with numerical simulations. The planar wiggler has 56 periods with a period of 9.6 mm. Typically, the wiggler field peak amplitude is 5 kG. The experimental efforts have been focused on control of the deviation of the beam toward the side edge of the planar wiggler along the wide transverse direction. It is found that a suitably tapered magnetic field configuration at the wiggler entrance can considerably reduce the rate of the deviation. The effects of the following techniques on beam transport efficiency are also discussed: side focusing, beam transverse velocity tuning at the wiggler entrance, and beam spread limiting. High beam transport efficiency (almost 100%) of a 15 A beam has been obtained in some cases. The results are relevant to development of a free electron laser amplifier for application to stabilizing and heating of plasma in magnetic fusion research

Superconducting wiggler magnets for beam-emittance damping rings

CERN Document Server

Schoerling, Daniel

2012-01-01

Ultra-low emittance beams with a high bunch charge are necessary for the luminosity performance of linear electron-positron colliders, such as the Compact Linear Collider (CLIC). An effective way to create ultra-low emittance beams with a high bunch charge is to use damping rings, or storage rings equipped with strong damping wiggler magnets. The remanent field of the permanent magnet materials and the ohmic losses in normal conductors limit the economically achievable pole field in accelerator magnets operated at around room temperature to below the magnetic saturation induction, which is 2.15 T for iron. In wiggler magnets, the pole field in the center of the gap is reduced further like the hyperbolic cosine of the ratio of the gap size and the period length multiplied by pi. Moreover, damping wiggler magnets require relatively large gaps because they have to accept the un-damped beam and to generate, at a small period length, a large magnetic flux density amplitude to effectively damp the beam emittance....

Far-infrared spectroscopic study of CeO{sub 2} nanocrystals

Energy Technology Data Exchange (ETDEWEB)

Popović, Z. V., E-mail: zoran.popovic@ipb.ac.rs; Grujić-Brojčin, M.; Paunović, N. [University of Belgrade, Center for Solid State Physics and New Materials, Institute of Physics (Serbia); Radonjić, M. M. [University of Belgrade, Scientific Computing Laboratory, Institute of Physics Belgrade (Serbia); Araújo, V. D.; Bernardi, M. I. B. [Universidade de São Paulo-USP, Instituto de Fisica (Brazil); Lima, M. M. de; Cantarero, A. [Universidad de Valencia, Instituto de Ciencia de Los Materiales (Spain)

2015-01-15

We present the far-infrared reflectivity spectra of 5 nm-sized pure and copper-doped Ce{sub 1−x}Cu{sub x}O{sub 2−y} (x = 0; 0.01 and 0.10) nanocrystals measured at room temperature in the 50–650 cm{sup −1} spectral range. Reflectivity spectra were analyzed using the factorized form of the dielectric function, which includes the phonon and the free carriers contribution. Four oscillators with TO energies of approximately 135, 280, 370, and 490 cm{sup −1} were included in the fitting procedure. These oscillators represent local maxima of the CeO{sub 2} phonon density of states, which is also calculated using the density functional theory. The lowest energy oscillator represents TA(L)/TA(X) phonon states, which become infrared-active E{sub u} modes at the L and X points of the Brillouin zone (BZ). The second oscillator originates from TO(Γ) phonon states. The oscillator at ∼400 cm{sup −1} originates from Raman mode phonon states, which at the L point of BZ also becomes infrared-active E{sub u} mode. The last oscillator describes phonons with dominantly LO(Γ) infrared mode character. The appearance of phonon density of states related oscillators, instead of single F{sub 2u}infrared-active mode in the far-infrared reflectivity spectra, is a consequence of the nanosized dimension of the CeO{sub 2} particles. The best fit spectra are obtained using the generalized Bruggeman model for inhomogeneous media, which takes into account the nanocrystal volume fraction and the pore shape.

A novel small-period wiggler for free-electron lasers

International Nuclear Information System (INIS)

Feng Bibo; Wang Mingchang; Wang Zhijiang

1992-01-01

A novel small-period wiggler configuration constructed by sheet of bifilar-helix with ferro-core for free-electron lasers is proposed. The performance characteristics of the wiggler prototype with 10 mm period are measured. The field as high as 500 G to 1 kG have been obtained. The amplifier designs for operation at 190 GHz using modest electron beam energies in the range of 400-500 keV are presented

Orion star-forming region - far-infrared and radio molecular observations

International Nuclear Information System (INIS)

Thronson, H.A. Jr.; Harper, D.A.; Bally, J.; Dragovan, M.; Mozurkewich, D.; Yerkes Observatory, Williams Bay, WI; ATandT Bell Labs., Holmdel, NJ; Chicago Uni., IL; E. O. Hulburt Center for Space Research, Washington, DC)

1986-01-01

New J = 1-0 CO and far-infrared maps of the Orion star-forming region are presented and discussed. The total infrared luminosity of the Orion star-forming ridge is 250,000 solar luminosities. The material that is emitting strongly at 60 microns is traced and found to be highly centrally concentrated. However, the majority of the extended emission from this region comes from dust that is ultimately heated by the visible Trapezium cluster stars. The luminosity of IRc 2, the most luminous member of the infrared cluster, is estimated to be 40,000-50,000 solar luminosities. A schematic drawing of the Ori MC 1 region is presented. 30 references

Analysis of the superconducting wiggler magnets for the ATF Harmonic Generation FEL experiment

International Nuclear Information System (INIS)

Zhang, X.; Ben-Zvi, I.; Ingold, G.; Krinsky, S.; Yu, L.H.

1992-01-01

In this paper, we consider the superconducting wiggler magnet under construction for the High Gain Harmonic Generation experiment (HGHG) at the Accelerator Test Facility (ATF) at BNL. This wiggler consists of an energy modulation section, a dispersion magnet and a radiator section. We present an analysis of the dispersion magnet and the end effects in the other wiggler sections. The purpose of the dispersion magnet is to convert energy modulation of the electron beam into spatial bunching. For the dispersion magnet, we discuss the physical requirements, analyze the magnetic design, determine the focusing properties, and consider the effect of departures from ideal behavior on the FEL gain. In the modulator and radiator wigglers we analyze the effects due to the ends of the wiggler and discuss their correction. In addition, the localized field produced by a trim coil for horizontal beam steering is investigated

Far-infrared and CO observations of Cep F: Implications for star formation in Cepheus OB3

International Nuclear Information System (INIS)

Sargent, A.I.; van Duinen, R.J.; Nordh, H.L.; Fridlund, C.V.M.; Aalders, J.W.G.; Beintema, D.

1983-01-01

Observations at 80-μm and 130-μm have revealed a source of far-infrared emission in the Cep F portion of the Cepheus OB3 molecular cloud. Molecular line measurements of this region, at the CO J = 1-0 line frequency, have led to the discovery of two CO maxima. One of these coincides with the new far-infrared source. The other is at least as intense as Cep B, until now considered to be the hottest part of the cloud. There is some evidence to suggest that a second far-infrared source is associated with this hotspot. If the far-infrared emission results from the presence of embedded protostars, their location, relative to the OB association stars and to the other active region, Cep A, requires a reexamination of how stars form in the Cepheus OB3 association

New far infrared images of bright, nearby, star-forming regions

Science.gov (United States)

Harper, D. AL, Jr.; Cole, David M.; Dowell, C. Darren; Lees, Joanna F.; Lowenstein, Robert F.

1995-01-01

Broadband imaging in the far infrared is a vital tool for understanding how young stars form, evolve, and interact with their environment. As the sensitivity and size of detector arrays has increased, a richer and more detailed picture has emerged of the nearest and brightest regions of active star formation. We present data on M 17, M 42, and S 106 taken recently on the Kuiper Airborne Observatory with the Yerkes Observatory 60-channel far infrared camera, which has pixel sizes of 17 in. at 60 microns, 27 in. at 100 microns, and 45 in. at 160 and 200 microns. In addition to providing a clearer view of the complex central cores of the regions, the images reveal new details of the structure and heating of ionization fronts and photodissociation zones where radiation form luminous stars interacts with adjacent molecular clouds.

First operation of a wiggler-focused, sheet beam free electron laser amplifier

International Nuclear Information System (INIS)

Destler, W.W.; Cheng, S.; Zhang, Z.X.; Antonsen, T.M. Jr.; Granatstein, V.L.; Levush, B.; Rodgers, J.

1994-01-01

A wiggler-focused, sheet beam free electron laser (FEL) amplifier utilizing a short-period wiggler magnet has been proposed as a millimeter-wave source for current profile modification and/or electron cyclotron resonance heating of tokamak plasmas. As proposed, such an amplifier would operate at a frequency of approximately 100--200 GHz with an output power of 1--10 MW CW. Electron beam energy would be in the range 500--1000 keV. To test important aspects of this concept, an initial sheet beam FEL amplifier experiment has been performed using a 1 mmx2 cm sheet beam produced by a pulse line accelerator with a pulse duration of 100 ns. The 500--570 keV, 4--18 A sheet beam is propagated through a 56 period uniform wiggler (λ w =9.6 mm) with a peak wiggler amplitude of 2--5 kG. Linear amplification of a 5--10 W, 94 GHz signal injected in the TE 01 rectangular mode is observed. All features of the amplified signal, including pulse shape and duration, are in accordance with the predictions of numerical simulation. Amplified signal gain has been measured as a function of injected beam energy, current, and wiggler field amplitude and is also in good agreement with simulation results. Continuation of this experiment will involve studying nonlinear amplifier operation and adding a section of tapered wiggler

Enhancement of isobutane refrigerator performance by using far-infrared coating

International Nuclear Information System (INIS)

Hsu, Yu-Chun; Teng, Tun-Ping

2016-01-01

Highlights: • Two-step synthesis method was employed to produce FIRCs. • Emissivity of FIRCs was determined using a FT-IR. • The highest emissivity of FIRMs was MWCNT. • No-load pull-down and 24-h on-load cycling test were performed. • The COP and EF of S2 were greater than those of S1 by 5.92% and 7.89%. - Abstract: This study evaluated the effect on refrigeration performance and feasibility of a far-infrared coating (FIRC) on the condenser of a small isobutane (R-600a) refrigerator. The evaluation was based on the no-load pull-down and 24-h on-load cycling tests. Far-infrared materials and a water-based coating material were mixed using a two-step synthesis method to obtain the FIRC material. Fourier transform infrared spectrometry established that the optimal far-infrared material was a multiwalled carbon nanotube (MWCNT). The results of the no-load pull-down test revealed that the electricity consumption, freezer temperature, and coefficient of performance (COP) of the R-600a refrigerator with MWCNT-FIRC (S2) were lower than those of the refrigerator without MWCNT-FIRC (S1) by 3.39%, 3.61%, and 2.92%, respectively. The results of the 24-h on-load cycling test showed that S2 had a lower electricity consumption, higher slope of pull-down (SPD), higher compression ratio (CR), higher COP, lower duty ratio (DR), and higher energy factor (EF), changing upon those of S1 by −7.05%, 5.66%, 3.24%, 5.92%, −5.63, and 7.89%, respectively. A MWCNT-FIRC on the condenser of an R-600a refrigerator can enhance refrigeration performance and reduce electricity consumption, resulting in energy saving and carbon reduction.

Far-Infrared Absorption of PbSe Nanorods

KAUST Repository

Hyun, Byung-Ryool

2011-07-13

Measurements of the far-infrared absorption spectra of PbSe nanocrystals and nanorods are presented. As the aspect ratio of the nanorods increases, the Fröhlich sphere resonance splits into two peaks. We analyze this splitting with a classical electrostatic model, which is based on the dielectric function of bulk PbSe but without any free-carrier contribution. Good agreement between the measured and calculated spectra indicates that resonances in the local field factors underlie the measured spectra. © 2011 American Chemical Society.

Drying watery wheat grains by far infrared

International Nuclear Information System (INIS)

Suda, K.; Murata, K.; Hara, M.

2004-01-01

Summary A far infrared dryer was experimented to dry wheat grains for high performance and cost reduction. It is more efficient than a circulating dryer reducing drying time by 20% and fuel consumption by 20 - 30%. Whereas it takes more time and more fuel, when the drying rate is set at 1%/h. Moreover, on condition that the average drying rate is lower, it could decrease the rate of green wheat grains up to 3%. But green wheat grains did not disappear at all on the condition

Stimulated transition radiation in the far-infrared

International Nuclear Information System (INIS)

Settakorn, C.; Hernandez, M.; Wiedemann, H.

1997-08-01

Stimulated transition radiation is generated by recycling coherent far-infrared light pulses of transition radiation in a special cavity. The cavity length is designed to be adjustable. At specific intervals the light of a previous bunch coincides at the radiator with the arrival of a subsequent bunch. In this situation, the external electromagnetic field stimulates the emission of higher intensity transition radiation. It is expected that the extracted energy from the cavity will be about 17 times more than would be possible without recycling

Using far-infrared limb brightening to probe isolated dark globules

International Nuclear Information System (INIS)

Leung, C.M.; O'brien, E.V.; Dubisch, R.

1989-01-01

The problem of radiation transport in dark globules with or without internal heat source, immersed in an isotropic incident interstellar radiation field, is solved. The phenomenon of infrared limb brightening, its dependence on cloud properties, and its observational implications are addressed. Numerical results regarding the dependence of limb brightening on total cloud opacity, luminosity of internal heat source, grain type, dust density distribution, and wavelength of emitted radiation are discussed. Observational implications concerning the use of limb brightening to place an upper limit on the luminosity of an embedded protostar and to determine the grain emissivity law in the far-infrared are examined. For sufficiently large optical depth, the limb-brightening ratio (LBR) is found to be related to the optical depth by a power-law relation in the 140-300 micron wavelength range, where thermal emission from grains peaks. By observing the LBR in this range, this power-law relationship can be exploited to determine the emissivity law of the dust grain in the far-infrared. Both the LBR and the longest wavelength for which limb brightening still occurs are related linearly to the luminosity of the central source. 37 references

Particle motion in the ELF wiggler

International Nuclear Information System (INIS)

Wurtele, J.S.; Sessler, A.M.

1982-06-01

Particle motion in the ELF wiggler was investigated numerically and analytically. A transport system was designed using continuous quadrupole focusing in the wiggle plane and natural wiggle focusing in the non-wiggle plane

The Intrinsic Far-infrared Continua of Type-1 Quasars

Energy Technology Data Exchange (ETDEWEB)

Lyu, Jianwei; Rieke, George H., E-mail: jianwei@email.arizona.edu [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States)

2017-06-01

The range of currently proposed active galactic nucleus (AGN) far-infrared templates results in uncertainties in retrieving host galaxy information from infrared observations and also undermines constraints on the outer part of the AGN torus. We discuss how to test and reconcile these templates. Physically, the fraction of the intrinsic AGN IR-processed luminosity compared with that from the central engine should be consistent with the dust-covering factor. In addition, besides reproducing the composite spectral energy distributions (SEDs) of quasars, a correct AGN IR template combined with an accurate library of star-forming galaxy templates should be able to reproduce the IR properties of the host galaxies, such as the luminosity-dependent SED shapes and aromatic feature strengths. We develop tests based on these expected behaviors and find that the shape of the AGN intrinsic far-IR emission drops off rapidly starting at ∼20 μ m and can be matched by an Elvis et al.-like template with a minor modification. Despite the variations in the near- to mid-IR bands, AGNs in quasars and Seyfert galaxies have remarkably similar intrinsic far-IR SEDs at λ ∼ 20–100 μ m, suggesting a similar emission character of the outermost region of the circumnuclear torus. The variations of the intrinsic AGN IR SEDs among the type-1 quasar population can be explained by the changing relative strengths of four major dust components with similar characteristic temperatures, and there is evidence for compact AGN-heated dusty structures at sub-kiloparsec scales in the far-IR.

Adjustment of Adiabatic Transition Magnetic Field of Solenoid-Induced Helicla Wiggler

CERN Document Server

Tsunawaki, Y

2005-01-01

We have been constructed a solenoid-induced helical wiggler for a compact free electron maser operated in a usual small laboratory which does not have electric source capacity available enough. It consists of two staggered-iron arrays inserted perpendicularly to each other in a solenoid electromagnet. In order to lead/extract an electron beam into/from the wiggler, adiabatic transition (AT) field is necessary at both ends of the wiggler. In this work the AT field was produced by setting staggered-nickel plates with different thickness in the five periods. The thickness of each nickel plate was decided by the field analysis using the MAGTZ computational code based on a magnetic moment method. Exact thickness was, however, found by the precise measurement of the field distribution with the greatest circumspection to obtain a homogeneous increment of the AT field. The change of AT field distribution was studied by referring to an equivalent electric circuit of the wiggler.

Effect of rare earth Ce on the far infrared radiation property of iron ore tailings ceramics

Energy Technology Data Exchange (ETDEWEB)

Liu, Jie [Key Laboratory of Special Functional Materials for Ecological Environment and Information (Hebei University of Technology), Ministry of Education, Tianjin 300130 (China); Institute of Power Source and Ecomaterials Science, Hebei University of Technology, Tianjin 300130 (China); Meng, Junping, E-mail: srlj158@sina.com [Key Laboratory of Special Functional Materials for Ecological Environment and Information (Hebei University of Technology), Ministry of Education, Tianjin 300130 (China); Institute of Power Source and Ecomaterials Science, Hebei University of Technology, Tianjin 300130 (China); Liang, Jinsheng; Duan, Xinhui [Key Laboratory of Special Functional Materials for Ecological Environment and Information (Hebei University of Technology), Ministry of Education, Tianjin 300130 (China); Institute of Power Source and Ecomaterials Science, Hebei University of Technology, Tianjin 300130 (China); Huo, Xiaoli [Institute of Power Source and Ecomaterials Science, Hebei University of Technology, Tianjin 300130 (China); Tang, Qingguo [Key Laboratory of Special Functional Materials for Ecological Environment and Information (Hebei University of Technology), Ministry of Education, Tianjin 300130 (China); Institute of Power Source and Ecomaterials Science, Hebei University of Technology, Tianjin 300130 (China)

2015-06-15

Highlights: • Detailed process proposed for preparation of iron ore tailings ceramics. • Replace natural minerals with iron ore tailings as raw materials for preparing functional ceramics. • Impact mechanism of Ce on far infrared ceramics, as well as its optimum addition amounts can be obtained. • Propose a new perspective on considering the mechanism of far infrared radiation. - Abstract: A kind of far infrared radiation ceramics was prepared by using iron ore tailings, CaCO{sub 3} and SiO{sub 2} as main raw materials, and Ce as additive. The result of Fourier transform infrared spectroscopy showed that the sample exhibits excellent radiation value of 0.914 when doping 7 wt.% Ce. Ce{sup 4+} dissolved into iron diopside and formed interstitial solid solution with it sintered at 1150 °C. The oxidation of Fe{sup 2+} to Fe{sup 3+} caused by Ce{sup 4+} led to a decrease of crystallite sizes and enhancement of Mg–O and Fe–O vibration in iron diopside, which consequently improved the far infrared radiation properties of iron ore tailings ceramics.

Estimation of leaf water content from far infrared (2.5-14µm) spectra using continuous wavelet analysis

NARCIS (Netherlands)

Ullah, S.; Skidmore, A.K.; Naeem, M.; Schlerf, M.

2012-01-01

The objective of this study was to estimate leaf water content based on continuous wavelet analysis from the far infrared (2.5 - 14.0 μm) spectra. The entire dataset comprised of 394 far infrared spectra which were divided into calibration (262 spectra) and validation (132 spectra) subsets. The far

The first steps towards a 7.5 T superconducting wiggler

International Nuclear Information System (INIS)

Werin, S.

1988-01-01

A 7.5 T superconducting wiggler is currently beeing constructed in cooperation between MAX-lab and the Institute of Technology in Tammerfors, Finland. The wiggler will be places at MAX-lab, either at the existing 550 MeV storage ring or at a future 1.2 GeV ring. In this paper some basic designs and calculations are described and discussed. (author)

Far infrared studies of superconducting V3Si, Nb3Ge and Nb. Final report

International Nuclear Information System (INIS)

Perkowitz, S.

1985-01-01

Far infrared spectroscopy between 10 and 250 cm -1 is an effective probe of superconductivity because typical gap and phonon energies lie in this region. Between 1979 and 1985, this DOE contract supported far infrared research in homogeneous high-T/sub c/ superconductors and in granular superconductors. Results in both areas are summarized in this report

Far-infrared contraband-detection-system development for personnel-search applications

International Nuclear Information System (INIS)

Schellenbaum, R.L.

1982-09-01

Experiments have been conducted toward the development of an active near-millimeter-wave, far infrared, personnel search system for the detection of contraband. These experiments employed a microwave hybrid tee interferometer/radiometer scanning system and quasi-optical techniques at 3.3-mm wavelength to illuminate and detect the reflection from target objects against a human body background. Clothing and other common concealing materials are transport at this wavelength. Retroreflector arrays, in conjunction with a Gunn diode radiation source, were investigated to provide all-angle illumination and detection of specular reflections from unaligned and irregular-shaped objects. Results indicate that, under highly controlled search conditions, metal objects greater than or equal to 25 cm 2 can be detected in an enclosure lined with retroreflectors. Further development is required to produce a practical personnel search system. The investigation and feasibility of alternate far infrared search techniques are presented. 23 figures, 2 tables

Spectrophotometry in the far infrared. Optical and Hertzian processes

International Nuclear Information System (INIS)

Coste, Andre

1968-01-01

After a general study of problems related to instrumental spectroscopy in the far infrared, this research thesis examines the theory and technique of construction of slit spectrometers. The author then studied the possibilities to increase brightness and resolution using Fabry-Perot interferometers, and the Fourier transform interferential spectrometry, and finally addressed methods used with micro-waves

Wiggler magnetic field assisted third harmonic generation in expanding clusters

Science.gov (United States)

Vij, Shivani

2018-04-01

A simple theoretical model is constructed to study the wiggler magnetic field assisted third harmonic generation of intense short pulse laser in a cluster in its expanding phase. The ponderomotive force of laser causes density perturbations in cluster electron density which couples with wiggler magnetic field to produce a nonlinear current that generates transverse third harmonic. An intense short pulse laser propagating through a gas embedded with atomic clusters, converts it into hot plasma balls via tunnel ionization. Initially, the electron plasma frequency inside the clusters ω pe > \\sqrt{3}{ω }1 (with ω 1 being the frequency of the laser). As the cluster expands under Coulomb force and hydrodynamic pressure, ω pe decreases to \\sqrt{3}{ω }1. At this time, there is resonant enhancement in the efficiency of the third harmonic generation. The efficiency of third harmonic generation is enhanced due to cluster plasmon resonance and by phase matching due to wiggler magnetic field. The effect of cluster size on the expansion rate is studied to observe that the clusters of different radii would expand differently. The impact of laser intensity and wiggler magnetic field on the efficiency of third harmonic generation is also explored.

Cosmic far-infrared background at high galactic latitudes

International Nuclear Information System (INIS)

Stecker, F.W.; Puget, J.L.; Fazio, G.G.

1977-01-01

We predict far-infrared background fluxes from various cosmic sources. These fluxes lie near the high-frequency side of the blackbody radiation spectrum. These sources could account for a significant fraction of the background radiation at frequencies above 400 GHz which might be misinterpreted as a ''Comptonization'' distortion of the blackbody radiation. Particular attention is paid to the possible contributions from external galaxies, from rich clusters of galaxies, and from galactic dust emission

Cosmic far-infrared background at high galactic latitudes

International Nuclear Information System (INIS)

Stecker, F.W.; Puget, J.L.; Fazio, G.G.

1976-12-01

Far-infrared background fluxes from various cosmic sources are predicted. These fluxes lie near the high-frequency side of the blackbody radiation spectrum. These sources could account for a significant fraction of the background radiation at frequencies above 400 GHz, which might be misinterpreted as a comptonization distortion of the blackbody radiation. Particular attention is paid to the possible contributions from external galaxies, rich clusters of galaxies and from galactic dust emission

Far infrared extinction coefficients of minerals of interest for astronomical observations

International Nuclear Information System (INIS)

Hasegawa, H.

1984-01-01

Far infrared extinction coefficients of mineral grains of interest for astronomical observations have been measured. The measured mineral species are: amorphous carbon, high temperature magnesium silicates, hydrous silicates, iron oxides, and amorphous silicates. (author)

Quasi-optical analysis of a far-infrared spatio-spectral space interferometer concept

Science.gov (United States)

Bracken, C.; O'Sullivan, C.; Murphy, J. A.; Donohoe, A.; Savini, G.; Lightfoot, J.; Juanola-Parramon, R.; Fisica Consortium

2016-07-01

FISICA (Far-Infrared Space Interferometer Critical Assessment) was a three year study of a far-infrared spatio-spectral double-Fourier interferometer concept. One of the aims of the FISICA study was to set-out a baseline optical design for such a system, and to use a model of the system to simulate realistic telescope beams for use with an end-to-end instrument simulator. This paper describes a two-telescope (and hub) baseline optical design that fulfils the requirements of the FISICA science case, while minimising the optical mass of the system. A number of different modelling techniques were required for the analysis: fast approximate simulation tools such as ray tracing and Gaussian beam methods were employed for initial analysis, with GRASP physical optics used for higher accuracy in the final analysis. Results are shown for the predicted far-field patterns of the telescope primary mirrors under illumination by smooth walled rectangular feed horns. Far-field patterns for both on-axis and off-axis detectors are presented and discussed.

Field correction for a one meter long permanent-magnet wiggler

International Nuclear Information System (INIS)

Fortgang, C.M.

1992-01-01

Field errors in wigglers are usually measured and corrected on-axis only, thus ignoring field error gradients. We find that gradient scale lengths are of the same order as electron beam size and therefore can be important. We report measurements of wiggler field errors in three dimensions and expansion of these errors out to first order (including two dipole and two quadrupole components). Conventional techniques for correcting on-axis errors (order zero) create new off-axis (first order) errors. We present a new approach to correcting wiggler fields out to first order. By correcting quadrupole errors in addition to the usual dipole correction, we minimize growth in electron beam size. Correction to first order yields better overlap between the electron and optical beams and should improve laser gain. (Author) 2 refs., 5 figs

Developing Wide-Field Spatio-Spectral Interferometry for Far-Infrared Space Applications

Science.gov (United States)

Leisawitz, David; Bolcar, Matthew R.; Lyon, Richard G.; Maher, Stephen F.; Memarsadeghi, Nargess; Rinehart, Stephen A.; Sinukoff, Evan J.

2012-01-01

Interferometry is an affordable way to bring the benefits of high resolution to space far-IR astrophysics. We summarize an ongoing effort to develop and learn the practical limitations of an interferometric technique that will enable the acquisition of high-resolution far-IR integral field spectroscopic data with a single instrument in a future space-based interferometer. This technique was central to the Space Infrared Interferometric Telescope (SPIRIT) and Submillimeter Probe of the Evolution of Cosmic Structure (SPECS) space mission design concepts, and it will first be used on the Balloon Experimental Twin Telescope for Infrared Interferometry (BETTII). Our experimental approach combines data from a laboratory optical interferometer (the Wide-field Imaging Interferometry Testbed, WIIT), computational optical system modeling, and spatio-spectral synthesis algorithm development. We summarize recent experimental results and future plans.

The 8 cm Period Electromagnetic Wiggler Magnet with Coils Made from Sheet Copper

CERN Document Server

Biallas, George H; Hiatt, Tommy; Neil, George R; Snyder, Michael D

2005-01-01

An electromagnetic wiggler, now lasing at the Jefferson Lab FEL, has 29 eight cm periods with K variable from 0.6 to1.1 and gap of 2.6 cm. The wiggler was made inexpensively in 11 weeks by an industrial machine shop. The conduction cooled coil design uses copper sheet material cut to forms using water jet cutting. The conductor is cut to serpentine shapes and the cooling plates are cut to ladder shape. The sheets are assembled in stacks insulated with polymer film, also cut with water jet. The coil design extends the serpentine conductor design of the Duke OK4 to more and smaller conductors. The wiggler features graded fields in the two poles at each end and trim coils on these poles to eliminate field errors caused by saturation. An added critical feature is mirror plates at the ends with integral trim coils to eliminate three dimensional end field effects and align the entrance and exit orbit with the axis of the wiggler. Details of construction, measurement methods and excellent wiggler performance are pre...

Tunable Far Infrared Studies in Support of Stratospheric Measurements

Science.gov (United States)

Chance, Kelly V.; Park, K.; Nolt, I. G.; Evenson, K. M.

2001-01-01

This report summarizes research done under NASA Grant NAG5-4653. The research performed under this grant has been a collaboration between institutions including the Smithsonian Astrophysical Observatory, the National Institute of Standards and Technology, the University of Oregon, and the NASA Langley Research Center. The program has included fully line-resolved measurements of submillimeter and far infrared spectroscopic line parameters (pressure broadening coefficients and their temperature dependences, and line positions) for the analysis of field measurements of stratospheric constituents, far infrared database improvements, and studies for improved satellite measurements of the Earth's atmosphere. This research program is designed to enable the full utilization of spectra obtained in far infrared/submillimeter field measurements, such as FIRS-2, FILOS, IBEX, SLS, EosMLS, and proposed European Space Agency measurements of OH (e.g., PIRAMHYD and SFINX) for the retrieval of accurate stratospheric altitude profiles of key trace gases involved in ozone layer photochemistry. For the analysis of the spectra obtained in the stratosphere from far infrared measurements it is necessary to have accurate values of the molecular parameters (line positions, strengths, and pressure broadening coefficients) for the measured molecules and for possible interfering species. Knowledge of line positions is in increasingly good shape, with some notable exceptions. The increase in position information includes research that has been performed in the present program of research on HO2, H2O, H2O2, O3, HCl, HF, HBr, HI, CO, OH, and ClO. Examples where further line position studies are necessary include hot band and minor isotopomer lines of some of the major trace species (H2O, O3) and normal lines of some triatomic and larger molecules (NO2). Knowledge of strengths is in generally good shape, since most of the lines are from electric dipole transitions whose intensities are well

Twin optically-pumped far-infrared CH3OH laser for plasma diagnostics

International Nuclear Information System (INIS)

Yamanaka, M.; Takeda, Y.; Tanigawa, S.; Nishizawa, A.

1980-01-01

A twin optically-pumped far-infrared CH 3 OH laser has been constructed for use in plasma diagnostics. The antisymmetric doublet due to the Raman-type resonant two-photon transition is reproducibly observed at 118.8 microns. With the 118.8-micron line, it is found that CH 3 OH absorption line center is 16 + or - 1 MHz higher than the pump 9.7-micron P(36) CO 2 laser line center. It is shown that the Raman-type resonant two-photon transition is useful in order to get several MHz phase modulation for the far-infrared laser interferometer. Some preliminary performances of this twin laser for the modulated interferometer are described

Electron dynamics with radiation and nonlinear wigglers

International Nuclear Information System (INIS)

Jowett, J.M.

1986-06-01

The physics of electron motion in storage rings is described by supplementing the Hamiltonian equations of motion with fluctuating radiation reaction forces to describe the effects of synchrotron radiation. This leads to a description of radiation damping and quantum diffusion in single-particle phase-space by means of Fokker-Planck equations. For practical purposes, most storage rings remain in the regime of linear damping and diffusion; this is discussed in some detail with examples, concentrating on longitudinal phase space. However special devices such as nonlinear wigglers may permit the new generation of very large rings to go beyond this into regimes of nonlinear damping. It is shown how a special combined-function wiggler can be used to modify the energy distribution and current profile of electron bunches

High-power free-electron laser amplifier using a scalloped electron beam and a two-stage wiggler

Directory of Open Access Journals (Sweden)

D. C. Nguyen

2006-05-01

Full Text Available High-power free-electron laser (FEL amplifiers present many practical design and construction problems. One such problem is possible damage to any optical beam control elements beyond the wiggler. The ability to increase the optical beam’s divergence angle after the wiggler, thereby reducing the intensity on the first optical element, is important to minimize such damage. One proposal to accomplish this optical beam spreading is to pinch the electron beam thereby focusing the radiation as well. In this paper, we analyze an approach that relies on the natural betatron motion to pinch the electron beam near the end of the wiggler. We also consider a step-tapered, two-stage wiggler to enhance the efficiency. The combination of a pinched electron beam and step-taper wiggler leads to additional optical guiding of the optical beam. This novel configuration is studied in simulation using the MEDUSA code. For a representative set of beam and wiggler parameters, we discuss (i the effect of the scalloped beam on the interaction in the FEL and on the focusing and propagation of the radiation, and (ii the efficiency enhancement in the two-stage wiggler.

Impact of the Wiggler Coherent Synchrotron Radiation Impedance on the Beam Instability

International Nuclear Information System (INIS)

Wu, Juhao

2003-01-01

Coherent Synchrotron Radiation (CSR) can play an important role by not only increasing the energy spread and emittance of a beam, but also leading to a potential instability. Previous studies of the CSR induced longitudinal instability were carried out for the CSR impedance due to dipole magnets. However, many storage rings include long wigglers where a large fraction of the synchrotron radiation is emitted. This includes high-luminosity factories such as DAPHNE, PEP-II, KEK-B, and CESR-C as well as the damping rings of future linear colliders. In this paper, the instability due to the CSR impedance from a wiggler is studied assuming a large wiggler parameter K. The primary consideration is a low frequency microwave-like instability, which arises near the pipe cut-off frequency. Detailed results are presented on the growth rate and threshold for the damping rings of several linear collider designs. Finally, the optimization of the relative fraction of damping due to the wiggler systems is discussed for the damping rings

Far-infrared ferroelectric soft mode spectroscopy on thin films

Czech Academy of Sciences Publication Activity Database

Petzelt, Jan; Ostapchuk, Tetyana

2001-01-01

Roč. 249, 1-2 (2001), s. 81-88 ISSN 0015-0193 R&D Projects: GA ČR GA202/98/1282; GA AV ČR IAA1010918; GA MŠk OC 514.10 Institutional research plan: CEZ:AV0Z1010914 Keywords : far-infrared spectroscopy * soft mode * dielectric spectra * permitivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.471, year: 2001

Advancing toward far-infrared interferometry in space through coordinated international efforts

NARCIS (Netherlands)

Leisawitz, D.; Baryshev, A.; Griffin, M. J.; Helmich, F. P.; Ivison, R. J.; Rinehart, S. A.; Savini, G.; Shibai, H.

2013-01-01

The international far-infrared astrophysics community is eager to follow up Spitzer and Herschel observations with sensitive, high-resolution imaging and spectroscopy, for such measurements are needed to understand merger-driven star formation, Active Galactic Nuclei, chemical enrichment in

γ -Ray Generation from Plasma Wakefield Resonant Wiggler

Science.gov (United States)

Lei, Bifeng; Wang, Jingwei; Kharin, Vasily; Zepf, Matt; Rykovanov, Sergey

2018-03-01

A flexible gamma-ray radiation source based on the resonant laser-plasma wakefield wiggler is proposed. The wiggler is achieved by inducing centroid oscillations of a short laser pulse in a plasma channel. Electrons (self-)injected in such a wakefield experience both oscillations due to the transverse electric fields and energy gain due to the longitudinal electric field. The oscillations are significantly enhanced when the laser pulse centroid oscillations are in resonance with the electron betatron oscillations, extending the radiation spectrum to the gamma-ray range. The polarization of the radiation can be easily controlled by adjusting the injection of the laser pulse into the plasma channel.

Optics Alignment of a Balloon-Borne Far-Infrared Interferometer BETTII

Science.gov (United States)

Dhabal, Arnab; Rinehart, Stephen A.; Rizzo, Maxime J.; Mundy, Lee; Sampler, Henry; Juanola Parramon, Roser; Veach, Todd; Fixsen, Dale; Vila Hernandez De Lorenzo, Jor; Silverberg, Robert F.

2017-01-01

The Balloon Experimental Twin Telescope for Infrared Interferometry (BETTII) is an 8-m baseline far-infrared (FIR: 30 90 micrometer) interferometer providing spatially resolved spectroscopy. The initial scientific focus of BETTII is on clustered star formation, but this capability likely has a much broader scientific application.One critical step in developing an interferometer, such as BETTII, is the optical alignment of the system. We discuss how we determine alignment sensitivities of different optical elements on the interferogram outputs. Accordingly, an alignment plan is executed that makes use of a laser tracker and theodolites for precise optical metrology of both the large external optics and the small optics inside the cryostat. We test our alignment on the ground by pointing BETTII to bright near-infrared sources and obtaining their images in the tracking detectors.

Making an Inexpensive Electromagnetic Wiggler Using Sheet Materials for the Coils

CERN Document Server

Herman-Biallas, George; Hiatt, Thomas; Neil, George; Snyder, Michael

2004-01-01

An inexpensive electromagnetic wiggler, made with twenty-eight, 4 cm periods with a K of 1 and gap of 2.6 cm was made within 10 weeks after receipt of order by an industrial machine shop. The coil design used sheet and plate materials cut to shapes using water jet cutting and was assembled in a simple stack design. The coil design extends the serpentine conductor design of the Duke OK4 to more and smaller conductors. The coils are conduction cooled to imbedded cooling plates. The wiggler features graded end pole fields, trim coil compensation for end field errors and mirror plates on the ends to avoid three dimensional end field effects. Details of the methods used in construction and the wiggler performance are presented.

A long electromagnetic wiggler for the paladin free-electron laser experiments

International Nuclear Information System (INIS)

Deis, G.A.; Harvey, A.R.; Parkison, C.D.; Prosnitz, D.; Rego, J.; Scharlemann, E.T.; Halbach, K.

1987-01-01

We have designed, built, and tested a 25.6-m-long wiggler for a free-electron-laser (FEL) experiment. It is a DC iron-core electromagnetic wiggler that incorporates a number of important and unique features. Permanent magnets are used to suppress saturation in the iron and extend the linear operating range. Steering-free excitation allows real-time adjustment of the field taper without causing beam steering. Wiggle-plane focusing is produced by curved pole tips. The magnitude of random pole-to-pole field errors is minimized by a mechanical design concept that reduces tolerance stackup in critical locations. To date, we have tested 15 m of this wiggler, and our measurements have shown exceptionally low levels of random errors. 8 refs

Manifestation of surface phonons in far infrared reflectivity of diamond-type semiconductors

Energy Technology Data Exchange (ETDEWEB)

Perez-Sanchez, F.L.; Perez-Rodriguez, F. [Instituto de Fisica, Universidad Autonoma de Puebla, Apdo. Post. J-48, Puebla, Pue. 72570 (Mexico)

2004-11-01

The coupling of surface phonons with light at (001) surfaces of diamond-structure crystals and its manifestation in far-infrared anisotropy spectra are theoretically studied. We apply the adiabatic bond charge model to describe short-range mechanical interactions together with long-range Coulomb forces and radiation fields, and we solve the corresponding system of coupled equations for the electromagnetic field and the lattice vibrations. We calculate far-infrared normal reflectance spectra of (001) surfaces of semi-infinite diamond-type crystals. In particular, we analyse reflectance spectra for the Si(001) (2 x 1) surface, which exhibit a resonance structure associated with the excitation of surface phonon modes. (copyright 2004 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Density functional theory for prediction of far-infrared vibrational frequencies: molecular crystals of astrophysical interest

Science.gov (United States)

Ennis, C.; Auchettl, R.; Appadoo, D. R. T.; Robertson, E. G.

2017-11-01

Solid-state density functional theory code has been implemented for the structure optimization of crystalline methanol, acetaldehyde and acetic acid and for the calculation of infrared frequencies. The results are compared to thin film spectra obtained from low-temperature experiments performed at the Australian Synchrotron. Harmonic frequency calculations of the internal modes calculated at the B3LYP-D3/m-6-311G(d) level shows higher deviation from infrared experiment than more advanced theory applied to the gas phase. Importantly for the solid-state, the simulation of low-frequency molecular lattice modes closely resembles the observed far-infrared features after application of a 0.92 scaling factor. This allowed experimental peaks to be assigned to specific translation and libration modes, including acetaldehyde and acetic acid lattice features for the first time. These frequency calculations have been performed without the need for supercomputing resources that are required for large molecular clusters using comparable levels of theory. This new theoretical approach will find use for the rapid characterization of intermolecular interactions and bonding in crystals, and the assignment of far-infrared spectra for crystalline samples such as pharmaceuticals and molecular ices. One interesting application may be for the detection of species of prebiotic interest on the surfaces of Kuiper-Belt and Trans-Neptunian Objects. At such locations, the three small organic molecules studied here could reside in their crystalline phase. The far-infrared spectra for their low-temperature solid phases are collected under planetary conditions, allowing us to compile and assign their most intense spectral features to assist future far-infrared surveys of icy Solar system surfaces.

High resolution far-infrared survey of A section of the galactic plane. I. The nature of the sources

International Nuclear Information System (INIS)

Jaffe, D.T.; Stier, M.T.; Fazio, G.G.

1982-01-01

We have surveyed a 7.5 deg 2 portion of the galactic plane between l/sup II/ = 10 0 and l/sup II/ = 16 0 at 70 μm with a 1' beam. We present far-infrared, radio continuum, and 12 CO and 13 CO line observations of the 42 far-infrared sources in the survey region. The sources range in luminosity from 4 x 10 3 to 3 x 10 6 L/sub sun/. Most are associated with 12 CO peaks. More than half of the sources have associated H 2 O maser emission. Half have associated radio continuum emission at a limit of 100 mJy. Eight sources have radio emission at weaker levels. In a number of cases, the far-infrared source is smaller than its associated radio source. This difference can be explained in the context of the ''blister'' picture of H II regions. One group of sources emits many fewer Lyman continuum photons than expected, given the far-infrared luminosities. We examine a number of possible reasons for this and conclude that the most reasonable explanation is that clusters of early type stars rather than single stars excite the far-infrared sources. We examine the energetics in the molecular clouds surrounding the infrared sources and conclude that the sources could supply the energy to explain the observed temperature structure and velocity field in the molecular gas

Harmonic generation with multiple wiggler schemes

Energy Technology Data Exchange (ETDEWEB)

Bonifacio, R.; De Salvo, L.; Pierini, P. [Universita degli Studi, Milano (Italy)

1995-02-01

In this paper the authors give a simple theoretical description of the basic physics of the single pass high gain free electron laser (FEL), describing in some detail the FEL bunching properties and the harmonic generation technique with a multiple-wiggler scheme or a high gain optical klystron configuration.

Second crystal cooling on cryogenically cooled undulator and wiggler double crystal monochromators

International Nuclear Information System (INIS)

Knapp, G. S.

1998-01-01

Simple methods for the cooling of the second crystals of cryogenically cooled undulator and wiggler double crystal monochromators are described. Copper braids between the first and second crystals are used to cool the second crystals of the double crystal monochromators. The method has proved successful for an undulator monochromator and we describe a design for a wiggler monochromator

Global beta-beating compensation of the ALS W16 wiggler

International Nuclear Information System (INIS)

Robin, D.; Decking, W.; Nishimura, H.

1997-05-01

The W16 wiggler is the first wiggler and highest field insertion device to be installed in the ALS storage ring. When the gaps of the W16 wiggler are closed, the vertical tune increases by 0.065 and the vertical beta function is distorted by up to ±37%. There are 48 quadrupoles in the ring whose fields can be adjusted individually to restore the tunes and partially compensate the beta-beating. In order to adjust the quadrupole field strengths to accurately compensate the focusing, it is necessary to have a method to precisely determine the beta-beating. In this paper we compare measurements of the induced beta-beating using two methods: measuring the tune dependence on quadrupole field strength and fitting a lattice model with measured response matrices. The fitted model also allows us to predict quadrupole field strengths that will best compensate the beta beating. These quadrupole field strengths are then applied and the resultant beta-beating is measured

Far infrared properties of PbTe doped with cerium

International Nuclear Information System (INIS)

Nikolic, P.M.; Koenig, W.; Vujatovic, S.S.; Blagojevic, V.; Lukovic, D.; Savic, S.; Radulovic, K.; Urosevic, D.; Nikolic, M.V.

2007-01-01

Single crystal samples of lead telluride doped with cerium were made using the Bridgman method. Far infrared reflectivity spectra in the temperature range from 10 to 300 K are presented. The experimental data were numerically analyzed using a fitting procedure based on the plasmon-phonon interaction model and optical parameters were determined. Two additional local modes were observed at about 138 and 337 cm -1 . The origin of these local vibrational impurity modes was discussed

Wigglers and single-particle dynamics in the NLC damping rings

International Nuclear Information System (INIS)

Venturini, Marco; Wolski, Andrzej; Dragt, Alex

2003-01-01

Wiggler insertions are expected to occupy a significant portion of the lattice of the Next Linear Collider (NLC) Main Damping Rings (MDR) and have a noticeable impact on the single-particle beam dynamics. Starting from a realistic 3D representation of the magnetic fields we calculate the transfer maps for the wigglers, accounting for linear and nonlinear effects, and we study the beam dynamics with particular attention paid to the Dynamic Aperture(DA). A DA reduction is observed but appears to remain within acceptable limits

Vacuum variable-angle far-infrared ellipsometer

Science.gov (United States)

Friš, Pavel; Dubroka, Adam

2017-11-01

We present the design and performance of a vacuum far-infrared (∼50-680 cm-1) ellipsometer with a rotating analyser. The system is based on a Fourier transform spectrometer, an in-house built ellipsometer chamber and a closed-cycle bolometer. The ellipsometer chamber is equipped with a computer controlled θ-2θ goniometer for automated measurements at various angles of incidence. We compare our measurements on SrTiO3 crystal with the results acquired above 300 cm-1 with a commercially available ellipsometer system. After the calibration of the angle of incidence and after taking into account the finite reflectivity of mirrors in the detector part we obtain a very good agreement between the data from the two instruments. The system can be supplemented with a closed-cycle He cryostat for measurements between 5 and 400 K.

FIRBACK Far Infrared Survey with ISO: Data Reduction, Analysis and First Results

OpenAIRE

Dole, Herve; Lagache, Guilaine; Puget, Jean-Loup; Gispert, Richard; Aussel, H.; Bouchet, F. R.; Ciliegi, C.; Clements, D. L.; Cesarsky, C.; Desert, F-X; Elbaz, D.; Franceschini, A.; Guiderdoni, B.; Harwit, M.; Laureijs, R.

1999-01-01

FIRBACK is one of the deepest cosmological surveys performed in the far infrared, using ISOPHOT. We describe this survey, its data reduction and analysis. We present the maps of fields at 175 microns. We point out some first results: source identifications with radio and mid infrared, and source counts at 175 microns. These two results suggest that half of the FIRBACK sources are probably at redshifts greater than 1. We also present briefly the large follow-up program.

Photon-Counting Microwave Kinetic Inductance Detectors (MKIDs) for High Resolution Far-Infrared Spectroscopy

Data.gov (United States)

National Aeronautics and Space Administration — We are developing ultrasensitive Microwave Kinetic Inductance Detectors (MKIDs) for high resolution far-infrared spectroscopy applications, with a long-term goal of...

Far infrared properties of PbTe doped with cerium

Energy Technology Data Exchange (ETDEWEB)

Nikolic, P.M. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia)]. E-mail: nikolic@sanu.ac.yu; Koenig, W. [Max Planck Institut fuer Festkoerperforschung, Heisenbergstrasse 1, 7000 Stuttgart 80 (Germany); Vujatovic, S.S. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Blagojevic, V. [Faculty of Electronic Engineering, University of Belgrade, Bulevar Kralja Aleksandra 73, 11000 Belgrade (Serbia); Lukovic, D. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Savic, S. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Radulovic, K. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Urosevic, D. [Mathematical Institute SASA, Knez Mihailova 35/I, 11000 Belgrade (Serbia); Nikolic, M.V. [Center for Multidisciplinary Studies of the University of Belgrade, Kneza Viseslava 1, Belgrade (Serbia)

2007-05-16

Single crystal samples of lead telluride doped with cerium were made using the Bridgman method. Far infrared reflectivity spectra in the temperature range from 10 to 300 K are presented. The experimental data were numerically analyzed using a fitting procedure based on the plasmon-phonon interaction model and optical parameters were determined. Two additional local modes were observed at about 138 and 337 cm{sup -1}. The origin of these local vibrational impurity modes was discussed.

Time-resolved far-infrared experiments at the National Synchrotron Light Source. Final report

International Nuclear Information System (INIS)

Tanner, D.B.; Reitze, D.H.; Carr, G.L.

1999-01-01

A facility for time-resolved infrared and far-infrared spectroscopy has been built and commissioned at the National Synchrotron Light Source. This facility permits the study of time dependent phenomena over a frequency range from 2-8000cm -1 (0.25 meV-1 eV). Temporal resolution is approximately 200 psec and time dependent phenomena in the time range out to 100 nsec can be investigated

Far infrared spectroscopy of high-Tc superconductors at the National Synchrotron Light Source

International Nuclear Information System (INIS)

Perkowitz, S.; Williams, G.P.

1989-01-01

This paper reports the first far infrared transmission spectra for micron-thick films of high-T c rare-earth superconductors such as DyBaCuO, with implications for the superconducting gap. Spectra were obtained at Brookhaven's National Synchrotron Light Source, a new high-intensity, broad-band millimeter to infrared source. The National Synchrotron Light Source at Brookhaven National Laboratory, known for powerful X-ray and UV output, is also a high-intensity (10 to 1000 times above a black body), high-brightness (intensity per solid angle), broad-band, picosecond, millimeter to infrared source. These features make it valuable for far-infrared condensed matter experiments, especially those in highly absorbing or extremely small systems. A first application has been to measure very small infrared transmissions through thick bulk-like high-T c superconducting films. Preliminary measurements through films of the conventional superconductor Nb 3 Ge established techniques. These were followed by the first measurements (to the author's knowledge) through micron-thick films of high-T c rare-earth superconductors such as DyBaCuO over 10-300 cm -1 , which includes the superconducting gap according to BCS or moderately strong-coupled theory. The authors discuss the transmission evidence bearing on the existence of a gap and other important features of high-T c superconductors, and describe the synchrotron and instrumentation features which make possible these unusual measurements

Far-infrared irradiation drying behavior of typical biomass briquettes

International Nuclear Information System (INIS)

Chen, N.N.; Chen, M.Q.; Fu, B.A.; Song, J.J.

2017-01-01

Infrared radiation drying behaviors of four typical biomass briquettes (populus tomentosa leaves, cotton stalk, spent coffee grounds and eucalyptus bark) were investigated based on a lab-scale setup. The effect of radiation source temperatures (100–200 °C) on the far-infrared drying kinetics and heat transfer of the samples was addressed. As the temperature went up from 100 °C to 200 °C, the time required for the four biomass briquettes drying decreased by about 59–66%, and the average values of temperature for the four biomass briquettes increased by about 33–39 °C, while the average radiation heat transfer fluxes increased by about 3.3 times (3.7 times only for the leaves). The specific energy consumptions were 0.622–0.849 kW h kg"−"1. The Modified Midilli model had the better representing for the moisture ratio change of the briquettes. The values of the activation energy for the briquettes in the first falling rate stage were between 20.35 and 24.83 kJ mol"−"1, while those in the second falling rate stage were between 17.89 and 21.93 kJ mol"−"1. The activation energy for the eucalyptus bark briquette in two falling rate stages was the least one, and that for the cotton stalk briquette was less than that for the rest two briquettes. - Highlights: • Far infrared drying behaviors of four typical biomass briquettes were addressed. • The effect of radiation source temperatures on IR drying kinetics was stated. • Radiation heat transfer flux between the sample and heater was evaluated. • Midilli model had the better representing for the drying process of the samples.

A twin optically-pumped far-infrared CH3OH laser for plasma diagnostics

International Nuclear Information System (INIS)

Yamanaka, M.; Takeda, Y.; Tanigawa, S.; Nishizawa, A.; Noda, N.

1979-11-01

A twin optically-pumped far-infrared CH 3 OH laser has been constructed for use in plasma diagnostics. The anti-symmetric doublet due to the Raman-type resonant two-photon transition is reproducibly observed at 118.8 μm. With the 118.8-μm line, it is obtained from the frequency separation of the anti-symmetric doublet that the CH 3 OH absorption line center is 16 +- 1 MHz higher than the pump 9.7-μm P(36) CO 2 laser line center. It is shown that the Raman-type resonant two-photon transition is useful in order to get several-MHz phase modulation for the far-infrared laser interferometer. Some preliminary performances of this twin laser for the modulated interferometer are described. (author)

Initial operation of SSRL wiggler in spear

International Nuclear Information System (INIS)

Berndt, M.; Brunk, W.; Cronin, R.; Jensen, D.; Johnson, R.; King, A.; Spencer, J.; Taylor, T.; Winick, H.

1979-03-01

A 3 lambda planar, magnetic wiggler has been designed, built, installed and operated in the SPEAR storage ring. Its primary purpose is to provide tunable synchrotron radiation (SR) with a higher energy and intensity than previously available for a new SR beam line just commissioned at the Stanford Synchrotron Radiation Laboratory. Because the magnet operates from 0-18 kG, it should also produce undulator radiation (UR). Since the wiggler influences storage ring operation in both single beam and colliding beam modes, measurements were made of tune changes, emittance changes and energy spreads which are compared to predictions. Significant improvements in luminosity for high energy physics experiments were observed. The ability to do x-ray experiments easily that were not previously feasible at low electron beam energies and currents has also been demonstrated. The basic design, some interesting characteristics of the magnetic measurements and initial operating experience and results are discussed

Atomic oxygen fine-structure splittings with tunable far-infrared spectroscopy

Science.gov (United States)

Zink, Lyndon R.; Evenson, Kenneth M.; Matsushima, Fusakazu; Nelis, Thomas; Robinson, Ruth L.

1991-01-01

Fine-structure splittings of atomic oxygen (O-16) in the ground state have been accurately measured using a tunable far-infrared spectrometer. The 3P0-3pl splitting is 2,060,069.09 (10) MHz, and the 3Pl-3P2 splitting is 4,744,777.49 (16) MHz. These frequencies are important for measuring atomic oxygen concentration in earth's atmosphere and the interstellar medium.

Design and analysis of a wiggler magnet system for the PEP-II B-Factory LER

International Nuclear Information System (INIS)

Heim, J.; Kendall, M.; Bertolini, L.; Fackler, O.; O'Connor, T.; Swan, T.; Zholents, A.

1996-01-01

The Low Energy Ring (LER) of the PEP-II B-Factory will use a wiggler magnet system for emittance control and additional damping. The wiggler magnet system is a set of 11 individual iron core, water cooled, dipole magnets designed to operate at 1.6 T and generate 400 kW of synchrotron radiation. Space has been provided to add a second wiggler with an additional 400 kW of synchrotron radiation if more damping is needed in the future. A copper vacuum chamber is used with continuous antechambers connected to both sides of the beam chamber via slots. Synchrotron radiation dump surfaces and distributed vacuum pumping are located in both antechambers. The authors describe the design and analysis of the wiggler magnets and the salient features of the vacuum chamber and dumps

Far-infrared observations of M17: The interaction of an H II region with a molecular cloud

International Nuclear Information System (INIS)

Gatley, I.; Becklin, E.E.; Sellgren, K.; Werner, M.W.

1979-01-01

The central 15' of the M17 H II region--molecular cloud complex has been mapped with 1' resolution simultaneously at 30, 50, and 100 μm. The data suggest that the bulk of the luminosity radiated in the far-infrared is supplied by the exciting stars of the H II region; the far-infrared radiation is thermal emission from dust grains located chiefly outside the ionized gas. Large-scale systematic gradients in both the temperature and the column density of the dust are seen across the source. The appearance of the source in the far-infrared reflects the markedly nonuniform distribution of matter around the exciting stars; the H II region is bounded by the molecular cloud to the southwest. The core of the molecular cloud is heated primarily by infrared radiation from dust within and adjacent to the H II region; no evidence is seen for substantial luminosity sources embedded within the molecular cloud

Initial experiment of focusing wiggler of MM wave Free Electron Laser on LAX-1

International Nuclear Information System (INIS)

Sakamoto, Keishi; Maebara, Sunao; Watanabe, Akihiko; Kishimoto, Yasuaki; Nagashima, Takashi; Maeda, Hikosuke; Shiho, Makoto; Oda, Hisako; Kawasaki, Sunao.

1991-03-01

Initial results of Free Electron laser (FEL) Experiment in the mm wave region are presented. The experiment is carried out using a induction linac system (LAX-1: Large current Accelerator Experiment) of E b = 1 MeV, Ib = 1 ∼ 3 kA. The wiggler of FEL is composed of the curved surface magnets arrays (focusing wiggler), which is found to be effective for a transport of low energy and high current beam through the wiggler. The superradiance of the mm wave region (30 GHz ∼ 40 GHz) is observed. The growth rate of this radiation is 0.42 dB/cm. (author)

In vacuum permanent magnet wiggler optimized for the production of hard x rays

Directory of Open Access Journals (Sweden)

O. Marcouille

2013-05-01

Full Text Available A new concept of wiggler has been designed and realized at SOLEIL to produce high energy photons in low/intermediate electron storage rings. Instead of using the superconducting technology which requires new equipment and instrumentation, heavy maintenance, and additional running costs, we have proposed to build a compact in-vacuum small gap short period wiggler that operates rather at moderate field than at high field. The wiggler composed of 38 periods of 50 mm produces 2.1 T at a gap of 5.5 mm. The moderate value of the magnetic field enables one to limit the effects on the beam dynamics and to avoid excessive power and magnetic forces. In this purpose, the narrow magnetic system has been equipped with a counterforce device made of nonmagnetic springs. The roll-off resulting from the small size of poles has been compensated in situ by permanent magnet magic fingers. This paper reports the phases of design, construction, magnetic measurements, and on-beam tests of the in-vacuum wiggler WSV50.

X-ray lithography using wiggler and undulator synchrotron-radiation sources

International Nuclear Information System (INIS)

Neureuther, A.R.; Kim, K.J.; Thompson, A.C.; Hoyer, E.

1983-08-01

A systems design approach is used to identify feasible options for wiggler and undulator beam lines for x-ray lithography in the 0.5 to 0.2 μm linewidth region over 5 cm by 5 cm fields. Typical parameters from the Wiggler and Undulator in the Advanced Light Source designed at the Lawrence Berkeley Laboratory are used as examples. Moving from the conventional wavelengths of 4 to 9 A to very soft wavelengths around 15 A is shown to be very promising. The mask absorber thickness can be reduced a factor of three so that 0.2 μm features can be made with a 1:1 mask aspect ratio. The mask heating limited exposure time is also reduced a factor of three to 3 sec/cm 2 . However, extremely thin beam line windows (1/4 mil Be) and mask supports (1 μm Si) must be used. A wiggler beam line design using a small slit window at a scanning mirror appears feasible. A unconventional, windowless differentially pumped beam line with dual deflecting mirrors could be used with an undulator source

A far-infrared spectroscopic survey of intermediate redshift (ultra) luminous infrared galaxies

International Nuclear Information System (INIS)

Magdis, Georgios E.; Rigopoulou, D.; Hopwood, R.; Clements, D.; Huang, J.-S.; Farrah, D.; Pearson, C.; Alonso-Herrero, Almudena; Bock, J. J.; Cooray, A.; Griffin, M. J.; Oliver, S.; Perez Fournon, I.; Riechers, D.; Swinyard, B. M.; Thatte, N.; Scott, D.; Valtchanov, I.; Vaccari, M.

2014-01-01

We present Herschel far-IR photometry and spectroscopy as well as ground-based CO observations of an intermediate redshift (0.21 ≤ z ≤ 0.88) sample of Herschel-selected (ultra)-luminous infrared galaxies (L IR > 10 11.5 L ☉ ). With these measurements, we trace the dust continuum, far-IR atomic line emission, in particular [C II] 157.7 μm, as well as the molecular gas of z ∼ 0.3 luminous and ultraluminous infrared galaxies (LIRGs and ULIRGs) and perform a detailed investigation of the interstellar medium of the population. We find that the majority of Herschel-selected intermediate redshift (U)LIRGs have L C II /L FIR ratios that are a factor of about 10 higher than that of local ULIRGs and comparable to that of local normal and high-z star-forming galaxies. Using our sample to bridge local and high-z [C II] observations, we find that the majority of galaxies at all redshifts and all luminosities follow an L C II –L FIR relation with a slope of unity, from which local ULIRGs and high- z active-galactic-nucleus-dominated sources are clear outliers. We also confirm that the strong anti-correlation between the L C II /L FIR ratio and the far-IR color L 60 /L 100 observed in the local universe holds over a broad range of redshifts and luminosities, in the sense that warmer sources exhibit lower L C II /L FIR at any epoch. Intermediate redshift ULIRGs are also characterized by large molecular gas reservoirs and by lower star formation efficiencies compared to that of local ULIRGs. The high L C II /L FIR ratios, the moderate star formation efficiencies (L IR /L CO ′ or L IR /M H 2 ), and the relatively low dust temperatures of our sample (which are also common characteristics of high-z star-forming galaxies with ULIRG-like luminosities) indicate that the evolution of the physical properties of (U)LIRGs between the present day and z > 1 is already significant by z ∼ 0.3.

Observations of far-infrared line profiles in the Orion-KL region

International Nuclear Information System (INIS)

Crawford, M.K.; Lugten, J.B.; Fitelson, W.; Genzel, R.; Melnick, G.; Harvard-Smithsonian Center for Astrophysics, Cambridge, MA)

1986-01-01

Measurements of several far-infrared emission line profiles in the Orion-KL region are reported. The emission from the CO, OH, and forbidden O I emission lines toward the BN-KL and H2 peak 1 positions probably comes from dense, hot molecular gas in the Orion-KL shock. The CO and forbidden O I lines have similar profiles, suggesting that the high-velocity forbidden O I emission also arises in magnetohydrodynamic cloud shocks. The velocity centroids of the lines are somewhat blueshifted. The far-infrared data thus support the interpretation that the blue asymmetry of the H2 2 micron lines is not mainly due to differential dust extinction, but rather to the kinematics and geometry of the shocked gas in the Orion-KL outflow. The forbidden O I and CO lines, however, have significantly less extreme blueshifted emission than the H2 lines. Both the forbidden O I 63 micron and forbidden C II 158 micron lines have features strongly supporting a common origin near the surface of the Orion molecular cloud. 28 references

Star formation in the inner galaxy: a far-infrared and radio study of two H2 regions

International Nuclear Information System (INIS)

Lester, D.F.; Dinerstein, H.L.; Werner, M.W.; Harvey, P.M.; Evans, N.J.II; Brown, R.L.

1985-12-01

Far-infrared and radio continuum maps have been made of the central 6' of the inner-galaxy H II regions G30.8-0.0 (in the W43 complex) and G25.4-02., along with radio and molecular line measurements at selected positions. An effort is made to understand far infrared wavelingths allow the dust temperature structures and total far infrared fluxes to be determined. Comparison of the radio and infrared maps shows a close relationship between the ionized gas and the infrared-emitting material. There is evidence that parts of G30.8 are substantially affected by extinction, even at far-infrared wavelengths. For G25.4-0.2, the radio recombination line and CO line data permit resolution of the distance ambiguity for this source. The confusion in distance determination is found to result from an extraordinary near-superposition of two bright H II regions. Using revised distances of 4.3 kpc for G26.4SE and 12 kpc for G25.4NW, that the latter, which is apparently the fainter of the two sources, is actually the more luminous. Though it is not seen on the Palomar Sky Survey, G25.4SE is easily visible in the 9532A line of S III and is mapped in this line. The ratio of total luminosity to ionizing luminosity is very similar to that of H II regions in the solar circle. Assuming a coeval population of ionizing stars, a normal initial mass function is indicated

Star formation in the inner galaxy: a far-infrared and radio study of two H2 regions

International Nuclear Information System (INIS)

Lester, D.F.; Dinerstein, H.L.; Werner, M.W.; Harvey, P.M.; Evans, N.J.; Brown, R.L.

1985-09-01

Far-infrared and radio continuum maps have been made of the central 6' of the inner-galaxy HII regions G30.8-0.0 (in the W43 complex) and G25.4-0.2, along with radio and molecular line measurements at selected positions. The purpose of this study is an effort to understand star formation in the molecular ring at 5 kpc in galactic radius. Measurements at several far infrared wavelengths allow the dust temperature structures and total far infrared fluxes to be determined. Comparison of the radio and infrared maps shows a close relationship between the ionized gas and the infrared-emitting material. There is evidence that parts of G30.8 are substantially affected by extinction, even at far-infrared wavelengths. Using radio recombination line and CO line data for G25.4-0.2, the distance ambiguity for this source is resolved. The large distance previously ascribed to the entire complex is found to apply to only one of the two main components. The confusion in distance determination is found to result from an extraordinary near-superposition of two bright HII regions. Using the revised distances of 4.3 kpc for G25.4SE and 12 kpc for G25.4NW, it is found that the latter, which is apparently the fainter of the two sources, is actually the more luminous. The ratio of total luminosity to ionizing luminosity is very similar to that of HII regions in the solar circle. Assuming a coeval population of ionizing stars, a normal initial mass function is indicated

Simulations of the effects of a superconducting damping wiggler on a short bunched electron beam at ANKA

Energy Technology Data Exchange (ETDEWEB)

Gethmann, Julian; Bernhard, Axel; Blomley, Edmund; Hillenbrand, Steffen; Mueller, Anke-Susanne; Smale, Nigel [Karlsruher Institut fuer Technologie (KIT) (Germany); Zolotarev, Konstantin [Budker Institute of Nuclear Physics (Russian Federation)

2016-07-01

(As a part of the CLIC collaboration) A CLIC damping wiggler prototype has been installed at the ANKA synchrotron light source in order to validate the technical design of the 3 T superconducting conduction cooled wiggler and its cryostat and to cary out studies on beam dynamical aspects including collective effects. The latter one will be the main focus in this talk. Collective effects that will occur in damping rings are an issue in ANKA's short bunch operation as well. To simulate these effects the accelerator's model including its insertion device has to be very accurate. Such a model of the ANKA storage ring in short bunch operation mode has been developed in elegant. Simulations with the damping wiggler switched on and off have been performed in order to investigate effects of the wiggler on different machine parameters. These new results will be discussed with regard to the question if on the one hand the wiggler could be used for diagnostic purposes and if on the other hand the wiggler's impact on the beam dynamics is changed by the collective effects.

Conceptual design of a three-pole wiggler for the APS upgrade

Energy Technology Data Exchange (ETDEWEB)

Abliz, M., E-mail: mabliz@aps.anl.gov; Grimmer, J., E-mail: grimmer@aps.anl.gov; Dejus, R.; Ramanathan, M., E-mail: mohan@aps.anl.gov [The Advanced Photon Source, Argonne National Laboratory, Argonne, IL 60439 (United States)

2016-07-27

The current design of the Advanced Photon Source Upgrade (APS-U) project is a multi-bend achromat (MBA) lattice, which incorporates three-pole wigglers as radiation sources for the bending magnet beamlines. They are located in the short section between the M4 dipole and Q8 quadrupole magnets. Due to space constraints, a hybrid permanent magnet design is necessary to provide the required magnetic field strength. A three-pole wiggler with a flat peak field profile along the beam axis was designed to enhance the photon flux and flatten the transverse flux density distributions. The magnetic peak field at the center pole reached 1.08 Tesla for a magnetic gap of 26 mm. The maximum power density, integrated over all vertical angles, is 3.1 W/mm{sup 2}, which is substantially higher than that of the existing bending magnets at the APS (0.86 W/mm{sup 2}). Detailed designs of the three-pole wiggler is presented, including calculated spectral-angular flux distributions.

Superconducting 63-Pole 2 Tesla Wiggler for Canadian Light Source

International Nuclear Information System (INIS)

Khruschev, S.V.; Kuper, E.A.; Lev, V.H.; Mezentsev, N.A.; Miginsky, E.G.; Repkov, V.V.; Shkaruba, B.A.; Syrovatin, V.M.; Tsukanov, V.M.

2006-01-01

A superconducting 63-pole wiggler with the average period 34 mm designed and fabricated at the Institute of Nuclear Physics in Novosibirsk for Synchrotron Radiation Center (CLS) in Canada is described. The maximum field 2.2 Tesla in the median plane has been achieved. The liquid helium consumption less than 0.03 liters per hour in operating mode has been reached. In January 2005, the wiggler was installed in the storage ring in CLS and now experiments are already underway. The main parameters of the magnet and the cryogenic systems as well as test results are presented

The Far-Infrared Radio Correlation at High-z : Prospects for the SKA

NARCIS (Netherlands)

Murphy, Eric J.

2009-01-01

In this conference proceedings article I summarize the recent work of Murphy (2009) which presents physically motivated predictions for the evolution of the Far-Infrared--radio correlation as a function of redshift arising from variations in the cosmic-ray (CR) electron cooling time-scales as

Design and manufacture of a 6-T wiggler magnet for the Daresbury SRS

International Nuclear Information System (INIS)

Ross, J.; Smith, K.

1992-01-01

The 6-T wiggler is an iron-cored, warm bore, superconducting dipole magnet destined for the SERC Daresbury Laboratory's 2-GeV Synchrotron Radiation Source to enhance the available radiation spectrum. The new wiggler will be inserted in the ring in addition to an existing 5-T wiggler, both of which will use the existing, although upgraded, refrigerator. The magnet is designed to provide a peak field of 6 T on the beam line. The design and manufacturing contract for this magnet was started in September 1989 and was preceded by a feasibility study, presented by Oxford Instruments in mid 1988. The major features of the magnet, along with a discussion of the early stages of manufacture, are described in the article

A mid- to far-infrared variability study of the intermediate Seyfert galaxy, Mk 6

International Nuclear Information System (INIS)

Clement, R.; Sembay, S.; Coe, M.J.; Hanson, C.G.

1988-01-01

A mid- to far-infrared (MFIR) variability study of the intermediate Seyfert galaxy, Mk 6, is presented using data from the Infrared Astronomical Satellite (IRAS). We have analysed 25 observations of this source covering a period of about 1 month. Within the expected errors, the source shows no evidence for variability and this may be an indication that there is a strong contribution to the MFIR emission from thermal re-radiation by dust. This interpretation is consistent with previous studies which suggest that the bulk of the far-infrared (30 -100 μm) emission in Seyfert galaxies originates from cool (35 - 75 K) dust associated with star formation regions in the surrounding envelope of the active nucleus. The lack of variability at 12 and 25 μm can also be readily explained by dust emission. However, in this case, the dust temperatures required to produce emission at these wavelengths makes the narrow-line region a more feasible location for the dust grains. (author)

Interpreting the cosmic far-infrared background anisotropies using a gas regulator model

Science.gov (United States)

Wu, Hao-Yi; Doré, Olivier; Teyssier, Romain; Serra, Paolo

2018-04-01

Cosmic far-infrared background (CFIRB) is a powerful probe of the history of star formation rate (SFR) and the connection between baryons and dark matter across cosmic time. In this work, we explore to which extent the CFIRB anisotropies can be reproduced by a simple physical framework for galaxy evolution, the gas regulator (bathtub) model. This model is based on continuity equations for gas, stars, and metals, taking into account cosmic gas accretion, star formation, and gas ejection. We model the large-scale galaxy bias and small-scale shot noise self-consistently, and we constrain our model using the CFIRB power spectra measured by Planck. Because of the simplicity of the physical model, the goodness of fit is limited. We compare our model predictions with the observed correlation between CFIRB and gravitational lensing, bolometric infrared luminosity functions, and submillimetre source counts. The strong clustering of CFIRB indicates a large galaxy bias, which corresponds to haloes of mass 1012.5 M⊙ at z = 2, higher than the mass associated with the peak of the star formation efficiency. We also find that the far-infrared luminosities of haloes above 1012 M⊙ are higher than the expectation from the SFR observed in ultraviolet and optical surveys.

Optical Properties of Natural Minerals in the Far-Infrared

Science.gov (United States)

Long, Larry Lavern

The reflectivity of natural mineral powders were measured in the far infrared. The complex indices of refraction were then determined by Kramers-Kronig analysis or dispersive analysis. The samples were constructed by pressing the powdered sample into a 13 mm diameter pellet. A few of the samples that were measured were kaolin, illite, and montmorillonite, clay samples that could not be obtained in large single crystals. For calcite and gypsum crystals a comparison between the single crystal measurements and powder measurements was done to determine the effect of sample preparation on the measured spectra.

Design of a 6 Tesla wiggler for the National Synchrotron Light Source

International Nuclear Information System (INIS)

Hsieh, H.; Krinsky, S.; Luccio, A.; van Steenbergen, A.

1981-01-01

A 6-pole, 6 Tesla wiggler with Nb-Ti superconducting windings has been designed, to be installed in a straight section of the 2.5 GeV x-ray storage ring of the NSLS. The technical problems of this magnet are discussed, in particular the optimization of the two-layer magnetic windings and the mechanical structure designed to counteract the strong magnetic forces. The effects of the insertion of the wiggler in the storage ring lattice are also studied

Far-Infrared and Millimeter Continuum Studies of K-Giants: Alpha Boo and Alpha Tau

Science.gov (United States)

Cohen, Martin; Carbon, Duane F.; Welch, William J.; Lim, Tanya; Forster, James R.; Goorvitch, David; Thigpen, William (Technical Monitor)

2002-01-01

We have imaged two normal, non-coronal, infrared-bright K-giants, alpha Boo and alpha Tau, in the 1.4-millimeter and 2.8-millimeter continuum using BIMA. These stars have been used as important absolute calibrators for several infrared satellites. Our goals are: (1) to probe the structure of their upper photospheres; (2) to establish whether these stars radiate as simple photospheres or possess long-wavelength chromospheres; and (3) to make a connection between millimeter-wave and far-infrared absolute flux calibrations. To accomplish these goals we also present ISO Long Wavelength Spectrometer (LWS) measurements of both these K-giants. The far-infrared and millimeter continuum radiation is produced in the vicinity of the temperature minimum in a Boo and a Tau, offering a direct test of the model photospheres and chromospheres for these two cool giants. We find that current photospheric models predict fluxes in reasonable agreement with those observed for those wavelengths which sample the upper photosphere, namely less than or equal to 170 micrometers in alpha Tau and less than or equal to 125 micrometers in alpha Boo. It is possible that alpha Tau is still radiative as far as 0.9 - 1.4 millimeters. We detect chromospheric radiation from both stars by 2.8 millimeters (by 1.4 millimeters in alpha Boo), and are able to establish useful bounds on the location of the temperature minimum. An attempt to interpret the chromospheric fluxes using the two-component "bifurcation model" proposed by Wiedemann et al. (1994) appears to lead to a significant contradiction.

Superconducting 63-pole 2 T wiggler for Canadian Light Source

International Nuclear Information System (INIS)

Khruschev, S.V.; Kuper, E.A.; Lev, V.H.; Mezentsev, N.A.; Miginsky, E.G.; Repkov, V.V.; Shkaruba, V.A.; Syrovatin, V.M.; Tsukanov, V.M.

2007-01-01

A superconducting 63-pole wiggler with the average period 34 mm designed and fabricated in the Institute of Nuclear Physics in Novosibirsk for Synchrotron Radiation Center Canadian Light Source (CLS) in Canada is described. The maximum field 2.2 T in the median plane has been achieved. The liquid helium consumption less than 0.03 L h in operating mode has been reached. It allows refilling liquid helium once a year. In January 2005, the wiggler was installed in the storage ring in CLS and now experiments are carried out. The main parameters of the magnet and the cryogenic systems as well as test results are presented

Airborne observations of far-infrared upwelling radiance in the Arctic

Directory of Open Access Journals (Sweden)

Q. Libois

2016-12-01

Full Text Available The first airborne measurements of the Far-InfraRed Radiometer (FIRR were performed in April 2015 during the panarctic NETCARE campaign. Vertical profiles of spectral upwelling radiance in the range 8–50 µm were measured in clear and cloudy conditions from the surface up to 6 km. The clear sky profiles highlight the strong dependence of radiative fluxes to the temperature inversion typical of the Arctic. Measurements acquired for total column water vapour from 1.5 to 10.5 mm also underline the sensitivity of the far-infrared greenhouse effect to specific humidity. The cloudy cases show that optically thin ice clouds increase the cooling rate of the atmosphere, making them important pieces of the Arctic energy balance. One such cloud exhibited a very complex spatial structure, characterized by large horizontal heterogeneities at the kilometre scale. This emphasizes the difficulty of obtaining representative cloud observations with airborne measurements but also points out how challenging it is to model polar clouds radiative effects. These radiance measurements were successfully compared to simulations, suggesting that state-of-the-art radiative transfer models are suited to study the cold and dry Arctic atmosphere. Although FIRR in situ performances compare well to its laboratory performances, complementary simulations show that upgrading the FIRR radiometric resolution would greatly increase its sensitivity to atmospheric and cloud properties. Improved instrument temperature stability in flight and expected technological progress should help meet this objective. The campaign overall highlights the potential for airborne far-infrared radiometry and constitutes a relevant reference for future similar studies dedicated to the Arctic and for the development of spaceborne instruments.

Analysis of cirrus cloud spectral signatures in the far infrared

International Nuclear Information System (INIS)

Maestri, T.; Rizzi, R.; Tosi, E.; Veglio, P.; Palchetti, L.; Bianchini, G.; Di Girolamo, P.; Masiello, G.; Serio, C.; Summa, D.

2014-01-01

This paper analyses high spectral resolution downwelling radiance measurements in the far infrared in the presence of cirrus clouds taken by the REFIR-PAD interferometer, deployed at 3500 m above the sea level at the Testa Grigia station (Italy), during the Earth COoling by WAter vapouR emission (ECOWAR) campaign. Atmospheric state and cloud geometry are characterised by the co-located millimeter-wave spectrometer GBMS and by radiosonde profile data, an interferometer (I-BEST) and a Raman lidar system deployed at a nearby location (Cervinia). Cloud optical depth and effective diameter are retrieved from REFIR-PAD data using a limited number of channels in the 820–960 cm −1 interval. The retrieved cloud parameters are the input data for simulations covering the 250–1100 cm −1 band in order to test our ability to reproduce the REFIR-PAD spectra in the presence of ice clouds. Inverse and forward simulations are based on the same radiative transfer code. A priori information concerning cloud ice vertical distribution is used to better constrain the simulation scheme and an analysis of the degree of approximation of the phase function within the radiative transfer codes is performed to define the accuracy of computations. Simulation-data residuals over the REFIR-PAD spectral interval show an excellent agreement in the window region, but values are larger than total measurement uncertainties in the far infrared. Possible causes are investigated. It is shown that the uncertainties related to the water vapour and temperature profiles are of the same order as the sensitivity to the a priori assumption on particle habits for an up-looking configuration. In case of a down-looking configuration, errors due to possible incorrect description of the water vapour profile would be drastically reduced. - Highlights: • We analyze down-welling spectral radiances in the far infrared (FIR) spectrum. • Discuss the scattering in the fir and the ice crystals phase function

HerMES: THE FAR-INFRARED EMISSION FROM DUST-OBSCURED GALAXIES

International Nuclear Information System (INIS)

Calanog, J. A.; Wardlow, J.; Fu, Hai; Cooray, A.; Assef, R. J.; Bock, J.; Riechers, D.; Schulz, B.; Casey, C. M.; Conley, A.; Farrah, D.; Oliver, S. J.; Roseboom, I. G.; Ibar, E.; Kartaltepe, J.; Magdis, G.; Rigopoulou, D.; Marchetti, L.; Pérez-Fournon, I.; Scott, Douglas

2013-01-01

Dust-obscured galaxies (DOGs) are an ultraviolet-faint, infrared-bright galaxy population that reside at z ∼ 2 and are believed to be in a phase of dusty star-forming and active galactic nucleus (AGN) activity. We present far-infrared (far-IR) observations of a complete sample of DOGs in the 2 deg 2 of the Cosmic Evolution Survey. The 3077 DOGs have (z) = 1.9 ± 0.3 and are selected from 24 μm and r + observations using a color cut of r + – [24] ≥ 7.5 (AB mag) and S 24 ≥ 100 μJy. Based on the near-IR spectral energy distributions, 47% are bump DOGs (star formation dominated) and 10% are power-law DOGs (AGN-dominated). We use SPIRE far-IR photometry from the Herschel Multi-tiered Extragalactic Survey to calculate the IR luminosity and characteristic dust temperature for the 1572 (51%) DOGs that are detected at 250 μm (≥3σ). For the remaining 1505 (49%) that are undetected, we perform a median stacking analysis to probe fainter luminosities. Herschel-detected and undetected DOGs have average luminosities of (2.8 ± 0.4) × 10 12 L ☉ and (0.77 ± 0.08) × 10 12 L ☉ , and dust temperatures of (33 ± 7) K and (37 ± 5) K, respectively. The IR luminosity function for DOGs with S 24 ≥ 100 μJy is calculated, using far-IR observations and stacking. DOGs contribute 10%-30% to the total star formation rate (SFR) density of the universe at z = 1.5-2.5, dominated by 250 μm detected and bump DOGs. For comparison, DOGs contribute 30% to the SFR density for all z = 1.5-2.5 galaxies with S 24 ≥ 100 μJy. DOGs have a large scatter about the star formation main sequence and their specific SFRs show that the observed phase of star formation could be responsible for their total observed stellar mass at z ∼ 2

HerMES: THE FAR-INFRARED EMISSION FROM DUST-OBSCURED GALAXIES

Energy Technology Data Exchange (ETDEWEB)

Calanog, J. A.; Wardlow, J.; Fu, Hai; Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Assef, R. J. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Bock, J.; Riechers, D.; Schulz, B. [California Institute of Technology, 1200 E. California Boulevard, Pasadena, CA 91125 (United States); Casey, C. M. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Conley, A. [Center for Astrophysics and Space Astronomy 389-UCB, University of Colorado, Boulder, CO 80309 (United States); Farrah, D.; Oliver, S. J.; Roseboom, I. G. [Astronomy Centre, Department of Physics and Astronomy, University of Sussex, Brighton BN1 9QH (United Kingdom); Ibar, E. [Instituto de Astrofísica, Facultad de Física, Pontificia Universidad Católica de Chile, Casilla 306, Santiago 22 (Chile); Kartaltepe, J. [National Optical Astronomy Observatory, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Magdis, G.; Rigopoulou, D. [Department of Astrophysics, Denys Wilkinson Building, University of Oxford, Keble Road, Oxford OX1 3RH (United Kingdom); Marchetti, L. [Department of Physical Sciences, The Open University, Milton Keynes MK7 6AA (United Kingdom); Pérez-Fournon, I. [Instituto de Astrofísica de Canarias (IAC), E-38200 La Laguna, Tenerife (Spain); Scott, Douglas [Department of Physics and Astronomy, University of British Columbia, 6224 Agricultural Road, Vancouver, BC V6T 1Z1 (Canada); and others

2013-09-20

Dust-obscured galaxies (DOGs) are an ultraviolet-faint, infrared-bright galaxy population that reside at z ∼ 2 and are believed to be in a phase of dusty star-forming and active galactic nucleus (AGN) activity. We present far-infrared (far-IR) observations of a complete sample of DOGs in the 2 deg{sup 2} of the Cosmic Evolution Survey. The 3077 DOGs have (z) = 1.9 ± 0.3 and are selected from 24 μm and r {sup +} observations using a color cut of r {sup +} – [24] ≥ 7.5 (AB mag) and S{sub 24} ≥ 100 μJy. Based on the near-IR spectral energy distributions, 47% are bump DOGs (star formation dominated) and 10% are power-law DOGs (AGN-dominated). We use SPIRE far-IR photometry from the Herschel Multi-tiered Extragalactic Survey to calculate the IR luminosity and characteristic dust temperature for the 1572 (51%) DOGs that are detected at 250 μm (≥3σ). For the remaining 1505 (49%) that are undetected, we perform a median stacking analysis to probe fainter luminosities. Herschel-detected and undetected DOGs have average luminosities of (2.8 ± 0.4) × 10{sup 12} L{sub ☉} and (0.77 ± 0.08) × 10{sup 12} L{sub ☉}, and dust temperatures of (33 ± 7) K and (37 ± 5) K, respectively. The IR luminosity function for DOGs with S{sub 24} ≥ 100 μJy is calculated, using far-IR observations and stacking. DOGs contribute 10%-30% to the total star formation rate (SFR) density of the universe at z = 1.5-2.5, dominated by 250 μm detected and bump DOGs. For comparison, DOGs contribute 30% to the SFR density for all z = 1.5-2.5 galaxies with S{sub 24} ≥ 100 μJy. DOGs have a large scatter about the star formation main sequence and their specific SFRs show that the observed phase of star formation could be responsible for their total observed stellar mass at z ∼ 2.

Polarization of far-infrared radiation from molecular clouds

Science.gov (United States)

Novak, G.; Gonatas, D. P.; Hildebrand, R. H.; Platt, S. R.; Dragovan, M.

1989-01-01

The paper reports measurements of the polarization of far-infrared emission from dust in nine molecular clouds. Detections were obtained in Mon R2, in the Kleinmann-Low (KL) nebula in Orion, and in Sgr A. Upper limits were set for six other clouds. A comparison of the 100 micron polarization of KL with that previously measured at 270 microns provides new evidence that the polarization is due to emission from magnetically aligned dust grains. Comparing the results for Orion with measurements at optical wavelengths, it is inferred that the magnetic field direction in the outer parts of the Orion cloud is the same as that in the dense core. This direction is nearly perpendicular to the ridge of molecular emission and is parallel to both the molecular outflow in KL and the axis of rotation of the cloud core. In Mon R2, the field direction which the measurements imply does not agree withthat derived from 0.9-2.2 micron polarimetry. The discrepancy is attributed to scattering in the near-infrared. In Orion and Sgr A, where comparisons are possible, the measurements are in good agreement with 10 micron polarization measurements.

Calculated and measured fields in superferric wiggler magnets

Energy Technology Data Exchange (ETDEWEB)

Blum, E.B.; Solomon, L. [Brookhaven National Lab., Upton, NY (United States)

1995-02-01

Although Klaus Halbach is widely known and appreciated as the originator of the computer program POISSON for electromagnetic field calculation, Klaus has always believed that analytical methods can give much more insight into the performance of a magnet than numerical simulation. Analytical approximations readily show how the different aspects of a magnet`s design such as pole dimensions, current, and coil configuration contribute to the performance. These methods yield accuracies of better than 10%. Analytical methods should therefore be used when conceptualizing a magnet design. Computer analysis can then be used for refinement. A simple model is presented for the peak on-axis field of an electro-magnetic wiggler with iron poles and superconducting coils. The model is applied to the radiator section of the superconducting wiggler for the BNL Harmonic Generation Free Electron Laser. The predictions of the model are compared to the measured field and the results from POISSON.

A study of far-infrared Michelson interferometry based on fast plasma scanning

International Nuclear Information System (INIS)

Bartlett, D.V.; Hewitt, G.L.; Robinson, L.C.; Tait, G.D.

1976-02-01

Fast far-infrared multiplex spectroscopy based on a plasma-scanned Michelson interferometer is studied. Our experiments show that the interferometer has sub-millisecond time response and high spectral resolving power. In addition to a description of the experimental performance of the interferometer, we develop and discuss two different methods of interferogram inversion. (author)

A study of far-infrared Michelson interferometry based on fast plasma scanning

International Nuclear Information System (INIS)

Bartlett, D.V.; Hewitt, R.G.L.; Robinson, L.C.; Tait, G.D.

1977-01-01

Fast far infrared (FIR) muliplex spectroscopy based on a plasma-scanned Michelson interferometer is studied. Experiments show that the interferometer has sub-millisecond time response and high spectral resolving power. In addition to the description of the experimental performance of the interferometer, two different methods of interferogram inversion are developed and discussed. (author)

THE EXTRAORDINARY FAR-INFRARED VARIATION OF A PROTOSTAR: HERSCHEL/PACS OBSERVATIONS OF LRLL54361

Energy Technology Data Exchange (ETDEWEB)

Balog, Zoltan; Detre, Örs H.; Bouwmann, Jeroen; Nielbock, Markus; Klaas, Ulrich; Krause, Oliver; Henning, Thomas [Max Planck Institute for Astronomy Königstuhl 17, Heidelberg D-69117 (Germany); Muzerolle, James [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Flaherty, Kevin [Astronomy Department, Wesleyan University, Middletown, CT 06459 (United States); Furlan, Elise [Natinal Optical Astronomy Observatory, 950 N. Cherry Avenue, Tucson, AZ 85719 (United States); Gutermuth, Rob [Department of Astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Juhasz, Attila [Leiden Observatory, Leiden University, Niels Bohrweg 2, NL-2333-CA Leiden (Netherlands); Bally, John [CASA, University of Colorado, CB 389, Boulder, CO 80309 (United States); Marton, Gabor, E-mail: balog@mpia.de [Konkoly Observatory, Research Center for Astronomy and Earth Sciences, Hungarian Academy of Sciences, Konkoly Thege 15-17, 1121 Budapest (Hungary)

2014-07-10

We report Herschel/Photodetector Array Camera and Spectrometer (PACS) photometric observations at 70 μm and 160 μm of LRLL54361—a suspected binary protostar that exhibits periodic (P = 25.34 days) flux variations at shorter wavelengths (3.6 μm and 4.5 μm) thought to be due to pulsed accretion caused by binary motion. The PACS observations show unprecedented flux variation at these far-infrared wavelengths that are well correlated with the variations at shorter wavelengths. At 70 μm the object increases its flux by a factor of six while at 160 μm the change is about a factor of two, consistent with the wavelength dependence seen in the far-infrared spectra. The source is marginally resolved at 70 μm with varying FWHM. Deconvolved images of the sources show elongations exactly matching the outflow cavities traced by the scattered light observations. The spatial variations are anti-correlated with the flux variation, indicating that a light echo is responsible for the changes in FWHM. The observed far-infrared flux variability indicates that the disk and envelope of this source is periodically heated by the accretion pulses of the central source, and suggests that such long wavelength variability in general may provide a reasonable proxy for accretion variations in protostars.

Properties in the middle and far infrared radiation of spiral and irregular galaxies

International Nuclear Information System (INIS)

Contursi, Alessandra

1998-01-01

In the first part of this research thesis, the author reports the study in the middle infrared of H II regions belonging to Magellanic clouds. For this purpose, he presents different aspects of infrared emission by the interstellar medium: origin and evolution of interstellar grains, dust studied by astrophysical observations, dust models, infrared observations made by COBE and IRAS satellites, exploitation of the ISO satellite. He also presents the Small and Large Magellanic clouds, and reports the study of the H II N4 region of the large one, imagery and spectroscopy of the H II N66 region of the small one, and the study of silicate emission in the central region of N66. The second part reports the study of cluster normal spiral galaxies in the middle and far infrared. For this purpose, the author discusses the colours in the middle infrared of Virgo's and Coma's galaxies, discusses the properties in the infrared of spiral galaxies (Coma and A1367), based on observations made by ISO [fr

THE FAR-INFRARED EMISSION FROM THE Mg+-PAH SPECIES

International Nuclear Information System (INIS)

Bauschlicher, Charles W. Jr.; Ricca, Alessandra

2009-01-01

The far-infrared (FIR) spectra of several Mg + -PAH species are studied using density functional theory. The Mg + -PAH stretching mode, regardless of the polycyclic aromatic hydrocarbon (PAH) species, carries a reasonable intensity and tends to fall in a narrow range near 40 μm. Because the bands tend to fall at very similar frequencies, the average spectra of several Mg + -PAH species produce a broadband with an intensity that is about 20% of the well known C-H out-of-plane bending mode. In contrast, an average of seven large compact pure PAHs has no FIR bands that carry any significant intensity.

Origins Space Telescope: The Far Infrared Imager and Polarimeter FIP

Science.gov (United States)

Staguhn, Johannes G.; Chuss, David; Howard, Joseph; Meixner, Margaret; Vieira, Joaquin; Amatucci, Edward; Bradley, Damon; Carter, Ruth; Cooray, Asantha; Flores, Anel; Leisawitz, David; Moseley, Samuel Harvey; Wollack, Edward; Origins Space Telescope Study Team

2018-01-01

The Origins Space Telescope (OST)* is the mission concept for the Far-Infrared Surveyor, one of the four science and technology definition studies of NASA Headquarters for the 2020 Astronomy and Astrophysics Decadal survey. The current "concept 1", which envisions a cold (4K) 9m space telescope, includes 5 instruments, providing a wavelength coverage ranging from 6um and 667um. The achievable sensitivity of the observatory will provide three to four orders of magnitude of improvement in sensitivity over current observational capabilities, allowing to address a wide range of new and so far inaccessible scientific questions, ranging from bio-signatures on exo-planets to mapping primordial H_2 from the "dark ages" before the universe went through the phase of re-ionization.Here we present the Far Infrared Imager and Polarimeter (FIP) for OST. The cameral will cover four bands, 40um, 80um, 120um, and 240um. It will allow for differential polarimetry in those bands with the ability to observe two colors in polarimtery mode simultaneously, while all four bands can be observed simultaneously in total power mode. While the confusion limit will be reached in only 32ms at 240um, at 40um the source density on the sky is so low, that at the angular resolution of 1" of OST at this wavelength there will be no source confusion, even for the longest integration times. Science topics that can be addressed by FIP include but are not limited to galactic and extragalactic magnetic field studies, Deep Galaxy Surveys, and Outer Solar System objects..*Origins will enable flagship-quality general observing programs led by the astronomical community in the 2030s. We welcome you to contact the Science and Technology Definition Team (STDT) with your science needs and ideas by emailing us at ost_info@lists.ipac.caltech.edu

Observations of far-infrared molecular emission lines from the Orion molecular cloud

International Nuclear Information System (INIS)

Viscuso, P.J.

1986-01-01

The Orion Nebula has been the subject of intensive study for over one hundred years. Far-infrared (FIR) molecular line observations of CO in the shock region surrounding the infrared source IRc2 have suggested that the molecular hydrogen density in the shocked and post-shock gas is roughly 3 x 10 6 cm -3 . The temperature of this gas is on the order of 750-2000K. IRc2, like other nearby infrared sources within the Nebula, is thought to be a site of recent star formation. This object is apparently at the center of a massive bipolar molecular outflow of gas, which is producing a shock front where it meets the ambient molecular cloud surrounding IRc2. Study of such regions is important for the understanding of the chemical and physical processes that are involved in the formation of stars from molecular clouds. Recently, several far-infrared transitions among the low-lying levels of OH have been observed toward IRc2. OH is thought to be abundant, and it plays an important role in the chemical evolution of the shock and post-shock regions. The OH emission serves as a sensitive probe of the temperature and density for the shock-processed gas. A rigorous treatment of the radiative transfer of these measured transitions is performed using the escape probability formalism. From this analysis, the author determines the temperature of the OH-emitting region to be on the order of 40K. This suggests that the gas is part of the post-shock gas that has cooled sufficiently, most likely by way of radiative cooling by CO

Active Control of Nitride Plasmonic Dispersion in the Far Infrared.

Energy Technology Data Exchange (ETDEWEB)

Shaner, Eric A.; Dyer, Gregory Conrad; Seng, William Francis; Bethke, Donald Thomas; Grine, Albert Dario,; Baca, Albert G.; Allerman, Andrew A.

2014-11-01

We investigate plasmonic structures in nitride-based materials for far-infrared (IR) applications. The two dimensional electron gas (2DEG) in the GaN/AlGaN material system, much like metal- dielectric structures, is a patternable plasmonic medium. However, it also permits for direct tunability via an applied voltage. While there have been proof-of-principle demonstrations of plasma excitations in nitride 2DEGs, exploration of the potential of this material system has thus far been limited. We recently demonstrated coherent phenomena such as the formation of plasmonic crystals, strong coupling of tunable crystal defects to a plasmonic crystal, and electromagnetically induced transparency in GaAs/AlGaAs 2DEGs at sub-THz frequencies. In this project, we explore whether these effects can be realized in nitride 2DEG materials above 1 THz and at temperatures exceeding 77 K.

Dust properties around evolved stars from far-infrared size limits

International Nuclear Information System (INIS)

Harvey, P.M.; Lester, D.F.; Brock, D.; Joy, M.

1991-01-01

High angular resolution far-infrared scans were obtained of six stars surrounded by circumstellar dust shells believed to result from mass loss by the central star. None of the dust shells was clearly resolved at either 50 or 100 microns; the upper limits are in the range 4 to 10 arcsec. These size limits place constraints on the far-IR dust emissivity and dust density distribution. For one of the objects, AFGL 2343, larger than normal grains are almost certainly required. For several other stars, the size limits are much more consistent with dust having an emissivity law no steeper than 1/lambda in the 1-100-micron spectral region. For IRC + 10216, an earlier suggestion is confirmed that, assuming reasonable grain properties, a smooth radial dust distribution is not consistent with the scans and the energy distribution of the object. 29 refs

ISO far-infrared observations of rich galaxy clusters II. Sersic 159-03

DEFF Research Database (Denmark)

Hansen, Lene; Jørgensen, H.E.; Nørgaard-Nielsen, Hans Ulrik

2000-01-01

In a series of papers we investigate far-infrared emission from rich galaxy clusters. Maps have been obtained by ISO at 60 mu m, 100 mu m, 135 mu m, and 200 mu m using the PHT-C camera. Ground based imaging and spectroscopy were also acquired. Here we present the results for the cooling flow...

Focal plane optics in far-infrared and submillimeter astronomy

Science.gov (United States)

Hildebrand, R. H.

1985-01-01

The construction of airborne observatories, high mountain-top observatories, and space observatories designed especially for infrared and submillimeter astronomy has opened fields of research requiring new optical techniques. A typical far-IR photometric study involves measurement of a continuum spectrum in several passbands between approx 30 microns and 1000 microns and diffraction-limited mapping of the source. At these wavelengths, diffraction effects strongly influence the design of the field optics systems which couple the incoming flux to the radiation sensors (cold bolometers). The Airy diffraction disk for a typical telescope at submillimeter wavelengths approx 100 microns-1000 microns is many millimeters in diameter; the size of the field stop must be comparable. The dilute radiation at the stop is fed through a Winston nonimaging concentrator to a small cavity containing the bolometer. The purpose of this paper is to review the principles and techniques of infrared field optics systems, including spectral filters, concentrators, cavities, and bolometers (as optical elements), with emphasis on photometric systems for wavelengths longer than 60 microns.

Focal plane optics in far-infrared and submillimeter astronomy

Science.gov (United States)

Hildebrand, R. H.

1986-02-01

The construction of airborne observatories, high mountain-top observatories, and space observatories designed especially for infrared and submillimeter astronomy has opened fields of research requiring new optical techniques. A typical far-IR photometric study involves measurement of a continuum spectrum in several passbands between approx 30 microns and 1000 microns and diffraction-limited mapping of the source. At these wavelengths, diffraction effects strongly influence the design of the field optics systems which couple the incoming flux to the radiation sensors (cold bolometers). The Airy diffraction disk for a typical telescope at submillimeter wavelengths approx 100 microns-1000 microns is many millimeters in diameter; the size of the field stop must be comparable. The dilute radiation at the stop is fed through a Winston nonimaging concentrator to a small cavity containing the bolometer. The purpose of this paper is to review the principles and techniques of infrared field optics systems, including spectral filters, concentrators, cavities, and bolometers (as optical elements), with emphasis on photometric systems for wavelengths longer than 60 microns.

Far infrared radiation (FIR): its biological effects and medical applications.

Science.gov (United States)

Vatansever, Fatma; Hamblin, Michael R

2012-11-01

Far infrared (FIR) radiation (λ = 3-100 μm) is a subdivision of the electromagnetic spectrum that has been investigated for biological effects. The goal of this review is to cover the use of a further sub-division (3- 12 μm) of this waveband, that has been observed in both in vitro and in vivo studies, to stimulate cells and tissue, and is considered a promising treatment modality for certain medical conditions. Technological advances have provided new techniques for delivering FIR radiation to the human body. Specialty lamps and saunas, delivering pure FIR radiation (eliminating completely the near and mid infrared bands), have became safe, effective, and widely used sources to generate therapeutic effects. Fibers impregnated with FIR emitting ceramic nanoparticles and woven into fabrics, are being used as garments and wraps to generate FIR radiation, and attain health benefits from its effects.

Far-infrared vibrational modes of DNA components studied by terahertz time-domain spectroscopy

International Nuclear Information System (INIS)

Fischer, B M; Walther, M; Jepsen, P Uhd

2002-01-01

The far-infrared dielectric function of a wide range of organic molecules is dominated by vibrations involving a substantial fraction of the atoms forming the molecule and motion associated with intermolecular hydrogen bond vibrations. Due to their collective nature such modes are highly sensitive to the intra- and intermolecular structure and thus provide a unique fingerprint of the conformational state of the molecule and effects of its environment. We demonstrate the use of terahertz time-domain spectroscopy (THz-TDS) for recording the far-infrared (0.5-4.0 THz) dielectric function of the four nucleobases and corresponding nucleosides forming the building blocks of deoxyribose nucleic acid (DNA). We observe numerous distinct spectral features with large differences between the molecules in both frequency-dependent absorption coefficient and index of refraction. Assisted by results from density-functional calculations we interpret the origin of the observed resonances as vibrations of hydrogen bonds between the molecules

Estimate of Radiosonde Dry Bias From Far-Infrared Measurements on the Antarctic Plateau

Science.gov (United States)

Rizzi, R.; Maestri, T.; Arosio, C.

2018-03-01

The experimental data set of downwelling radiance spectra measured at the ground in clear conditions during 2013 by a Far-Infrared Fourier Transform Spectrometer at Dome-C, Antarctica, presented in Rizzi et al. (2016, https://doi.org/10.1002/2016JD025341) is used to estimate the effect of solar heating of the radiosonde humidity sensor, called dry bias. The effect is quite evident comparing residuals for the austral summer and winter clear cases and can be modeled by an increase of the water vapor concentration at all levels by about 15%. Such an estimate has become possible only after a new version of the simulation code and spectroscopic data has become available, which has substantially improved the modeling of water vapor absorption in the far infrared. The negative yearly spectral bias reported in Rizzi et al. (2016, https://doi.org/10.1002/2016JD025341) is in fact greatly reduced when compared to the same measurement data set.

High speed FPGA-based Phasemeter for the far-infrared laser interferometers on EAST

Science.gov (United States)

Yao, Y.; Liu, H.; Zou, Z.; Li, W.; Lian, H.; Jie, Y.

2017-12-01

The far-infrared laser-based HCN interferometer and POlarimeter/INTerferometer\\break (POINT) system are important diagnostics for plasma density measurement on EAST tokamak. Both HCN and POINT provide high spatial and temporal resolution of electron density measurement and used for plasma density feedback control. The density is calculated by measuring the real-time phase difference between the reference beams and the probe beams. For long-pulse operations on EAST, the calculation of density has to meet the requirements of Real-Time and high precision. In this paper, a Phasemeter for far-infrared laser-based interferometers will be introduced. The FPGA-based Phasemeter leverages fast ADCs to obtain the three-frequency signals from VDI planar-diode Mixers, and realizes digital filters and an FFT algorithm in FPGA to provide real-time, high precision electron density output. Implementation of the Phasemeter will be helpful for the future plasma real-time feedback control in long-pulse discharge.

The Relationship Between Dynamics and Structure in the Far Infrared Absorption Spectrum of Liquid Water

Energy Technology Data Exchange (ETDEWEB)

Woods, K.

2005-01-14

Using an intense source of far-infrared radiation, the absorption spectrum of liquid water is measured at a temperature ranging from 269 to 323 K. In the infrared spectrum we observe modes that are related to the local structure of liquid water. Here we present a FIR measured spectrum that is sensitive to the low frequency (< 100cm{sup -1}) microscopic details that exist in liquid water.

Drunk identification using far infrared imagery based on DCT features in DWT domain

Science.gov (United States)

Xie, Zhihua; Jiang, Peng; Xiong, Ying; Li, Ke

2016-10-01

Drunk driving problem is a serious threat to traffic safety. Automatic drunk driver identification is vital to improve the traffic safety. This paper copes with automatic drunk driver detection using far infrared thermal images by the holistic features. To improve the robustness of drunk driver detection, instead of traditional local pixels, a holistic feature extraction method is proposed to attain compact and discriminative features for infrared face drunk identification. Discrete cosine transform (DCT) in discrete wavelet transform (DWT) domain is used to extract the useful features in infrared face images for its high speed. Then, the first six DCT coefficients are retained for drunk classification by means of "Z" scanning. Finally, SVM is applied to classify the drunk person. Experimental results illustrate that the accuracy rate of proposed infrared face drunk identification can reach 98.5% with high computation efficiency, which can be applied in real drunk driver detection system.

ELECTRON TRAPPING IN WIGGLER AND QUADRUPOLE MAGNETS OF CESRTA

International Nuclear Information System (INIS)

Wang, Lanfa

2010-01-01

The Cornell Electron Storage Ring (CESR) has been reconfigured as an ultra low emittance damping ring for use as a test accelerator (CesrTA) for International Linear Collider (ILC) damping ring R and D (1). One of the primary goals of the CesrTA program is to investigate the interaction of the electron cloud with low emittance positron beam to explore methods to suppress the electron cloud, develop suitable advanced instrumentation required for these experimental studies and benchmark predictions by simulation codes. This paper reports the simulation of the electron-cloud formation in the wiggler and quadrupole magnets using the 3D code CLOUDLAND. We found that electrons can be trapped with long lifetime in a quadrupole magnet due to the mirror field trapping mechanism and photoelectrons produced in the wiggler zero field zone have long lifetime due to their complicated trajectory.

An experimental study about effect of far infrared radiant ceramics on efficient methane fermentation

International Nuclear Information System (INIS)

Oda, A.; Yamazaki, M.; Oida, A.

2003-01-01

Methane fermentation, well known as one of the methods for organic wastes treatment, has been used as an energy production process in order to produce a gaseous fuel. But methane fermentation has some problems to be solved about gas production rate and volatile solids reduction efficiency. Simple methods to improve these problems are needed. In this study, we focused on far infrared radiant ceramics as a stimulating substance to activate methanogenic bacteria. Firstly, through the experiment of one batch fermentation, it was confirmed that the ceramics in the fermenter caused increase of total gas production. Next, even through the experiment of continuous fermentation, same stimulating effect was confirmed. It was considered that this effect was caused not only by a function of bio-contactor of the ceramics but also by far infrared radiation from ceramics. (author)

SEASONAL DISAPPEARANCE OF FAR-INFRARED HAZE IN TITAN'S STRATOSPHERE

Energy Technology Data Exchange (ETDEWEB)

Jennings, Donald E.; Anderson, C. M.; Flasar, F. M.; Cottini, V. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Samuelson, R. E.; Nixon, C. A.; Kunde, V. G.; Achterberg, R. K. [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); De Kok, R. [SRON Netherlands Institute for Space Research, Sorbonnelaan 2, 3584 CA Utrecht (Netherlands); Coustenis, A.; Vinatier, S. [LESIA, Observatoire de Paris-Meudon, 92195 Meudon Cedex (France); Calcutt, S. B., E-mail: donald.e.jennings@nasa.gov [Department of Physics, University of Oxford, Parks Road, Oxford OX1 3PU (United Kingdom)

2012-07-20

A far-infrared emission band attributed to volatile or refractory haze in Titan's stratosphere has been decreasing in intensity since Cassini's arrival in 2004. The 220 cm{sup -1} feature, first seen by the Voyager Infrared Interferometer Spectrometer, has only been found in Titan's winter polar region. The emission peaks at about 140 km altitude near the winter stratospheric temperature minimum. Observations recorded over the period 2004-2012 by the Composite Infrared Spectrometer on Cassini show a decrease in the intensity of this feature by about a factor of four. Possible seasonal causes of this decline are an increase in photolytic destruction of source chemicals at high altitude, a lessening of condensation as solar heating increased, or a weakening of downwelling of vapors. As of early 2012, the 220 cm{sup -1} haze has not yet been detected in the south. The haze composition is unknown, but its decrease is similar to that of HC{sub 3}N gas in Titan's polar stratosphere, pointing to a nitrile origin.

The structural and optical constants of Ag2S semiconductor nanostructure in the Far-Infrared.

Science.gov (United States)

Zamiri, Reza; Abbastabar Ahangar, Hossein; Zakaria, Azmi; Zamiri, Golnoosh; Shabani, Mehdi; Singh, Budhendra; Ferreira, J M F

2015-01-01

In this paper a template-free precipitation method was used as an easy and low cost way to synthesize Ag2S semiconductor nanoparticles. The Kramers-Kronig method (K-K) and classical dispersion theory was applied to calculate the optical constants of the prepared samples, such as the reflective index n(ω) and dielectric constant ε(ω) in Far-infrared regime. Nanocrystalline Ag2S was synthesized by a wet chemical precipitation method. Ag2S nanoparticle was characterized by X-ray diffraction, Scanning Electron Microscopy, UV-visible, and FT-IR spectrometry. The refinement of the monoclinic β-Ag2S phase yielded a structure solution similar to the structure reported by Sadanaga and Sueno. The band gap of Ag2S nanoparticles is around 0.96 eV, which is in good agreement with previous reports for the band gap energy of Ag2S nanoparticles (0.9-1.1 eV). The crystallite size of the synthesized particles was obtained by Hall-Williamson plot for the synthesized Ag2S nanoparticles and it was found to be 217 nm. The Far-infrared optical constants of the prepared Ag2S semiconductor nanoparticles were evaluated by means of FTIR transmittance spectra data and K-K method. Graphical abstractThe Far-infrared optical constants of Ag2S semiconductor nanoparticles.

Efficacy and safety of far infrared radiation in lymphedema treatment: clinical evaluation and laboratory analysis.

Science.gov (United States)

Li, Ke; Zhang, Zheng; Liu, Ning Fei; Feng, Shao Qing; Tong, Yun; Zhang, Ju Fang; Constantinides, Joannis; Lazzeri, Davide; Grassetti, Luca; Nicoli, Fabio; Zhang, Yi Xin

2017-04-01

Swelling is the most common symptom of extremities lymphedema. Clinical evaluation and laboratory analysis were conducted after far infrared radiation (FIR) treatment on the main four components of lymphedema: fluid, fat, protein, and hyaluronan. Far infrared radiation is a kind of hyperthermia therapy with several and additional benefits as well as promoting microcirculation flow and improving collateral lymph circumfluence. Although FIR therapy has been applied for several years on thousands of lymphedema patients, there are still few studies that have reported the biological effects of FIR on lymphatic tissue. In this research, we investigate the effects of far infrared rays on the major components of lymphatic tissue. Then, we explore the effectiveness and safety of FIR as a promising treatment modality of lymphedema. A total of 32 patients affected by lymphedema in stage II and III were treated between January 2015 and January 2016 at our department. After therapy, a significant decrease of limb circumference measurements was noted and improving of quality of life was registered. Laboratory examination showed the treatment can also decrease the deposition of fluid, fat, hyaluronan, and protein, improving the swelling condition. We believe FIR treatment could be considered as both an alternative monotherapy and a useful adjunctive to the conservative or surgical lymphedema procedures. Furthermore, the real and significant biological effects of FIR represent possible future applications in wide range of the medical field.

Effects of Somatothermal Far-Infrared Ray on Primary Dysmenorrhea: A Pilot Study

Directory of Open Access Journals (Sweden)

Yu-Min Ke

2012-01-01

Full Text Available The purpose of this study was to assess the beneficial effects of using a far-infrared (FIR belt on the management of patients with primary dysmenorrhea. This is the first study to determine the efficacy of somatothermal FIR using a parallel-arm randomized sham-controlled and double-blinded design with objective physical evidence and psychometric self-reports. Fifty-one Taiwanese women with primary dysmenorrhea were enrolled in the study. Results indicate that there was an increased abdominal temperature of 0.6°C and a 3.27% increase in abdominal blood flow in the FIR group (wearing FIR belt compared to those in the control group (wearing sham belt. Verbal rating scale and numeric rating scale scores in the FIR group were both lower than those in the control group. Compared to the blank group (wearing no belt, the average dysmenorrhea pain duration of the FIR group was significantly reduced from 2.5 to 1.8 days, but there was no significant difference in the control group. These results demonstrate that the use of a belt made of far-infrared ceramic materials can reduce primary dysmenorrhea.

Beam Line VI REC-steel hybrid wiggler for SSRL

International Nuclear Information System (INIS)

Hoyer, E.; Chan, T.; Chin, J.W.G.; Halbach, K.; Kim, K.J.; Winick, H.; Yang, J.

1983-03-01

A wiggler magnet with 27 periods, each 7 cm long which reaches 1.21 T at a 1.2 cm gap and 1.64 T at 0.8 cm gap has been designed and is in fabrication. Installation in SPEAR is scheduled for mid 1983. This new wiggler will be the radiation source for a new high intensity synchrotron radiation beam line at SSRL. The magnet utilizes rare-earth cobalt (REC) material and steel in a hybrid configuration to achieve simultaneously a high magnetic field with a short period. The magnet is external to a thin walled variable gap stainless steel vacuum chamber which is opened to provide beam aperture of 1.8 cm gap at injection and then closed to a smaller aperture (< 1.0 cm). Five independent drive systems are provided to adjust the magnet and chamber gaps and alignment. Magnetic design, construction details and magnetic measurements are presented

Decreasing the emittance using a multi-period Robinson wigglers in TPS

Energy Technology Data Exchange (ETDEWEB)

Huamg, C. W., E-mail: huang.zw@nsrrc.org.tw [Department of Physics, National Tsing Hua University Hsinchu 30043, Taiwan (China); Hwang, C. S., E-mail: cshwang@nsrrc.org.tw [NSRRC, 101 Hsin-Ann Road, Hsinchu Science Park, Hsinchu 30076, Taiwan (China); Department of Electrophysics, National Chiao Tung University, Hsinchu 300, Taiwan (China); Lee, S. Y., E-mail: shylee@indiana.edu [Department of Physics, Indiana University (United States)

2016-07-27

The Taiwan Photon Source (TPS) has been successfully commissioned. However, the minimum emittance in the TPS lattice is 1.6 nm rad. In the existing TPS storage ring lattice, it is imperative to reduce the emittance to below 1 nm rad. Therefore, a feasibility study for reducing the effective emittance of the TPS storage ring by using a Robinson wiggler was launched; the reduction is necessary to enhance the photon brilliance. In this study, a permanent-magnet multiperiod Robinson wiggler (MRW) was developed for use instead of the single-period Robinson wiggler. In general, the quadruple field of a combined function magnet in the storage ring is approximately few tesla per meter. According to beam dynamic analysis, we found that it is necessary to adopt a high gradient (40 T/m) combined-function MRW magnet to reduce the emittance effectively. Therefore, a high gradient field strength is required in the combined function MRW magnet. In this study, the quadrupole field strength of the MRW magnet was allowed to be approximately 40 T/m at a magnet gap of 20 mm. The period length of the MRW magnet was 300 mm and the period number was 16. The of MRWs is discussed in regard to the possibility of increasing the photon brilliance from IU22.

Design of the 1.8 Tesla wiggler for the DAΦNE Main Rings

International Nuclear Information System (INIS)

Sanelli, C.; Hsieh, H.

1992-01-01

The electromagnetic and mechanical design of the eight wiggler magnets for DAΦNE Main Rings is described. The wigglers have a large 1.8 Tesla flat top magnetic field, 64 cm period and 4 cm gap. The magnetic 3-D calculations, the electromagnetic design and the adopted mechanical solutions, with particular attention to the vacuum chamber problems are described. A full scale prototype (5 full poles and two half pole) will be constructed in order to verify the accuracy of magnetic calculations, the end pole design and the multipole content. (author) 4 figs.; 1 tab

Coherent infrared radiation from the ALS generated via femtosecond laser modulation of the electron beam

International Nuclear Information System (INIS)

Byrd, J.M.; Hao, Z.; Martin, M.C.; Robin, D.S.; Sannibale, F.; Schoenlein, R.W.; Venturini, M.; Zholents, A.A.; Zolotorev, M.S.

2004-01-01

Interaction of an electron beam with a femtosecond laser pulse co-propagating through a wiggler at the ALS produces large modulation of the electron energies within a short ∼100 fs slice of the electron bunch. Propagating around the storage ring, this bunch develops a longitudinal density perturbation due to the dispersion of electron trajectories. The length of the perturbation evolves with a distance from the wiggler but is much shorter than the electron bunch length. This perturbation causes the electron bunch to emit short pulses of temporally and spatially coherent infrared light which are automatically synchronized to the modulating laser. The intensity and spectra of the infrared light were measured in two storage ring locations for a nominal ALS lattice and for an experimental lattice with the higher momentum compaction factor. The onset of instability stimulated by laser e-beam interaction had been discovered. The infrared signal is now routinely used as a sensitive monitor for a fine tuning of the laser beam alignment during data accumulation in the experiments with femtosecond x-ray pulses

Infrared-faint radio sources remain undetected at far-infrared wavelengths. Deep photometric observations using the Herschel Space Observatory

Science.gov (United States)

Herzog, A.; Norris, R. P.; Middelberg, E.; Spitler, L. R.; Leipski, C.; Parker, Q. A.

2015-08-01

Context. Showing 1.4 GHz flux densities in the range of a few to a few tens of mJy, infrared-faint radio sources (IFRS) are a type of galaxy characterised by faint or absent near-infrared counterparts and consequently extreme radio-to-infrared flux density ratios up to several thousand. Recent studies showed that IFRS are radio-loud active galactic nuclei (AGNs) at redshifts ≳2, potentially linked to high-redshift radio galaxies (HzRGs). Aims: This work explores the far-infrared emission of IFRS, providing crucial information on the star forming and AGN activity of IFRS. Furthermore, the data enable examining the putative relationship between IFRS and HzRGs and testing whether IFRS are more distant or fainter siblings of these massive galaxies. Methods: A sample of six IFRS was observed with the Herschel Space Observatory between 100 μm and 500 μm. Using these results, we constrained the nature of IFRS by modelling their broad-band spectral energy distribution (SED). Furthermore, we set an upper limit on their infrared SED and decomposed their emission into contributions from an AGN and from star forming activity. Results: All six observed IFRS were undetected in all five Herschel far-infrared channels (stacking limits: σ = 0.74 mJy at 100 μm, σ = 3.45 mJy at 500 μm). Based on our SED modelling, we ruled out the following objects to explain the photometric characteristics of IFRS: (a) known radio-loud quasars and compact steep-spectrum sources at any redshift; (b) starburst galaxies with and without an AGN and Seyfert galaxies at any redshift, even if the templates were modified; and (c) known HzRGs at z ≲ 10.5. We find that the IFRS analysed in this work can only be explained by objects that fulfil the selection criteria of HzRGs. More precisely, IFRS could be (a) known HzRGs at very high redshifts (z ≳ 10.5); (b) low-luminosity siblings of HzRGs with additional dust obscuration at lower redshifts; (c) scaled or unscaled versions of Cygnus A at any

Spiking mode operation for a uniform-period wiggler

International Nuclear Information System (INIS)

Warren, R.W.; Goldstein, J.C.; Newnam, B.E.

1985-01-01

The onset of saturation in a uniform-period wiggler has been examined experimentally and through numerical simulations. Models have been constructed that explain the observations in simple and consistent ways. The models are based upon the development of strong frequency and amplitude modulation of the optical wave as a way to increase extraction efficiency and optical power

Far-infrared Fourier Transform Spectroscopy Measurements of Mn12-acetate.

Science.gov (United States)

Tu, Jiufeng; Suzuki, Yoko; Mertes, K. M.; Sarachik, M. P.; Agladze, N. I.; Sievers, A. J.; Rumberger, E. M.; Hendrickson, D. N.; Christou, G.

2004-03-01

The transmission spectra of both powder samples and assemblies of single crystals of Mn_12-acetate were measured in the far infrared region (2.0 - 20 cm-1) using a Fourier transform technique. The energies of the observed aborption lines agree with those obtained by Mukhin et al. [1] using the backwards wave oscillator technique. The temperature dependence of the aborption lines, as well as the presence of additional absorption lines, will be discussed. [1] A. A. Mukhin, V. D. Travkin, A. K. Zvesdin, A. Caneschi, D. Gatteschi and R. Sessoli, Physica B 284-288 (2000) 1221-1222

Consideration of the Verleur model of far-infrared spectroscopy of ternary compounds

International Nuclear Information System (INIS)

Robouch, B. V.; Kisiel, A.; Sheregii, E. M.

2001-01-01

The clustering model proposed by Verleur and Barker [Phys. Rev. 149, 715 (1966)] to interpret far infrared data for face-centered-cubic ternary compounds is critically analyzed. It is shown that their approach, satisfactory for fitting some ternary compound spectral curves, is too restricted by its one-parameter β model to be able to describe preferences (with respect to a random distribution case) for the five tetrahedron configurations

Germanium blocked impurity band far infrared detectors

International Nuclear Information System (INIS)

Rossington, C.S.

1988-04-01

The infrared portion of the electromagnetic spectrum has been of interest to scientist since the eighteenth century when Sir William Herschel discovered the infrared as he measured temperatures in the sun's spectrum and found that there was energy beyond the red. In the late nineteenth century, Thomas Edison established himself as the first infrared astronomer to look beyond the solar system when he observed the star Arcturus in the infrared. Significant advances in infrared technology and physics, long since Edison's time, have resulted in many scientific developments, such as the Infrared Astronomy Satellite (IRAS) which was launched in 1983, semiconductor infrared detectors for materials characterization, military equipment such as night-vision goggles and infrared surveillance equipment. It is now planned that cooled semiconductor infrared detectors will play a major role in the ''Star Wars'' nuclear defense scheme proposed by the Reagan administration

Permanent magnets including undulators and wigglers

CERN Document Server

Bahrdt, J

2010-01-01

After a few historic remarks on magnetic materials we introduce the basic definitions related to permanent magnets. The magnetic properties of the most common materials are reviewed and the production processes are described. Measurement techniques for the characterization of macroscopic and microscopic properties of permanent magnets are presented. Field simulation techniques for permanent magnet devices are discussed. Today, permanent magnets are used in many fields. This article concentrates on the applications of permanent magnets in accelerators starting from dipoles and quadrupoles on to wigglers and undulators.

Effects of laser-polarization and wiggler magnetic fields on electron acceleration in laser-cluster interaction

Science.gov (United States)

Singh Ghotra, Harjit; Kant, Niti

2018-06-01

We examine the electron dynamics during laser-cluster interaction. In addition to the electrostatic field of an individual cluster and laser field, we consider an external transverse wiggler magnetic field, which plays a pivotal role in enhancing the electron acceleration. Single-particle simulation has been presented with a short pulse linearly polarized as well as circularly polarized laser pulses for electron acceleration in a cluster. The persisting Coulomb field allows the electron to absorb energy from the laser field. The stochastically heated electron finds a weak electric field at the edge of the cluster from where it is ejected. The wiggler magnetic field connects the regions of the stochastically heated, ejected electron from the cluster and high energy gain by the electron from the laser field outside the cluster. This increases the field strength and hence supports the electron to meet the phase of the laser field for enhanced acceleration. A long duration resonance appears with an optimized magnetic wiggler field of about 3.4 kG. Hence, the relativistic energy gain by the electron is enhanced up to a few 100 MeV with an intense short pulse laser with an intensity of about 1019 W cm‑2 in the presence of a wiggler magnetic field.

Bio-inspired Plasmonic Nanoarchitectured Hybrid System Towards Enhanced Far Red-to-Near Infrared Solar Photocatalysis

OpenAIRE

Runyu Yan; Min Chen; Han Zhou; Tian Liu; Xingwei Tang; Ke Zhang; Hanxing Zhu; Jinhua Ye; Di Zhang; Tongxiang Fan

2016-01-01

Solar conversion to fuels or to electricity in semiconductors using far red-to-near infrared (NIR) light, which accounts for about 40% of solar energy, is highly significant. One main challenge is the development of novel strategies for activity promotion and new basic mechanisms for NIR response. Mother Nature has evolved to smartly capture far red-to-NIR light via their intelligent systems due to unique micro/nanoarchitectures, thus motivating us for biomimetic design. Here we report the fi...

Far-infrared constraints on the contamination by dust-obscured galaxies of high-z dropout searches.

OpenAIRE

Boone, F.; Schaerer, D.; Pelló, R.; Lutz, D.; Weiss, A.; Egami, E.; Smail, I.; Rex, M.; Rawle, T.; Ivison, R.; Laporte, N.; Beelen, A.; Combes, F.; Blain, A.W.; Richard, J.

2011-01-01

The spectral energy distributions (SED) of dusty galaxies at intermediate redshift may look similar to very high-redshift galaxies in the optical/near infrared (NIR) domain. This can lead to the contamination of high-redshift galaxy searches based on broad-band optical/NIR photometry by lower redshift dusty galaxies because both kind of galaxies cannot be distinguished. The contamination rate could be as high as 50%. This work shows how the far-infrared (FIR) domain can help to recognize like...

Environmental Temperature Effect on the Far-Infrared Absorption Features of Aromatic-Based Titan's Aerosol Analogs

Science.gov (United States)

Gautier, Thomas; Trainer, Melissa G.; Loeffler, Mark J.; Sebree, Joshua A.; Anderson, Carrie M.

2016-01-01

Benzene detection has been reported in Titans atmosphere both in the stratosphere at ppb levels by remote sensing and in the thermosphere at ppm levels by the Cassini's Ion and Neutral Mass Spectrometer. This detection supports the idea that aromatic and heteroaromatic reaction pathways may play an important role in Titans atmospheric chemistry, especially in the formation of aerosols. Indeed, aromatic molecules are easily dissociated by ultraviolet radiation and can therefore contribute significantly to aerosol formation. It has been shown recently that aerosol analogs produced from a gas mixture containing a low concentration of aromatic and/or heteroaromatic molecules (benzene, naphthalene, pyridine, quinoline and isoquinoline) have spectral signatures below 500/cm, a first step towards reproducing the aerosol spectral features observed by Cassini's Composite InfraRed Spectrometer (CIRS) in the far infrared. In this work we investigate the influence of environmental temperature on the absorption spectra of such aerosol samples, simulating the temperature range to which aerosols, once formed, are exposed during their transport through Titans stratosphere. Our results show that environmental temperature does not have any major effect on the spectral shape of these aerosol analogs in the far-infrared, which is consistent with the CIRS observations.

Control System of the Superconducting 63-Pole 2-Tesla Wiggler for Canadian Light Source

International Nuclear Information System (INIS)

Kuper, E.A.; Mezentsev, N.A.; Miginsky, E.G.; Repkov, V.V.; Tsukanov, V.M.

2006-01-01

A control system of the superconducting 63-pole wiggler fabricated at the Institute of Nuclear Physics in Novosibirsk (BINP) for Synchrotron Radiation Center in Canada (CLS) is described. Specific electronics and software which provide continuos monitoring of all the superconducting wiggler parameters as well as full control and monitoring of power suppliers and cryogenics machines, have been designed. The control system is VME-based. A client/server architecture of the software allowed us to integrate easily this system into the CLS distributed control system

Far-and mid-infrared properties of carbon layers elaborated by plasma sputtering

Energy Technology Data Exchange (ETDEWEB)

Rousseau, Benoit, E-mail: benoit.rousseau@univ-nantes.fr [Université de Nantes, CNRS, LTN UMR6607, La Chantrerie, Rue Christian Pauc, B.P. 50609, F-44306 Nantes Cedex 3 (France); Ammar, Mohamed Ramzi; Bormann, Denis; Simon, Patrick [CNRS, CEMHTI UPR3079, Université d' Orléans, F-55071 (France); Rabat, Hervé; Brault, Pascal [Université d' Orléans, CNRS, GREMI UMR7344, BP 6744, F-45067 Orléans Cedex 2 (France)

2016-12-30

Highlights: • Magnetron sputtering deposition of columnar, disordered carbon films. • Sputtered carbon films infrared properties are dependent on the local order. • Film texture at the micro-nanoscale explains difference of optical properties. - Abstract: The far-and mid-infrared reflectivity spectra of two carbon layers deposited on pure (100) silicon substrates by DC magnetron sputtering were investigated at room temperature in the 10–5000 cm{sup −1} wavenumber range. Their structural and textural features were also studied by combining Raman spectroscopy, Field Emission Scanning Electron Microscopy (FESEM), High Resolution Transmission Electron Microscopy (HRTEM), X-Ray Reflectivity (XRR) and Rutherford Backscattering Spectroscopy (RBS). The set of results was used to discuss afterwards the influence of the texture on the infrared properties at varying length scale. Thereby, the two layers were found to be heterogeneous as assessed by RBS, XRR and FESEM and their thicknesses had been measured by XRR and FESEM. The information on the structural organization and “crystallite” size was given by Raman spectroscopy. The influence of both the textural and structural parameters on the measured infrared reflectivity spectra was discussed. Finally, a methodology was proposed to recover the intrinsic index of refraction and the intrinsic index of absorption of each layer.

Intersubband Rabi oscillations in asymmetric nanoheterostructures: implications for a tunable continuous-wave source of a far-infrared and THz radiation.

Science.gov (United States)

Kukushkin, V A

2012-06-01

A tunable continuous-wave source of a far-infrared and THz radiation based on a semiconductor nanoheterostructure with asymmetric quantum wells is suggested. It utilizes Rabi oscillations at a transition between quantum well subbands excited by external femtosecond pulses of a mid-infrared electromagnetic field. Due to quantum well broken inversion symmetry the subbands possess different average dipole moments, which enables the creation of polarization at the Rabi frequency as the subband populations change. It is shown that if this polarization is excited so that it is periodic in space, then, though being pulsed, it can produce continuous-wave output radiation. Changing the polarization space period and the time intervals between the exciting pulses, one can tune the frequency of this radiation throughout the far-infrared and THz range. In the present work a concrete multiple quantum well heterostructure design and a scheme of its space-periodic polarization are suggested. It is shown that for existing sources of mid-infrared femtosecond pulses the proposed scheme can provide a continuous-wave output power of order the power of far-infrared and THz quantum cascade lasers. Being added to the possibility of its output frequency tuning, this can make the suggested device attractive for fundamental research and various applications.

THE FAR-INFRARED SPECTROSCOPY OF VERY LARGE NEUTRAL POLYCYCLIC AROMATIC HYDROCARBONS

International Nuclear Information System (INIS)

Ricca, Alessandra; Bauschlicher, Charles W.; Mattioda, Andrew L.; Boersma, Christiaan; Allamandola, Louis J.

2010-01-01

Here we report the computed far-infrared (FIR) spectra of neutral polycyclic aromatic hydrocarbon (PAH) molecules containing at least 82 carbons up to 130 carbons and with shapes going from compact round and oval-type structures to rectangular and to trapezoidal. The effects of size and shape on the FIR band positions and intensities are discussed. Using FIR data from the NASA Ames PAH IR Spectroscopic Database Version 1.1, we generate synthetic spectra that support the suggestion that the 16.4, 17.4, and 17.8 μm bands arise from PAHs.

Downwelling Far-Infrared Radiance Spectra Measured by FIRST at Cerro Toco, Chile

Science.gov (United States)

Mast, J. C.; Mlynczak, M. G.; Cageao, R.; Kratz, D. P.; Latvakoski, H.; Johnson, D. G.; Mlawer, E. J.; Turner, D. D.

2015-12-01

The Far-Infrared Spectroscopy of the Troposphere (FIRST) instrument is a Fourier transform spectrometer developed by NASA Langley Research Center in collaboration with the Space Dynamics Laboratory and the Harvard-Smithsonian Center for Astrophysics. FIRST was initially developed for measuring the far-infrared portion of Earth's longwave spectrum as a balloon borne instrument and later was reconfigured to operate as a ground-based instrument. In its current ground-based configuration FIRST was deployed at 17500 ft on Cerro Toco, a mountain in the Atacama Desert of Chile, from August to October, 2009. There the integrated precipitable water (IPW) was as low as 0.02 cm. FIRST measurements from days with IPW between 0.024 and 0.035 cm during the campaign are presented here between 200 cm-1 and 800 cm-1. Significant spectral development in the far-IR is observed over the entire 200 cm-1 to 800 cm-1 band. Water vapor and temperature profiles from radiosonde and GVRP measurements are used as inputs to the AER Line-by-Line Radiative Transfer Model (LBLRTM) utilizing the AER v3.2 line parameter database. Uncertainties in both the measured and modeled radiances are accounted for in this study. The residual LBLRTM - FIRST is calculated to assess agreement between the measured and modeled spectra. Measured and model radiances generally agree to within the combined uncertainties for wavenumbers greater than 360 cm-1. At wavenumbers less than 360 cm-1 persistent troughs in the residual are present outside of the combined uncertainties. These features are present on different days and at different water vapor amounts. Possible solutions for these features are discussed.

Far infrared and terahertz spectroscopy of ferroelectric soft modes in thin films: a review

Czech Academy of Sciences Publication Activity Database

Petzelt, Jan; Kamba, Stanislav

2016-01-01

Roč. 503, č. 1 (2016), s. 19-44 ISSN 0015-0193 R&D Projects: GA ČR GA15-08389S Institutional support: RVO:68378271 Keywords : soft mode * central mode * ferroelectric thin film * terahertz spectroscopy * far-infrared spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.551, year: 2016

Determination of carbohydrates in Folium Lysium Chinensis using capillary electrophoresis combined with far-infrared light irradiation-assisted extraction.

Science.gov (United States)

Fu, Yuejiao; Zhang, Luyan; Chen, Gang

2011-11-01

In this work, a method based on capillary electrophoresis with amperometric detection and far-infrared-assisted extraction has been developed for the determination of mannitol, sucrose, glucose and fructose in Folium Lysium Chinensis, a commonly used traditional Chinese medicine. The water-soluble constituents in the herbal drug were extracted with double distilled water with the assistance of far-infrared radiations. The effects of detection potential, irradiation time, and the voltage applied on the infrared generator were investigated to acquire the optimum analysis conditions. The detection electrode was a 300-μm-diameter copper disk electrode at a detection potential of +0.65 V. The four carbohydrates could be well separated within 18 min in a 50-cm length fused-silica capillary at a separation voltage of 9 kV in a 50-mM NaOH aqueous solution. The relation between peak current and analyte concentration was linear over about three orders of magnitude with detection limits (S/N=3) ranging from 0.66 to 1.15 μM for all analytes. The results indicated that far infrared significantly enhanced the extraction efficiency of the carbohydrates in Folium Lysium Chinensis. The extraction time was significantly reduced to 7 min compared with several hours for conventional hot solvent extraction. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

High resolution far-infrared observations of the evolved H II region M16

International Nuclear Information System (INIS)

McBreen, B.; Fazio, G.G.; Jaffe, D.T.

1982-01-01

M16 is an evolved, extremely density bounded H II region, which now consists only of a series of ionization fronts at molecular cloud boundaries. The source of ionization is the OB star cluster (NGC 6611) which is about 5 x 10 6 years old. We used the CFA/UA 102 cm balloon-borne telescope to map this region and detected three far-infrared (far-IR) sources embedded in an extended ridge of emission. Source I is an unresolved far-IR source embedded in a molecular cloud near a sharp ionization front. An H 2 O maser is associated with this source, but no radio continuum emission has been observed. The other two far-IR sources (II and III) are associated with ionized gas-molecular cloud interfaces, with the far-IR radiation arising from dust at the boundary heated by the OB cluster. Source II is located at the southern prominent neutral intrusion with its associated bright rims and dark ''elephant trunk'' globules that delineate the current progress of the ionization front into the neutral material, and Source III arises at the interface of the northern molecular cloud fragment

Electron energy and electron trajectories in an inverse free-electron laser accelerator based on a novel electrostatic wiggler

Science.gov (United States)

Nikrah, M.; Jafari, S.

2016-06-01

We expand here a theory of a high-gradient laser-excited electron accelerator based on an inverse free-electron laser (inverse-FEL), but with innovations in the structure and design. The electrostatic wiggler used in our scheme, namely termed the Paul wiggler, is generated by segmented cylindrical electrodes with applied oscillatory voltages {{V}\\text{osc}}(t) over {{90}\\circ} segments. The inverse-FEL interaction can be described by the equations that govern the electron motion in the combined fields of both the laser pulse and Paul wiggler field. A numerical study of electron energy and electron trajectories has been made using the fourth-order Runge-Kutta method. The results indicate that the electron attains a considerable energy at short distances in this device. It is found that if the electron has got sufficient suitable wiggler amplitude intensities, it can not only gain higher energy in longer distances, but also can retain it even after the passing of the laser pulse. In addition, the results reveal that the electron energy gains different peaks for different initial axial velocities, so that a suitable small initial axial velocity of e-beam produces substantially high energy gain. With regard to the transverse confinement of the electron beam in a Paul wiggler, there is no applied axial guide magnetic field in this device.

Application of far-infrared spectroscopy to the structural identification of protein materials.

Science.gov (United States)

Han, Yanchen; Ling, Shengjie; Qi, Zeming; Shao, Zhengzhong; Chen, Xin

2018-05-03

Although far-infrared (IR) spectroscopy has been shown to be a powerful tool to determine peptide structure and to detect structural transitions in peptides, it has been overlooked in the characterization of proteins. Herein, we used far-IR spectroscopy to monitor the structure of four abundant non-bioactive proteins, namely, soybean protein isolate (SPI), pea protein isolate (PPI) and two types of silk fibroins (SFs), domestic Bombyx mori and wild Antheraea pernyi. The two globular proteins SPI and PPI result in broad and weak far-IR bands (between 50 and 700 cm-1), in agreement with those of some other bioactive globular proteins previously studied (lysozyme, myoglobin, hemoglobin, etc.) that generally only have random amino acid sequences. Interestingly, the two SFs, which are characterized by a structure composed of highly repetitive motifs, show several sharp far-IR characteristic absorption peaks. Moreover, some of these characteristic peaks (such as the peaks at 260 and 428 cm-1 in B. mori, and the peaks at 245 and 448 cm-1 in A. pernyi) are sensitive to conformational changes; hence, they can be directly used to monitor conformational transitions in SFs. Furthermore, since SF absorption bands clearly differ from those of globular proteins and different SFs even show distinct adsorption bands, far-IR spectroscopy can be applied to distinguish and determine the specific SF component within protein blends.

Third harmonic generation of high power far infrared radiation in semiconductors

Energy Technology Data Exchange (ETDEWEB)

Urban, M [Ecole Polytechnique Federale, Lausanne (Switzerland). Centre de Recherche en Physique des Plasma (CRPP)

1996-04-01

We investigated the third harmonic generation of high power infrared radiation in doped semiconductors with emphasis on the conversion efficiency. The third harmonic generation effect is based on the nonlinear response of the conduction band electrons in the semiconductor with respect to the electric field of the incident electromagnetic wave. Because this work is directed towards a proposed application in fusion plasma diagnostics, the experimental requirements for the radiation source at the fundamental frequency are roughly given as follows: a wavelength of the radiation at the fundamental frequency in the order of 1 mm and an incident power greater than 1 MW. The most important experiments of this work were performed using the high power far infrared laser of the CRPP. With this laser a new laser line was discovered, which fits exactly the source specifications given above: the wavelength is 676 {mu}m and the maximum power is up to 2 MW. Additional experiments were carried out using a 496 {mu}m laser and a 140 GHz (2.1 mm) gyrotron. The main experimental progress with respect to previous work in this field is, in addition to the use of a very high power laser, the possibility of an absolute calibration of the detectors for the far infrared radiation and the availability of a new type of detector with a very fast response. This detector made it possible to measure the power at the fundamental as well as the third harmonic frequency with full temporal resolution of the fluctuations during the laser pulse. Therefore the power dependence of the third harmonic generation efficiency could be measured directly. The materials investigated were InSb as an example of a narrow gap semiconductor and Si as standard material. The main results are: narrow gap semiconductors indeed have a highly nonlinear electronic response, but the narrow band gap leads at the same time to a low power threshold for internal breakdown, which is due to impact ionization. figs., tabs., refs.

Third harmonic generation of high power far infrared radiation in semiconductors

International Nuclear Information System (INIS)

Urban, M.

1996-04-01

In this work we investigated the third harmonic generation of high power infrared radiation in doped semiconductors with emphasis on the conversion efficiency. The third harmonic generation effect is based on the nonlinear response of the conduction band electrons in the semiconductor with respect to the electric field of the incident electromagnetic wave. Because this work is directed towards a proposed application in fusion plasma diagnostics, the experimental requirements for the radiation source at the fundamental frequency are roughly given as follows: a wavelength of the radiation at the fundamental frequency in the order of 1 mm and an incident power greater than 1 MW. The most important experiments of this work were performed using the high power far infrared laser of the CRPP. With this laser a new laser line was discovered, which fits exactly the source specifications given above: the wavelength is 676 μm and the maximum power is up to 2 MW. Additional experiments were carried out using a 496 μm laser and a 140 GHz (2.1 mm) gyrotron. The main experimental progress with respect to previous work in this field is, in addition to the use of a very high power laser, the possibility of an absolute calibration of the detectors for the far infrared radiation and the availability of a new type of detector with a very fast response. This detector made it possible to measure the power at the fundamental as well as the third harmonic frequency with full temporal resolution of the fluctuations during the laser pulse. Therefore the power dependence of the third harmonic generation efficiency could be measured directly. The materials investigated were InSb as an example of a narrow gap semiconductor and Si as standard material. The main results are: narrow gap semiconductors indeed have a highly nonlinear electronic response, but the narrow band gap leads at the same time to a low power threshold for internal breakdown, which is due to impact ionization. (author) figs

Far infrared study of molecular reorientations in some alkoxyazoxybenzenes

International Nuclear Information System (INIS)

Godlewska, M.; Kocot, A.

1986-05-01

Far infrared spectra in the frequency range 20 - 200 cm -1 for di-n-alkoxyazoxybenzene homologous series are presented for the isotropic and nematic phases and for 0.1 M solution in benzene. Additionally some partly deuterated samples were measured. The spectra generally consist of two broad bands. By comparison of the spectra for differently deuterated compounds it was possible to interpret the higher frequency band as being connected with the intermolecular torsional vibration of the groups. We connect the band at lower frequencies with the Poley absorption of librating molecules. The confined rotator model calculations performed for this band for all compounds studied give the rotational correlation time which happens to be in good agreement with the correlation times as derived from the quasielastic neutron scattering experiments. 12 refs., 7 figs., 3 tabs. (author)

Vibration mitigation in J-TEXT far-infrared diagnostic systems

International Nuclear Information System (INIS)

Li, Q.; Chen, J.; Zhuang, G.; Wang, Z. J.; Gao, L.; Chen, W.

2012-01-01

Optical structure stability is an important issue for far-infrared (FIR) phase measurements. To ensure good signal quality, influence of vibration should be minimized. Mechanical amelioration and optical optimization can be taken in turn to decrease vibration's influence and ensure acceptable measurement. J-TEXT (Joint Texal Experiment Tokamak, formerly TEXT-U) has two FIR diagnostic systems: a HCN interferometer system for electron density measurement and a three-wave polarimeter-interferometer system (POLARIS) for electron density and Faraday effect measurements. All use phase detection techniques. HCN interferometer system has almost eliminated the influence of vibration after mechanical amelioration and optical optimization. POLARIS also obtained first experimental results after mechanical stability improvements and is expected to further reduce vibration's influence on Faraday angle to 0.1° after optical optimization.

Far-Infrared Spectroscopy of Weakly Bound Hydrated Cluster Molecules

DEFF Research Database (Denmark)

Andersen, Jonas

The thermodynamic properties of condensed phases, the functionality of many materials and the molecular organization in biological organisms are all governed by the classes of non-covalent interactions that occur already on the microscopic scale between pairs of molecules. A detailed investigation...... of the intermolecular interactions between prototypical molecular assemblies are valuable for accurate descriptions of larger supramolecular systems such as materials, gas hydrates and biological macromolecules. The aim of this PhD dissertation is to investigate intermolecular interactions fora series of medium...... vibrational bands of the cluster molecules in the challenging far-infrared and terahertz spectral regions.A key parameter in the validation of the performance of theoretical predictions for weak non-covalent intermolecular interactions is the dissociation energy D0 that depends heavily on the class of large...

An Influence of 7.5 T Superconducting Wiggler on Beam Parameters of Siberia-2 Storage Ring

International Nuclear Information System (INIS)

Korchuganov, Vladimir; Valentinov, Alexander; Mezentsev, Nikolai

2007-01-01

At present the dedicated synchrotron radiation source Siberia-2 in Kurchatov Institute operates with electron energy 2.5 GeV and current up to 200 mA. In order to expand spectral range of SR and to increase brightness an installation of 7.5 T 19-pole superconducting wiggler is planned at the end of 2006. Now the wiggler is under fabrication in BINP, Novosibirsk. Such high level of a magnetic field in the wiggler will have a great influence on electron beam parameters of Siberia-2. Changes of these parameters (betatron tunes, horizontal emittance of the electron beam, momentum compaction, energy spread etc.) are discussed in the report. Different methods of compensation (global and local) of betatron functions distortion are presented. Much attention is paid to dynamic aperture calculations using analytical approximation of magnetic field behavior in transverse horizontal direction

Wide-field Spatio-Spectral Interferometry: Bringing High Resolution to the Far- Infrared

Science.gov (United States)

Leisawitx, David

Wide-field spatio-spectral interferometry combines spatial and spectral interferometric data to provide integral field spectroscopic information over a wide field of view. This technology breaks through a mission cost barrier that stands in the way of resolving spatially and measuring spectroscopically at far-infrared wavelengths objects that will lead to a deep understanding of planetary system and galaxy formation processes. A space-based far-IR interferometer will combine Spitzer s superb sensitivity with a two order of magnitude gain in angular resolution, and with spectral resolution in the thousands. With the possible exception of detector technology, which is advancing with support from other research programs, the greatest challenge for far-IR interferometry is to demonstrate that the interferometer will actually produce the images and spectra needed to satisfy mission science requirements. With past APRA support, our team has already developed the highly specialized hardware testbed, image projector, computational model, and image construction software required for the proposed effort, and we have access to an ideal test facility.

High resolution spectroscopy of six SOCl2 isotopologues from the microwave to the far-infrared

Science.gov (United States)

Martin-Drumel, M. A.; Roucou, A.; Brown, G. G.; Thorwirth, S.; Pirali, O.; Mouret, G.; Hindle, F.; McCarthy, M. C.; Cuisset, A.

2016-02-01

Despite its potential role as an atmospheric pollutant, thionyl chloride, SOCl2, remains poorly characterized in the gas phase. In this study, the pure rotational and ro-vibrational spectra of six isotopologues of this molecule, all detected in natural abundance, have been extensively studied from the cm-wave band to the far-infrared region by means of three complementary techniques: chirped-pulse Fourier transform microwave spectroscopy, sub-millimeter-wave spectroscopy using frequency multiplier chain, and synchrotron-based far-infrared spectroscopy. Owing to the complex line pattern which results from two nuclei with non-zero spins, new, high-level quantum-chemical calculations of the hyperfine structure played a crucial role in the spectroscopic analysis. From the combined experimental and theoretical work, an accurate semi-experimental equilibrium structure (reSE) of SOCl2 has been derived. With the present data, spectroscopy-based methods can now be applied with confidence to detect and monitor this species, either by remote sensing or in situ.

Nonlinear Dynamics in Spear Wigglers

International Nuclear Information System (INIS)

2002-01-01

BL11, the most recently installed wiggler in the SPEAR storage ring at SSRL, produces a large nonlinear perturbation of the electron beam dynamics, which was not directly evident in the integrated magnetic field measurements. Measurements of tune shifts with betatron oscillation amplitude and with closed orbit shifts were used to characterize the nonlinear fields of the SPEAR insertion devices (IDs). Because of the narrow pole width in BL11, the nonlinear fields seen along the wiggling electron trajectory are dramatically different than the flip coil measurements made along a straight line. This difference explains the tune shift measurements and the observed degradation in dynamic aperture. Corrector magnets to cancel the BL11 nonlinear fields are presently under construction

Effect of nano-sized cerium-zirconium oxide solid solution on far-infrared emission properties of tourmaline powders

Science.gov (United States)

Guo, Bin; Yang, Liqing; Hu, Weijie; Li, Wenlong; Wang, Haojing

2015-10-01

Far-infrared functional nanocomposites were prepared by the co-precipitation method using natural tourmaline (XY3Z6Si6O18(BO3)3V3W, where X is Na+, Ca2+, K+, or vacancy; Y is Mg2+, Fe2+, Mn2+, Al3+, Fe3+, Mn3+, Cr3+, Li+, or Ti4+; Z is Al3+, Mg2+, Cr3+, or V3+; V is O2-, OH-; and W is O2-, OH-, or F-) powders, ammonium cerium(IV) nitrate and zirconium(IV) nitrate pentahydrate as raw materials. The reference sample, tourmaline modified with ammonium cerium(IV) nitrate alone was also prepared by a similar precipitation route. The results of Fourier transform infrared spectroscopy show that tourmaline modified with Ce and Zr has a better far-infrared emission property than tourmaline modified with Ce alone. Through characterization by transmission electron microscopy (TEM), X-ray diffraction (XRD), and X-ray photoelectron spectroscopy (XPS), the mechanism for oxygen evolution during the heat process in the two composite materials was systematically studied. The XPS spectra show that Fe3+ ratio inside tourmaline modified with Ce alone can be raised by doping Zr. Moreover, it is showed that there is a higher Ce3+ ratio inside the tourmaline modified with Ce and Zr than tourmaline modified with Ce alone. In addition, XRD results indicate the formation of CeO2 and Ce1-xZrxO2 crystallites during the heat treatment and further TEM observations show they exist as nanoparticles on the surface of tourmaline powders. Based on these results, we attribute the improved far-infrared emission properties of Ce-Zr doped tourmaline to the enhanced unit cell shrinkage of the tourmaline arisen from much more oxidation of Fe2+ to Fe3+ inside the tourmaline caused by the change in the catalyst redox properties of CeO2 brought about by doping with Zr4+. In all samples, tourmaline modified with 7.14 wt.% Ce and 1.86 wt.% Zr calcined at 800∘C for 5 h has the best far-infrared emission property with the maximum emissivity value of 98%.

Measured and Modeled Downwelling Far-Infrared Radiances in Very Dry Environments and Calibration Requirements for Future Experiments

Science.gov (United States)

Mast, J. C.; Mlynczak, M. G.; Cageao, R.; Kratz, D. P.; Latvakoski, H.; Johnson, D. G.; Mlawer, E. J.; Turner, D. D.

2016-12-01

Downwelling radiances measured by the Far-Infrared Spectroscopy of the Troposphere (FIRST) instrument in an environment with integrated precipitable water as low as 0.03 cm are compared with calculated spectra in the far-infrared and mid-infrared. In its current ground-based configuration FIRST was deployed to 5.38 km on Cerro Toco, a mountain in the Atacama Desert of Chile, from August to October 2009. There FIRST took part in the Radiative Heating in Unexplored Bands Campaign Part 2. Water vapor and temperature profiles from an optimal-estimation-based physical retrieval algorithm (using simultaneous radiosonde and multichannel 183 GHz microwave radiometer measurements) are input to the AER Line-by-Line Radiative Transfer Model (LBLRTM) to compute radiances for comparison with FIRST. The AER v3.4 line parameter database is used. The low water vapor amounts and relatively cold atmosphere result in extremely small far-IR radiances (1.5 mW/m2/sr/cm-1) with corresponding brightness temperatures of 120 K. The residual LBLRTM minus FIRST is calculated to assess agreement between the measured and modeled spectra. Uncertainties in both the measured and modeled radiances are accounted for in the comparison. A goal of the deployment and subsequent analysis is the assessment of water vapor spectroscopy in the far-infrared and mid-infrared. While agreement is found between measured and modeled radiances within the combined uncertainties across all spectra, uncertainties in the measured water vapor profiles and from the laboratory calibration exceed those associated with water vapor spectroscopy in this very low radiance environment. Consequently, no improvement in water vapor spectroscopy is afforded by these measurements. However, we use these results to place requirements on instrument calibration accuracy and water vapor profile accuracy for future campaigns to similarly dry environments. Instrument calibration uncertainty needs to be at 2% (1-sigma) of measured radiance

A hybrid type undulator for far-infrared FELs at FELI

Energy Technology Data Exchange (ETDEWEB)

Zako, A.; Miyauchi, Y.; Koga, A. [Free Electron Laser Research Institute, Inc., Osaka (Japan)] [and others

1995-12-31

Two FEL facilities of the FELI are now operating in the wavelength range of 1-20 {mu}m. A 3.2-m hybrid type undulator ({lambda}{sub u}=80mm, N=40) has been designed for far-infrared FELs and will be installed in December. It can cover the wavelength of 20-60 {mu}m by changing K-value from 1 to 2.7 for a 28.0-MeV electron beam. It is composed of ferrite magnetic poles and Sm-Co permanent magnets. Commonly wound coils induce alternating magnetic field in ferrite poles. Combination of the induced field and the permanent magnet field can controls the magnetic field between the undulator gap.

Far-infrared /FIR/ optical black bidirectional reflectance distribution function /BRDF/

Science.gov (United States)

Smith, S. M.

1981-01-01

A nonspecular reflectometer and its operation at far-infrared wavelengths are described. Large differences in nonspecular reflectance were found to exist between different optically black coatings. Normal incidence bidirectional reflectance distribution function /BRDF) measurements at wavelengths between 12 and 316 microns of three black coatings show that their mean BRDFs increase with wavelength. The specularity of two of these coatings also showed a strong wavelength dependence, while the specularity of one coating seemed independent of wavelength. The BRDF of one coating depended on the angle of incidence at 12 and 38 microns, but not at 316 microns. Beyond 200 microns, it was found necessary to correct the measurements for the beam spread of the instrument.

The Beam Line X NdFe-steel hybrid wiggler for SSRL

International Nuclear Information System (INIS)

Hoyer, E.; Halbach, K.; Humphries, D.; Marks, S.; Plate, D.; Shuman, D.; Karpenko, V.P.; Kulkarni, S.; Tirsell, K.G.

1987-01-01

A wiggler magnet with 15 periods, each 12.85 cm long, which achieves 1.40 T at a 2.1 cm gap (2.26T at 0.8 cm) has been designed and is now in fabrication at LBL. This wiggler will be the radiation source of the high intensity synchrotron radiation beam line for the Beam Line X PRT facility at SSRL. The magnet utilizes Neodymium-Iron (NdFe) material and Vanadium Permendur (steel) in the hybrid configuration to achieve simultaneously a high magnetic field and short period. Magnetic field adjustment is with a driven chain and ball screw drive system. The magnetic structure is external to an s.s. vacuum chamber which has thin walls, 0.76 mm thickness, at each pole tip for higher field operation. Magnetic design, construction details and magnetic measurements are presented

Experimental test of far-infrared polarimetry for Faraday rotation measurements on the TFR 600 Tokamak

Energy Technology Data Exchange (ETDEWEB)

Soltwisch, H [Kernforschungsanlage Juelich G.m.b.H. (Germany, F.R.). Inst. fuer Plasmaphysik; Association Euratom-Kernforschungsanlage Juelich G.m.b.H. (Germany, F.R.)); Equipe, T F.R. [Association Euratom-CEA sur la Fusion, Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (France). Dept. de Recherches sur la Fusion Controlee

1981-09-01

The results are reported on the feasibility of using far-infrared polarimetry for Faraday rotation diagnostic measurements on the TRF Tokamak. Precise quantitative results were not obtained but a satisfactory agreement with a simple theoretical model leads to a good understanding of the experimental limitations of the method.

Pulse propagation in tapered wiggler free electron lasers

International Nuclear Information System (INIS)

Goldstein, J.C.; Colson, W.B.

1981-01-01

The one-dimensional theory of short pulse propagation in free electron lasers is extended to tapered wiggler devices and is used to study the behavior of an oscillator with parameter values close to those expected in forthcoming experiments. It is found that stable laser output is possible only over a small range of optical cavity lengths. Optical pulse characteristcs are presented and are found to change considerably over this range

Multimode simulations of a wide field of view double-Fourier far-infrared spatio-spectral interferometer

Science.gov (United States)

Bracken, Colm P.; Lightfoot, John; O'Sullivan, Creidhe; Murphy, J. Anthony; Donohoe, Anthony; Savini, Giorgio; Juanola-Parramon, Roser; The Fisica Consortium, On Behalf Of

2018-01-01

In the absence of 50-m class space-based observatories, subarcsecond astronomy spanning the full far-infrared wavelength range will require space-based long-baseline interferometry. The long baselines of up to tens of meters are necessary to achieve subarcsecond resolution demanded by science goals. Also, practical observing times command a field of view toward an arcminute (1‧) or so, not achievable with a single on-axis coherent detector. This paper is concerned with an application of an end-to-end instrument simulator PyFIInS, developed as part of the FISICA project under funding from the European Commission's seventh Framework Programme for Research and Technological Development (FP7). Predicted results of wide field of view spatio-spectral interferometry through simulations of a long-baseline, double-Fourier, far-infrared interferometer concept are presented and analyzed. It is shown how such an interferometer, illuminated by a multimode detector can recover a large field of view at subarcsecond angular resolution, resulting in similar image quality as that achieved by illuminating the system with an array of coherent detectors. Through careful analysis, the importance of accounting for the correct number of higher-order optical modes is demonstrated, as well as accounting for both orthogonal polarizations. Given that it is very difficult to manufacture waveguide and feed structures at sub-mm wavelengths, the larger multimode design is recommended over the array of smaller single mode detectors. A brief note is provided in the conclusion of this paper addressing a more elegant solution to modeling far-infrared interferometers, which holds promise for improving the computational efficiency of the simulations presented here.

Competition of electron-cyclotron maser and free-electron laser modes with combined solenoidal and longitudinal wiggler fields

International Nuclear Information System (INIS)

Lin, A.T.; Lin, C.

1986-01-01

A relativistic electron beam with a finite transverse dc momentum (β/sub perpendicular/ = 1/γ 0 ) passing through a region of combined uniform solenoidal and longitudinal wiggler magnetic fields is observed to convert 25% of its kinetic energy into coherent radiation at frequency ω = γ 2 0 (k/sub w/V 0 +Ω/sub c//γ 0 ) if the phase velocity of the generated wave is slightly above the speed of light. In this situation, the bunchings of the slow electron-cyclotron mode and free-electron laser modes with combined solenoidal and longitudinal wiggler fields (lowbitron) are observed to compensate each other, which gives rise to a finite threshold for lowbitron operation. In order to attain high efficiency, the wiggler strength of a lowbitron must substantially exceed the threshold

THE ORIGIN OF THE INFRARED EMISSION IN RADIO GALAXIES. II. ANALYSIS OF MID- TO FAR-INFRARED SPITZER OBSERVATIONS OF THE 2JY SAMPLE

NARCIS (Netherlands)

Dicken, D.; Tadhunter, C.; Axon, D.; Morganti, R.; Inskip, K. J.; Holt, J.; Delgado, R. Gonzalez; Groves, B.

2009-01-01

We present an analysis of deep mid- to far-infrared (MFIR) Spitzer photometric observations of the southern 2Jy sample of powerful radio sources (0.05

MID- AND FAR-INFRARED PROPERTIES OF A COMPLETE SAMPLE OF LOCAL ACTIVE GALACTIC NUCLEI

International Nuclear Information System (INIS)

Ichikawa, Kohei; Ueda, Yoshihiro; Terashima, Yuichi; Oyabu, Shinki; Gandhi, Poshak; Nakagawa, Takao; Matsuta, Keiko

2012-01-01

We investigate the mid- (MIR) to far-infrared (FIR) properties of a nearly complete sample of local active galactic nuclei (AGNs) detected in the Swift/Burst Alert Telescope (BAT) all-sky hard X-ray (14-195 keV) survey, based on the cross correlation with the AKARI infrared survey catalogs complemented by those with Infrared Astronomical Satellite and Wide-field Infrared Survey Explorer. Out of 135 non-blazer AGNs in the Swift/BAT nine-month catalog, we obtain the MIR photometric data for 128 sources either in the 9, 12, 18, 22, and/or 25 μm band. We find good correlation between their hard X-ray and MIR luminosities over three orders of magnitude (42 λ (9, 18 μm) < 45), which is tighter than that with the FIR luminosities at 90 μm. This suggests that thermal emission from hot dusts irradiated by the AGN emission dominate the MIR fluxes. Both X-ray unabsorbed and absorbed AGNs follow the same correlation, implying isotropic infrared emission, as expected in clumpy dust tori rather than homogeneous ones. We find excess signals around 9 μm in the averaged infrared spectral energy distribution from heavy obscured 'new type' AGNs with small scattering fractions in the X-ray spectra. This could be attributed to the polycyclic aromatic hydrocarbon emission feature, suggesting that their host galaxies have strong starburst activities.

Direction of Wolf-Rayet stars in a very powerful far-infrared galaxy - Direct evidence for a starburst

International Nuclear Information System (INIS)

Armus, L.; Heckman, T.M.; Miley, G.K.

1988-01-01

Spectra covering the wavelength range 4476-7610 A are presented for the powerful far-infrared galaxy IRAS 01003-2238. The broad emission band centered at a rest wavelength of roughly 4660 A, and other broad weaker features are interpreted, as arising from the combined effect of approximately 100,000 late Wolf-Rayet stars of the WN subtype. This represents perhaps the most direct evidence to date for the presence of a large number of hot massive stars in the nucleus of a very powerful far-infrared galaxy. The high number of Wolf-Rayet stars in relation to the number of O-type stars may be interpreted as arguing against continuous steady state star formation in 01003-2238, in favor of a recent burst of star formation occurring approximately 100 million yrs ago. 24 references

Enhanced THz radiation generation by photo-mixing of tophat lasers in rippled density plasma with a planar magnetostatic wiggler and s-parameter

Science.gov (United States)

Abedi-Varaki, M.

2018-02-01

In this paper, the effects of planar magnetostatic wiggler and s-parameter on the terahertz (THz) radiation generation through rippled plasma have been investigated. Efficient THz radiation generation by photo-mixing of tophat lasers for rippled density plasma in the presence of the wiggler field has been presented. Fundamental equations for the analysis of the non-linear current density and THz radiation generation by wiggler magnetostatic field have been derived. It is shown that for the higher order of the tophat lasers, the values of THz amplitude are greater. In fact, the higher order of the tophat lasers has a sharp gradient in the intensity of lasers, which leads to a stronger nonlinear ponderomotive force and, consequently, a stronger current density. In addition, it is seen that by increasing s-parameter, the normalized transverse profile becomes more focused near the axis of y. Furthermore, it is observed that the normalized laser efficiency has a decreasing trend with increasing normalized THz frequency for different values of the wiggler field. Also, it is shown that by employing a greater order of the tophat lasers and a stronger wiggler field, the efficiency of order of 30% can be achieved. Moreover, it is found that we can control focus and intensity of THz radiation emitted in rippled plasma by choosing the appropriate order of the tophat lasers and tuning of the wiggler field.

Theoretical considerations and preparatory experiments for poloidal field measurements in tokamaks by far-infrared polarimetry

Energy Technology Data Exchange (ETDEWEB)

Kunz, W; Dodel, G [Stuttgart Univ. (TH) (Germany, F.R.). Inst. fuer Plasmaforschung

1978-12-01

Numerical calculations give an optimum wavelength and show the precision requirements for determining poloidal field profiles in tokamaks on the basis of the Faraday effect. The required precision of the polarimetric measurements can be achieved in the far-infrared as is verified in a model experiment using a ferrite modulated HCN laser beam.

Tunable Far Infrared Laser Spectroscopy of Van Der Waals Bonds: Argon-Ammonia

Science.gov (United States)

Gwo, Dz-Hung

Hyperfine resolved vibration-rotation-tunneling spectra of Ar-NH_3 and (NH _3)_2, generated in a planar supersonic jet, have been measured with the Berkeley tunable far infrared laser spectrometer. Among the seven rotationally assigned bands, one band belongs to Ar-NH_3, and the other six belong to (NH_3)_2 . To facilitate the intermolecular vibrational assignment for Ar-NH_3, a dynamics study aided by a permutation-inversion group theoretical treatment is performed on the rovibrational levels. The rovibrational quantum number correlation between the free internal rotor limit and the semi-rigid limit is established to provide a basic physical picture of the evolution of intermolecular vibrational component states (K_{a } manifolds). An anomalous vibronically (not just rovibronically) allowed unique Q branch vibrational band structure is predicted to exist for a near prolate binary complex containing an inverting subunit. According to the model developed in this work, the observed band of Ar-NH_3 centered at 26.470633(17) cm^{-1} can correlate only to either (1) the fundamental dimeric stretching band for the A_2 states with the NH_3 inversional quantum number v_{i} = 1, or (2) the K_{a} = 0 >=ts 0 subband of the lowest internal-rotation -inversion difference band. Although the estimated nuclear quadrupole coupling constant favors a tentative assignment in terms of the first possibility, a definitive assignment will require more far infrared data and a dynamical model incorporating a potential surface.

Magnetic measurements of the 10 T superconducting wiggler for the SPring-8 storage ring

CERN Document Server

Batrakov, A; Bekhtenev, E A; Fedurin, M; Hara, M; Karpov, G; Kuzin, M; Mezentsev, N A; Miahara, Y; Shimada, T; Shkaruba, V A; Soutome, K; Tzumaki, K

2001-01-01

In 1999, in the frame of the project ISTC No. 767 'Budker INP/RIKEN Slow Positron Source', the Budker Institute of Nuclear Physics had made a 10 T Three-pole Superconducting Wiggler. The wiggler will be the keystone of this project by its installation on the SPring-8 storage ring for powerful gamma ray generation (lambda sub c =450 keV), that will be used for slow positron production (N subgamma(epsilon>1 MeV)approx 10 sup 1 sup 5 , gamma/s I sub e =0.1 A). A. Ando et al., Proposal of the high magnetic field super conducting WLS for slow positron source at SPring-8, presented at SR1 '97 Conference. In January, 2000, the wiggler was transported to SPring-8, where the last test and measurements were carried out in collaboration with Japan. In this article, the results of measurements of the magnetic field, finding the magnetic field amplitude by an NMR probe, the definition of feed current relations by stretch current wire method, the calibration of a Hall probe in the high magnetic field, and the measurement o...

Far-infrared spectra of polycrystalline Ba2YCu3O/sub 9-//sub δ/

International Nuclear Information System (INIS)

Thomas, G.A.; Ng, H.K.; Millis, A.J.; Bhatt, R.N.; Cava, R.J.; Rietman, E.A.; Johnson, D.W. Jr.; Espinosa, G.P.; Vandenberg, J.M.

1987-01-01

We present far-infrared reflectivity spectra of seven samples of ceramic superconductors in the Ba-Y-Cu-O system with transition temperatures near 93 K. We find superconducting gap structures on the basis of which we estimate the ratio of twice the average gap to the transition temperature to be consistent with 3.5, but possibly higher. Questions of normal-state characterization preclude a definitive analysis

Bench test results on a new technique for far-infrared polarimetry

International Nuclear Information System (INIS)

Barry, S.; Nieswand, C.; Prunty, S.L.; Mansfield, H.M.; O'Leary, P.

1996-11-01

The results of bench tests performed on a new method of combined interferometry/polarimetry for the magnetic field reconstruction of tokamak plasmas is presented. In particular, the sensitivity obtained in the polarimetric measurement shows the feasibility of Faraday rotation determination approaching a precision of ±0.2 o . The method is based on an optically pumped far-infrared (FIR) laser with a rotating polarization where both the interferometric and polarimetric information is determined from phase measurements. Specific sources which introduce disturbances in the optical arrangement and which can limit the attainment of the polarimetric precision, mentioned above, are discussed. (author) 4 figs., 6 refs

Status of Far Infrared Tangential Interferometry/Polarimetry (FIReTIP) on NSTX

International Nuclear Information System (INIS)

Park, H.K.; Edwards, S.; Guttadora, L.; Deng, B.; Domier, C.W.; Lee, K.C.; Johnson, M.; Luhmann, N.C. Jr.

2000-01-01

The Influence of paramagnetism and diamagnetism will significantly alter the vacuum toroidal magnetic field in the spherical torus. Therefore, plasma parameters dependent upon BT such as the q-profile and the local b value need an independent measurement of BT(r,t). The multi-chord Tangential Far Infrared Interferometer/Polarimeter (FIReTIP) system [1] currently under development for the National Spherical Torus Experiment (NSTX) will provide temporally and radially resolved toroidal field profile [BT(r,t)] and 2-D electron density profile [ne(r,t)] data. A two-channel interferometer will be operational this year and the full system will be ready by 2002

Far-infrared tangential interferometer/polarimeter design and installation for NSTX-U

Energy Technology Data Exchange (ETDEWEB)

Scott, E. R., E-mail: evrscott@ucdavis.edu [Department of Mechanical and Aerospace Engineering, University of California, Davis, California 95616 (United States); Barchfeld, R. [Department of Applied Science, University of California, Davis, California 95616 (United States); Riemenschneider, P.; Domier, C. W.; Sohrabi, M.; Luhmann, N. C. [Department of Electrical and Computer Engineering, University of California, Davis, California 95616 (United States); Muscatello, C. M. [General Atomics, San Diego, California 92121 (United States); Kaita, R.; Ren, Y. [Princeton Plasma Physics Laboratory, Princeton, New Jersey 08540 (United States)

2016-11-15

The Far-infrared Tangential Interferometer/Polarimeter (FIReTIP) system has been refurbished and is being reinstalled on the National Spherical Torus Experiment—Upgrade (NSTX-U) to supply real-time line-integrated core electron density measurements for use in the NSTX-U plasma control system (PCS) to facilitate real-time density feedback control of the NSTX-U plasma. Inclusion of a visible light heterodyne interferometer in the FIReTIP system allows for real-time vibration compensation due to movement of an internally mounted retroreflector and the FIReTIP front-end optics. Real-time signal correction is achieved through use of a National Instruments CompactRIO field-programmable gate array.

Inhibitory Effects of Far-Infrared Ray-Emitting Belts on Primary Dysmenorrhea

Directory of Open Access Journals (Sweden)

Ben-Yi Liau

2012-01-01

Full Text Available This study investigated the therapeutic effect of the far-infrared ray-emitting belt (FIRB in the management of primary dysmenorrhea in female patients. Forty adolescent females with primary dysmenorrhea were enrolled in the study. Quantitative measurements were taken during the menstruation. Several parameters were measured and compared, including temperature, abdominal blood flow, heart rate variability, and pain assessment. Statistical analysis shows that treatment with FIRB had significant efficiency in increasing regional surface temperature and abdominal blood flow, widening standard deviation of normal-to-normal RR intervals, and reducing VRS and NRS pain scores. The application of an FIRB appears to alleviate dysmenorrhea.

A Stark-tuned, far-infrared laser for high frequency plasma diagnostics

International Nuclear Information System (INIS)

Mansfield, D.K.; Vocaturo, M.; Guttadora, L.; Rockmore, M.; Micai, K.; Krug, P.A.

1992-03-01

A Stark-tuned optically pumped far-infrared methanol laser operating at 119 micrometers has been built. The laser is designed to operate at high power while exhibiting a well-separated Stark doublet. At a pump power of 65 Watts and electric field of 1 kV/cm the laser has delivered over 100 mW c.w. while exhibiting a frequency splitting of 34 MHz. These parameters indicate that this laser would be suitable for use in the present generation of modulated interferometers on large thermonuclear plasma devices. The achieved modulation frequency is more than an order of magnitude higher than could be achieved using standard techniques

Energy levels and far-infrared optical absorption of impurity doped semiconductor nanorings: Intense laser and electric fields effects

Energy Technology Data Exchange (ETDEWEB)

Barseghyan, M.G., E-mail: mbarsegh@ysu.am

2016-11-10

Highlights: • The electron-impurity interaction on energy levels in nanoring have been investigated. • The electron-impurity interaction on far-infrared absorption have been investigated. • The energy levels are more stable for higher values of electric field. - Abstract: The effects of electron-impurity interaction on energy levels and far-infrared absorption in semiconductor nanoring under the action of intense laser and lateral electric fields have been investigated. Numerical calculations are performed using exact diagonalization technique. It is found that the electron-impurity interaction and external fields change the energy spectrum dramatically, and also have significant influence on the absorption spectrum. Strong dependence on laser field intensity and electric field of lowest energy levels, also supported by the Coulomb interaction with impurity, is clearly revealed.

Early results from the Far Infrared Absolute Spectrophotometer (FIRAS)

Science.gov (United States)

Mather, J. C.; Cheng, E. S.; Shafer, R. A.; Eplee, R. E.; Isaacman, R. B.; Fixsen, D. J.; Read, S. M.; Meyer, S. S.; Weiss, R.; Wright, E. L.

1991-01-01

The Far Infrared Absolute Spectrophotometer (FIRAS) on the Cosmic Background Explorer (COBE) mapped 98 percent of the sky, 60 percent of it twice, before the liquid helium coolant was exhausted. The FIRAS covers the frequency region from 1 to 100/cm with a 7 deg angular resolution. The spectral resolution is 0.2/cm for frequencies less than 20/cm and 0.8/cm for higher frequencies. Preliminary results include: a limit on the deviations from a Planck curve of 1 percent of the peak brightness from 1 to 20/cm, a temperature of 2.735 +/- 0.06 K, a limit on the Comptonization parameter y of 0.001, on the chemical potential parameter mu of 0.01, a strong limit on the existence of a hot smooth intergalactic medium, and a confirmation that the dipole anisotropy spectrum is that of a Doppler shifted blackbody.

Mode structure in an optically pumped D2O far infrared ring laser

International Nuclear Information System (INIS)

Yuan, D.C.; Soumagne, G.; Siegrist, M.R.

1989-07-01

The mode structures in an optically pumped D 2 O far infrared ring laser and a corresponding linear resonator have been compared. While single mode operation can be obtained over the whole useful pressure range in the ring structure, this is only possible at pressures greater than 8 Torr in the linear resonator case. A numerical model predicts quite well the pulse shape, pressure dependence and influence of the resonator quality in the ring cavity. (author) 12 figs., 8 refs

Development and application of a far infrared laser

International Nuclear Information System (INIS)

Nakayama, Kazuya; Okajima, Shigeki; Kawahata, Kazuo

2011-01-01

There has been a 40 years history on the application of an infrared laser to interference, polarization and scattering light sources in fusion plasma diagnostics. It is one of important light sources in ITER plasma diagnostics too. In the present review, authors recall the history of the infrared laser development especially of cw infrared lasers. In addition, the state-of-the-art technology for infrared lasers, infrared components and its applications to plasma diagnostics are discussed. (J.P.N.)

Lattice design for a high-power infrared FEL

International Nuclear Information System (INIS)

Douglas, D.R.

1997-01-01

A 1 kW infrared FEL, funded by the U.S. Navy, is being built at Jefferson Lab. It will be driven by a compact energy-recovering CW superconducting radio-frequency (SRF)-based linear accelerator. Stringent phase space requirements at the wiggler, low beam energy, and high beam current subject the design to numerous constraints. This report addresses these issues and presents a design solution for an accelerator transport lattice meeting the requirements imposed by physical phenomena and operational necessities

ATR and transmission analysis of pigments by means of far infrared spectroscopy.

Science.gov (United States)

Kendix, Elsebeth L; Prati, Silvia; Joseph, Edith; Sciutto, Giorgia; Mazzeo, Rocco

2009-06-01

In the field of FTIR spectroscopy, the far infrared (FIR) spectral region has been so far less investigated than the mid-infrared (MIR), even though it presents great advantages in the characterization of those inorganic compounds, which are inactive in the MIR, such as some art pigments, corrosion products, etc. Furthermore, FIR spectroscopy is complementary to Raman spectroscopy if the fluorescence effects caused by the latter analytical technique are considered. In this paper, ATR in the FIR region is proposed as an alternative method to transmission for the analyses of pigments. This methodology was selected in order to reduce the sample amount needed for analysis, which is a must when examining cultural heritage materials. A selection of pigments have been analyzed in both ATR and transmission mode, and the resulting spectra were compared with each other. To better perform this comparison, an evaluation of the possible effect induced by the thermal treatment needed for the preparation of the polyethylene pellets on the transmission spectra of the samples has been carried out. Therefore, pigments have been analyzed in ATR mode before and after heating them at the same temperature employed for the polyethylene pellet preparation. The results showed that while the heating treatment causes only small changes in the intensity of some bands, the ATR spectra were characterized by differences in both intensity and band shifts towards lower frequencies if compared with those recorded in transmission mode. All pigments' transmission and ATR spectra are presented and discussed, and the ATR method was validated on a real case study.

Water Vapor in Titan's Stratosphere from Cassini CIRS Far-Infrared Spectra

Science.gov (United States)

Cottini, V.; Nixon, C. A.; Jennings, D. E.; Anderson, C. M.; Gorius, N.; Bjoraker, G. L.; Coustenis, A.; Teanby, N. A.; Achterberg, R. K.; Bezard, B.;

The Far-Infrared Properties of the Most Isolated Galaxies

Science.gov (United States)

Lisenfeld, U.; Verdes-Montenegro, L.; Sulentic, J.; Leon, S.; Espada, D.; Bergond, G.; García, E.; Sabater, J.; Santander-Vela, J. D.; Verley, S.

2007-05-01

A long-standing question in galaxy evolution involves the role of nature (self-regulation) vs. nurture (environment) on the observed properties (and evolution) of galaxies. A collaboration centreed at the Instituto de Astrofisica de Andalucia (Granada, Spain) is trying to address this question by producing a observational database for a sample of 1050 isolated galaxies from the catalogue of Karachentseva (1973) with the overarching goal being the generation of a "zero-point" sample against which effects of environment on galaxies can be assessed. The AMIGA (Analysis of the Interstellar Medium of Isolated Galaxies) database (see www.iaa.es/AMIGA.html) will include optical, IR and radio line and continuum measures. The galaxies in the sample represent the most isolated galaxies in the local universe. In the present contribution, we will present the project, as well as the results of an analysis of the far-infrared (FIR) and molecular gas properties of this sample.

Exploring the Dynamics of Superconductors by Time-Resolved Far-Infrared Spectroscopy

International Nuclear Information System (INIS)

Carr, G. L.; Lobo, R. P. S. M.; LaVeigne, J.; Reitze, D. H.; Tanner, D. B.

2000-01-01

We have examined the recombination of excess quasiparticles in superconducting Pb by time-resolved far-infrared spectroscopy using a pulsed synchrotron source. The energy gap shift calculated by Owen and Scalapino [Phys. Rev. Lett. 28, 1559 (1972)] is directly observed, as is the associated reduction in the Cooper pair density. The relaxation process involves a two-component decay; the faster (∼200 ps) is associated with the actual (effective) recombination process, while the slower (∼10 to 100ns) is due to heat transport across the film/substrate interface. The temperature dependence of the recombination process between 0.5T c and 0.85T c is in good agreement with theory

The polarization of the far-infrared radiation from the Galactic center

Science.gov (United States)

Werner, M. W.; Davidson, J. A.; Morris, M.; Novak, G.; Platt, S. R.

1988-01-01

The first detection of linear polarization of the far-infrared (100-micron) radiation from the about 3-pc-diameter dust ring surrounding the galactic nucleus is reported. The percentage of polarization is between 1 and 2 percent at the three measured positions. It is argued that the polarized radiation is produced by thermal emission from elongated interstellar grains oriented by the local magnetic field. The dust ring is optically thin at 100 microns; therefore the observations sample dust through the entire depth of the cloud and are free of confusing effects due to embedded sources, scattering, or selective absorption. These data provide the first information about the configuration of the magnetic field in the dust ring.

A kilo-pixel imaging system for future space based far-infrared observatories using microwave kinetic inductance detectors

NARCIS (Netherlands)

Baselmans, J.J.A.; Bueno, J.; Yates, Stephen J.C.; Yurduseven, O.; Llombart Juan, N.; Karatsu, K.; Baryshev, A. M.; Ferrarini, L; Endo, A.; Thoen, D.J.; de Visser, P.J.; Janssen, R.M.J.; Murugesan, V.; Driessen, E.F.C.; Coiffard, G.; Martin-Pintado, J.; Hargrave, P.; Griffin, M.

2017-01-01

Aims. Future astrophysics and cosmic microwave background space missions operating in the far-infrared to millimetre part of the spectrum will require very large arrays of ultra-sensitive detectors in combination with high multiplexing factors and efficient low-noise and low-power readout systems.

A kilo-pixel imaging system for future space based far-infrared observatories using microwave kinetic inductance detectors

NARCIS (Netherlands)

Baselmans, J. J. A.; Bueno, J.; Yates, S. J. C.; Yurduseven, O.; Llombart, N.; Karatsu, K.; Baryshev, A. M.; Ferrari, L.; Endo, A.; Thoen, D. J.; de Visser, P. J.; Janssen, R. M. J.; Murugesan, V.; Driessen, E. F. C.; Coiffard, G.; Martin-Pintado, J.; Hargrave, P.; Griffin, M.

Aims: Future astrophysics and cosmic microwave background space missions operating in the far-infrared to millimetre part of the spectrum will require very large arrays of ultra-sensitive detectors in combination with high multiplexing factors and efficient low-noise and low-power readout systems.

ISO observations of far-infrared rotational emission lines of water vapor toward the supergiant star VY Canis Majoris

OpenAIRE

Neufeld, David A.; Feuchtgruber, Helmut; Harwit, Martin; Melnick, Gary J.

1999-01-01

We report the detection of numerous far-infrared emission lines of water vapor toward the supergiant star VY Canis Majoris. A 29.5 - 45 micron grating scan of VY CMa, obtained using the Short Wavelength Spectrometer (SWS) of the Infrared Space Observatory (ISO) at a spectral resolving power of approximately 2000, reveals at least 41 spectral features due to water vapor that together radiate a total luminosity ~ 25 solar luminosities. In addition to pure rotational transitions within the groun...

SRS Behaviour with a superconducting 5-Tesla wiggler insertion

International Nuclear Information System (INIS)

Suller, V.P.; Marks, N.; Poole, M.W.; Walker, R.P.

1983-01-01

A 5 Tesla superconducting wavelength shifting wiggler magnet has been inserted into the SRS lattice. Observations have been made of the behaviour of the stored electron beam with the magnet powered. Betatron tune shifts and modulation of the betatron function have been measured and good agreement obtained with theory. Closed orbit changes have been examined and the stored beam lifetime optimised. The magnet is fully operational and is producing intense x-ray beams for users

THE ORIGIN OF THE INFRARED EMISSION IN RADIO GALAXIES. II. ANALYSIS OF MID- TO FAR-INFRARED SPITZER OBSERVATIONS OF THE 2JY SAMPLE

International Nuclear Information System (INIS)

Dicken, D.; Tadhunter, C.; Axon, D.; Morganti, R.; Inskip, K. J.; Holt, J.; Groves, B.; Delgado, R. Gonzalez

2009-01-01

We present an analysis of deep mid- to far-infrared (MFIR) Spitzer photometric observations of the southern 2Jy sample of powerful radio sources (0.05 < z < 0.7), conducting a statistical investigation of the links between radio jet, active galactic nucleus (AGN), starburst activity and MFIR properties. This is part of an ongoing extensive study of powerful radio galaxies that benefits from both complete optical emission line information and a uniquely high detection rate in the far-infrared (far-IR). We find tight correlations between the MFIR and [O III]λ5007 emission luminosities, which are significantly better than those between MFIR and extended radio luminosities, or between radio and [O III] luminosities. Since [O III] is a known indicator of intrinsic AGN power, these correlations confirm AGN illumination of the circumnuclear dust as the primary heating mechanism for the dust producing thermal MFIR emission at both 24 and 70 μm. We demonstrate that AGN heating is energetically feasible, and identify the narrow-line region clouds as the most likely location of the cool, far-IR emitting dust. Starbursts make a major contribution to the heating of the cool dust in only 15%-28% of our targets. We also investigate the orientation dependence of the continuum properties, finding that the broad- and narrow-line objects in our sample with strong emission lines have similar distributions of MFIR luminosities and colors. Therefore our results are entirely consistent with the orientation-based unified schemes for powerful radio galaxies. However, the weak line radio galaxies form a separate class of objects with intrinsically low-luminosity AGNs in which both the optical emission lines and the MFIR continuum are weak.

Tunable far infrared laser spectroscopy of van der Waals bonds: Ar-NH3

International Nuclear Information System (INIS)

Gwo, Dz-Hung; California Univ., Berkeley, CA

1989-11-01

Hyperfine resolved vibration-rotation-tunneling spectra of Ar--NH 3 and (NH 3 ) 2 , generated in a planar supersonic jet, have been measured with the Berkeley tunable far infrared laser spectrometer. Among the seven rotationally assigned bands, one band belongs to Ar--NH 3 , and the other six belong to (NH 3 ) 2 . To facilitate the intermolecular vibrational assignment for Ar--NH 3 , a dynamics study aided by a permutation-inversion group theoretical treatment is performed on the rovibrational levels. The rovibrational quantum number correlation between the free internal rotor limit and the semi-rigid limit is established to provide a basic physical picture of the evolution of intermolecular vibrational component states. An anomalous vibronically allowed unique Q branch vibrational band structure is predicted to exist for a near prolate binary complex containing an inverting subunit. According to the model developed in this work, the observed band of Ar--NH 3 centered at 26.470633(17) cm -1 can correlate only to either the fundamental dimeric stretching band for the A 2 states with the NH 3 inversional quantum number v i = 1, or the K a = 0 left-arrow 0 subband of the lowest internal-rotation-inversion difference band. Although the estimated nuclear quadrupole coupling constant favors a tentative assignment in terms of the first possibility, a definitive assignment will require far infrared data and a dynamical model incorporating a potential surface

Detection of OH from Comet Halley in the far-infrared

International Nuclear Information System (INIS)

Stacey, G.J.; Lugten, J.B.; Genzel, R.

1986-01-01

The 2 Pi 3/2 (J = 5/2 yields 3/2 + yields - parity) transition of OH was detected in comet Halley at 119.44 microns. The upper limit to the line intensity of the - yields + parity transition is 119.23 microns. The ratio of these lines is consistent with radiative pumping of the rotational levels through absorption of near ultraviolet solar photons which excite the low lying vibrational levels of OH. The far-infrared lines probe the inner regions of the coma where OH is produced through photodissociation of a parent molecule (presumably H 2 O). Hence, these lines complement the 18 cm radio measurements which are sensitive to the outer regions of the comet coma. The OH production rate is highly model dependent but is of the order 2 to 4 times 10 to the 29th power molecules/sec

The Far-Infrared Emission Line and Continuum Spectrum of the Seyfert Galaxy NGC 1068

Science.gov (United States)

Spinoglio, Luigi; Smith, Howard A.; Gonzalez-Alfonso, Eduardo; Fisher, Jacqueline

2005-01-01

We report on the analysis of the first complete far-infrared spectrum (43-197 microns) of the Seyfert 2 galaxy NGC 1068 as observed with the Long Wavelength Spectrometer (LWS) onboard the Infrared Space Observatory (ISO). In addition to the 7 expected ionic fine structure emission lines, the OH rotational lines at 79, 119 and 163 microns were all detected in emission, which is unique among galaxies with full LWS spectra, where the 119 micron line, where detected, is always in absorption. The observed line intensities were modelled together with IS0 Short Wavelength Spectrometer (SWS) and optical and ultraviolet line intensities from the literature, considering two independent emission components: the AGN component and the starburst component in the circumnuclear ring of approximately 3kpc in size. Using the UV to mid-IR emission line spectrum to constrain the nuclear ionizing continuum, we have confirmed previous results: a canonical power-law ionizing spectrum is a poorer fit than one with a deep absorption trough, while the presence of a big blue bump is ruled out. Based on the instantaneous starburst age of 5 Myr constrained by the Br gamma equivalent width in the starburst ring, and starburst synthesis models of the mid- and far-infrared fine-structure line emission, a low ionization parameter (U=10(exp -3.5)) and low densities (n=100 cm (exp -3)) are derived. Combining the AGN and starburst components, we succeed in modeling the overall UV to far-IR atomic spectrum of SGC 1068, reproducing the line fluxes to within a factor 2.0 on average with a standard deviation of 1.4. The OH 119 micron emission indicates that the line is collisionally excited, and arises in a warm and dense region. The OH emission has been modeled using spherically symmetric, non-local, non-LTE radiative transfer models. The models indicate that the bulk of the emission arises from the nuclear region, although some extended contribution from the starburst is not ruled out. The OH abundance

Installation And Test Of Electron Beam Generation System To Produce Far-Infrared Radiation And X-Ray Pulses

International Nuclear Information System (INIS)

Wichaisirimongkol, Pathom; Jinamoon, Witoon; Khangrang, Nopadon; Kusoljariyakul, Keerati; Rhodes, Michael W.; Rimjaem, Sakhorn; Saisut, Jatuporn; Chitrlada, Thongbai; Vilaithong, Thiraphat; Wiedemann, Helmut

2005-10-01

SURIYA project at the Fast Neutron Research Facility, Chiang Mai University, aims to establish a facility to generate femtosecond electron beams. This electron beam can be used to generate high intensity far-infrared radiation and ultra-short X-ray pulses. The main components of the system are a 3 MeV RF electron gun with a thermionic cathode, an a-magnet as a bunch compressor, and post acceleration 15-20 MeV by a linear accelerator (linac). Between the main components, there are focusing quadrupole magnets and steering magnets to maintain the electron beam within a high vacuum tube. At the end of the beam transport line, a dipole magnet has been installed to function as a beam dump and an energy spectrometer. After the installation and testing of individual major components were completed, we have been investigating the generation of the electron beam, intense far- infrared radiation and ultra short X-ray pulses

Possibility of observation of polaron normal modes at the far-infrared spectrum of acetanilide and related organics

Science.gov (United States)

Kalosakas, G.; Aubry, S.; Tsironis, G. P.

1998-10-01

We use a stationary and normal mode analysis of the semiclassical Holstein model in order to connect the low-frequency linear polaron modes to low-lying far-infrared lines of the acetanilide spectrum and through parameter fitting we comment on the validity of the polaron results in this system.

Meso-ester and carboxylic acid substituted BODIPYs with far-red and near-infrared emission for bioimaging applications

KAUST Repository

Ni, Yong

2014-01-21

A series of meso-ester-substituted BODIPY derivatives 1-6 are synthesized and characterized. In particular, dyes functionalized with oligo(ethylene glycol) ether styryl or naphthalene vinylene groups at the α positions of the BODIPY core (3-6) become partially soluble in water, and their absorptions and emissions are located in the far-red or near-infrared region. Three synthetic approaches are attempted to access the meso-carboxylic acid (COOH)-substituted BODIPYs 7 and 8 from the meso-ester-substituted BODIPYs. Two feasible synthetic routes are developed successfully, including one short route with only three steps. The meso-COOH-substituted BODIPY 7 is completely soluble in pure water, and its fluorescence maximum reaches around 650 nm with a fluorescence quantum yield of up to 15 %. Time-dependent density functional theory calculations are conducted to understand the structure-optical properties relationship, and it is revealed that the Stokes shift is dependent mainly on the geometric change from the ground state to the first excited singlet state. Furthermore, cell staining tests demonstrate that the meso-ester-substituted BODIPYs (1 and 3-6) and one of the meso-COOH-substituted BODIPYs (8) are very membrane-permeable. These features make these meso-ester- and meso-COOH-substituted BODIPY dyes attractive for bioimaging and biolabeling applications in living cells. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Far-Infrared Emission Characteristics and Wear Comfort Property of ZrC-Imbedded Heat Storage Knitted Fabrics for Emotional Garments

Directory of Open Access Journals (Sweden)

Kim Hyun Ah

2017-06-01

Full Text Available This study examined the far-infrared emission characteristics and wear comfort properties of ZrC-imbedded heat storage knitted fabrics. For this purpose, ZrC-imbedded, heat storage PET (polyethylene terephthalate was spun from high-viscosity PET with imbedded ZrC powder on the core part and low-viscosity PET on the sheath part using a conjugated spinning method. ZrC-imbedded PET knitted fabric was also prepared and its physical properties were measured and compared with those of regular PET knitted fabric. In addition, ingredient analysis and the far-infrared emission characteristics of the ZrC-imbedded knitted fabrics were analyzed by energy dispersive X-ray spectroscopy and Fourier transform infrared spectroscopy. The thermal properties, moisture absorption, and drying properties of the ZrC-imbedded PET knitted fabric were measured and compared with those of the regular PET knitted fabric. The mechanical properties using the FAST (fabric assurance by simple testing system and the dye affinity of the ZrC-imbedded knitted fabric were also measured and compared with those of regular PET knitted fabric.

Cleanability evaluation of ceramic glazes with nanometer far-infrared materials using contact angle measurement.

Science.gov (United States)

Wang, Lijuan; Liang, Jinsheng; Di, Xingfu; Tang, Qingguo

2014-05-01

The cleanability of easy-to-clean ceramic glazes doped with nanometer far-infrared materials was compared with that of some high-quality household ceramic glazes from the market. The cleanability was evaluated by the contact angle measurement using a sessile drop method with a Dataphysics OCA-30 contact angle analyzer. The results showed that the difference of contact angles of water on the glazes before soiling and after cleaning could be used as a parameter for evaluating the cleanability of the glazes. The relationship between cleanability and surface properties, such as surface free energy and surface topography, was investigated. The surface free energy of the samples and their components were calculated using van Oss acid-base approach. By measuring advancing and receding contact angles, the contact angle hysteresis of the ceramic glazes due to the surface topography was investigated. It was shown that the cleanability of ceramic glazes containing nanometer far-infrared materials (NFIM) is better than that of household ceramic glazes from market, due to a higher ratio of electron-acceptor parameter to electron-donor parameter, which led to the effect of water hydration as well as better hydrophilic property and increased smoothness. The contact angle measurement not only accurately evaluates the cleanability of the ceramic glazes, but also has a contribution to the study of cleanability theory. Moreover, this method is simple, convenient and less sample-consumption.

Particle-in-Cell Calculations of the Electron Cloud in the ILC Positron Damping Ring Wigglers

International Nuclear Information System (INIS)

Celata, C.M.; Furman, M.A.; Vay, J.-L.; Grote, D.P.

2007-01-01

The self-consistent code suite WARP-POSINST is being used to study electron cloud effects in the ILC positron damping ring wiggler. WARP is a parallelized, 3D particle-in-cell code which is fully self-consistent for all species. The POSINST models for the production of photoelectrons and secondary electrons are used to calculate electron creation. Mesh refinement and a moving reference frame for the calculation will be used to reduce the computer time needed by several orders of magnitude. We present preliminary results for cloud buildup showing 3D electron effects at the nulls of the vertical wiggler field. First results from a benchmark of WARP-POSINST vs. POSINST are also discussed

A new software tool for computing Earth's atmospheric transmission of near- and far-infrared radiation

Science.gov (United States)

Lord, Steven D.

1992-01-01

This report describes a new software tool, ATRAN, which computes the transmittance of Earth's atmosphere at near- and far-infrared wavelengths. We compare the capabilities of this program with others currently available and demonstrate its utility for observational data calibration and reduction. The program employs current water-vapor and ozone models to produce fast and accurate transmittance spectra for wavelengths ranging from 0.8 microns to 10 mm.

Comparison of laser-based mitigation of fused silica surface damage using mid- versus far-infrared lasers

Energy Technology Data Exchange (ETDEWEB)

Yang, S T; Matthews, M J; Elhadj, S; Cooke, D; Guss, G M; Draggoo, V G; Wegner, P J

2009-12-16

Laser induced growth of optical damage can limit component lifetime and therefore operating costs of large-aperture fusion-class laser systems. While far-infrared (IR) lasers have been used previously to treat laser damage on fused silica optics and render it benign, little is known about the effectiveness of less-absorbing mid-IR lasers for this purpose. In this study, they quantitatively compare the effectiveness and efficiency of mid-IR (4.6 {micro}m) versus far-IR (10.6 {micro}m) lasers in mitigating damage growth on fused silica surfaces. The non-linear volumetric heating due to mid-IR laser absorption is analyzed by solving the heat equation numerically, taking into account the temperature-dependent absorption coefficient {alpha}(T) at {lambda} = 4.6 {micro}m, while far-IR laser heating is well-described by a linear analytic approximation to the laser-driven temperature rise. In both cases, the predicted results agree well with surface temperature measurements based on infrared radiometry, as well as sub-surface fictive temperature measurements based on confocal Raman microscopy. Damage mitigation efficiency is assessed using a figure of merit (FOM) relating the crack healing depth to laser power required, under minimally-ablative conditions. Based on their FOM, they show that for cracks up to at least 500 {micro}m in depth, mitigation with a 4.6 {micro}m mid-IR laser is more efficient than mitigation with a 10.6 {micro}m far-IR laser. This conclusion is corroborated by direct application of each laser system to the mitigation of pulsed laser-induced damage possessing fractures up to 225 {micro}m in depth.

Development of transition edge superconducting bolometers for the SAFARI Far-Infrared spectrometer on the SPICA space-borne telescope

NARCIS (Netherlands)

Mauskopf, P.; Morozov, D.; Glowacka, D.; Goldie, D.; Withington, S.; Bruijn, M.; De Korte, P.; Hoevers, H.; Ridder, M.; Van der Kuur, J.; Gao, J.R.

2008-01-01

We describe the optimization of transition edge superconducting (TES) detectors for use in a far-infrared (FIR) Fourier transform spectrometer (FTS) mounted on a cryogenically cooled space-borne telescope (e.g. SPICA). The required noise equivalent power (NEP) of the detectors is approximately 10?19

Far-infrared imaging arrays for fusion plasma density and magnetic field measurements

International Nuclear Information System (INIS)

Neikirk, D.P.; Rutledge, D.B.

1982-01-01

Far-infrared imaging detector arrays are required for the determination of density and local magnetic field in fusion plasmas. Analytic calculations point out the difficulties with simple printed slot and dipole antennas on ungrounded substrates for use in submillimeter wave imaging arrays because of trapped surface waves. This is followed by a discussion of the use of substrate-lens coupling to eliminate the associated trapped surface modes responsible for their poor performance. This integrates well with a modified bow-tie antenna and permits diffraction-limited imaging. Arrays using bismuth microbolometers have been successfully fabricated and tested at 1222μm and 119μm. A 100 channel pilot experiment designed for the UCLA Microtor tokamak is described. (author)

Dynamic apeerture in damping rings with realistic wigglers

Energy Technology Data Exchange (ETDEWEB)

Cai, Yunhai; /SLAC

2005-05-04

The International Linear Collider based on superconducting RF cavities requires the damping rings to have extremely small equilibrium emittance, huge circumference, fast damping time, and large acceptance. To achieve all of these requirements is a very challenging task. In this paper, we will present a systematic approach to designing the damping rings using simple cells and non-interlaced sextupoles. The designs of the damping rings with various circumferences and shapes, including dogbone, are presented. To model realistic wigglers, we have developed a new hybrid symplectic integrator for faster and accurate evaluation of dynamic aperture of the lattices.

Tunable far infrared laser spectroscopy of van der Waals bonds: Ar-NH sub 3

Energy Technology Data Exchange (ETDEWEB)

Gwo, Dz-Hung (Lawrence Berkeley Lab., CA (USA) California Univ., Berkeley, CA (USA). Dept. of Chemistry)

1989-11-01

Hyperfine resolved vibration-rotation-tunneling spectra of Ar--NH{sub 3} and (NH{sub 3}){sub 2}, generated in a planar supersonic jet, have been measured with the Berkeley tunable far infrared laser spectrometer. Among the seven rotationally assigned bands, one band belongs to Ar--NH{sub 3}, and the other six belong to (NH{sub 3}){sub 2}. To facilitate the intermolecular vibrational assignment for Ar--NH{sub 3}, a dynamics study aided by a permutation-inversion group theoretical treatment is performed on the rovibrational levels. The rovibrational quantum number correlation between the free internal rotor limit and the semi-rigid limit is established to provide a basic physical picture of the evolution of intermolecular vibrational component states. An anomalous vibronically allowed unique Q branch vibrational band structure is predicted to exist for a near prolate binary complex containing an inverting subunit. According to the model developed in this work, the observed band of Ar--NH{sub 3} centered at 26.470633(17) cm{sup {minus}1} can correlate only to either the fundamental dimeric stretching band for the A{sub 2} states with the NH{sub 3} inversional quantum number v{sub i} = 1, or the K{sub a} = 0 {l arrow} 0 subband of the lowest internal-rotation-inversion difference band. Although the estimated nuclear quadrupole coupling constant favors a tentative assignment in terms of the first possibility, a definitive assignment will require far infrared data and a dynamical model incorporating a potential surface.

Advanced optimization of permanent magnet wigglers using a genetic algorithm

Energy Technology Data Exchange (ETDEWEB)

Hajima, Ryoichi [Univ. of Tokyo (Japan)

1995-12-31

In permanent magnet wigglers, magnetic imperfection of each magnet piece causes field error. This field error can be reduced or compensated by sorting magnet pieces in proper order. We showed a genetic algorithm has good property for this sorting scheme. In this paper, this optimization scheme is applied to the case of permanent magnets which have errors in the direction of field. The result shows the genetic algorithm is superior to other algorithms.

Advanced optimization of permanent magnet wigglers using a genetic algorithm

International Nuclear Information System (INIS)

Hajima, Ryoichi

1995-01-01

In permanent magnet wigglers, magnetic imperfection of each magnet piece causes field error. This field error can be reduced or compensated by sorting magnet pieces in proper order. We showed a genetic algorithm has good property for this sorting scheme. In this paper, this optimization scheme is applied to the case of permanent magnets which have errors in the direction of field. The result shows the genetic algorithm is superior to other algorithms

Conceptual designs for NLC ubitrons with permanent-magnet wigglers

International Nuclear Information System (INIS)

Phillips, R.

1994-09-01

This paper describes three embodiments of the ubitron (FEL) amplifier that will be analyzed for possible use on the NLC. The design frequency and power are 11.424 GHz and 200 MW peak rf output power. The baseline against which these conceptual designs are to be evaluated is the PPM-focused 50-MW SIAC klystron, which in simulation shows 65% efficiency. In order to remain competitive in cost and power consumption, only ubitron beam-wave configurations that can use permanent-magnet wigglers are considered

Terahertz time-domain spectroscopy response of amines and amino acids intercalated smectites in far-infrared region

Energy Technology Data Exchange (ETDEWEB)

Janek, M., E-mail: marian.janek@fns.uniba.sk [Comenius University, Faculty of Natural Sciences, Department of Physical and Theoretical Chemistry, Mlynská dolina CH1, SK-84215 Bratislava (Slovakia); Zich, D. [Comenius University, Faculty of Natural Sciences, Department of Physical and Theoretical Chemistry, Mlynská dolina CH1, SK-84215 Bratislava (Slovakia); Naftaly, M., E-mail: mira.naftaly@npl.co.uk [National Physical Laboratory, Hampton Rd, Teddington, Middlesex TW11 0LW (United Kingdom)

2014-06-01

Layered clay minerals from the smectite group with different chemical composition and resulting layer charge (e.g. pyrophyllite, illite, hectorite and montmorillonite) were characterised for their dielectric properties in the far-infrared region using terahertz-time domain spectroscopy (THz-TDS). Samples with distinct cation exchange capacity such as hectorite and montmorillonite were modified using cation exchange reaction with alkylamines or amino acids. The presence of these species in 2D gallery was proved by X-ray diffraction and Fourier transform infrared spectroscopy. The frequency-dependent refractive index of these minerals was determined in the experimentally accessible range of 0.1–3.0 THz (3–100 cm{sup −1}) using THz-TDS. Pristine samples revealed their refractive indices to be 1.82–2.15 at about 1 THz while the modified montmorillonite samples had their refractive indices changed by organic molecules used for their modification to 1.70–2.35 for amines and 1.97–2.36 for amino acids. The presence of organic substances in 2D gallery of clays was detectable despite the relatively high absorption of smectites with magnitude of 100 cm{sup −1}. - Graphical abstract: Display Omitted - Highlights: • “Guest” molecules in “host” layered material were investigated. • Amines and amino-acids were selected as guest molecules. • Natural and synthetic host with smectite phyllosilicate structure were used. • Dielectric properties were investigated by terahertz time domain spectroscopy. • Resonance absorption peaks of guest were detected in far infrared region.

Far-infrared laser scattering from spontaneous and driven fluctuations in the UCLA microtor tokamak

International Nuclear Information System (INIS)

Lee, P.; Luhmann, N.C.; Park, H. Jr.; Peebles, W.A.; Taylor, R.J.; Xu, Ying; Yu, C.X.

1982-01-01

A far-infrared (FIR) laser scattering system for the study of tokamak density fluctuations is described. Recent scattering data from low frequency microturbulence in high density (n >= 5 x 10 13 cm -3 ) microtor discharges are presented. In addition, the first observation and identification of internal modes generated during ICRF heating are described. The latter study directly conforms to fast wave mode conversion theory in a two-ion species plasma. In particular, the first internal observation of mode converted ion Bernstein waves in a tokamak plasma has been made. (author)

Bio-inspired Plasmonic Nanoarchitectured Hybrid System Towards Enhanced Far Red-to-Near Infrared Solar Photocatalysis

Science.gov (United States)

Yan, Runyu; Chen, Min; Zhou, Han; Liu, Tian; Tang, Xingwei; Zhang, Ke; Zhu, Hanxing; Ye, Jinhua; Zhang, Di; Fan, Tongxiang

2016-01-01

Solar conversion to fuels or to electricity in semiconductors using far red-to-near infrared (NIR) light, which accounts for about 40% of solar energy, is highly significant. One main challenge is the development of novel strategies for activity promotion and new basic mechanisms for NIR response. Mother Nature has evolved to smartly capture far red-to-NIR light via their intelligent systems due to unique micro/nanoarchitectures, thus motivating us for biomimetic design. Here we report the first demonstration of a new strategy, based on adopting nature’s far red-to-NIR responsive architectures for an efficient bio-inspired photocatalytic system. The system is constructed by controlled assembly of light-harvesting plasmonic nanoantennas onto a typical photocatalytic unit with butterfly wings’ 3D micro/nanoarchitectures. Experiments and finite-difference time-domain (FDTD) simulations demonstrate the structural effects on obvious far red-to-NIR photocatalysis enhancement, which originates from (1) Enhancing far red-to-NIR (700~1200 nm) harvesting, up to 25%. (2) Enhancing electric-field amplitude of localized surface plasmon (LSPs) to more than 3.5 times than that of the non-structured one, which promotes the rate of electron-hole pair formation, thus substantially reinforcing photocatalysis. This proof-of-concept study provides a new methodology for NIR photocatalysis and would potentially guide future conceptually new NIR responsive system designs.

Bio-inspired Plasmonic Nanoarchitectured Hybrid System Towards Enhanced Far Red-to-Near Infrared Solar Photocatalysis.

Science.gov (United States)

Yan, Runyu; Chen, Min; Zhou, Han; Liu, Tian; Tang, Xingwei; Zhang, Ke; Zhu, Hanxing; Ye, Jinhua; Zhang, Di; Fan, Tongxiang

2016-01-28

Solar conversion to fuels or to electricity in semiconductors using far red-to-near infrared (NIR) light, which accounts for about 40% of solar energy, is highly significant. One main challenge is the development of novel strategies for activity promotion and new basic mechanisms for NIR response. Mother Nature has evolved to smartly capture far red-to-NIR light via their intelligent systems due to unique micro/nanoarchitectures, thus motivating us for biomimetic design. Here we report the first demonstration of a new strategy, based on adopting nature's far red-to-NIR responsive architectures for an efficient bio-inspired photocatalytic system. The system is constructed by controlled assembly of light-harvesting plasmonic nanoantennas onto a typical photocatalytic unit with butterfly wings' 3D micro/nanoarchitectures. Experiments and finite-difference time-domain (FDTD) simulations demonstrate the structural effects on obvious far red-to-NIR photocatalysis enhancement, which originates from (1) Enhancing far red-to-NIR (700~1200 nm) harvesting, up to 25%. (2) Enhancing electric-field amplitude of localized surface plasmon (LSPs) to more than 3.5 times than that of the non-structured one, which promotes the rate of electron-hole pair formation, thus substantially reinforcing photocatalysis. This proof-of-concept study provides a new methodology for NIR photocatalysis and would potentially guide future conceptually new NIR responsive system designs.

POLYCYCLIC AROMATIC HYDROCARBON FAR-INFRARED SPECTROSCOPY

International Nuclear Information System (INIS)

Boersma, C.; Mattioda, A. L.; Tielens, A. G. G. M.; Allamandola, L. J.; Bauschlicher, C. W. Jr; Ricca, A.; Peeters, E.

2011-01-01

The far-IR characteristics of astrophysically relevant polycyclic aromatic hydrocarbons (PAHs) averaging in size around 100 carbon atoms have been studied using the theoretical spectra in the NASA Ames PAH IR Spectroscopic Database. These spectra were calculated using density functional theory. Selections of PAH species are made, grouped together by common characteristics or trends, such as size, shape, charge, and composition, and their far-IR spectra compared. The out-of-plane modes involving the entire molecule are explored in detail, astronomical relevance is assessed, and an observing strategy is discussed. It is shown that PAHs produce richer far-IR spectra with increasing size. PAHs also produce richer far-IR spectra with increasing number of irregularities. However, series of irregular-shaped PAHs with the same compact core have common 'Jumping-Jack' modes that 'pile up' at specific frequencies in their average spectrum. For the PAHs studied here, around 100 carbon atoms in size, this band falls near 50 μm. PAH charge and nitrogen inclusion affect band intensities but have little effect on far-IR band positions. Detailed analysis of the two-dimensional, out-of-plane bending 'drumhead' modes in the coronene and pyrene 'families' and the one-dimensional, out-of-plane bending 'bar' modes in the acene 'family' show that these molecular vibrations can be treated as classical vibrating sheets and bars of graphene, respectively. The analysis also shows that the peak position of these modes is very sensitive to the area of the emitting PAH and does not depend on the particular geometry. Thus, these longest wavelength PAH bands could provide a unique handle on the size of the largest species in the interstellar PAH family. However, these bands are weak. Observing highly excited regions showing the mid-IR bands in which the emission from classical dust peaks at short wavelengths offers the best chance of detecting PAH emission in the far-IR. For these regions

Polycyclic Aromatic Hydrocarbon Far-infrared Spectroscopy

Science.gov (United States)

Boersma, C.; Bauschlicher, C. W., Jr.; Ricca, A.; Mattioda, A. L.; Peeters, E.; Tielens, A. G. G. M.; Allamandola, L. J.

2011-03-01

The far-IR characteristics of astrophysically relevant polycyclic aromatic hydrocarbons (PAHs) averaging in size around 100 carbon atoms have been studied using the theoretical spectra in the NASA Ames PAH IR Spectroscopic Database. These spectra were calculated using density functional theory. Selections of PAH species are made, grouped together by common characteristics or trends, such as size, shape, charge, and composition, and their far-IR spectra compared. The out-of-plane modes involving the entire molecule are explored in detail, astronomical relevance is assessed, and an observing strategy is discussed. It is shown that PAHs produce richer far-IR spectra with increasing size. PAHs also produce richer far-IR spectra with increasing number of irregularities. However, series of irregular-shaped PAHs with the same compact core have common "Jumping-Jack" modes that "pile up" at specific frequencies in their average spectrum. For the PAHs studied here, around 100 carbon atoms in size, this band falls near 50 μm. PAH charge and nitrogen inclusion affect band intensities but have little effect on far-IR band positions. Detailed analysis of the two-dimensional, out-of-plane bending "drumhead" modes in the coronene and pyrene "families" and the one-dimensional, out-of-plane bending "bar" modes in the acene "family" show that these molecular vibrations can be treated as classical vibrating sheets and bars of graphene, respectively. The analysis also shows that the peak position of these modes is very sensitive to the area of the emitting PAH and does not depend on the particular geometry. Thus, these longest wavelength PAH bands could provide a unique handle on the size of the largest species in the interstellar PAH family. However, these bands are weak. Observing highly excited regions showing the mid-IR bands in which the emission from classical dust peaks at short wavelengths offers the best chance of detecting PAH emission in the far-IR. For these regions

Dispersion relation of Raman FEL with helical Wiggler and ion channel

International Nuclear Information System (INIS)

Hosseinalinezhad, M.; Bahmani, M.; Hasanbeigi, A.; Salehkoutahi, M.

2012-01-01

In this paper the theory of free electron laser with helical wiggler and ion channel guiding has been presented. The equations of motion for an electron have been analyzed. A formula for the dispersion relation is then derived in the low-gain-per-pass limit. The results of a numerical study of the growth rate enhancement due to the ion channel are presented and discussed.

High-resolution far-infrared synchrotron FTIR spectrum of the ν12 band of formamide-d1 (DCONH2)

Science.gov (United States)

Tan, T. L.; Wu, Q. Y.; Ng, L. L.; Appadoo, Dominique R. T.; McNaughton, Don

2018-05-01

The spectrum of the ν12 band of formamide-d1 (DCONH2) was recorded using a synchrotron Fourier transform infrared (FTIR) spectrometer coupled to the Australian Synchrotron THz/Far-IR beamline, with an unapodized resolution of 0.00096 cm-1 in the 350-210 cm-1 region. For the first time, rovibrational constants up to five quartic and two sextic terms were derived for the v12 = 1 state through the fitting of a total of 2072 far-infrared transitions using Watson's A-reduced Hamiltonian in the Ir representation with a root-mean-square (rms) deviation of 0.000073 cm-1. The band centre of the ν12 band of DCONH2 was found to be 289.3327553(47) cm-1 although the experimental uncertainty was limited to ±0.0002 cm-1. Ground state rovibrational constants of DCONH2 up to five quartic and two sextic constants were derived from a fit of 847 ground state combination differences (GSCDs) obtained from the infrared transitions of the ν12 band, together with 6 previously reported microwave transitions, with a rms deviation of 0.000108 cm-1. The ground state rotational constants (A, B, and C) of DCONH2 were improved while the ground state centrifugal distortion constants were accurately obtained for the first time. The uncertainty of the measured infrared lines was estimated to be ±0.0002 cm-1. From the ground state rotational constants, the inertial defect of DCONH2 was calculated to be 0.0169412(11) uÅ2.

Theoretical study of H- stripping with a wiggler magnet

International Nuclear Information System (INIS)

Hutson, R.L.

1991-01-01

The first step for injecting protons into the LAMPF Proton Storage Ring (PSR) at LANL is to strip a beam of 800-MeV H - ions to H 0 with a 1.8-T dipole magnet. Because of the finite lifetime of energetic H - ions in the magnetic field, their trajectories bend before stripping causing the angular spread of the beam, and therefore its emittance, to grow during the stripping process. In the case of the PSR, the horizontal beam emittance grows by a factor of roughly three during injection. As a consequence, beam losses in the ring are significantly greater than they would be if there were not emittance growth. A speculative technique is proposed in which the beam divergence growth and resulting emittance growth is reduced by stripping the H - in a wiggler magnet whose transverse field alternates in direction as a function of position along the beam axis. The wiggler field configuration is adjusted so that the angular beam spread introduced during passage through one unidirectional-field increment of path is relatively small and so that 99.99% of the beam is stripped after passing through the whole magnet. With careful field design the net added angular beam spread is reduced because the incremental angular spreads are painted back and forth over the same small range. In the hypothetical case described, the calculated emittance growth and beam loss increase are significantly smaller than those calculated for a conventional stripper magnet. 3 refs., 3 figs

b-dipole transitions in trans-HOCO observed by far infrared laser magnetic resonance

International Nuclear Information System (INIS)

Sears, T.J.; Radford, H.E.; Moore, M.A.

1993-01-01

Far infrared laser magnetic resonance spectroscopy is used to measure components of 12 rotational transitions in the ground state of the HOCO radical. The transitions are all b-dipole in character in contrast to the a-dipole rotational spectrum previously reported [Radford, Wei, and Sears, J. Chem. Phys. 97, 3989 (1992)]. The new data determine the A rotational constant to high precision and allow the determination of several centrifugal distortion constants for the first time. The hyperfine coupling in the radical leads to observable splittings in several of the observed transitions and these are used to estimate two of the four expected nonzero hyperfine parameters in the radical

DISCOVERY OF TIME VARIATION OF THE INTENSITY OF MOLECULAR LINES IN IRC+10216 IN THE SUBMILLIMETER AND FAR-INFRARED DOMAINS

Energy Technology Data Exchange (ETDEWEB)

Cernicharo, J.; Quintana-Lacaci, G.; Agúndez, M.; Velilla-Prieto, L. [Group of Molecular Astrophysics, ICMM, CSIC, C/Sor Juana Inés de La Cruz N3, E-28049 Madrid (Spain); Teyssier, D.; García-Lario, P. [ESA, ESAC, P.O. Box 78, Villanueva de la Cañada, E-28691 Madrid (Spain); Daniel, F. [Univ. Grenoble Alpes, IPAG, F-38000 Grenoble (France); Decin, L. [Instituut voor Sterrenkunde, Katholieke Universiteit Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Guélin, M. [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, F-38406 St-Martin d' Hères (France); Encrenaz, P. [LERMA, Observatoire de Paris, 61 Av. de l' Observatoire, F-75014 Paris (France); De Beck, E. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE 439 92 Onsala (Sweden); Barlow, M. J. [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Groenewegen, M. A. T. [Koninklijke Sterrenwacht van België, Ringlaan 3, B-1180 Brussels (Belgium); Neufeld, D. [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Pearson, J. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States)

2014-11-20

We report on the discovery of strong intensity variations in the high rotational lines of abundant molecular species toward the archetypical circumstellar envelope of IRC+10216. The observations have been carried out with the Heterodyne Instrument for the Far-Infrared (HIFI) instrument on board Herschel and with the IRAM30 m telescope. They cover several observing periods spreading over three years. The line intensity variations for molecules produced in the external layers of the envelope most likely result from time variations in the infrared pumping rates. We analyze the main implications this discovery has on the interpretation of molecular line emission in the envelopes of Mira-type stars. Radiative transfer calculations must take into account both the time variability of infrared pumping and the possible variation of the dust and gas temperatures with stellar phase in order to reproduce the observation of molecular lines at different epochs. The effect of gas temperature variations with stellar phase could be particularly important for lines produced in the innermost regions of the envelope. Each layer of the circumstellar envelope sees the stellar light radiation with a different lag time (phase). Our results show that this effect must be included in the models. The submillimeter and far infrared lines of asymptotic giant branch stars can no longer be considered as safe intensity calibrators.

Low-frequency quadrupole impedance of undulators and wigglers

Directory of Open Access Journals (Sweden)

A. Blednykh

2016-10-01

Full Text Available An analytical expression of the low-frequency quadrupole impedance for undulators and wigglers is derived and benchmarked against beam-based impedance measurements done at the 3 GeV NSLS-II storage ring. The adopted theoretical model, valid for an arbitrary number of electromagnetic layers with parallel geometry, allows to calculate the quadrupole impedance for arbitrary values of the magnetic permeability μ_{r}. In the comparison of the analytical results with the measurements for variable magnet gaps, two limit cases of the permeability have been studied: the case of perfect magnets (μ_{r}→∞, and the case in which the magnets are fully saturated (μ_{r}=1.

HAWC+/SOFIA observations of Rho Oph A: far-infrared polarization spectrum

Science.gov (United States)

Santos, Fabio; Dowell, Charles D.; Houde, Martin; Looney, Leslie; Lopez-Rodriguez, Enrique; Novak, Giles; Ward-Thompson, Derek; HAWC+ Science Team

2018-01-01

In this work, we present preliminary results from the HAWC+ far-infrared polarimeter that operates on the SOFIA airborne observatory. The densest portions of the Rho Ophiuchi molecular complex, known as Rho Oph A, have been mapped using HAWC+ bands C (89 microns) and D (155 microns). Rho Oph A is a well known nearby star forming region. At the target's distance of approximately 130 pc, our observations provide excellent spatial resolution (~5 mpc in band C).The magnetic field map suggests a compressed and distorted field morphology around Oph S1, a massive B3 star that is the main heat source of Rho Oph A. We compute the ratio p(D)/p(C), where p(C) and p(D) are the polarization degree maps at bands C and D, respectively. This ratio estimates the slope of the polarization spectrum in the far-infrared. Although the slope is predicted to be positive by dust grain models, previous observations of other molecular clouds have revealed that negative slopes are common. In Rho Oph A, we find that there is a smooth gradient of p(D)/p(C) across the mapped field. The change in p(D)/p(C) is well correlated with the integrated NH3 (1,1) emission. A positive slope dominates the lower density and well illuminated portions of the cloud, whereas a transition to a negative slope is observed at the denser and less evenly illuminated cloud core.We interpret the positive to negative slope transition as being consistent with the radiative torques (RATs) grain alignment theory. For the sight lines of higher column density, polarized emission from the warmer outer cloud layers is added to emission from the colder inner well-shielded layers lying along the same line-of-sight. Given that the outer layers receive more radiation from Oph S1, their grain alignment efficiency is expected to be higher according to RATs. The combination of warmer, well aligned grains with cooler, poorly aligned grains is what causes the negative slope. This effect is not present in the sight lines of lower column

Development of an optical resonator with high-efficient output coupler for the JAERI far-infrared free-electron laser

International Nuclear Information System (INIS)

Nagai, Ryoji; Hajima, Ryoichi; Nishimori, Nobuyuki; Sawamura, Masaru; Kikuzawa, Nobuhiro; Shizuma, Toshiyuki; Minehara, Eisuke

2001-01-01

An optical resonator with a high-efficient output coupler was developed for the JAERI far-infrared free-electron laser. The optical resonator is symmetrical near-concentric geometry with an insertable scraper output coupler. As a result of the development of the optical resonator, the JAERI-FEL has been successfully, lased with averaged power over 1 kW. Performance of the optical resonator with the output coupler was evaluated at optical wavelength of 22 μm by using an optical mode calculation code. The output coupling and diffractive loss with a dominant eigen-mode of the resonator were calculated using an iterative computation called Fox-Li procedure. An efficiency factor of the optical resonator was introduced for the evaluation of the optical resonator performance. The efficiency factor was derived by the amount of the output coupling and diffractive loss of the optical resonator. It was found that the optical resonator with the insertable scraper coupler was the most suitable to a high-power and high-efficient far-infrared free-electron laser. (author)

Single mode operation of a hybrid optically pumped D2O far infrared laser

International Nuclear Information System (INIS)

Yuan, D.C.; Siegrist, M.R.

1990-04-01

We have achieved single mode operation in a hybrid optically pumped D 2 O far infrared laser. The active volume of the resonator was divided into two sections separated by a thin plastic foil. The larger section served as the main gain medium and the shorter section as mode selective element. The vapor pressure in the smaller volume was either very low or alternatively about 3 times higher than the pressure in the main part. In both cases single mode operation was achieved without any reduction of the total output energy. (author) 13 refs., 7 figs

Predesign Study of a 4-5 tesla Superconducting Wiggler Magnet for the ESRF

NARCIS (Netherlands)

ten Kate, Herman H.J.; ter Avest, D.; ter Avest, D.; Ravex, A.; Lagnier, M.; Elleaume, P.

1994-01-01

The ESRF is currently setting up a beam line for very hard photons well above 250 keV. This requires the installation of a high field three polewavelength shifter. The nominal and target fields of the wiggler magnet are 4 and 5 tesla respectively while the nominal field integral over the central

FAR-INFRARED LINE SPECTRA OF SEYFERT GALAXIES FROM THE HERSCHEL-PACS SPECTROMETER

International Nuclear Information System (INIS)

Spinoglio, Luigi; Pereira-Santaella, Miguel; Busquet, Gemma; Dasyra, Kalliopi M.; Calzoletti, Luca; Malkan, Matthew A.; Tommasin, Silvia

2015-01-01

We observed the far-IR fine-structure lines of 26 Seyfert galaxies with the Herschel-PACS spectrometer. These observations are complemented with Spitzer Infrared Spectrograph and Herschel SPIRE spectroscopy. We used the ionic lines to determine electron densities in the ionized gas and the [C I] lines, observed with SPIRE, to measure the neutral gas densities, while the [O I] lines measure the gas temperature, at densities below ∼10 4  cm –3 . Using the [O I]145 μm/63 μm and [S III]33/18 μm line ratios, we find an anti-correlation of the temperature with the gas density. Various fine-structure line ratios show density stratifications in these active galaxies. On average, electron densities increase with the ionization potential of the ions. The infrared lines arise partly in the narrow line region, photoionized by the active galactic nucleus (AGN), partly in H II regions photoionized by hot stars, and partly in photo-dissociated regions. We attempt to separate the contributions to the line emission produced in these different regions by comparing our observed emission line ratios to theoretical values. In particular, we tried to separate the contribution of AGNs and star formation by using a combination of Spitzer and Herschel lines, and we found that besides the well-known mid-IR line ratios, the line ratio of [O III]88 μm/[O IV]26 μm can reliably discriminate the two emission regions, while the far-IR line ratio of [C II]157 μm/[O I]63 μm is only able to mildly separate the two regimes. By comparing the observed [C II]157 μm/[N II]205 μm ratio with photoionization models, we also found that most of the [C II] emission in the galaxies we examined is due to photodissociation regions

FAR-INFRARED LINE SPECTRA OF SEYFERT GALAXIES FROM THE HERSCHEL-PACS SPECTROMETER

Energy Technology Data Exchange (ETDEWEB)

Spinoglio, Luigi; Pereira-Santaella, Miguel; Busquet, Gemma [Istituto di Astrofisica e Planetologia Spaziali, INAF, Via Fosso del Cavaliere 100, I-00133 Roma (Italy); Dasyra, Kalliopi M. [Observatoire de Paris, LERMA (CNRS:UMR8112), 61 Av. de l' Observatoire, F-75014, Paris (France); Calzoletti, Luca [Agenzia Spaziale Italiana (ASI) Science Data Center, I-00044 Frascati (Roma) (Italy); Malkan, Matthew A. [Astronomy Division, University of California, Los Angeles, CA 90095-1547 (United States); Tommasin, Silvia, E-mail: luigi.spinoglio@iaps.inaf.it [Weizmann Institute of Science, Department of Neurobiology, Rehovot 76100 (Israel)

2015-01-20

We observed the far-IR fine-structure lines of 26 Seyfert galaxies with the Herschel-PACS spectrometer. These observations are complemented with Spitzer Infrared Spectrograph and Herschel SPIRE spectroscopy. We used the ionic lines to determine electron densities in the ionized gas and the [C I] lines, observed with SPIRE, to measure the neutral gas densities, while the [O I] lines measure the gas temperature, at densities below ∼10{sup 4} cm{sup –3}. Using the [O I]145 μm/63 μm and [S III]33/18 μm line ratios, we find an anti-correlation of the temperature with the gas density. Various fine-structure line ratios show density stratifications in these active galaxies. On average, electron densities increase with the ionization potential of the ions. The infrared lines arise partly in the narrow line region, photoionized by the active galactic nucleus (AGN), partly in H II regions photoionized by hot stars, and partly in photo-dissociated regions. We attempt to separate the contributions to the line emission produced in these different regions by comparing our observed emission line ratios to theoretical values. In particular, we tried to separate the contribution of AGNs and star formation by using a combination of Spitzer and Herschel lines, and we found that besides the well-known mid-IR line ratios, the line ratio of [O III]88 μm/[O IV]26 μm can reliably discriminate the two emission regions, while the far-IR line ratio of [C II]157 μm/[O I]63 μm is only able to mildly separate the two regimes. By comparing the observed [C II]157 μm/[N II]205 μm ratio with photoionization models, we also found that most of the [C II] emission in the galaxies we examined is due to photodissociation regions.

Investigation of the nonlinear effects of Wiggler and undulator fields on the beam dynamics of particle storage rings in the case of DORIS III

International Nuclear Information System (INIS)

Decking, W.

1995-11-01

In this thesis I analyze the effects of wiggler and undulator magnetic fields on the beam dynamics of electron/positron storage rings. DORIS III, DESY's synchrotron radiation source is taken as an example. Wigglers and undulators are used for the production of synchrotron radiation or to control beam sizes in storage rings. Their introduction in the lattices of storage rings causes some problems due to the strong nonlinearities of the magnetic fields. Therefore a detailed analysis of the particle dynamics under the influence of wiggler magnetic fields and their field errors is necessary. This thesis provides such an analysis. The problem will be attacked analytically, numerically and experimentally. The analytic approach is based on the treatment of the appropriate Hamiltonian with perturbation theory. The magnetic fields are described with a Fourier series, which covers the main characteristics of wiggler and undulator fields. The main effect of wigglers and undulators is the excitation of fourth order synchro-betatron resonances. The description of field errors and other details of the magnetic fields is achieved by integrating over appropriately distributed current sheets. This allows the modeling of different parameters such as magnet pole width, periodicity errors and errors in the field gradients. (orig./WL)ons of motion in the fields calculated with this method can only be integrated numerically. This would be much too slow to be used in particle tracking codes. Therefore a transfer map b

A Demonstration of TIA Using FD-SOI CMOS OPAMP for Far-Infrared Astronomy

Science.gov (United States)

Nagase, Koichi; Wada, Takehiko; Ikeda, Hirokazu; Arai, Yasuo; Ohno, Morifumi; Hanaoka, Misaki; Kanada, Hidehiro; Oyabu, Shinki; Hattori, Yasuki; Ukai, Sota; Suzuki, Toyoaki; Watanabe, Kentaroh; Baba, Shunsuke; Kochi, Chihiro; Yamamoto, Keita

2016-07-01

We are developing a fully depleted silicon-on-insulator (FD-SOI) CMOS readout integrated circuit (ROIC) operated at temperatures below ˜ 4 K. Its application is planned for the readout circuit of high-impedance far-infrared detectors for astronomical observations. We designed a trans-impedance amplifier (TIA) using a CMOS operational amplifier (OPAMP) with FD-SOI technique. The TIA is optimized to readout signals from a germanium blocked impurity band (Ge BIB) detector which is highly sensitive to wavelengths of up to ˜ 200 \\upmu m. For the first time, we demonstrated the FD-SOI CMOS OPAMP combined with the Ge BIB detector at 4.5 K. The result promises to solve issues faced by conventional cryogenic ROICs.

Modeling the effects of a flat wiggler on a storage ring beam

International Nuclear Information System (INIS)

Helm, R.H.

1978-06-01

The purpose of the present note is to show how the various effects of the wiggler may be modeled in a simple way suitable for use in machine control. It will be seen that in general a total of about 17 functions are involved. However, in typical designs many of these functions vanish identically because of symmetries, and others are neglibly small. Furthermore, each of the functions may be modeled quite accurately by a single power law in (B/sub o//E)/sup n/ where B is a measure of the field excitation. E is the beam energy, and n is an integer which takes on values of either 0, 2, 3, 4, for 5 for the different functions. Magnet saturation may cause the field distribution to vary with excitation so that the series coefficients would vary slowly with B/sub o/. A computer program has been used to obtain numerical results for typical wiggler designs. In practice, the required functions could be determined either by computer analysis of the measured field data, or by experimental calibration using the stored beam in the ring. 9 refs., 3 figs., 11 tabs

Dispersion relation and growth rate of a relativistic electron beam propagating through a Langmuir wave wiggler

Science.gov (United States)

Zirak, H.; Jafari, S.

2015-06-01

In this study, a theory of free-electron laser (FEL) with a Langmuir wave wiggler in the presence of an axial magnetic field has been presented. The small wavelength of the plasma wave (in the sub-mm range) allows obtaining higher frequency than conventional wiggler FELs. Electron trajectories have been obtained by solving the equations of motion for a single electron. In addition, a fourth-order Runge-Kutta method has been used to simulate the electron trajectories. Employing a perturbation analysis, the dispersion relation for an electromagnetic and space-charge waves has been derived by solving the momentum transfer, continuity, and wave equations. Numerical calculations show that the growth rate increases with increasing the e-beam energy and e-beam density, while it decreases with increasing the strength of the axial guide magnetic field.

Local Volume Hi Survey: the far-infrared radio correlation

Science.gov (United States)

Shao, Li; Koribalski, Bärbel S.; Wang, Jing; Ho, Luis C.; Staveley-Smith, Lister

2018-06-01

In this paper we measure the far-infrared (FIR) and radio flux densities of a sample of 82 local gas-rich galaxies, including 70 "dwarf" galaxies (M* correlation (FRC) over four orders of magnitude (F_1.4GHz ∝ F_FIR^{1.00± 0.08}). However, for detected galaxies only, a trend of larger FIR-to-radio ratio with decreasing flux density is observed. We estimate the star formation rate by combining UV and mid-IR data using empirical calibration. It is confirmed that both FIR and radio emission are strongly connected with star formation but with significant non-linearity. Dwarf galaxies are found radiation deficient in both bands, when normalized by star formation rate. It urges a "conspiracy" to keep the FIR-to-radio ratio generally constant. By using partial correlation coefficient in Pearson definition, we identify the key galaxy properties associated with the FIR and radio deficiency. Some major factors, such as stellar mass surface density, will cancel out when taking the ratio between FIR and radio fluxes. The remaining factors, such as HI-to-stellar mass ratio and galaxy size, are expected to cancel each other due to the distribution of galaxies in the parameter space. Such cancellation is probably responsible for the "conspiracy" to keep the FRC alive.

MIRI: A multichannel far-infrared laser interferometer for electron density measurements on TFTR [Tokamak Fusion Test Reactor

International Nuclear Information System (INIS)

Mansfield, D.K.; Park, H.K.; Johnson, L.C.; Anderson, H.M.; Chouinard, R.; Foote, V.S.; Ma, C.H.; Clifton, B.J.

1987-07-01

A ten-channel far-infrared laser interferometer which is routinely used to measure the spatial and temporal behavior of the electron density profile on the TFTR tokamak is described and representative results are presented. This system has been designed for remote operation in the very hostile environment of a fusion reactor. The possible expansion of the system to include polarimetric measurements is briefly outlined. 13 refs., 8 figs

ESPRIT: a study concept for a far-infrared interferometer in space

Science.gov (United States)

Wild, W.; de Graauw, Th.; Helmich, F.; Baryshev, A.; Cernicharo, J.; Gao, J. R.; Gunst, A.; Bos, A.; den Herder, J.-W.; Jackson, B.; Koshelets, V.; Langevelde, H.-J.; Maat, P.; Martin-Pintado, J.; Noordam, J.; Roelfsema, P.; Venema, L.; Wesselius, P.; Yagoubov, P.

2008-07-01

In the far-infrared (FIR) / THz regime the angular (and often spectral) resolution of observing facilities is still very restricted despite the fact that this frequency range has become of prime importance for modern astrophysics. ALMA (Atacama Large Millimeter Array) with its superb sensitivity and angular resolution will only cover frequencies up to about 1 THz, while the HIFI instrument for ESA'a Herschel Space Observatory will provide limited angular resolution (10 to 30 arcsec) up to 2 THz. Observations of regions with star and planet formation require extremely high angular resolution as well as frequency resolution in the full THz regime. In order to open these regions for high-resolution astrophysics we present a study concept for a heterodyne space interferometer, ESPRIT (Exploratory Submm Space Radio-Interferometric Telescope). This mission will cover the Terahertz regime inaccessible from the ground and outside the operating range of the James Webb Space Telescope (JWST).

Generation of tunable coherent far-infrared radiation using atomic Rydberg states

International Nuclear Information System (INIS)

Bookless, W.

1980-12-01

A source of tunable far-infrared radiation has been constructed. The system has been operated at 91.6 cm -1 with a demonstrated tunability of .63 cm -1 . The system is based on a Rydberg state transition in optically pumped potassium vapor. The transition energy is tuned by the application of an electric field to the excited vapor. The transition wavelength and the shifted wavelength were detected and measured by the use of a Michelson interferometer and a liquid helium cooled Ga:Ge bolometer and the data was reduced using Fast Fourier transform techniques. Extensive spectroscopy was done on the potassium vapor to elucidate the depopulation paths and rates of the excited levels. Both theoretical and experimental results are presented to support the conclusions of the research effort. Additionally, possible alternative approaches to the population of the excited state are explored and recommendations are made for the future development of this source as well as the potential uses of it in molecular spectroscopy

Downwelling Far-Infrared Emission Spectra Measured By First at Cerro Toco, Chile and Table Mountain, California

Science.gov (United States)

Mast, J. C.; Mlynczak, M. G.; Cageao, R.; Kratz, D. P.; Johnson, D. G.; Mlawer, E. J.; Turner, D. D.

2014-12-01

The Far-Infrared Spectroscopy of the Troposphere (FIRST) instrument is a Fourier transform spectrometer developed to measure the important far-infrared spectrum between 100 and 650 cm-1. Presented here are measurements made by FIRST during two successful deployments in a ground-based configuration to measure downwelling longwave radiation at Earth's surface. The initial deployment was to Cerro Toco, Chile, where FIRST operated from August to October, 2009 as part of the Radiative Heating in Underexplored Bands Campaign (RHUBC-II) campaign. After recalibration, FIRST was deployed to the Table Mountain Facility from September through October, 2012. Spectra observed at each location are substantially different, due in large part to the order of magnitude difference in integrated precipitable water vapor (0.3 cm at Table Mountain, 0.03 cm at Cerro Toco). Dry days for both campaigns are chosen for analysis - 09/24/2009 and 10/19/2012. Also available during both deployments are coincident radiosonde temperature and water vapor vertical profiles which are used as inputs a line-by-line radiative transfer program. Comparisons between measured and modeled spectra are presented over the 200 to 800 cm-1 range. An extensive error analysis of both the measured and modeled spectra is presented. In general, the differences between the measured and modeled spectra are within their combined uncertainties.

Modeling the light-travel-time effect on the far-infrared size of IRC +10216

Science.gov (United States)

Wright, Edward L.; Baganoff, Frederick K.

1995-01-01

Models of the far-infrared emission from the large circumstellar dust envelope surrounding the carbon star IRC +10216 are used to assess the importance of the light-travel-time effect (LTTE) on the observed size of the source. The central star is a long-period variable with an average period of 644 +/- 17 days and a peak-to-peak amplitude of two magnituds, so a large light-travel-time effect is seen at 1 min radius. An attempt is made to use the LTTE to reconcile the discrepancy between the observations of Fazio et al. and Lester et al. regarding the far-infrared source size. This discrepancy is reviewed in light of recent, high-spatial-resolution observations at 11 microns by Danchi et al. We conclude that IRC +10216 has been resolved on the arcminute scale by Fazio et al. Convolution of the model intensity profile at 61 microns with the 60 sec x 90 sec Gaussian beam of Fazio et al. yields an observed source size full width at half maximum (FWHM) that ranges from approximately 67 sec to 75 sec depending on the phase of the star and the assumed distance to the source. Using a simple r(exp -2) dust distribution and the 106 deg phase of the Fazio et al. observations, the LTTE model reaches a peak size of 74.3 sec at a distance of 300 pc. This agrees favorably with the 78 sec x 6 sec size measured by Fazio et al. Finally, a method is outlined for using the LTTE as a distance indicator to IRC +10216 and other stars with extended mass outflows.

Far infrared polarimetry with tokamak plasmas for determination of the poloidal magnetic field distribution

Energy Technology Data Exchange (ETDEWEB)

Kunz, W

1979-01-01

This study examines the poloidal magnetic field distribution of tokamak plasma, and the elucidation of the radial distribution of the toroidal plasma flow. A numerical and experimental determination of the poloidal field based on the Faraday effect is presented. A method is discussed for measuring the rotation of the polarization plane linear polarized electromagnetic radiation, by passing through a plasma magnetized in the direction of the radiation. The polarization behavior of a linear polarized wave passing through a tokamak plasma is presented theoretically for various wavelengths, along with the experimental investigation of a ferrite modulation procedure through the use of different far infrared detectors.

Analytic Electron Trajectories in an Extremely Relativistic Helical Wiggler an Application to the Proposed SLAC E166 Experiment.

CERN Document Server

ThomasDonohue, John

2004-01-01

The proposed experiment SLAC E166 intends to generate circularly polarized gamma rays of energy 10 MeV by passing a 15 GeV electron beam through a meter long wiggler with approximately 400 periods. Using an analytic model formulated by Rullier and me, I present calculations of electron trajectories. At this extremely high energy the trajectories are described quite well by the model, and an extremely simple picture emerges, even for trajectories that that fail to encircle the axis of the wiggler. Our calculations are successfully compared with standard numerical integration of the Lorentz force equations of motion. In addition, the calculation of the spectrum and angular distribution of the radiated photons is easily carried out.

Analysis of Precursors Prior to Rock Burst in Granite Tunnel Using Acoustic Emission and Far Infrared Monitoring

OpenAIRE

Liang, Zhengzhao; Liu, Xiangxin; Zhang, Yanbo; Tang, Chunan

2013-01-01

To understand the physical mechanism of the anomalous behaviors observed prior to rock burst, the acoustic emission (AE) and far infrared (FIR) techniques were applied to monitor the progressive failure of a rock tunnel model subjected to biaxial stresses. Images of fracturing process, temperature changes of the tunnel, and spatiotemporal serials of acoustic emission were simultaneously recorded during deformation of the model. The b-value derived from the amplitude distribution data of AE wa...

Mission Concept for the Single Aperture Far-Infrared (SAFIR) Observatory

Science.gov (United States)

Benford, Dominic J.; Amato, Michael J.; Mather, John C.; Moseley, S. Harvey, Jr.

2004-01-01

We have developed a preliminary but comprehensive mission concept for SAFIR, as a 10 m-class far-infrared and submillimeter observatory that would begin development later in this decade to meet the needs outlined above. Its operating temperature ( or approx. 40 microns. This would provide a point source sensitivity improvement of several orders of magnitude over that of the Spitzer Space Telescope (previously SIRTF) or the Herschel Space Observatory. Additionally, it would have an angular resolution 12 times finer than that of Spitzer and three times finer than Herschel. This sensitivity and angular resolution are necessary to perform imaging and spectroscopic studies of individual galaxies in the early universe. We have considered many aspects of the SAFIR mission, including the telescope technology (optical design, materials, and packaging), detector needs and technologies, cooling method and required technology developments, attitude and pointing, power systems, launch vehicle, and mission operations. The most challenging requirements for this mission are operating temperature and aperture size of the telescope, and the development of detector arrays. SAFIR can take advantage of much of the technology under development for JWST, but with much less stringent requirements on optical accuracy.

Recognizing pedestrian's unsafe behaviors in far-infrared imagery at night

Science.gov (United States)

Lee, Eun Ju; Ko, Byoung Chul; Nam, Jae-Yeal

2016-05-01

Pedestrian behavior recognition is important work for early accident prevention in advanced driver assistance system (ADAS). In particular, because most pedestrian-vehicle crashes are occurred from late of night to early of dawn, our study focus on recognizing unsafe behavior of pedestrians using thermal image captured from moving vehicle at night. For recognizing unsafe behavior, this study uses convolutional neural network (CNN) which shows high quality of recognition performance. However, because traditional CNN requires the very expensive training time and memory, we design the light CNN consisted of two convolutional layers and two subsampling layers for real-time processing of vehicle applications. In addition, we combine light CNN with boosted random forest (Boosted RF) classifier so that the output of CNN is not fully connected with the classifier but randomly connected with Boosted random forest. We named this CNN as randomly connected CNN (RC-CNN). The proposed method was successfully applied to the pedestrian unsafe behavior (PUB) dataset captured from far-infrared camera at night and its behavior recognition accuracy is confirmed to be higher than that of some algorithms related to CNNs, with a shorter processing time.

Metal-Insulator Phase Transition in thin VO2 films: A Look from the Far Infrared Side

DEFF Research Database (Denmark)

Jepsen, Peter Uhd; Fischer, B. M.; Thoman, A.

Vanadium dioxide (VO2) displays a well-known metal-insulator (MI) transition at atemperature of 68oC. The MI transition in VO2 has been studied extensively by a widerange of optical, electrical, structural, and magnetic measurements. In spite of this there isstill some controversy about the nature...... temperature hysteresis of the far-infrared transmission through thethin film with temperature. Interestingly the temperature-dependent transmissionamplitude shows a markedly different switching temperature than the transmission phase.This effect has not been observed before, and is very important...

Near-infrared observations of IRAS minisurvey galaxies

International Nuclear Information System (INIS)

Carico, D.P.; Soifer, B.T.; Elias, J.H.; Matthews, K.; Neugebauer, G.; Beichman, C.; Persson, C.J.; Persson, S.E.

1987-01-01

Near infrared photometry at J, H, and K was obtained for 82 galaxies from the IRAS minisurvey. The near infrared colors of these galaxies cover a larger range in J-H and H-K than do normal field spiral galaxies, and evidence is presented of a tighter correlation between the near and far infrared emission in far infrared bright galaxies than exists between the far infrared and the visible emission. These results suggest the presence of dust in the far infrared bright galaxies, with hot dust emission contributing to the 2.2 micron emission, and extinction by dust affecting both the near infrared colors and the visible luminosities. In addition, there is some indication that the infrared emission in many of the minisurvey galaxies is coming from a strong nuclear component

Far-infrared investigation of the Taurus star-forming region using the IRAS database

International Nuclear Information System (INIS)

Hughes, J.D.

1986-01-01

The Taurus-Auriga complex was selected as the first molecular cloud to be investigated in this study. The Taurus clouds were defined as lying between 04h and 05h in R.A. and +16 to +31 degrees in Dec., then the IRAS point-source catalogue was searched for sources with good or moderate quality fluxes in all three of the shortest IRAS bands. The sources selected were then classified into subgroups according to their IRAS colors. Taurus is generally believed to be an area of low-mass star formation, having no luminous O-B associations within or near to the cloud complex. Once field stars, galaxies and planetary nebulae had been removed from the sample only the molecular cloud cores, T Tauri stars and a few emission-line A and B stars remained. The great majority of these objects are pre-main sequence in nature and, as stated by Chester (1985), main sequence stars without excess far-infrared emission would only be seen in Taurus if their spectral types were earlier than about A5 and then not 25 microns. By choosing our sample in this way we are naturally selecting the hotter and thus more evolved sources. To counteract this, the molecular cloud core-criterion was applied to soruces with good or moderate quality flux at 25, 60 and 100 microns, increasing the core sample by about one third. The candidate protostar B335 is only detected by IRAS at 60 and 100 microns while Taurus is heavily contaminated by cirrus at 100 microns. This means that detection at 25 microns is also required with those at 60 and 100 microns to avoid confusing a ridge of cirrus with a genuine protostar. The far-infrared luminosity function of these sources is then calculated and converted to the visual band by a standard method to compare with the field star luminosity function of Miller and Scalo

Design and prototype results of a far-infrared interferometer for MFTF-B

International Nuclear Information System (INIS)

Monjes, J.A.; Throop, A.L.; Thomas, S.R.; Peebles, A.; Zu, Qin-Zin.

1983-01-01

A Far-Infrared (FIR) Laser Interferometer (FLI), operating at 185 μm wavelength is planned as part of the initial start-up set of plasma diagnostics for the Mirror Fusion Test Facility (MFTF-B). The FLI will consist of a heterodyne, three-chord laser interferometer which will be used initially to measure line-integrated plasma density in the high-density, center cell region of the machine. The conceptual system design and analysis has been completed. There are several unique environmental/physical constraints and performance requirements for this system which have required that technology-evaluation and prototyping experiments be completed to support the design effort and confirm the expected performance parameters. Issues which have been addressed include extensive use of long-path dielectric waveguide, coupling and control of free-space propagation of the beam, and polarization control. The results and conclusions of the design analysis and experimental measurements will be presented

A high-average power tapered FEL amplifier at submillimeter frequencies using sheet electron beams and short-period wigglers

International Nuclear Information System (INIS)

Bidwell, S.W.; Radack, D.J.; Antonsen, T.M. Jr.; Booske, J.H.; Carmel, Y.; Destler, W.W.; Granatstein, V.L.; Levush, B.; Latham, P.E.; Zhang, Z.X.

1990-01-01

A high-average-power FEL amplifier operating at submillimeter frequencies is under development at the University of Maryland. Program goals are to produce a CW, ∼1 MW, FEL amplifier source at frequencies between 280 GHz and 560 GHz. To this end, a high-gain, high-efficiency, tapered FEL amplifier using a sheet electron beam and a short-period (superconducting) wiggler has been chosen. Development of this amplifier is progressing in three stages: (1) beam propagation through a long length (∼1 m) of short period (λ ω = 1 cm) wiggler, (2) demonstration of a proof-of-principle amplifier experiment at 98 GHz, and (3) designs of a superconducting tapered FEL amplifier meeting the ultimate design goal specifications. 17 refs., 1 fig., 1 tab

A study of Sn addition on bonding arrangement of Se-Te alloys using far infrared transmission spectroscopy

International Nuclear Information System (INIS)

Kumar, Rajneesh; Rangra, V. S.; Sharma, Parikshit; Katyal, S. C.; Sharma, Pankaj

2011-01-01

Far infrared transmission spectra of Se 92 Te 8-x Sn x (x = 0, 1, 2, 3, 4, 5) glassy alloys are obtained in the spectral range 50-600 cm -1 at room temperature. The results are interpreted in terms of the vibrations of the isolated molecular units in such a way so as to preserve fourfold and twofold coordination for Sn and chalcogen atoms (Se,Te), respectively. With the addition of Sn, Far-IR spectra shift toward high frequency side and some new bands start appearing. Sn atoms appear to substitute for the selenium atoms in the outrigger sites due to large bond formation probability. Theoretical calculations of bond energy, relative probability of bond formation, force constant, and wave number were also made to justify the result.

Hyperfine spectrum measurement of an optically pumped far-infrared laser with a Michelson interferometer

International Nuclear Information System (INIS)

Zuo, Z G; Ling, F R; Wang, P; Liu, J S; Yao, J Q; Weng, C X

2013-01-01

In this letter, we present a Michelson interferometer for the hyperfine spectrum measurement of an optically pumped far-infrared laser with a highest frequency resolution of 3–5 GHz. CH 3 OH gas with a purity of 99.9%, is pumped by the CO 2 9P36 and 9R10 laser lines to generate terahertz lasers with frequencies of 2.52 and 3.11 THz, respectively. Moreover, except for the center frequency, which is in good agreement with theoretical work, some additional frequencies on both sides of the center frequency are obtained at a frequency interval of 0.15 THz. Meanwhile, the mechanism behind the observed experimental results is also investigated. (letter)

NGC 985 - Extended ionized regions and the far-infrared luminosity of a ring-shaped Seyfert galaxy

International Nuclear Information System (INIS)

Rodriguez Espinosa, J.M.; Stanga, R.M.

1990-01-01

Narrow-band H-alpha images and long-slit spectroscopy of the Seyfert galaxy NGC 985 are presented. Large-scale extended ionized zones are seen to cover a significant fraction of the ring of this object. These ionized zones are responsible for a considerable fraction (greater than 35 percent) of the far-infrared emission of NGC 985. These ionized zones are interpreted as giant H II region complexes, formed in a recent burst of star formation. It is also argued that that starburst was triggered by a galaxy interaction. 41 refs

Kinetic description of a wiggler pumped ion-channel free electron laser

International Nuclear Information System (INIS)

Mehdian, H; Raghavi, A

2006-01-01

The wiggler pumped ion-channel free electron laser (WPIC-FEL) is treated and the classes of possible single-particle electron trajectories in this configuration are discussed in the paper. A new region of orbital stability is seen in the negative mass regime. A kinetic description of WPIC-FEL is given. Vlasov-Maxwell equations are solved to get the linear gain in a tenuous-beam limit, where the beam plasma frequency is much less than the radiation frequency and the self-field effects can be ignored

FAR-INFRARED PROPERTIES OF SPITZER-SELECTED LUMINOUS STARBURSTS

International Nuclear Information System (INIS)

Kovacs, A.; Omont, A.; Fiolet, N.; Beelen, A.; Dole, H.; Lagache, G.; Lonsdale, C.; Polletta, M.; Greve, T. R.; Borys, C.; Dowell, C. D.; Bell, T. A.; Cox, P.; De Breuck, C.; Farrah, D.; Menten, K. M.; Owen, F.

2010-01-01

We present SHARC-2 350 μm data on 20 luminous z ∼ 2 starbursts with S 1.2 m m > 2 mJy from the Spitzer-selected samples of Lonsdale et al. and Fiolet et al. All the sources were detected, with S 350 μ m > 25 mJy for 18 of them. With the data, we determine precise dust temperatures and luminosities for these galaxies using both single-temperature fits and models with power-law mass-temperature distributions. We derive appropriate formulae to use when optical depths are non-negligible. Our models provide an excellent fit to the 6 μm-2 mm measurements of local starbursts. We find characteristic single-component temperatures T 1 ≅ 35.5 ± 2.2 K and integrated infrared (IR) luminosities around 10 12.9±0.1 L sun for the SWIRE-selected sources. Molecular gas masses are estimated at ≅4 x 10 10 M sun , assuming κ 850 μ m = 0.15 m 2 kg -1 and a submillimeter-selected galaxy (SMG)-like gas-to-dust mass ratio. The best-fit models imply ∼>2 kpc emission scales. We also note a tight correlation between rest-frame 1.4 GHz radio and IR luminosities confirming star formation as the predominant power source. The far-IR properties of our sample are indistinguishable from the purely submillimeter-selected populations from current surveys. We therefore conclude that our original selection criteria, based on mid-IR colors and 24 μm flux densities, provides an effective means for the study of SMGs at z ∼ 1.5-2.5.

Atrazine Molecular Imprinted Polymers: Comparative Analysis by Far-Infrared and Ultraviolet Induced Polymerization

Directory of Open Access Journals (Sweden)

Jun Chen

2014-01-01

Full Text Available Atrazine molecular imprinted polymers (MIPs were comparatively synthesized using identical polymer formulation by far-infrared (FIR radiation and ultraviolet (UV-induced polymerization, respectively. Equilibrium binding experiments were carried out with the prepared MIPs; the results showed that MIPuv possessed specific binding to atrazine compared with their MIPFIR radiation counterparts. Scatchard plot’s of both MIPs indicated that the affinities of the binding sites in MIPs are heterogeneous and can be approximated by two dissociation-constants corresponding to the high- and low-affinity binding sites. Moreover, several common pesticides including atrazine, cyromazine, metamitron, simazine, ametryn, terbutryn were tested to determine their specificity, similar imprinting factor (IF and different selectivity index (SI for both MIPs. Physical characterization of the polymers revealed that the different polymerization methods led to slight differences in polymer structures and performance by scanning electron microscope (SEM, Fourier transform infrared absorption (FT-IR, and mercury analyzer (MA. Finally, both MIPs were used as selective sorbents for solid phase extraction (SPE of atrazine from lake water, followed by high performance liquid chromatography (HPLC analysis. Compared with commercial C18 SPE sorbent (86.4%–94.8%, higher recoveries of atrazine in spiked lake water were obtained in the range of 90.1%–97.1% and 94.4%–101.9%, for both MIPs, respectively.

Measurements of electron cloud growth and mitigation in dipole, quadrupole, and wiggler magnets

Energy Technology Data Exchange (ETDEWEB)

Calvey, J.R., E-mail: jrc97@cornell.edu; Hartung, W.; Li, Y.; Livezey, J.A.; Makita, J.; Palmer, M.A.; Rubin, D.

2015-01-11

Retarding field analyzers (RFAs), which provide a localized measurement of the electron cloud, have been installed throughout the Cornell Electron Storage Ring (CESR), in different magnetic field environments. This paper describes the RFA designs developed for dipole, quadrupole, and wiggler field regions, and provides an overview of measurements made in each environment. The effectiveness of electron cloud mitigations, including coatings, grooves, and clearing electrodes, are assessed with the RFA measurements.

Planck intermediate results: XVII. Emission of dust in the diffuse interstellar medium from the far-infrared to microwave frequencies

DEFF Research Database (Denmark)

Bartlett, J.G.; Cardoso, J.-F.; Delabrouille, J.

2014-01-01

H-atom. The dust temperature is observed to be anti-correlated with the dust emissivity and opacity. We interpret this result as evidence of dust evolution within the diffuse ISM. The mean dust opacity is measured to be (7.1 ± 0.6) × 10-27 cm2 H-1 × (v/353 GHz) 1.53 ± 0.03for 100 ≤ v ≤ 353 GHz......The dust-Hi correlation is used to characterize the emission properties of dust in the diffuse interstellar medium (ISM) from far infrared wavelengths to microwave frequencies. The field of this investigation encompasses the part of the southern sky best suited to study the cosmic infrared...... and microwave backgrounds. We cross-correlate sky maps from Planck, the Wilkinson Microwave Anisotropy Probe (WMAP), and the diffuse infrared background experiment (DIRBE), at 17 frequencies from 23 to 3000 GHz, with the Parkes survey of the 21 cm line emission of neutral atomic hydrogen, over a contiguous area...

Solid state spectroscopy by using of far-infrared synchrotron radiation

Energy Technology Data Exchange (ETDEWEB)

Nanba, Takao [Kobe Univ. (Japan). Faculty of Science

1996-07-01

If the spectroscopic system corresponding to the wavelength region required for experiment is installed, the light source with continuous wavelength is to be obtainable by synchrotron radiation. This report is that of the research on solid state spectroscopy using the ordinary incoherent synchrotron radiation which is obtained from the deflection electromagnet parts of electron storage ring. At present in the world, the facilities which can be utilized in far-infrared spectroscopy region are five, including the UVSOR of Molecular Science Research Institute in Japan. The optical arrangement of the measuring system of the UVSOR is shown. The spectrum distribution of the light passing through the pinholes with different diameter in the place of setting samples was compared in case of the UVSOR and a high pressure mercury lamp, and it was shown that synchrotron radiation has high luminance. The researches on solid state spectroscopy carried out in the above mentioned five facilities are enumerated. In this paper, the high pressure spectroscopic experiment which has been carried out at the UVSOR is reported. The observation of the phase transition of fine particles and the surface phonons of fine particles are described. As fine particle size became smaller, the critical pressure at which phase transition occurred was high. (K.I.)

Design of end magnetic structures for the Advanced Light Source wigglers

International Nuclear Information System (INIS)

Humphries, D.; Akre, J.; Hoyer, E.; Marks, S.; Minamihara, Y.; Pipersky, P.; Plate, D.; Schlueter, R.

1995-01-01

The vertical magnetic structures for the Advanced Light planar wiggler and 20 cm period elliptical hybrid permanent magnet design. The ends of these structures are characterized by diminishing scalar potential distributions the poles which control beam trajectories. They incorporate electromagnetic correction coils to dynamically correct for variations in the first integral of the field as a function of gap. A permanent magnet trim mechanism is incorporated to minimize the transverse integrated error field distribution. The ends were designed using analytic and computer modeling techniques. The design and modeling results are presented

Submillimeter-wave and far-infrared spectroscopy of high-J transitions of the ground and ν2 = 1 states of ammonia.

Science.gov (United States)

Yu, Shanshan; Pearson, John C; Drouin, Brian J; Sung, Keeyoon; Pirali, Olivier; Vervloet, Michel; Martin-Drumel, Marie-Aline; Endres, Christian P; Shiraishi, Tetsuro; Kobayashi, Kaori; Matsushima, Fusakazu

2010-11-07

Complete and reliable knowledge of the ammonia spectrum is needed to enable the analysis and interpretation of astrophysical and planetary observations. Ammonia has been observed in the interstellar medium up to J=18 and more highly excited transitions are expected to appear in hot exoplanets and brown dwarfs. As a result, there is considerable interest in observing and assigning the high J (rovibrational) spectrum. In this work, numerous spectroscopic techniques were employed to study its high J transitions in the ground and ν(2)=1 states. Measurements were carried out using a frequency multiplied submillimeter spectrometer at Jet Propulsion Laboratory (JPL), a tunable far-infrared spectrometer at University of Toyama, and a high-resolution Bruker IFS 125 Fourier transform spectrometer (FTS) at Synchrotron SOLEIL. Highly excited ammonia was created with a radiofrequency discharge and a dc discharge, which allowed assignments of transitions with J up to 35. One hundred and seventy seven ground state and ν(2)=1 inversion transitions were observed with microwave accuracy in the 0.3-4.7 THz region. Of these, 125 were observed for the first time, including 26 ΔK=3 transitions. Over 2000 far-infrared transitions were assigned to the ground state and ν(2)=1 inversion bands as well as the ν(2) fundamental band. Of these, 1912 were assigned using the FTS data for the first time, including 222 ΔK=3 transitions. The accuracy of these measurements has been estimated to be 0.0003-0.0006 cm(-1). A reduced root mean square error of 0.9 was obtained for a global fit of the ground and ν(2)=1 states, which includes the lines assigned in this work and all previously available microwave, terahertz, far-infrared, and mid-infrared data. The new measurements and predictions reported here will support the analyses of astronomical observations by high-resolution spectroscopy telescopes such as Herschel, SOFIA, and ALMA. The comprehensive experimental rovibrational energy levels

Far infrared conductivity of charge density wave materials and the oxygen isotope effect in high-Tc superconductors

International Nuclear Information System (INIS)

Creager, W.N.

1991-09-01

The far infrared reflectance and conductivity of (Ta 1-x Nb x Se 4 ) 2 I and TaS 3 have been measured to determine the origin of a huge infrared resonance that dominates the charge density wave (CDW) dynamics along with the pinned acoustic phason mode in the related materials (TaSe 4 ) 2 I and K 0. 3 MoO 3 . The measurements cover frequencies from 3 to 700cm -1 and the temperature range from 15K to 300K. In the niobium-doped alloys (Ta 1-x Nb x Se 4 ) 2 I, the size and frequency of the giant infrared mode remain nearly constant as the impurity concentration x is increased. For TaS 3 , the pinned acoustic phason near 0.5cm -1 dominates var-epsilon(ω) and an additional small mode lies near 9cm -1 . The latter mode is much smaller than the infrared mode in other CDW materials. These results rule out several models of a ''generic infrared mode'' in CDW excitations. They are compared in detail to the predictions of a recent theory attributing the infrared mode to a bound collective mode localized at impurity sites within the crystal. The transmittance of K 0.3 MoO 3 has been measured at 1.2K with a strong dc electric field applied across the crystal. Under these conditions, the charge density wave depins abruptly and carries large currents with near-zero differential resistance. For some samples, the low-frequency transmittance is enhanced slightly when the CDW depins. The magnitude of the oxygen isotope effect in the high-T c superconductor YBa 2 Cu 3 O 7 has been determined by substitution of 18 O for 16 O. A series of cross-exchanges was performed on high-quality polycrystalline specimens to eliminate uncertainties due to sample heat treatments and sample inhomogeneities

Tunable far infrared laser spectroscopy of Van der Waals molecules in a planar supersonic jet expansion

International Nuclear Information System (INIS)

Busarow, K.L.

1990-12-01

The gas phase high resolution spectroscopic study of weakly bound clusters can provide the information necessary to develop an intermolecular potential energy surface. This surface can then be used to better understand condensed phases. In this work, a tunable far infrared laser spectrometer is used to study weakly bound dimers produced in the newly developed continuous planar supersonic jet expansion apparatus. The water dimer is an extensively studied hydrogen bonded dimer. It undergoes several tunneling motions which result in splittings and perturbations of the rovibrational energy levels. A review is presented of much of the experimental and theoretical work done on water dimer, including a description of the combined fit of all the high resolution spectroscopic results by Coudert and Hougen. Also included is a discussion of the measurement of the K = 1 lower → K = 2 lower band performed using the tunable far infrared laser/planar jet apparatus. The preliminary results from the study of CH 4 ·H 2 O will also be presented. CH 4 ·H 2 O is unique in that unlike a strongly anisotropic complex, such as the water dimer, the monomer subunits are nearly free internal rotors. Seven bands are observed which have very similar band origins and rotational constants. Two energy level diagrams are proposed which are strongly influenced by earlier ArH 2 O studies. A brief qualitative discussion of the CH 4 ·H 2 O binding energy compared to that of ArH 2 O is also included. 152 refs., 54 figs., 20 tabs

Synchrotron far-infrared spectroscopy of the two lowest fundamental modes of 1,1-difluoroethane

Science.gov (United States)

Wong, Andy; Thompson, Christopher D.; Appadoo, Dominique R. T.; Plathe, Ruth; Roy, Pascale; Manceron, Laurent; Barros, Joanna; McNaughton, Don

2013-08-01

The far-infrared (FIR) spectrum (50-600 cm-1) of 1,1-difluoroethane was recorded using the high-resolution infrared AILES beamline at the Soleil synchrotron. A ro-vibrational assignment was performed on the lowest wavenumber, low intensity 181 0 and 171 0 modes, yielding band centres of 224.241903 (10) cm-1 and 384.252538 (13) cm-1, respectively. A total of 965 and 2031 FIR transitions were assigned to the 181 0 and 171 0 fundamentals, respectively. Previously measured pure rotational transitions from the upper states were included into the respective fits to yield improved rotational and centrifugal distortion constants. The 182 1 hot band was observed within the fundamental band, with 369 FIR transitions assigned and co-fitted with the fundamental to give a band centre of 431.956502 (39) cm-1 for ν 18 = 2. The 182 0 overtone was observed with 586 transitions assigned and fitted to give a band centre of 431.952763 (23) cm-1 for ν 18 = 2. The difference in energy is attributed to a torsional splitting of 0.003740 (45) cm-1 in the ν 18 = 2 state. Two hot bands originating from the ν 18 = 1 and ν 17 = 1 states were observed within the 171 0 fundamental.

The far infrared radiation characteristics for Li2O.Al2O3.4SiO2(LAS) glass-ceramics and transition-metal oxide

International Nuclear Information System (INIS)

Huh, Nam Jung; Yang, Joong Sik

1991-01-01

The far infrared radiation characteristic for Li 2 O.Al 2 O 3 .4SiO 2 (LAS) glass, the LAS glass-ceramic and sintered transition metal oxides such as CuO, Fe 2 O 3 and Co 3 O 4 , were investigated. LAS glass and LAS glass-ceramic was higher than that of the LAS glass. Heat-treated CuO and Co 3 o 4 had radiation characteristic of high efficiency infrared radiant, and heat-treated Fe 2 O 3 had radiation characteristic that infrared emissivity decreased in higher was length above 15μm. (Author)

OH far-infrared emission from low- and intermediate-mass protostars surveyed with Herschel-PACS

DEFF Research Database (Denmark)

Wampfler, Susanne Franziska; Bruderer, S.; Karska, A.

2013-01-01

fluxes nor their broad line widths, strongly suggesting an outflow origin. Slab excitation models indicate that the observed excitation temperature can either be reached if the OH molecules are exposed to a strong far-infrared continuum radiation field or if the gas temperature and density...... are sufficiently high. Using realistic source parameters and radiation fields, it is shown for the case of Ser SMM1 that radiative pumping plays an important role in transitions arising from upper level energies higher than 300 K. The compact emission in the low-mass sources and the required presence of a strong...

BETTII: The Balloon Experimental Twin Telescope for Infrared Interferometry (Phase 2a)- High Angular Resolution Astronomy at Far-Infrared Wavelengths

Science.gov (United States)

Rinehart, Stephen

The Balloon Experimental Twin Telescope for Infrared Interferometry (BETTII) is an eight-meter baseline far-infrared interferometer to fly on a high altitude balloon. The combination of the long baseline with a double-Fourier instrument allows BETTII to simultaneously gain both spatial and spectral information; BETTII is designed for spatially-resolved spectroscopy. The unique data obtained with BETTII will be valuable for understanding how stars form within dense clusters, by isolating individual objects that are unresolved by previous space telescopes and my measuring their spectral energy distributions. BETTII will be also used in future flights to understand the processes in the cores of Active Galactic Nuclei. In addition to these scientific goals, BETTII serves as a major step towards achieving the vision of space-based interferometry. BETTII was first funded through the 2010 APRA program; last year, the proposal also fared well in the APRA review, but for programmatic reasons was only awarded one year of funding. With the current funding, we will complete the BETTII experiment and conduct a Commissioning Flight in August/September 2016. The effort proposed includes full analysis of data from the Commissioning Flight, which will help us determine the technical and scientific capabilities of the experiment. It also includes two science flights, one in each 2017 and 2018, with full data analysis being completed in 2019.

Infrared Space Observatory Observations of Far-Infrared Rotational Emission Lines of Water Vapor toward the Supergiant Star VY Canis Majoris

Science.gov (United States)

Neufeld, David A.; Feuchtgruber, Helmut; Harwit, Martin; Melnick, Gary J.

1999-06-01

We report the detection of numerous far-infrared emission lines of water vapor toward the supergiant star VY Canis Majoris. A 29.5-45 μm grating scan of VY CMa, obtained using the Short-Wavelength Spectrometer (SWS) of the Infrared Space Observatory at a spectral resolving power λ/Δλ of ~2000, reveals at least 41 spectral features due to water vapor that together radiate a total luminosity of ~25 Lsolar. In addition to pure rotational transitions within the ground vibrational state, these features include rotational transitions within the (010) excited vibrational state. The spectrum also shows the 2Π1/2(J=5/2)VY CMa were carried out in the instrument's Fabry-Perot mode for three water transitions: the 725-616 line at 29.8367 μm, the 441-312 line at 31.7721 μm, and the 432-303 line at 40.6909 μm. The higher spectral resolving power λ/Δλ of approximately 30,000 thereby obtained permits the line profiles to be resolved spectrally for the first time and reveals the ``P Cygni'' profiles that are characteristic of emission from an outflowing envelope. Based on observations with ISO, an ESA project with instruments funded by ESA Member States (especially the PI countries: France, Germany, the Netherlands, and the UK) with the participation of ISAS and NASA.

Quantum SASE FEL with a Laser Wiggler

CERN Document Server

Bonifacio, R

2005-01-01

Quantum effects in high-gain FELs become relevant when ρ'=ρ(mcγ/ ћ k)<1. The quantum FEL parameter ρ' rules the maximum number of photons emitted per electrons. It has been shown that when ρ'<1 a "quantum purification" of the SASE regime occurs: in fact, the spectrum of the emitted radiation (randomly spiky in the usual classical SASE regime) shrinks to a very narrow single line, leading to a high degree of temporal coherence. From the definition of ρ it appears that in order to achieve the quantum regime, small values of ρ, beam energy and radiation wavelength are necessary. These requirements can be met only using a laser wiggler. In this work we state the scaling laws necessary to operate a SASE FEL in the Angstrom region. All physical quantities are expressed in terms of the normalized emittance and of two parameters: the ratio between laser and electron beam spot sizes and the ratio between Rayleigh range and electron ...

Investigation of betatron instability in a wiggler pumped ion-channel free electron laser

Energy Technology Data Exchange (ETDEWEB)

Raghavi, A [Physics Department, Payame Noor University, 19395-4697 (Iran, Islamic Republic of); Mehdian, H, E-mail: Raghavi@tmu.ac.ir, E-mail: Mehdian@tmu.ac.ir [Department of Physics, Teacher Training University, Tehran (Iran, Islamic Republic of)

2011-10-15

Betatron emission from an ion-channel free electron laser in the presence of a helical wiggler pump and in the high gain regime is studied. The dispersion relation and the frequency of betatron emission are derived. Growth rate is illustrated and maximum growth rate as a function of ion-channel density is considered. Finally, the relation between beam energy, the density of ion channel and the region of betatron emission is discussed.

Effect of ultraviolet and far infrared radiation on microbial decontamination and quality of cumin seeds.

Science.gov (United States)

Erdoğdu, S Belgin; Ekiz, H İbrahim

2011-01-01

Cumin seeds might be exposed to a high level of natural bacterial contamination, and this could potentially create a public health risk besides leading to problems in exportation. Ultraviolet (UVC) and far infrared (FIR) radiation has low penetration power, and due to that, there might be no detrimental defects to the products during a possible decontamination process. Therefore, the objective of this study was to determine the effect of UVC and FIR treatment on microbial decontamination and quality of cumin seeds. For this purpose, FIR treatment at different exposure times and temperatures were applied followed by constant UVC treatment with an intensity of 10.5 mW/cm² for 2 h. Total mesophilic aerobic bacteria of the cumin seeds were decreased to the target level of 10⁴ CFU/g after 1.57, 2.8, and 4.8 min FIR treatment at 300, 250, and 200 °C, respectively, following a 2 h UVC treatment. Under the given conditions, a complete elimination for total yeast and molds were obtained while there were no significant changes in volatile oil content and color of the cumin seeds. Consequently, combined UVC and FIR treatment was determined to be a promising method for decontamination of the cumin seeds. This research attempts to apply UVC and far infrared (FIR) radiation for pasteurization of cumin seeds. The data suggested that combined UVC and FIR radiation treatments can become a promising new method for pasteurization of cumin seeds without causing any detrimental defect to the quality parameters. The results of this industry partnered (Kadioglu Baharat, Mersin, Turkey--http://www.kadioglubaharat.com) study were already applied in industrial scale production lines. © 2011 Institute of Food Technologists®

Far-infrared and submillimeter spectroscopy of photodissociation regions

International Nuclear Information System (INIS)

Qaiyum, A.

1993-12-01

The physical properties of the galactic and extragalactic photodissociation regions, warm gas components molecular clouds are, generally, derived through the far-infrared (FIR) fine structure and submillimeter line emissions arising out of these regions. In the theoretical studies of these lines the model of Tielens and Hollenbach (herein after referred as TH) are usually employed in which all the opacity is assumed local in escape probability formalism and inward directed photons do not escape. These assumptions are contrary to the observational facts, where most of the lines are found optically thin except OI (63 μm) and low rotational transitions of CO and some other molecules. The optically thin medium will allow the radiation to escape through any face of the region. These observational evidences let us to assume finite parallel plane slab, instead of semi-infinite parallel slab, in which the photons are allowed to escape from both surfaces (back and front). In the present study an attempt has been made to incorporate the two sided escape of photons from the PDRs and to study its effect on the FIR and submillimeter line emission from the PDRs/molecular clouds. Further the present formalism is also employed to study the clumpy PDRs/molecular clouds. The preliminary results show that now serious consequences are found on the thermal and chemical structure of the regions but individual line emissions are modified by differing factors. Particularly at low density and low kinetic temperature the change is substantial but at density greater than the critical density of the line and temperature close to the excitation temperature its effect is almost negligible. An attempt has also been made to study the physical conditions of the M17 region employing the present formalism. (author). 49 refs, 8 figs, 1 tab

A far-infrared Michelson interferometer for tokamak electron density measurements using computer-generated reference fringes

International Nuclear Information System (INIS)

Krug, P.A.; Stimson, P.A.; Falconer, I.S.

1986-01-01

A simple far-infrared interferometer which uses the 394 μm laser line from optically-pumped formic acid vapour to measure tokamak electron density is described. This interferometer is unusual in requiring only one detector and a single probing beam since reference fringes during the plasma shot are obtained by computer interpolation between the fringes observed immediately before and after the shot. Electron density has been measured with a phase resolution corresponding to + - 1/20 wavelength fringe shift, which is equivalent to a central density resolution of + - 0.1 x 10 19 m -3 for an assumed parabolic density distribution in a plasma of diameter of 0.2 m, and with a time resolution of 0.2 ms. (author)

Far-infrared phonon spectroscopy of Pb1-xMn xTe layers grown by molecular beam epitaxy

International Nuclear Information System (INIS)

Romcevic, N.; Nadolny, A.J.; Romcevic, M.; Story, T.; Taliashvili, B.; Milutinovic, A.; Trajic, J.; Lusakowska, E.; Vasiljevic-Radovic, D.; Domukhovski, V.; Osinniy, V.; Hadzic, B.; Dziawa, P.

2007-01-01

In this paper we used far-infrared spectroscopy, reflection high energy electron diffraction (RHEED), X-ray diffraction and atomic force microscopy (AFM) to investigate structural and optical properties of Pb 1-x Mn x Te layers grown by molecular beam epitaxy (MBE). A numerical model for calculating the reflectivity coefficient for complex systems which include films, buffer layer and substrate has been applied. The infrared reflectivity spectra consist of Pb 1-x Mn x Te phonons, which exhibit intermediate one-two mode behavior, and MnTe phonons. A good agreement between calculated and experimental spectra is achieved. We registered the local distribution of Mn impurities depending on substrate type. For films growth on BaF 2 substrate we registered the orthorhombic local structure of MnTe clusters, while in the case of KCl substrate this structure is cubic. The Pb 1-x Mn x Te long wavelength optical phonons were described by the modified Genzel's model

CesrTA Retarding Field Analyzer Measurements in Drifts, Dipoles, Quadrupoles and Wigglers

International Nuclear Information System (INIS)

Calvey, J.R.; Li, Y.; Livezey, J.A.; Makita, J.; Meller, R.E.; Palmer, M.A.; Schwartz, R.M.; Strohman, C.R.; Harkay, K.; Calatroni, S.; Rumolo, G.; Kanazawa, K.; Suetsugu, Y.; Pivi, M.; Wang, L.

2010-01-01

Over the course of the CesrTA program, the Cornell Electron Storage Ring (CESR) has been instrumented with several retarding field analyzers (RFAs), which measure the local density and energy distribution of the electron cloud. These RFAs have been installed in drifts, dipoles, quadrupoles, and wigglers; and data have been taken in a variety of beam conditions and bunch configurations. This paper will provide an overview of these results, and give a preliminary evaluation of the efficacy of cloud mitigation techniques implemented in the instrumented vacuum chambers.

Depth-of-field effects in wiggler radiation sources: Geometrical versus wave optics

Directory of Open Access Journals (Sweden)

Richard P. Walker

2017-02-01

Full Text Available A detailed analysis is carried out of the optical properties of synchrotron radiation emitted by multipole wigglers, concentrating on the effective source size and brightness and the so-called “depth of field” effects, concerning which there has been some controversy in the literature. By comparing calculations made with both geometrical optics and wave optics methods we demonstrate that the two approaches are not at variance, and that the wave optics results tend towards those of geometrical optics under well-defined conditions.

The ETA-II linear induction accelerator and IMP wiggler: A high-average-power millimeter-wave free-electron-laser for plasma heating

International Nuclear Information System (INIS)

Allen, S.L.; Scharlemann, E.T.

1992-05-01

We have constructed a 140-GHz free-electron laser to generate high-average-power microwaves for heating the MTX tokamak plasma. A 5.5-m steady-state wiggler (intense Microwave Prototype-IMP) has been installed at the end of the upgraded 60-cell ETA-II accelerator, and is configured as an FEL amplifier for the output of a 140-GHz long-pulse gyrotron. Improvements in the ETA-II accelerator include a multicable-feed power distribution network, better magnetic alignment using a stretched-wire alignment technique (SWAT). and a computerized tuning algorithm that directly minimizes the transverse sweep (corkscrew motion) of the electron beam. The upgrades were first tested on the 20-cell, 3-MeV front end of ETA-II and resulted in greatly improved energy flatness and reduced corkscrew motion. The upgrades were then incorporated into the full 60-cell configuration of ETA-II, along with modifications to allow operation in 50-pulse bursts at pulse repetition frequencies up to 5 kHz. The pulse power modifications were developed and tested on the High Average Power Test Stand (HAPTS), and have significantly reduced the voltage and timing jitter of the MAG 1D magnetic pulse compressors. The 2-3 kA. 6-7 MeV beam from ETA-II is transported to the IMP wiggler, which has been reconfigured as a laced wiggler, with both permanent magnets and electromagnets, for high magnetic field operation. Tapering of the wiggler magnetic field is completely computer controlled and can be optimized based on the output power. The microwaves from the FEL are transmitted to the MTX tokamak by a windowless quasi-optical microwave transmission system. Experiments at MTX are focused on studies of electron-cyclotron-resonance heating (ECRH) of the plasma. We summarize here the accelerator and pulse power modifications, and describe the status of ETA-II, IMP, and MTX operations

The ETA-II linear induction accelerator and IMP wiggler: A high-average-power millimeter-wave free-electron laser for plasma heating

International Nuclear Information System (INIS)

Allen, S.L.; Scharlemann, E.T.

1993-01-01

The authors have constructed a 140-GHz free-electron laser to generate high-average-power microwaves for heating the MTX tokamak plasma. A 5.5-m steady-state wiggler (Intense Microwave, Prototype-IMP) has been installed at the end of the upgraded 60-cell ETA-II accelerator, and is configured as an FEL amplifier for the output of a 140-GHz long-pulse gyrotron. Improvements in the ETA-II accelerator include a multicable-feed power distribution network, better magnetic alignment using a stretched-wire alignment technique (SWAT), and a computerized tuning algorithm that directly minimizes the transverse sweep (corkscrew motion) of the electron beam. The upgrades were first tested on the 20-cell, 3-MeV front end of ETA-II and resulted in greatly improved energy flatness and reduced corkscrew motion. The upgrades were then incorporated into the full 60-cell configuration of ETA-II, along with modifications to allow operation in 50-pulse bursts at pulse repetition frequencies up to 5 kHz. The pulse power modifications were developed and tested on the High Average Power Test Stand (HAPTS), and have significantly reduced the voltage and timing jitter of the MAG 1D magnetic pulse compressors. The 2-3 kA, 6-7 MeV beam from ETA-II is transported to the IMP wiggler, which has been reconfigured as a laced wiggler, with both permanent magnets and electromagnets, for high magnetic field operation. Tapering of the wiggler magnetic field is completely computer controlled and can be optimized based on the output power. The microwaves from the FEL are transmitted to the MTX tokamak by a windowless quasi-optical microwave transmission system. Experiments at MTX are focused on studies of electron-cyclotron-resonance heating (ECRH) of the plasma. The authors summarize here the accelerator and pulse power modifications, and describe the status of ETA-II, IMP, and MTX operations

Far-infrared fusion plasma diagnostics. Task IIIA. Final report

International Nuclear Information System (INIS)

Luhmann, N.C. Jr.

1986-01-01

The Task IIIA program at UCLA has been concerned with the development of innovative yet practical plasma diagnostic systems capable of providing detailed information essential to the success of the fusion program but not presently available within the fusion community. Historically, this has involved an initial development in the laboratory, followed by a test of feasibility on the Microtor tokamak prior to transfer of the technique/instrument to main line fusion devices. Strong emphasis has been placed upon the far-infrared (FIR) spectral region where novel diagnostic systems and technology have been developed and then distributed throughout the fusion program. The major diagnostics under development have been the measurement of plasma microturbulence and coherent modes via multichannel cw collective Thomson scattering, and the application of phase/polarization imaging techniques to provide accurate and detailed (>20 channel) electron density and current profiles not presently available using conventional methods. The eventual transfer of the above techniques to main line fusion devices is, of course, a major goal of the UCLA development program. The multichannel scattering development at UCLA was efficiently transferred to TEXT a few years ago. The apparatus has been employed to investigate the strong spectral and spatial asymmetries in the microturbulence uncovered through the unique multichannel and spatial scanning capabilities of the system. The scattering apparatus has also produced evidence for the ion pressure gradient driven eta/sub i/ modes thought responsible for anomalous transport in the edge regions of tokamak plasmas, as well as providing insight into the wave-wave coupling processes between various plasma modes

Far-infrared Spectral Radiance Observations and Modeling of Arctic Cirrus: Preliminary Results From RHUBC

Science.gov (United States)

Humpage, Neil; Green, Paul D.; Harries, John E.

2009-03-01

Recent studies have highlighted the important contribution of the far-infrared (electromagnetic radiation with wavelengths greater than 12 μm) to the Earth's radiative energy budget. In a cloud-free atmosphere, a significant fraction of the Earth's cooling to space from the mid- and upper troposphere takes place via the water vapor pure rotational band between 17 and 33 μm. Cirrus clouds also play an important role in the Earth's outgoing longwave radiation. The effect of cirrus on far-infrared radiation is of particular interest, since the refractive index of ice depends strongly on wavelength in this spectral region. The scattering properties of ice crystals are directly related to the refractive index, so consequently the spectral signature of cirrus measured in the FIR is sensitive to the cloud microphysical properties [1, 2]. By examining radiances measured at wavelengths between the strong water vapor absorption lines in the FIR, the understanding of the relationship between cirrus microphysics and the radiative transfer of thermal energy through cirrus may be improved. Until recently, very few observations of FIR spectral radiances had been made. The Tropospheric Airborne Fourier Transform Spectrometer (TAFTS) was developed by Imperial College to address this lack of observational data. TAFTS observes both zenith and nadir radiances at 0.1 cm-1 resolution, between 80 and 600 cm-1. During February and March 2007, TAFTS was involved in RHUBC (the Radiative Heating in Under-explored Bands Campaign), an ARM funded field campaign based at the ACRF-North Slope of Alaska site near Barrow, situated at 71° latitude. Infrared zenith spectral observations were taken by both TAFTS and the AERI-ER (spectral range 400-3300 cm-1) from the ground during both cloud-free and cirrus conditions. A wide range of other instrumentation was also available at the site, including a micropulse lidar, 35 GHz radar and the University of Colorado/NOAA Ground-based Scanning Radiometer

Far-infrared pedestrian detection for advanced driver assistance systems using scene context

Science.gov (United States)

Wang, Guohua; Liu, Qiong; Wu, Qingyao

2016-04-01

Pedestrian detection is one of the most critical but challenging components in advanced driver assistance systems. Far-infrared (FIR) images are well-suited for pedestrian detection even in a dark environment. However, most current detection approaches just focus on pedestrian patterns themselves, where robust and real-time detection cannot be well achieved. We propose a fast FIR pedestrian detection approach, called MAP-HOGLBP-T, to explicitly exploit the scene context for the driver assistance system. In MAP-HOGLBP-T, three algorithms are developed to exploit the scene contextual information from roads, vehicles, and background objects of high homogeneity, and we employ the Bayesian approach to build a classifier learner which respects the scene contextual information. We also develop a multiframe approval scheme to enhance the detection performance based on spatiotemporal continuity of pedestrians. Our empirical study on real-world datasets has demonstrated the efficiency and effectiveness of the proposed method. The performance is shown to be better than that of state-of-the-art low-level feature-based approaches.

Free electron laser with small period wiggler and sheet electron beam: A study of the feasibility of operation at 300 GHz with 1 MW CW output power

International Nuclear Information System (INIS)

Booske, J.H.; Granatstein, V.L.; Antonsen, T.M. Jr.

1988-01-01

The use of a small period wiggler (/ell//sub ω/ 2 ). Based on these encouraging results, a proof-of-principle experiment is being assembled, and is aimed at demonstrating FEL operating at 120 GHz with 300 kW output power in 1 μs pulses: electron energy would be 410 keV. Preliminary design of a 300 GHz 1 MW FEL with an untapered wiggler is also presented. 10 refs., 5 figs., 3 tabs

Effects of intermittent CO2 convection under far-infrared radiation on vacuum drying of pre-osmodehydrated watermelon.

Science.gov (United States)

Chakraborty, Rajat; Mondal, Pijus

2017-08-01

Watermelon, a tropical seasonal fruit with high nutrient content, requires preservation through drying due to its perishable nature. Nevertheless, drying of watermelon through conventional processes has a negative impact either on the drying time or on the final product quality. In this work, osmotic dehydration of watermelon followed by far-infrared radiation-assisted vacuum drying (FIRRAVD) was optimized to develop dehydrated watermelon with minimum moisture content. Significantly, during FIRRAVD, an attempt was made to further intensify the drying rate by forced convection through intermittent CO 2 injection. Drying kinetics of each operation and physicochemical qualities of dried products were evaluated. FIRRAVD was a viable method of watermelon drying with appreciably high moisture diffusivity (D eff,m ) of 4.97 × 10 -10 to 1.49 × 10 -9 m 2 s -1 compared to conventional tray drying. Moreover, intermittent CO 2 convection during FIRRAVD (ICFIRRAVD) resulted in appreciable intensification of drying rate, with enhanced D eff,m (9.93 × 10 -10 to 1.99 × 10 -9 m 2 s -1 ). Significantly, ICFIRRAVD required less energy and approximately 16% less time compared to FIRRAVD. The quality of the final dehydrated watermelon was superior compared to conventional drying protocols. The novel CO 2 convective drying of watermelon in the presence of far-infrared radiation demonstrated an energy-efficient and time-saving operation rendering a dehydrated watermelon with acceptable quality parameters. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Chicane and wiggler based bunch compressors for future linear colliders

International Nuclear Information System (INIS)

Raubenheimer, T.O.; Emma, P.; Kheifets, S.

1993-05-01

In this paper, we discuss bunch compressors for future linear colliders. In the past, the bunch compression optics has been based upon achromatic cells using strong sextupoles to correct the dispersive and betatron chromaticity. To preserve the very small emittances required in most future collider designs, these schemes tend to have very tight alignment tolerances. Here, we describe bunch compressors based upon magnetic chicanes or wigglers which do need sextupoles to correct the chromatic emittance dilution. The dispersive chromaticity cancels naturally and the betatron chromaticity is not a significant source of emittance dilution. Thus, these schemes allow for substantially reduced alignment tolerances. Finally, we present a detailed design for the NLC linear collider

Far-infrared laser interferometry measurements on the STP-3(M) reversed-field pinch

International Nuclear Information System (INIS)

Kubota, Shigeyuki; Nagatsu, Masaaki; Tsukishima, Takashige; Arimoto, Hideki; Sato, Koichi; Matsuoka, Akio.

1993-09-01

Far-infrared laser interferometry at 432 μm was carried out on the STP-3(M) reversed-field pinch. Measurements along two vertical chords showed a change from a parabolic-like to a flat-like electron density profile after field reversal. A density profile inversion and a correlated toroidal magnetic flux perturbation were also observed during the transition from the current rising to the current decay phase. Measurements of electron density fluctuations indicated relative fluctuation levels of ∼10% for both chords during the current rising phase and ∼5% and ∼15% during the current decay phase for the central and outer chords, respectively. Spectral analysis showed a ∼30 kHz mode consistent with poloidal mode number m=0 magnetic fluctuations, and a ∼90 kHz mode localized to the outer region of the plasma, which was strongly excited during the current decay phase and may be connected to particle and energy transport in STP-3(M). (author)

CSEM-steel hybrid wiggler/undulator magnetic field studies

International Nuclear Information System (INIS)

Halbach, K.; Hoyer, E.; Marks, S.; Plate, D.; Shuman, D.

1985-05-01

Current design of permanent magnet wiggler/undulators use either pure charge sheet equivalent material (CSEM) or the CSEM-Steel hybrid configuration. Hybrid configurations offer higher field strength at small gaps, field distributions dominated by the pole surfaces and pole tuning. Nominal performance of the hybrid is generally predicted using a 2-D magnetic design code neglecting transverse geometry. Magnetic measurements are presented showing transverse configuration influence on performance, from a combination of models using CSEMs, REC (H/sub c/ = 9.2 kOe) and NdFe (H/sub c/ = 10.7 kOe), different pole widths and end configurations. Results show peak field improvement using NdFe in place of REC in identical models, gap peak field decrease with pole width decrease (all results less than computed 2-D fields), transverse gap field distributions, and importance of CSEM material overhanging the poles in the transverse direction for highest gap fields

Installation of a second superconducting wiggler at SAGA-LS

Energy Technology Data Exchange (ETDEWEB)

Kaneyasu, T., E-mail: kaneyasu@saga-ls.jp; Takabayashi, Y.; Iwasaki, Y.; Koda, S. [SAGA Light Source, 8-7 Yayoigaoka, Tosu 841-0005 (Japan)

2016-07-27

The SAGA Light Source is a synchrotron radiation facility consisting of a 255 MeV injector linac and a 1.4 GeV storage ring with a circumference of 75.6 m. A superconducting wiggler (SCW) with a peak magnetic field of 4 T has been routinely operating for generating hard X-rays since its installation in 2010. In light of this success, it was decided to install a second SCW as a part of the beamline construction by Sumitomo Electric Industries. To achieve this, machine modifications including installation of a new magnet power supply, improvement of the magnet control system, and replacement of the vacuum chambers in the storage ring were carried out. Along with beamline construction, installation and commissioning of the second SCW are scheduled to take place in 2015.

Detection of small surface vessels in near, medium, and far infrared spectral bands

Science.gov (United States)

Dulski, R.; Milewski, S.; Kastek, M.; Trzaskawka, P.; Szustakowski, M.; Ciurapinski, W.; Zyczkowski, M.

2011-11-01

Protection of naval bases and harbors requires close co-operation between security and access control systems covering land areas and those monitoring sea approach routes. The typical location of naval bases and harbors - usually next to a large city - makes it difficult to detect and identify a threat in the dense regular traffic of various sea vessels (i.e. merchant ships, fishing boats, tourist ships). Due to the properties of vessel control systems, such as AIS (Automatic Identification System), and the effectiveness of radar and optoelectronic systems against different targets it seems that fast motor boats called RIB (Rigid Inflatable Boat) could be the most serious threat to ships and harbor infrastructure. In the paper the process and conditions for the detection and identification of high-speed boats in the areas of ports and naval bases in the near, medium and far infrared is presented. Based on the results of measurements and recorded thermal images the actual temperature contrast delta T (RIB / sea) will be determined, which will further allow to specify the theoretical ranges of detection and identification of the RIB-type targets for an operating security system. The data will also help to determine the possible advantages of image fusion where the component images are taken in different spectral ranges. This will increase the probability of identifying the object by the multi-sensor security system equipped additionally with the appropriate algorithms for detecting, tracking and performing the fusion of images from the visible and infrared cameras.

Electron acceleration from rest to GeV energy by chirped axicon Gaussian laser pulse in vacuum in the presence of wiggler magnetic field

Science.gov (United States)

Kant, Niti; Rajput, Jyoti; Singh, Arvinder

2018-03-01

This paper presents a scheme of electron energy enhancement by employing frequency - chirped lowest order axicon focussed radially polarised (RP) laser pulse in vacuum under the influence of wiggler magnetic field. Terawatt RP laser can be focussed down to ∼5μm by an axicon optical element, which produces an intense longitudinal electric field. This unique property of axicon focused Gaussian RP laser pulse is employed for direct electron acceleration in vacuum. A linear frequency chirp increases the time duration of laser-electron interaction, whereas, the applied magnetic wiggler helps in improving the strength of ponderomotive force v→ ×B→ and periodically deflects electron in order to keep it traversing in the accelerating phase up to longer distance. Numerical simulations have been carried out to investigate the influence of laser, frequency chirp and magnetic field parameters on electron energy enhancement. It is noticed that an electron from rest can be accelerated up to GeV energy under optimized laser and magnetic field parameters. Significant enhancement in the electron energy gain of the order of 11.2 GeV is observed with intense chirped laser pulse in the presence of wiggler magnetic field of strength 96.2 kG.

Modeling the HD 32297 Debris Disk With Far-Infrared Herschel Data

Science.gov (United States)

Donaldson, J.K.; Lebreton, J.; Roberge, A.; Augereau, J.-C.; Krivov, A. V.

2013-01-01

HD 32297 is a young A-star (approx. 30 Myr) 112 pc away with a bright edge-on debris disk that has been resolved in scattered light. We observed the HD 32297 debris disk in the far-infrared and sub-millimeter with the Herschel Space Observatory PACS and SPIRE instruments, populating the spectral energy distribution (SED) from 63 to 500 micron..We aimed to determine the composition of dust grains in the HD 32297 disk through SED modeling, using geometrical constraints from the resolved imaging to break the degeneracies inherent in SED modeling. We found the best fitting SED model has two components: an outer ring centered around 110 AU, seen in the scattered light images, and an inner disk near the habitable zone of the star. The outer disk appears to be composed of grains>2 micron consisting of silicates, carbonaceous material, and water ice with an abundance ratio of 1:2:3 respectively and 90% porosity. These grains appear consistent with cometary grains, implying the underlying planetesimal population is dominated by comet-like bodies. We also discuss the 3.7 sigma detection of [C ii] emission at 158 micron with the Herschel PACS instrument, making HD 32297 one of only a handful of debris disks with circumstellar gas detected

Lattice Design for a High-Power Infrared FEL

Science.gov (United States)

Douglas, D. R.

1997-05-01

A 1 kW infrared FEL, funded by the U.S. Navy, is under construction at Jefferson Lab. This device will be driven by a compact, 42 MeV, 5 mA, energy-recovering, CW SRF-based linear accelerator to produce light in the 3-6.6 μm range. The machine concept comprises a 10 MeV injector, a linac based on a single high-gradient Jefferson Lab accelerator cryomodule, a wiggler and optical cavity, and an energy-recovery recirculation arc. Energy recovery limits cost and technical risk by reducing the RF power requirements in the driver accelerator. Following deceleration to 10 MeV, the beam is dumped. Stringent phase space requirements at the wiggler, low beam energy, and high beam current subject the accelerator lattice to numerous constraints. Principal considerations include: transport and delivery to the FEL of a high-quality, high-current beam; the impact of coherent synchrotron radiation (CSR) during beam recirculation transport; beam optics aberration control, to provide low-loss energy-recovery transport of a 5% relative momentum spread, high-current beam; attention to possible beam breakup (BBU) instabilities in the recirculating accelerator; and longitudinal phase space management during beam transport, to optimize RF drive system control during energy recovery and FEL operation. The presentation will address the design process and design solution for an accelerator transport lattice that meets the requirements imposed by these physical phenomena and operational necessities.

Measurement of the relative rate of prompt $\\chi_{c0}$, $\\chi_{c1}$ and $\\chi_{c2}$ production at $\\sqrt{s}=7$TeV

CERN Document Server

Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; Mc Skelly, B; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

2013-01-01

Prompt production of charmonium $\\chi_{c0}$, $\\chi_{c1}$ and $\\chi_{c2}$ mesons is studied using proton-proton collisions at the LHC at a centre-of-mass energy of $\\sqrt{s}=7$TeV. The $\\chi_{c}$ mesons are identified through their decay to $J/\\psi\\gamma$, with $J/\\psi\\rightarrow\\mu^+mu^-$ using photons that converted in the detector. A data sample, corresponding to an integrated luminosity of $1.0\\mathrm{fb}^{-1}$ collected by the LHCb detector, is used to measure the relative prompt production rate of $\\chi_{c1}$ and $\\chi_{c2}$ in the rapidity range $2.0chi_{c0}$ meson production at a hadron collider is also presented.

Far infrared (terahertz) spectroscopy of a series of polycyclic aromatic hydrocarbons and application to structure interpretation of asphaltenes and related compounds.

Science.gov (United States)

Cataldo, Franco; Angelini, Giancarlo; García-Hernández, D Aníbal; Manchado, Arturo

2013-07-01

A series of 33 different polycyclic aromatic hydrocarbons (PAHs) were studied by far infrared spectroscopy (terahertz spectroscopy) in the spectral range comprised between 600 and 50 cm(-1). In addition to common PAHs like naphthalene, anthracene, phenanthrene, fluoranthene, picene, pyrene, benzo[α]pyrene, and perylene, also quite unusual PAHs were studied like tetracene, pentacene, acenaphtene, acenaphtylene, triphenylene, and decacyclene. A series of alkylated naphthalenes and anthracenes were studied as well as methypyrene. Partially or totally hydrogenated PAHs were also object of the present investigation, ranging from tetrahydronaphthalene (tetralin) to decahydronaphthalene (decalin), 9,10-dihydroanthracene, 9,10-dihydrophenanthrene, hexahydropyrene, and dodecahydrotriphenylene. Finally, the large and quite rare PAHs coronene, quaterrylene, hexabenzocoronene, and dicoronylene were studied by far infrared spectroscopy. The resulting reference spectra were used in the interpretation of the chemical structure of asphaltenes (as extracted from a heavy petroleum fraction and from bitumen), the chemical structures of other petroleum fractions known as DAE (distillate aromatic extract) and RAE (residual aromatic extract), and a possible interpretation of components of the chemical structure of anthracite coal. Asphaltenes, heavy petroleum fractions, and coal were proposed as model compounds for the interpretation of the emission spectra of certain proto-planetary nebulae (PPNe) with a good matching in the mid infrared between the band pattern of the PPNe emission spectra and the spectra of these oil fractions or coal. Although this study was finalized in an astrochemical context, it may find application also in the petroleum and coal chemistry. Copyright © 2013 Elsevier B.V. All rights reserved.

A new type of permanent magnet ondulator and wiggler

International Nuclear Information System (INIS)

Jianming, X.; Maosan, L.; Qing, X.

1987-01-01

A new type of permanent magnet ondulator and wiggler is discussed. In this new design the magnet is composed of permanent magnet segments with modulated thickness. The magnetization directions of the segments are all perpendicular to the symmetrical plane of the magnet gap. By modulating the thicknesses of the segments, the field distribution is a pure sinusoidal curve in the ideal 2-dimensional case. The spatial expressions of the magnet field in the ideal case and in the real case are given. The methods for reducing the undesirable harmonics in the magnet field in the real case are discussed. Because of the arrangement of the magnetization directions of the magnet segments, soft iron shield can be used to strenghten the magnet field. In some cases, the stregnthening factor is more than two. The strenghtening effect of the soft iron shield is analysed also

Determination of thicknesses and temperatures of crystalline silicon wafers from optical measurements in the far infrared region

Science.gov (United States)

Franta, Daniel; Franta, Pavel; Vohánka, Jiří; Čermák, Martin; Ohlídal, Ivan

2018-05-01

Optical measurements of transmittance in the far infrared region performed on crystalline silicon wafers exhibit partially coherent interference effects appropriate for the determination of thicknesses of the wafers. The knowledge of accurate spectral and temperature dependencies of the optical constants of crystalline silicon in this spectral region is crucial for the determination of its thickness and vice versa. The recently published temperature dependent dispersion model of crystalline silicon is suitable for this purpose. Because the linear thermal expansion of crystalline silicon is known, the temperatures of the wafers can be determined with high precision from the evolution of the interference patterns at elevated temperatures.

Design of a far infrared interferometer diagnostic support structure

International Nuclear Information System (INIS)

Brooksby, C.A.; Rice, B.W.; Peebles, W.A.

1987-10-01

The Far Infrared Interferometer (FIR) diagnostic will operate in the 119 to 400 micron range to measure the plasma electron density on the Microwave Tokamak Experiment (MTX) being set up at LLNL. This diagnostic is a multi-channel system which incorporates a long elliptically shaped beam that passes through the plasma and is imaged onto an array of 14 detectors that are located on a table above the machine. The reference beam is brought around the machine and mixed with the plasma beam onto the detectors. The density is measured by a phase shift between these beams and is, therefore, very sensitive to path length changes between the two beam paths due to motion of the support structure. The design goal for allowable phase shifts caused by changes in the path length due to structure movement is 1/50th of a wavelength (2.4 to 8 microns). The structure needs to maintain this stability during the 0.5 second plasma shot. The structure is approximately 5 meters tall to support the optics table above the machine. In order to reduce the structure motion to the required level the forces acting on it were evaluated. The forces evaluated were eddy currents from the pulsed electromagnetic fields, the ambient ground motion, and the floor movement as the magnets are pulsed. The designs for similar diagnostic interferometers on other tokamaks were also reviewed to evaluate the forces and motions that might cause such small deflections in the support structure. Our structure is somewhat unique in that it is designed for operation in relatively large pulsed magnetic fields (100 to 7000 gauss) arising from the air core transformer of MTX. The design chosen incorporates a very rigid structure with high resistive and non-conductive materials. The choice of materials selected is discussed with reference to their response to expected forces. 14 refs., 10 figs

Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

CERN Document Server

Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

2014-10-14

The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

A precursory ULF signature for the Chi-Chi earthquake in Taiwan

Directory of Open Access Journals (Sweden)

Y. Akinaga

2001-01-01

Full Text Available ULF emission data at Lunping (epicentral distance, 120 km have been analysed for the Chi-Chi earthquake (with magnitude 7.6 and depth of 11 km in Taiwan which occurred on 21 September 1999. Simple intensity analyses have not yielded any significant results but we have found, based on the analysis of polarization (the ratio of vertical magnetic field component Z to the horizontal component G, that the polarization (Z/G showed a significant enhancement for two months before the earthquake. This kind of temporal evolution of polarization seems to be very similar to previous results, so that it is highly likely that this phenomenon may be associated with the Chi-Chi earthquake. Also, the comparison of the results of polarization analyses, by changing the signal threshold, has given us an approximate intensity of the seismogenic emission of the order of the monthly mean value.

Computed tomographic analysis of vegetable during far infrared radiation drying process

International Nuclear Information System (INIS)

Maneechot, P.; Tojo, S.; Watanabe, K.

2006-01-01

Far Infrared Radiation (FIR) technology is widely used in the automotive industry to cure painted finishes during manufacturing. FIR drying is used not only in manufacturing but also in agricultural processing such as rice drying. At the present time, FIR drying technology has rarely been used for fruits and vegetables except in research laboratories. In this study, FIR drying and hot air convection drying were compared with respect to energy consumption and time requirement. The internal changes of the agricultural product were also observed during the FIR drying process. A Computed Tomographic (CT) scanner was employed for the observation of the tested material, carrot, and was used to analyze the structural deformation and the internal moisture distribution of the test material. CT data and the hardness of the sample were recorded at regular intervals during the drying experiment. For 200, 400 and 600W FIR drying, the maximum drying rates were 173, 459 and 724%d.b./hr respectively, and the required drying times were 26, 12 and 4.5 hours, respectively. The structure of the carrot sample shrank in accordance with the reduction of moisture content in 200W FIR drying as well as in hot air drying, whereas in 400W and 600W FIR drying the sample was dried without so much deformation

Safari: instrument design of the far-infrared imaging spectrometer for spica

Science.gov (United States)

Jellema, W.; Pastor, C.; Naylor, D.; Jackson, B.; Sibthorpe, B.; Roelfsema, P.

2017-11-01

The next great leap forward in space-based far-infrared astronomy will be made by the Japanese-led SPICA mission, which is anticipated to be launched late 2020's as the next large astrophysics mission of JAXA, in partnership with ESA and with key European contributions. Filling in the gap between JWST and ALMA, the SPICA mission will study the evolution of galaxies, stars and planetary systems. SPICA will utilize a deeply cooled 3m-class telescope, provided by European industry, to realize zodiacal background limited performance, high spatial resolution and large collecting area. Making full advantage of the deeply cooled telescope (architecture. We will describe the reference design of the SAFARI focal- plane unit, the implementation of the various optical instrument functions designed around the central large-stroke FTS system, the photometric band definition and out-of-band filtering by quasioptical elements, the control of straylight, diffraction and thermal emission in the long-wavelength limit, and how we interface to the large-format FPA arrays at one end and the SPICA telescope assembly at the other end. We will briefly discuss the key performance drivers with special emphasis on the optical techniques adopted to overcome issues related to very low background operation of SAFARI. A summary and discussion of the expected instrument performance and an overview of the astronomical capabilities finally conclude the paper.

The impact of clustering and angular resolution on far-infrared and millimeter continuum observations

Science.gov (United States)

Béthermin, Matthieu; Wu, Hao-Yi; Lagache, Guilaine; Davidzon, Iary; Ponthieu, Nicolas; Cousin, Morgane; Wang, Lingyu; Doré, Olivier; Daddi, Emanuele; Lapi, Andrea

2017-11-01

Follow-up observations at high-angular resolution of bright submillimeter galaxies selected from deep extragalactic surveys have shown that the single-dish sources are comprised of a blend of several galaxies. Consequently, number counts derived from low- and high-angular-resolution observations are in tension. This demonstrates the importance of resolution effects at these wavelengths and the need for realistic simulations to explore them. We built a new 2 deg2 simulation of the extragalactic sky from the far-infrared to the submillimeter. It is based on an updated version of the 2SFM (two star-formation modes) galaxy evolution model. Using global galaxy properties generated by this model, we used an abundance-matching technique to populate a dark-matter lightcone and thus simulate the clustering. We produced maps from this simulation and extracted the sources, and we show that the limited angular resolution of single-dish instruments has a strong impact on (sub)millimeter continuum observations. Taking into account these resolution effects, we are reproducing a large set of observables, as number counts and their evolution with redshift and cosmic infrared background power spectra. Our simulation consistently describes the number counts from single-dish telescopes and interferometers. In particular, at 350 and 500 μm, we find that the number counts measured by Herschel between 5 and 50 mJy are biased towards high values by a factor 2, and that the redshift distributions are biased towards low redshifts. We also show that the clustering has an important impact on the Herschel pixel histogram used to derive number counts from P(D) analysis. We find that the brightest galaxy in the beam of a 500 μm Herschel source contributes on average to only 60% of the Herschel flux density, but that this number will rise to 95% for future millimeter surveys on 30 m-class telescopes (e.g., NIKA2 at IRAM). Finally, we show that the large number density of red Herschel sources

Traveling waves in a free-electron laser with an electromagnetic wiggler

International Nuclear Information System (INIS)

Olumi, Mohsen; Maraghechi, B; Rouhani, M H

2011-01-01

The propagation of electromagnetic traveling wave in a free-electron laser (FEL) with an electromagnetic wiggler is investigated using the relativistic fluid-Maxwell formulation. By adapting the traveling-wave ansatz, three coupled, nonlinear ordinary differential equations are obtained describing the nonlinear propagation of the coupled wave. These equations may be used to study saturation in FELs. By linearizing the nonlinear equations dispersion relations for the traveling wave are obtained. Numerical solution of the small-signal traveling dispersion relation reveals the coupling of radiation to both slow and fast space-charge waves. It is shown that the traveling wave, which is not a normal mode in a laboratory frame, becomes a normal mode in terms of a transformed variable.

Generalized theory of a free-electron laser in a helical wiggler and guide magnetic fields using the kinetic approach

International Nuclear Information System (INIS)

Misra, K.D.; Mishra, P.K.

2002-01-01

A self-consistent theory of a free-electron laser is developed by the kinetic approach, using the method of characteristics in helical wiggler and guide magnetic fields. The detailed relativistic particle trajectories obtained in wiggler and guide magnetic fields are used in linearized Vlasov-Maxwell equations having variations in perpendicular and parallel momenta to obtain the perturbed distribution function in terms of perturbed electric and magnetic fields deviating from the vector potential approach. The perturbed distribution function thus obtained, having variations in perpendicular and parallel momenta for an arbitrary distribution function, is used to obtain current, conductivity and dielectric tensors. The full dispersion relation (FDR) and Compton dispersion relation (CDR) have been obtained. The dispersion diagram has been obtained and the interaction of the negative longitudinal space charge with the electromagnetic wave has been shown. The temporal growth rates obtained from the full dispersion relation and Compton dispersion relation for the tenuous cold relativistic beam in microwave region have been discussed

Magnetic X-ray measurements using the elliptical multipole wiggler

International Nuclear Information System (INIS)

Montano, P. A.; Li, Y.; Beno, M. A.; Jennings, G.; Kimball, C. W.

1999-01-01

The EMW at the BESSRC beam lines at the APS provides high photon flux at high energies with the capability of producing circular polarization on axis. The authors observe a high degree of circularly polarized x-rays at such energies. The polarization and frequency tunability of the elliptical multipole wiggler (EMW) is an ideal source for many magnetic measurements from X-ray Magnetic Circular Dichroism (XMCD) to Compton scattering experiments. They performed Compton scattering measurements to determine the polarization and photon flux at the sample as a function of the deflection parameters K y and K x . They used for their measurements a Si (220) Laue monochromator providing simultaneous photon energies at 50 keV, 100 keV and 150 keV. Magnetic Compton Profiles were determined by either switching the magnet polarity or the photon helicity. The results obtained using Fe(110) single crystals were very similar

Measurement of the cross-section ratio $\\sigma(\\chi_{c2})/\\sigma(\\chi_{c1})$ for prompt $\\chi_c$ production at $\\sqrt{s}=7$ TeV

CERN Document Server

INSPIRE-00258707; Abellan Beteta, C.; Adeva, B.; Adinolfi, M.; Adrover, C.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Alkhazov, G.; Alvarez Cartelle, P.; Alves Jr, A.A.; Amato, S.; Amhis, Y.; Anderson, J.; Appleby, R.B.; Aquines Gutierrez, O.; Archilli, F.; Arrabito, L.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Bachmann, S.; Back, J.J.; Bailey, D.S.; Balagura, V.; Baldini, W.; Barlow, R.J.; Barschel, C.; Barsuk, S.; Barter, W.; Bates, A.; Bauer, C.; Bauer, Th.; Bay, A.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Benayoun, M.; Bencivenni, G.; Benson, S.; Benton, J.; Bernet, R.; Bettler, M.O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P.M.; Blake, T.; Blanc, F.; Blanks, C.; Blouw, J.; Blusk, S.; Bobrov, A.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Bowcock, T.J.V.; Bozzi, C.; Brambach, T.; van den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N.H.; Brown, H.; Buchler-Germann, A.; Burducea, I.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Callot, O.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cattaneo, M.; Cauet, Ch.; Charles, M.; Charpentier, Ph.; Chiapolini, N.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P.E.L.; Clemencic, M.; Cliff, H.V.; Closier, J.; Coca, C.; Coco, V.; Cogan, J.; Collins, P.; Comerma-Montells, A.; Constantin, F.; Conti, G.; Contu, A.; Cook, A.; Coombes, M.; Corti, G.; Cowan, G.A.; Currie, R.; D'Almagne, B.; D'Ambrosio, C.; David, P.; David, P.N.Y.; De Bonis, I.; De Capua, S.; De Cian, M.; De Lorenzi, F.; de Miranda, J.M.; De Paula, L.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Degaudenzi, H.; Deissenroth, M.; Del Buono, L.; Deplano, C.; Derkach, D.; Deschamps, O.; Dettori, F.; Dickens, J.; Dijkstra, H.; Diniz Batista, P.; Bonal, F.Domingo; Donleavy, S.; Dordei, F.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Dzhelyadin, R.; Dziurda, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; van Eijk, D.; Eisele, F.; Eisenhardt, S.; Ekelhof, R.; Eklund, L.; Elsasser, Ch.; Elsby, D.; Esperante Pereira, D.; Esteve, L.; Falabella, A.; Fanchini, E.; Farber, C.; Fardell, G.; Farinelli, C.; Farry, S.; Fave, V.; Fernandez Albor, V.; Ferro-Luzzi, M.; Filippov, S.; Fitzpatrick, C.; Fontana, M.; Fontanelli, F.; Forty, R.; Frank, M.; Frei, C.; Frosini, M.; Furcas, S.; Gallas Torreira, A.; Galli, D.; Gandelman, M.; Gandini, P.; Gao, Y.; Garnier, J-C.; Garofoli, J.; Garra Tico, J.; Garrido, L.; Gascon, D.; Gaspar, C.; Gauvin, N.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gibson, V.; Gligorov, V.V.; Gobel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Grabalosa Gandara, M.; Graciani Diaz, R.; Granado Cardoso, L.A.; Grauges, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Haefeli, G.; Haen, C.; Haines, S.C.; Hampson, T.; Hansmann-Menzemer, S.; Harji, R.; Harnew, N.; Harrison, J.; Harrison, P.F.; He, J.; Heijne, V.; Hennessy, K.; Henrard, P.; Hernando Morata, J.A.; van Herwijnen, E.; Hicks, E.; Holubyev, K.; Hopchev, P.; Hulsbergen, W.; Hunt, P.; Huse, T.; Huston, R.S.; Hutchcroft, D.; Hynds, D.; Iakovenko, V.; Ilten, P.; Imong, J.; Jacobsson, R.; Jaeger, A.; Jahjah Hussein, M.; Jans, E.; Jansen, F.; Jaton, P.; Jean-Marie, B.; Jing, F.; John, M.; Johnson, D.; Jones, C.R.; Jost, B.; Kaballo, M.; Kandybei, S.; Karacson, M.; Karbach, T.M.; Keaveney, J.; Kenyon, I.R.; Kerzel, U.; Ketel, T.; Keune, A.; Khanji, B.; Kim, Y.M.; Knecht, M.; Koppenburg, P.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kruzelecki, K.; Kucharczyk, M.; Kvaratskheliya, T.; La Thi, V.N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R.W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J.P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leroy, O.; Lesiak, T.; Li, L.; Li Gioi, L.; Lieng, M.; Liles, M.; Lindner, R.; Linn, C.; Liu, B.; Liu, G.; Lopes, J.H.; Lopez Asamar, E.; Lopez-March, N.; Lu, H.; Luisier, J.; Raighne, A.Mac; Machefert, F.; Machikhiliyan, I.V.; Maciuc, F.; Maev, O.; Magnin, J.; Malde, S.; Mamunur, R.M.D.; Manca, G.; Mancinelli, G.; Mangiafave, N.; Marconi, U.; Marki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martin, L.; Martin Sanchez, A.; Martinez Santos, D.; Massafferri, A.; Mathe, Z.; Matteuzzi, C.; Matveev, M.; Maurice, E.; Maynard, B.; Mazurov, A.; McGregor, G.; McNulty, R.; Mclean, C.; Meissner, M.; Merk, M.; Merkel, J.; Messi, R.; Miglioranzi, S.; Milanes, D.A.; Minard, M.N.; Molina Rodriguez, J.; Monteil, S.; Moran, D.; Morawski, P.; Mountain, R.; Mous, I.; Muheim, F.; Muller, K.; Muresan, R.; Muryn, B.; Muster, B.; Musy, M.; Mylroie-Smith, J.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Nedos, M.; Needham, M.; Neufeld, N.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Nikitin, N.; Nomerotski, A.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Orlandea, M.; Otalora Goicochea, J.M.; Owen, P.; Pal, K.; Palacios, J.; Palano, A.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C.J.; Passaleva, G.; Patel, G.D.; Patel, M.; Paterson, S.K.; Patrick, G.N.; Patrignani, C.; Pavel-Nicorescu, C.; Pazos Alvarez, A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perego, D.L.; Perez Trigo, E.; Perez-Calero Yzquierdo, A.; Perret, P.; Perrin-Terrin, M.; Pessina, G.; Petrella, A.; Petrolini, A.; Phan, A.; Picatoste Olloqui, E.; Pie Valls, B.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Plackett, R.; Playfer, S.; Plo Casasus, M.; Polok, G.; Poluektov, A.; Polycarpo, E.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; du Pree, T.; Prisciandaro, J.; Pugatch, V.; Puig Navarro, A.; Qian, W.; Rademacker, J.H.; Rakotomiaramanana, B.; Rangel, M.S.; Raniuk, I.; Raven, G.; Redford, S.; Reid, M.M.; dos Reis, A.C.; Ricciardi, S.; Rinnert, K.; Roa Romero, D.A.; Robbe, P.; Rodrigues, E.; Rodrigues, F.; Rodriguez Perez, P.; Rogers, G.J.; Roiser, S.; Romanovsky, V.; Rosello, M.; Rouvinet, J.; Ruf, T.; Ruiz, H.; Sabatino, G.; Saborido Silva, J.J.; Sagidova, N.; Sail, P.; Saitta, B.; Salzmann, C.; Sannino, M.; Santacesaria, R.; Santamarina Rios, C.; Santinelli, R.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schaack, P.; Schiller, M.; Schleich, S.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M.H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Seyfert, P.; Shao, B.; Shapkin, M.; Shapoval, I.; Shatalov, P.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, O.; Shevchenko, V.; Shires, A.; Coutinho, R.Silva; Skwarnicki, T.; Smith, A.C.; Smith, N.A.; Smith, E.; Sobczak, K.; Soler, F.J.P.; Solomin, A.; Soomro, F.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stoica, S.; Stone, S.; Storaci, B.; Straticiuc, M.; Straumann, U.; Subbiah, V.K.; Swientek, S.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Teodorescu, E.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tran, M.T.; Tsaregorodtsev, A.; Tuning, N.; Garcia, M.Ubeda; Ukleja, A.; Urquijo, P.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vecchi, S.; Velthuis, J.J.; Veltri, M.; Viaud, B.; Videau, I.; Vilasis-Cardona, X.; Visniakov, J.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Voss, H.; Wandernoth, S.; Wang, J.; Ward, D.R.; Watson, N.K.; Webber, A.D.; Websdale, D.; Whitehead, M.; Wiedner, D.; Wiggers, L.; Wilkinson, G.; Williams, M.P.; Williams, M.; Wilson, F.F.; Wishahi, J.; Witek, M.; Witzeling, W.; Wotton, S.A.; Wyllie, K.; Xie, Y.; Xing, F.; Xing, Z.; Yang, Z.; Young, R.; Yushchenko, O.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W.C.; Zhang, Y.; Zhelezov, A.; Zhong, L.; Zverev, E.; Zvyagin, A.

2013-07-16

The prompt production of the charmonium $\\chi_{c1}$ and $\\chi_{c2}$ mesons has been studied in proton-proton collisions at the Large Hadron Collider at a centre-of-mass energy of $\\sqrt{s}=7$~TeV. The $\\chi_c$ mesons are identified through their decays $\\chi_c\\,\\rightarrow\\,J/\\psi\\,\\gamma$ with $J/\\psi\\,\\rightarrow\\,\\mu^+\\,\\mu^-$ using 36~$\\mathrm{pb^{-1}}$ of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for the two $\\chi_c$ spin states, $\\sigma(\\chi_{c2})\\,/\\,\\sigma(\\chi_{c1})$, has been determined as a function of the $J/\\psi$ transverse momentum, $p_{\\mathrm{T}}^{J/\\psi}$, in the range from 2 to 15~GeV/$c$. The results are in agreement with the next-to-leading order non-relativistic QCD model at high $p_{\\mathrm{T}}^{J/\\psi}$ and lie consistently above the pure leading-order colour singlet prediction.

Use of COTS uncooled microbolometers for the observation of solar eruptions in far infrared

Science.gov (United States)

Le Ruyet, B.; Bernardi, P.; Sémery, A.

2017-11-01

The Small Explorer for Solar Eruptions (SMESE) mission is a French-Chinese satellite dedicated to the combined study of coronal mass ejections and flares. It should operate by the beginning of 2013. The spacecraft is based on a generic MYRIADE platform developed by CNES. Its payload consists of a Lyman α imager and a Lyman α chronograph (LYOT), a far infrared telescope (DESIR) and a hard X and γ ray spectrometer (HEBS). Its Sun-synchronous orbit will allow for continuous observations. LESIA (Laboratoire d'Etudes Spatiales et d'Instrumentation en Astrophysique, in Paris-Meudon Observatory) is in charge of DESIR instrument. DESIR (Detection of Eruptive Solar InfraRed emission) is an imaging photometer observing the sun in two bandwidths: [25; 45μm] and [80; 130μm]. The detector is a commercially available, uncooled microbolometer focal plane array (UL 02 05 1, from ULIS) designed for thermographic imaging in the 8-14 μm wavelength range. The 160x120 pixels are based on amorphous silicon, with dimensions 35x35 μm2. The performances in terms of noise and dynamics given by the manufacturer associated with simulations of a perfect quarter-wave cavity to predict the microbolometer absorption, make possible the use of such a detector to fulfil the DESIR detection specifications in the two FIR bandwidths. During the A Phase, tests have been carried out in our laboratory to validate the feasibility of the project. In this work, we present the first results obtained on the microbolometer performances in the FIR domain.

Tai chi and chronic pain.

Science.gov (United States)

Peng, Philip W H

2012-01-01

In the last 2 decades, a growing body of research aimed at investigating the health benefits of Tai Chi in various chronic health conditions has been recognized in the literature. This article reviewed the history, the philosophy, and the evidence for the role of Tai Chi in a few selected chronic pain conditions. The ancient health art of Tai Chi contributes to chronic pain management in 3 major areas: adaptive exercise, mind-body interaction, and meditation. Trials examining the health benefit of Tai Chi in chronic pain conditions are mostly low quality. Only 5 pain conditions were reviewed: osteoarthritis, fibromyalgia, rheumatoid arthritis, low back pain, and headache. Of these, Tai Chi seems to be an effective intervention in osteoarthritis, low back pain, and fibromyalgia. The limitations of the Tai Chi study design and suggestions for the direction of future research are also discussed.

The solid molecular hydrogens in the ordered state as function of density and ortho-para concentration: a far infrared study

International Nuclear Information System (INIS)

Jochemsen, R.

1978-01-01

In this thesis, the results of far infrared absorption experiments on solid molecular hydrogen and deuterium are presented. In Chapter I an introduction to the properties of solid molecular hydrogens in given. The experimental system used for the high pressure infrared measurements and the data handling procedures are discussed in Chapter II. The theory of infrared absorption and the averaging of the dipole moment over the motion of the molecules is contained in Chapter III. In this chapter a general sum rule for the integrated absorption is derived. The remaining chapters present the results of the measurements and the discussion. In Chapter IV the author concentrates on the phonon frequencies as a function of ortho-para concentration and density, while in Chapter V measuremtns of phonon lineshape and integrated absorption intensities are presented. Finally, in Chapter VI, a study is given of the phase transition in solid hydrogen and deuterium. This study provides accurate values for the transition temperature as a function of density (in deuterium) and as a function of ortho-para concentration (in hydrogen) as well as the dependence of the order parameter on the temperature and the ortho-para concentration. (Auth.)

Kinetics of infrared stimulated luminescence from feldspars

DEFF Research Database (Denmark)

Jain, Mayank; Sohbati, Reza; Guralnik, Benny

2015-01-01

thermal and optical, of the infrared stimulated luminescence signal from feldspar. Based on the application of this model, it is concluded that different infra-red stimulated luminescence emissions (UV, blue, yellow and far-red) follow the same kinetics, and, therefore, involve participation of the same...

Changes of heart rate variability and prefrontal oxygenation during Tai Chi practice versus arm ergometer cycling.

Science.gov (United States)

Lu, Xi; Hui-Chan, Christina Wan-Ying; Tsang, William Wai-Nam

2016-11-01

[Purpose] Exercise has been shown to improve cardiovascular fitness and cognitive function. Whether the inclusion of mind over exercise would increase parasympathetic control of the heart and brain activities more than general exercise at a similar intensity is not known. The aim of this study was to compare the effects of Tai Chi (mind-body exercise) versus arm ergometer cycling (body-focused exercise) on the heart rate variability and prefrontal oxygenation level. [Subjects and Methods] A Tai Chi master was invited to perform Tai Chi and arm ergometer cycling with similar exercise intensity on two separate days. Heart rate variability and prefrontal oxyhemoglobin levels were measured continuously by a RR recorder and near-infrared spectroscopy, respectively. [Results] During Tai Chi exercise, spectral analysis of heart rate variability demonstrated a higher high-frequency power as well as a lower low-frequency/high-frequency ratio than during ergometer cycling, suggesting increased parasympathetic and decreased sympathetic control of the heart. Also, prefrontal oxyhemoglobin and total hemoglobin levels were higher than those during arm ergometer exercise. [Conclusion] These findings suggest that increased parasympathetic control of the heart and prefrontal activities may be associated with Tai Chi practice. Having a "mind" component in Tai Chi could be more beneficial for older adults' cardiac health and cognitive function than body-focused ergometer cycling.

Thin-layer catalytic far-infrared radiation drying and flavour of tomato slices

Directory of Open Access Journals (Sweden)

Ernest Ekow Abano

2014-06-01

Full Text Available A far-infrared radiation (FIR catalytic laboratory dryer was designed by us and used to dry tomato. The kinetics of drying of tomato slices with FIR energy was dependent on both the distance from the heat source and the sample thickness. Numerical evaluation of the simplified Fick’s law for Fourier number showed that the effective moisture diffusivity increased from 0.193×10–9 to 1.893×10–9 m2/s, from 0.059×10–9 to 2.885×10–9 m2/s, and, from 0.170×10–9 to 4.531×10–9 m2/s for the 7, 9, and 11 mm thick slices as moisture content decreased. Application of FIR enhanced the flavour of the dried tomatoes by 36.6% when compared with the raw ones. The results demonstrate that in addition to shorter drying times, the flavour of the products can be enhanced with FIR. Therefore, FIR drying should be considered as an efficient drying method for tomato with respect to minimization of processing time, enhancement in flavour, and improvements in the quality and functional property of dried tomatoes.

Infrared observation of the early universe

International Nuclear Information System (INIS)

Matsumoto, T.

1984-01-01

The rocket observation of the near-infrared extragalactic background radiation and its influence on the cosmology are described. The furute plans to observe the near-infrared and far-infrared backgrounds are also presented. (author)

Measurement of sigma chi c2 B(chi c2-->J/psi gamma)/sigma chi c1 B(chi c1 -->J/psi gamma) in pp collisions at square root s=1.96 TeV.

Science.gov (United States)

Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; Datta, M; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

2007-06-08

We measure the ratio of cross section times branching fraction, Rp=sigma chi c2 B(chi c2-->J/psi gamma)/sigma chi c1 B(chi c1-->J/psi gamma), in 1.1 fb(-1) of pp collisions at square root s=1.96 TeV. This measurement covers the kinematic range pT(J/psi)>4.0 GeV/c, |eta(J/psi)1.0 GeV/c. For events due to prompt processes, we find Rp=0.395+/-0.016(stat)+/-0.015(syst). This result represents a significant improvement in precision over previous measurements of prompt chi c1,2 hadro production.

Infrared Line Intensities for Formaldehyde from Simultaneous Measurements in the Infrared and Far Infrared Spectral Ranges

Science.gov (United States)

Fissiaux, L.; Földes, T.; Tchana, F. Kwabia; Daumont, L.; Lepère, M.; Vander Auwera, J.

2011-06-01

Formaldehyde (H_2CO) is an important intermediate compound in the degradation of the volatile organic compounds (VOCs), including methane, in the terrestrial troposphere. Its observation using optical remote sensing in the infrared range relies on the 3.6 and 5.7 μm absorption bands. Band and individual line intensities have been reported in both ranges. With the present work, we aim to also derive infrared line intensities for formaldehyde, however relying on pure rotation line intensities and the known electric dipole moment to determine the particle density. Indeed, because formaldehyde polymerizes or degrades easily, the gas phase may contain polymerization or degradation products. Spectra of H_2CO diluted in 10 hPa of N_2 were therefore simultaneously recorded in the 20-60 Cm-1 and 3.6 μm ranges, respectively using a Bruker IFS125HR Fourier transform spectrometer and a tunable diode laser. see A. Perrin, D. Jacquemart, F. Kwabia Tchana, N. Lacome, J. Quant. Spectrosc. Radiat. Transfer 110 (2009) 700-716, and references therein

Far infrared conductivity of charge density wave materials and the oxygen isotope effect in high-T sub c superconductors

Energy Technology Data Exchange (ETDEWEB)

Creager, W.N.

1991-09-01

The far infrared reflectance and conductivity of (Ta{sub 1-x}Nb{sub x}Se{sub 4}){sub 2}I and TaS{sub 3} have been measured to determine the origin of a huge infrared resonance that dominates the charge density wave (CDW) dynamics along with the pinned acoustic phason mode in the related materials (TaSe{sub 4}){sub 2}I and K{sub 0. 3}MoO{sub 3}. The measurements cover frequencies from 3 to 700cm{sup {minus}1} and the temperature range from 15K to 300K. In the niobium-doped alloys (Ta{sub 1-x}Nb{sub x}Se{sub 4}){sub 2}I, the size and frequency of the giant infrared mode remain nearly constant as the impurity concentration x is increased. For TaS{sub 3}, the pinned acoustic phason near 0.5cm{sup {minus}1} dominates {var epsilon}({omega}) and an additional small mode lies near 9cm{sup {minus}1}. The latter mode is much smaller than the infrared mode in other CDW materials. These results rule out several models of a generic infrared mode'' in CDW excitations. They are compared in detail to the predictions of a recent theory attributing the infrared mode to a bound collective mode localized at impurity sites within the crystal. The transmittance of K{sub 0.3}MoO{sub 3} has been measured at 1.2K with a strong dc electric field applied across the crystal. Under these conditions, the charge density wave depins abruptly and carries large currents with near-zero differential resistance. For some samples, the low-frequency transmittance is enhanced slightly when the CDW depins. The magnitude of the oxygen isotope effect in the high-{Tc} superconductor YBa{sub 2}Cu{sub 3}O{sub 7} has been determined by substitution of {sup 18}O for {sup 16}O. A series of cross-exchanges was performed on high-quality polycrystalline specimens to eliminate uncertainties due to sample heat treatments and sample inhomogeneities.

A Study of the Radio Continuum Far Infrared Correlation at Small Scales in the Galaxy

Science.gov (United States)

Rodriguez-Martinez, Monica I.; Allen, R. J.; Wiklind, T.; Loinard, L.

2006-12-01

We present a study of the behavior of the Radio Continuum (RC) Far Infrared (FIR) correlation on scales corresponding to the size of small molecular clouds. This was done by comparing the spatial distribution of RC emission and FIR emission from a sample of several regions, distributed within the range 79∘ ≤ l ≤ 174∘ in the Galaxy. We have examined the 408 and 1420 MHz mosaic images of the sample, from the Canadian Galactic Plane Survey (CGPS), which later were compared with images at 60 and 100 μm. Preliminary results suggest that the RC -FIR correlation still holds at small scales, since a good qualitative correlation between RC and FIR emission is found. The physical process involved that may cause such correlation will be discussed as well as the nature of the RC emission. This research makes use of data from the Canadian Galactic Plane Survey.

Stress Management: Tai Chi

Science.gov (United States)

... in constant motion. Tai chi has many different styles. Each style may subtly emphasize various tai chi principles and methods. There are variations within each style. Some styles may focus on health maintenance, while ...

Operation of a five-pole superconducting wiggler in the DCI positron ring and design of the beamline

International Nuclear Information System (INIS)

Bazin, C.; Dubuisson, J.M.; Labeque, A.; Level, M.P.; Raoux, D.; Sommer, M.; Zyngier, H.; Chomillier, J.; Frouin, J.; Garreau, Y.; Loupias, G.; Tarbes, J.

1989-01-01

A five-pole superconducting wiggler has been installed in the DCI positron ring and operated without disturbing the machine characteristics at full energy (1.85 GeV) and maximum current (300 mA). Three beamlines have been built which feed six beam ports. The first two-crystal monochromator to be used for Compton scattering has been commissioned although the sagittal focusing has not yet been tested

Far-Infrared Radiation Thermotherapy Improves Tissue Fibrosis in Chronic Extremity Lymphedema.

Science.gov (United States)

Li, Ke; Zhang, Zheng; Liu, Ning Fei; Sadigh, Parviz; Evans, Verity Joyce; Zhou, Huihong; Gao, Weiqing; Zhang, Yi Xin

2017-09-29

Fibrosis can enhance the exacerbation of lymphedema, which becomes obvious in late stage II-III lymphedema. However, whether far-infrared radiation thermotherapy (FIRT) can cure lymphedema fibrosis is still lack of research. This research was to investigate the therapeutic effect of FIRT on tissue fibrosis in the treatment of Late stage II-III lymphedema. Patients accepted only FIRT for a total of 20 sessions. The treatment session duration was 2 hours, and a stable machine temperature of 42°C was maintained throughout treatments. Clinical evaluation and laboratory evaluation were conducted before and after FIRT. Clinical outcome measures included circumference of affected extremity, skin elasticity, ultrasound, patients' subjective assessment, and quality of life (QOL). Laboratory outcome measures included serum and local lymphedema tissue fluid concentrations of fibrosis associated cytokines, tissue growth factor beta-1 (TGF-β1), interleukin (IL)-1β, IL-4, IL-18, and caspase-1. Between 2015 and 2016, clinical evaluation of 64 patients with late stage II-III lymphedema was conducted. From this group, 12 cases (18.75%) underwent simultaneous laboratory evaluation. Circumferences of affected extremities improved significantly following treatment (p pain, discomfort, and numbness (p effective treatment for lymphedema tissue fibrosis; it reduces the concentration of fibrosis cytokines in local lymphedema tissues. Consequently, this treatment can reduce the density of fibrosed tissue in the affected extremity, increase skin elasticity, significantly improve clinical symptoms, and improve QOL of patients.

Comfort and Functional Properties of Far-Infrared/Anion-Releasing Warp-Knitted Elastic Composite Fabrics Using Bamboo Charcoal, Copper, and Phase Change Materials

Directory of Open Access Journals (Sweden)

Ting-Ting Li

2016-02-01

Full Text Available Elastic warp-knitted composite fabrics with far-infrared emissivity and an anion-releasing property were prepared using bamboo charcoal (BC, copper (Cu, and phase-change material (PCM. The functional composite fabric, which was composed of self-made complex yarns with various twisting degrees and material composition, were created using a rotor twister and ring-spinning technique. The fabric structure was diversified by the feeding modes of weft yarn into a crochet-knitting machine. The twist number of complex yarns was optimized by tensile tenacity, twist contraction, and hairiness, and analysis showed that twisting at 12 twists per inch produced the highest tensile tenacity and appropriate twist contraction and hairiness. Comfort evaluation showed that the elastic composite fabrics with BC weft yarns exhibited higher water–vapor transmission rate and air permeability, reaching 876 g/m2∙ day and 73.2 cm3/s/cm2, respectively. Three structures of composite fabric with various weft yarns had >0.85 ε far-infrared emissivity and 350–420 counts/cm3 anion amount. The prepared elastic warp-knitted fabrics can provide a comfortable, dry, and breathable environment to the wearer and can thus be applied as health-care textiles in the future.

Micro-Spec: An Ultracompact, High-sensitivity Spectrometer for Far-Infrared and Submillimeter Astronomy

Science.gov (United States)

Cataldo, Giuseppe; Hsieh, Wen-Ting; Huang, Wei-Chung; Moseley, S. Harvey; Stevenson, Thomas R.; Wollack, Edward J.

2014-01-01

High-performance, integrated spectrometers operating in the far-infrared and submillimeter ranges promise to be powerful tools for the exploration of the epochs of reionization and initial galaxy formation. These devices, using high-efficiency superconducting transmission lines, can achieve the performance of a meter-scale grating spectrometer in an instrument implemented on a 4 inch silicon wafer. Such a device, when combined with a cryogenic telescope in space, provides an enabling capability for studies of the early universe. Here, the optical design process for Micro-Spec (micron-Spec) is presented, with particular attention given to its two-dimensional diffractive region, where the light of different wavelengths is focused on the different detectors. The method is based on the stigmatization and minimization of the light path function in this bounded region, which results in an optimized geometrical configuration. A point design with an efficiency of (is) approximately 90% has been developed for initial demonstration and can serve as the basis for future instruments. Design variations on this implementation are also discussed, which can lead to lower efficiencies due to diffractive losses in the multimode region.

CHI: A General Agent Communication Framework

Energy Technology Data Exchange (ETDEWEB)

Goldsmith, S.Y.; Phillips, L.R.; Spires, S.V.

1998-12-17

We have completed and exercised a communication framework called CHI (CLOS to HTML Interface) by which agents can communicate with humans. CHI follows HTTP (HyperText Transfer Protocol) and produces HTML (HyperText Markup Language) for use by WWW (World-Wide Web) browsers. CHI enables the rapid and dynamic construction of interface mechanisms. The essence of CHI is automatic registration of dynamically generated interface elements to named objects in the agent's internal environment. The agent can access information in these objects at will. State is preserved, so an agent can pursue branching interaction sequences, activate failure recovery behaviors, and otherwise act opportunistically to maintain a conversation. The CHI mechanism remains transparent in multi-agent, multi-user environments because of automatically generated unique identifiers built into the CHI mechanism. In this paper we discuss design, language, implementation, and extension issues, and, by way of illustration, examine the use of the general CHI/HCHI mechanism in a specific international electronic commerce system. We conclude that the CHI mechanism is an effective, efficient, and extensible means of the agent/human communication.

Biomedical wellness by tai chi and sports

Science.gov (United States)

Chin, Daniel C.; Chin, Amita G.

2011-06-01

Tai-chi chuan is popular worldwide especially in China. People practice tai-chi chuan daily with faith believing that they will be rewarded with health and varieties of other rewords. The Tai Chi Chuan Theory by Master Chang and the Tai Chi Chuan Theory by Master Wang are translated to be the baseline of the tai-chi chuan. The theory described in these two papers clearly shows that the tai-chi power source is the combination of the two antigravity forces distinction by each foot. The ying, yang and hollowed, solid discussed in the papers are the properties and body relationship of the two antigravity forces. The antigravity forces presented inside of body are as air to the balloon termed chi. However chi could be generated by any muscle pressing; only the antigravity forces from feet are called nature chi that has the maximum strength of the person. When a person is soft, as an infant the nature chi will fulfill entire body with no time and effort. The sequence forms were designed for deploying the nature chi in speed and power. The combination of chi and tai-chi form make tai chi chuan supreme than other kinds of martial art. In the training process chi massages whole body many time for a sequence form practice that stimulate all organs and could lead to cure body diseases, lose weight, postpone aging process, and remove the aging symptoms. For the people practicing in the park daily with proper guidance they will fulfill their wishes. Tai chi exercise could also apply to other sports as in dancing and golfing they are discussed at the end of the paper.

Transmission Spectra of HgTe-Based Quantum Wells and Films in the Far-Infrared Range

Science.gov (United States)

Savchenko, M. L.; Vasil'ev, N. N.; Yaroshevich, A. S.; Kozlov, D. A.; Kvon, Z. D.; Mikhailov, N. N.; Dvoretskii, S. A.

2018-04-01

Strained 80-nm-thick HgTe films belong to a new class of materials referred to as three-dimensional topological insulators (i.e., they have a bulk band gap and spin-nondegenerate surface states). Though there are a number of studies devoted to analysis of the properties of surface states using both transport and magnetooptical techniques in the THz range, the information about direct optical transitions between bulk and surface bands in these systems has not been reported. This study is devoted to the analysis of transmission and reflection spectra of HgTe films of different thicknesses in the far-infrared range recorded in a wide temperature range in order to detect the above interband transitions. A peculiarity at 15 meV, which is sensitive to a change in the temperature, is observed in spectra of both types. Detailed analysis of the data obtained revealed that this feature is related to absorption by HgTe optical phonons, while the interband optical transitions are suppressed.

Contribution of water dimer absorption to the millimeter and far infrared atmospheric water continuum

Science.gov (United States)

Scribano, Yohann; Leforestier, Claude

2007-06-01

We present a rigorous calculation of the contribution of water dimers to the absorption coefficient α(ν¯,T ) in the millimeter and far infrared domains, over a wide range (276-310K) of temperatures. This calculation relies on the explicit consideration of all possible transitions within the entire rovibrational bound state manifold of the dimer. The water dimer is described by the flexible 12-dimensional potential energy surface previously fitted to far IR transitions [C. Leforestier et al., J. Chem. Phys. 117, 8710 (2002)], and which was recently further validated by the good agreement obtained for the calculated equilibrium constant Kp(T) with experimental data [Y. Scribano et al., J. Phys. Chem. A. 110, 5411 (2006)]. Transition dipole matrix elements were computed between all rovibrational states up to an excitation energy of 750cm-1, and J =K=5 rotational quantum numbers. It was shown by explicit calculations that these matrix elements could be extrapolated to much higher J values (J=30). Transitions to vibrational states located higher in energy were obtained from interpolation of computed matrix elements between a set of initial states spanning the 0-750cm-1 range and all vibrational states up to the dissociation limit (˜1200cm-1). We compare our calculations with available experimental measurements of the water continuum absorption in the considered range. It appears that water dimers account for an important fraction of the observed continuum absorption in the millimeter region (0-10cm-1). As frequency increases, their relative contribution decreases, becoming small (˜3%) at the highest frequency considered ν¯=944cm-1.

Design Concept of Superconducting Multipole Wiggler with Variably Polarized X-Ray

International Nuclear Information System (INIS)

Hwang, C.S.; Chang, C.H.; Li, W.P.; Lin, F.Y.

2004-01-01

In response to the growing demand for X-ray research, and to satisfy future needs for generating circularly polarized synchrotron radiation in the X-ray region, a 3.5 T superconducting multipole with a periodic length of 6 cm was designed to produce horizontal linearly polarized, and circularly polarized light on a 1.5 GeV electron storage ring. Differently arranged excitation current loop for the same coil design switched between the operation of symmetric and asymmetric modes to creat the linearly and circularly polarized light, respectively. This study elucidates the design concepts of the superconducting multipole wiggler with symmetric and asymmetric operation modes. The design of the magnetic circuit and the field calculation are also discussed. Meanwhile, the spectra characteristics of the symmetric and asymmetric modes are calculated and presented in this article

Infrared studies of the S235 molecular cloud

International Nuclear Information System (INIS)

Evans, N.J. II; Beichman, C.; Gatley, I.; Harvey, P.; Nadeau, D.; Sellgren, K.

1981-01-01

Infrared observations from 7.8 to 200 μm have been obtained for the S235 molecular cloud. Far-infrared maps were obtained for a region of active star formation, as marked by the presence of compact H II regions, water masers, and compact near-infrared sources. The primary heating source for the far-infrared emission appears to be the compact H II region, S235A. Detailed examination of the gas energetics in the region supports the plausibility of the picture in which the gas is heated by collisions with warm dust grains. The ratio of far-infrared optical depth to 13 CO column density is somewhat lower in this source than is commonly found. This effect may be caused by the presence of substantial 13 CO in regions where the dust is not warm enough to emit substantial 50--100 μm radiation

Free-electron laser with a plasma wave wiggler propagating through a magnetized plasma channel

International Nuclear Information System (INIS)

Jafari, S; Jafarinia, F; Mehdian, H

2013-01-01

A plasma eigenmode has been employed as a wiggler in a magnetized plasma channel for the generation of laser radiation in a free-electron laser. The short wavelength of the plasma wave allows a higher radiation frequency to be obtained than from conventional wiggler free-electron lasers. The plasma can significantly slow down the radiation mode, thereby relaxing the beam energy requirement considerably. In addition, it allows a beam current in excess of the vacuum current limit via charge neutralization. This configuration has a higher tunability by controlling the plasma density in addition to the γ-tunability of the standard FEL. The laser gain has been calculated and numerical computations of the electron trajectories and gain are presented. Four groups (I–IV) of electron orbits have been found. It has been shown that by increasing the cyclotron frequency, the gain for orbits of group I and group III increases, while a decrease in gain has been obtained for orbits of group II and group IV. Similarly, the effect of plasma density on gain has been exhibited. The results indicate that with increasing plasma density, the orbits of all groups shift to higher cyclotron frequencies. The effects of beam self-fields on gain have also been demonstrated. It has been found that in the presence of beam self-fields the sensitivity of the gain increases substantially in the vicinity of gyroresonance. Here, the gain enhancement and reduction are due to the paramagnetic and diamagnetic effects of the self-magnetic field, respectively. (paper)

Tai chi and rheumatic diseases.

Science.gov (United States)

Wang, Chenchen

2011-02-01

Tai chi is a complex multicomponent mind-body exercise. Many studies have provided evidence that tai chi benefits patients with a variety of chronic disorders. This form of mind-body exercise enhances cardiovascular fitness, muscular strength, balance, and physical function and seems to be associated with reduced stress, anxiety, and depression and improved quality of life. Thus, despite certain limitations in the evidence, tai chi can be recommended to patients with osteoarthritis, rheumatoid arthritis, and fibromyalgia as a complementary and alternative medical approach. This article overviews the current knowledge about tai chi to better inform clinical decision making for rheumatic patients. Copyright © 2011 Elsevier Inc. All rights reserved.

REGIONAL VARIATIONS IN THE DENSE GAS HEATING AND COOLING IN M51 FROM HERSCHEL FAR-INFRARED SPECTROSCOPY

Energy Technology Data Exchange (ETDEWEB)

Parkin, T. J.; Wilson, C. D.; Schirm, M. R. P.; Foyle, K. [Department of Physics and Astronomy, McMaster University, Hamilton, Ontario, L8S 4M1 (Canada); Baes, M.; De Looze, I. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Boquien, M.; Boselli, A. [Laboratoire d' Astrophysique de Marseille-LAM, Université d' Aix-Marseille and CNRS, UMR7326, 38 rue F. Joliot-Curie, F-13388 Marseille Cedex 13 (France); Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Cormier, D. [Institut für Theoretische Astrophysik, Zentrum für Astronomie der Universität Heidelberg, Albert-Ueberle Str. 2, D-69120 Heidelberg (Germany); Karczewski, O. Ł. [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Lebouteiller, V.; Madden, S. C.; Sauvage, M. [CEA, Laboratoire AIM, Irfu/SAp, Orme des Merisiers, F-91191 Gif-sur-Yvette (France); Roussel, H. [Institut d' Astrophysique de Paris, UMR7095 CNRS, Université Pierre and Marie Curie, 98 bis Boulevard Arago, F-75014 Paris (France); Spinoglio, L., E-mail: parkintj@mcmaster.ca [Istituto di Astrofisica e Planetologia Spaziali, INAF-IAPS, Via Fosso del Cavaliere 100, I-00133 Roma (Italy)

2013-10-20

We present Herschel PACS and SPIRE spectroscopy of the most important far-infrared cooling lines in M51, [C II](158 μm), [N II](122 and 205 μm), [O I](63 and 145 μm), and [O III](88 μm). We compare the observed flux of these lines with the predicted flux from a photon-dominated region model to determine characteristics of the cold gas such as density, temperature, and the far-ultraviolet (FUV) radiation field, G{sub 0}, resolving details on physical scales of roughly 600 pc. We find an average [C II]/F{sub TIR} of 4 × 10{sup –3}, in agreement with previous studies of other galaxies. A pixel-by-pixel analysis of four distinct regions of M51 shows a radially decreasing trend in both the FUV radiation field, G{sub 0}, and the hydrogen density, n, peaking in the nucleus of the galaxy, and then falling off out to the arm and interarm regions. We see for the first time that the FUV flux and gas density are similar in the differing environments of the arm and interarm regions, suggesting that the inherent physical properties of the molecular clouds in both regions are essentially the same.

Measurement of the cross-section ratio {sigma}({chi}{sub c2})/{sigma}({chi}{sub c1}) for prompt {chi}{sub c} production at {radical}(s)=7 TeV

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Abellan Beteta, C. [Universitat de Barcelona, Barcelona (Spain); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Universite, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Universite, Universite Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J.; Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amhis, Y. [Ecole Polytechnique Federale de Lausanne (EPFL), Lausanne (Switzerland); Anderson, J. [Physik-Institut, Universitaet Zuerich, Zuerich (Switzerland); Appleby, R.B. [School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); Aquines Gutierrez, O. [Max-Planck-Institut fuer Kernphysik (MPIK), Heidelberg (Germany); Archilli, F. [Laboratori Nazionali dell' INFN di Frascati, Frascati (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Arrabito, L. [CC-IN2P3, CNRS/IN2P3, Lyon-Villeurbanne (France); and others

2012-08-14

The prompt production of the charmonium {chi}{sub c1} and {chi}{sub c2} mesons has been studied in proton-proton collisions at the Large Hadron Collider at a centre-of-mass energy of {radical}(s)=7 TeV. The {chi}{sub c} mesons are identified through their decays {chi}{sub c}{yields}J/{psi}{gamma} with J/{psi}{yields}{mu}{sup +}{mu}{sup -} using 36 pb{sup -1} of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for the two {chi}{sub c} spin states, {sigma}({chi}{sub c2})/{sigma}({chi}{sub c1}), has been determined as a function of the J/{psi} transverse momentum, p{sub T}{sup J/{psi}}, in the range from 2 to 15 GeV/c. The results are in agreement with the next-to-leading order non-relativistic QCD model at high p{sub T}{sup J/{psi}} and lie consistently above the pure leading-order colour-singlet prediction.

Submillimeter and far infrared line observations of M17 SW: A clumpy molecular cloud penetrated by UV radiation

Science.gov (United States)

Stutzki, J.; Stacey, G. J.; Genzel, R.; Harris, A. I.; Jaffe, d. T.; Lugten, J. B.

1987-01-01

Millimeter, submillimeter, and far infrared spectroscopic observations of the M17 SW star formation region are discussed. The results require the molecular cloud near the interface to be clumpy or filamentary. As a consequence, far ultraviolet radiation from the central OB stellar cluster can penetrate into the dense molecular cloud to a depth of several pc, thus creating bright and extended (CII) emission from the photodissociated surfaces of dense atomic and molecular clumps or sheets. The extended (CII) emission throughout the molecular cloud SW of the M17 complex has a level 20 times higher than expected from a single molecular cloud interface exposed to an ultraviolet radiation field typical of the solar neighborhood. This suggests that the molecular cloud as a whole is penetrated by ultraviolet radiation and has a clumpy or filamentary structure. The number of B stars expected to be embedded in the M17 molecular cloud probably can provide the UV radiation necessary for the extended (CII) emission. Alternatively, the UV radiation could be external, if the interstellar radiation in the vicinity of M17 is higher than in the solar neighborhood.

Measurement of $\\chi_{c1}$ and $\\chi_{c2}$ production with $\\sqrt{s}=7$ TeV $pp$ collisions at ATLAS

CERN Document Server

Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; {\\AA}kesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; {\\AA}sman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimaraes da Costa, Joao; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jurg; Bernard, Clare; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Boddy, Christopher Richard; Boehler, Michael; Boek, Jennifer; Boek, Thorsten Tobias; Boelaert, Nele; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Bohm, Jan; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bolnet, Nayanka Myriam; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Bordoni, Stefania; Borer, Claudia; Borisov, Anatoly; Borissov, Guennadi; Borri, Marcello; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Bouchami, Jihene; Boudreau, Joseph; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boutouil, Sara; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozovic-Jelisavcic, Ivanka; Bracinik, Juraj; Branchini, Paolo; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Brelier, Bertrand; Brendlinger, Kurt; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Broggi, Francesco; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Gareth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Budick, Burton; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bundock, Aaron Colin; Bunse, Moritz; Burckhart, Helfried; Burdin, Sergey; Burgess, Thomas; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Buscher, Volker; Bussey, Peter; Buszello, Claus-Peter; Butler, Bart; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Buttinger, William; Buzatu, Adrian; Byszewski, Marcin; Cabrera Urb\\'an, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Caloi, Rita; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarri, Paolo; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Canale, Vincenzo; Canelli, Florencia; Canepa, Anadi; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Antony; Carter, Janet; Carvalho, Joao; Casadei, Diego; Casado, Maria Pilar; Caso, Carlo; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caughron, Seth; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chan, Kevin; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Charfeddine, Driss; Charlton, Dave; Chavda, Vikash; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Yujiao; Cheng, Yangyang; Cheplakov, Alexander; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiefari, Giovanni; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christidi, Ilektra-Athanasia; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Ciapetti, Guido; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciocio, Alessandra; Cirilli, Manuela; Cirkovic, Predrag; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clemens, Jean-Claude; Clement, Benoit; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coelli, Simone; Coffey, Laurel; Cogan, Joshua Godfrey; Coggeshall, James; Colas, Jacques; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collins-Tooth, Christopher; Collot, Johann; Colombo, Tommaso; Colon, German; Compostella, Gabriele; Conde Muino, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cooper-Smith, Neil; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, Mar\\'ia Jos\\'e; Costanzo, Davide; C\\^ot\\'e, David; Cottin, Giovanna; Courneyea, Lorraine; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Cr\\'ep\\'e-Renaudin, Sabine; Crescioli, Francesco; Crispin Ortuzar, Mireia; Cristinziani, Markus; Crosetti, Giovanni; Cuciuc, Constantin-Mihai; Cuenca Almenar, Crist\\'obal; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; D'Orazio, Alessia; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Daniells, Andrew Christopher; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darlea, Georgiana Lavinia; Darmora, Smita; Dassoulas, James; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davignon, Olivier; Davison, Adam; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; de Graat, Julien; De Groot, Nicolo; de Jong, Paul; De La Taille, Christophe; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; De Zorzi, Guido; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dechenaux, Benjamin; Dedovich, Dmitri; Degenhardt, James; Del Peso, Jose; Del Prete, Tarcisio; Delemontex, Thomas; Deliot, Frederic; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Demirkoz, Bilge; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deviveiros, Pier-Olivier; Dewhurst, Alastair; DeWilde, Burton; Dhaliwal, Saminder; Dhullipudi, Ramasudhakar; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dindar Yagci, Kamile; Dingfelder, Jochen; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Barros do Vale, Maria Aline; Do Valle Wemans, Andr\\'e; Doan, Thi Kieu Oanh; Dobos, Daniel; Dobson, Ellie; Dodd, Jeremy; Doglioni, Caterina; Doherty, Tom; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dos Anjos, Andre; Dotti, Andrea; Dova, Maria-Teresa; Doyle, Tony; Dris, Manolis; Dubbert, Jorg; Dube, Sourabh; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Dudziak, Fanny; Duflot, Laurent; Duguid, Liam; Duhrssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Duren, Michael; Dwuznik, Michal; Ebke, Johannes; Edson, William; Edwards, Clive; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Eisenhandler, Eric; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Katherine; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Engelmann, Roderich; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Espinal Curull, Xavier; Esposito, Bellisario; Etienne, Francois; Etienvre, Anne-Isabelle; Etzion, Erez; Evangelakou, Despoina; Evans, Hal; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Fatholahzadeh, Baharak; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Fehling-Kaschek, Mirjam; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Fernando, Waruna; Ferrag, Samir; Ferrando, James; Ferrara, Valentina; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filip\\v{c}i\\v{c}, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Julia; Fisher, Matthew; Fitzgerald, Eric Andrew; Flechl, Martin; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Florez Bustos, Andres Carlos; Flowerdew, Michael; Fonseca Martin, Teresa; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Fournier, Daniel; Fox, Harald; Francavilla, Paolo; Franchini, Matteo; Franchino, Silvia; Francis, David; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; Fratina, Sasa; French, Sky; Friedrich, Conrad; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadfort, Thomas; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gandrajula, Reddy Pratap; Gao, Jun; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; Garc\\'ia, Carmen; Garc\\'ia Navarro, Jos\\'e Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniel Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-H\\'el\\`ene; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gillman, Tony; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Francesco Michelangelo; Giovannini, Paola; Giraud, Pierre-Francois; Giugni, Danilo; Giuliani, Claudia; Giunta, Michele; Gjelsten, B{\\o}rge Kile; Gkialas, Ioannis; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glazov, Alexandre; Glonti, George; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godfrey, Jennifer; Godlewski, Jan; Goeringer, Christian; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gon\\c calo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; Gonz\\'alez de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez Silva, Laura; Gonzalez-Sevilla, Sergio; Goodson, Jeremiah Jet; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorfine, Grant; Gorini, Benedetto; Gorini, Edoardo; Gori\\v{s}ek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gossling, Claus; Gostkin, Mikhail Ivanovitch; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafstrom, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Francesco; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Gray, Julia Ann; Graziani, Enrico; Grebenyuk, Oleg; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grigalashvili, Nugzar; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Groth-Jensen, Jacob; Grout, Zara Jane; Grybel, Kai; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guicheney, Christophe; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Gunther, Jaroslav; Guo, Jun; Gupta, Shaun; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guttman, Nir; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haefner, Petra; Hageboeck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Hall, David; Halladjian, Garabed; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hansen, John Renner; Hansen, J{\\o}rgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hansson, Per; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Harrison, Paul Fraser; Hartjes, Fred; Harvey, Alex; Hasegawa, Satoshi; Hasegawa, Yoji; Hassani, Samira; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heinemann, Beate; Heisterkamp, Simon; Hejbal, Jiri; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Hensel, Carsten; Herbert, Geoffrey Henry; Medina Hernandez, Carlos; Hern\\'andez Jim\\'enez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hickling, Robert; Hig\\'on-Rodriguez, Emilio; Hill, John; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoffman, Julia; Hoffmann, Dirk; Hofmann, Julia Isabell; Hohlfeld, Marc; Holmes, Tova Ray; Hong, Tae Min; Hooft van Huysduynen, Loek; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huettmann, Antje; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hulsing, Tobias Alexander; Hurwitz, Martina; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Idarraga, John; Ideal, Emma; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Iliadis, Dimitrios; Ilic, Nikolina; Inamaru, Yuki; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ivashin, Anton; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, John; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansen, Hendrik; Janssen, Jens; Janus, Michel; Jared, Richard; Jarlskog, Goran; Jeanty, Laura; Jeng, Geng-yuan; Jen-La Plante, Imai; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; J\\'ez\\'equel, St\\'ephane; Jha, Manoj Kumar; Ji, Haoshuang; Ji, Weina; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Joffe, David; Johansson, Erik; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kadlecik, Peter; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kajomovitz, Enrique; Kalinin, Sergey; Kama, Sami; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kanno, Takayuki; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karastathis, Nikolaos; Karnevskiy, Mikhail; Karpov, Sergey; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Keener, Paul; Kehoe, Robert; Keil, Markus; Keller, John; Keoshkerian, Houry; Kepka, Oldrich; Ker\\v{s}evan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharchenko, Dmitri; Khodinov, Alexander; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hyeon Jin; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kitamura, Takumi; Kittelmann, Thomas; Kiuchi, Kenji; Kladiva, Eduard; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klinkby, Esben; Klioutchnikova, Tatiana; Klok, Peter; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koenig, Sebastian; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Koll, James; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Koneke, Karsten; Konig, Adriaan; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Kopke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotov, Sergey; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Nina; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Kruger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurata, Masakazu; Kurochkin, Yurii; Kurumida, Rie; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwee, Regina; La Rosa, Alessandro; La Rotonda, Laura; Labarga, Luis; Lablak, Said; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ram\\'on; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laier, Heiko; Laisne, Emmanuel; Lambourne, Luke; Lampen, Caleb; Lampl, Walter; Lan\\c con, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, Clemens; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Larner, Aimee; Lassnig, Mario; Laurelli, Paolo; Lavorini, Vincenzo; Lavrijsen, Wim; Laycock, Paul; Le, Bao Tran; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmacher, Marc; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Lendermann, Victor; Leney, Katharine; Lenz, Tatjana; Lenzen, Georg; Lenzi, Bruno; Leone, Robert; Leonhardt, Kathrin; Leontsinis, Stefanos; Leroy, Claude; Lessard, Jean-Raphael; Lester, Christopher; Lester, Christopher Michael; Lev\\^eque, Jessica; Levin, Daniel; Levinson, Lorne; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Bo; Li, Haifeng; Li, Ho Ling; Li, Shu; Li, Xuefei; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Limper, Maaike; Lin, Simon; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loddenkoetter, Thomas; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Loh, Chang Wei; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Lombardo, Vincenzo Paolo; Long, Jonathan; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Losty, Michael; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Ludwig, Dorthe; Ludwig, Inga; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lund, Esben; Lundberg, Johan; Lundberg, Olof; Lund-Jensen, Bengt; Lungwitz, Matthias; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Ma\\v{c}ek, Bo\\v{s}tjan; Machado Miguens, Joana; Macina, Daniela; Mackeprang, Rasmus; Madar, Romain; Madaras, Ronald; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeno, Mayuko; Maeno, Tadashi; Magnoni, Luca; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Mahmoud, Sara; Mahout, Gilles; Maiani, Camilla; Maidantchik, Carmen; Maio, Am\\'elia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mandelli, Luciano; Mandi\\'{c}, Igor; Mandrysch, Rocco; Maneira, Jos\\'e; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany Andreina; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchese, Fabrizio; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marques, Carlos; Marroquim, Fernando; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian; Martin, Brian Thomas; Martin, Jean-Pierre; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Homero; Martinez, Mario; Martin-Haugh, Stewart; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Matsunaga, Hiroyuki; Matsushita, Takashi; Mattig, Peter; Mattig, Stefan; Mattmann, Johannes; Mattravers, Carly; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazzaferro, Luca; Mazzanti, Marcello; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; Mclaughlan, Tom; McMahon, Steve; McPherson, Robert; Meade, Andrew; Mechnich, Joerg; Mechtel, Markus; Medinnis, Mike; Meehan, Samuel; Meera-Lebbai, Razzak; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mendoza Navas, Luis; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Meric, Nicolas; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer, Joerg; Michal, Sebastien; Middleton, Robin; Migas, Sylwia; Mijovi\\'{c}, Liza; Mikenberg, Giora; Mikestikova, Marcela; Miku\\v{z}, Marko; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Minaenko, Andrey; Minano Moya, Mercedes; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Mitsui, Shingo; Miyagawa, Paul; Mjornmark, Jan-Ulf; Moa, Torbjoern; Moeller, Victoria; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Molfetas, Angelos; Monig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Mora Herrera, Clemencia; Moraes, Arthur; Morange, Nicolas; Morel, Julien; Moreno, Deywis; Moreno Ll\\'acer, Mar\\'ia; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Morvaj, Ljiljana; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Thibaut; Mueller, Timo; Muenstermann, Daniel; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Mussche, Ido; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Nanava, Gizo; Napier, Austin; Narayan, Rohin; Nash, Michael; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negri, Guido; Negrini, Matteo; Nektarijevic, Snezana; Nelson, Andrew; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neusiedl, Andrea; Neves, Ricardo; Nevski, Pavel; Newcomer, Mitchel; Newman, Paul; Nguyen, Duong Hai; Nguyen Thi Hong, Van; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Norberg, Scarlet; Nordberg, Markus; Novakova, Jana; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nuncio-Quiroz, Adriana-Elizabeth; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakes, Louise Beth; Oakham, Gerald; Oberlack, Horst; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohshima, Takayoshi; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira, Miguel Alfonso; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olivito, Dominick; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, Ant\\'onio; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Simon; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panduro Vazquez, William; Pani, Priscilla; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pashapour, Shabnaz; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; P\\'asztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pearce, James; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Cavalcanti, Tiago; Perez Codina, Estel; Perez Garcia-Estan, Maria Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrino, Roberto; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Jorgen; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Petteni, Michele; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Piec, Sebastian Marcin; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, Joao Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pizio, Caterina; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Poddar, Sahill; Podlyski, Fabrice; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Pohl, Martin; Polesello, Giacomo; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pomeroy, Daniel; Pomm\\`es, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Pospelov, Guennady; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Prabhu, Robindra; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Price, Darren; Price, Joe; Price, Lawrence; Prieur, Damien; Primavera, Margherita; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Prudent, Xavier; Przybycien, Mariusz; Przysiezniak, Helenka; Psoroulas, Serena; Ptacek, Elizabeth; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Pylypchenko, Yuriy; Qian, Jianming; Quadt, Arnulf; Quarrie, David; Quayle, William; Quilty, Donnchadha; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Rammes, Marcus; Randle-Conde, Aidan Sean; Rangel-Smith, Camila; Rao, Kanury; Rauscher, Felix; Rave, Tobias Christian; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Reinsch, Andreas; Reisin, Hernan; Reisinger, Ingo; Relich, Matthew; Rembser, Christoph; Ren, Zhongliang; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Resende, Bernardo; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Ridel, Melissa; Rieck, Patrick; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ritsch, Elmar; Riu, Imma; Rivoltella, Giancesare; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Rocha de Lima, Jose Guilherme; Roda, Chiara; Roda Dos Santos, Denis; Rodrigues, Luis; Roe, Shaun; R{\\o}hne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romeo, Gaston; Romero Adam, Elena; Rompotis, Nikolaos; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Anthony; Rose, Matthew; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Ruhr, Frederik; Ruiz-Martinez, Aranzazu; Rumyantsev, Leonid; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Rutherfoord, John; Ruthmann, Nils; Ruzicka, Pavel; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sacerdoti, Sabrina; Saddique, Asif; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, Jos\\'e; Salvachua Ferrando, Bel\\'en; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; S\\'anchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, Joao; Sarkisyan-Grinbaum, Edward; Sarrazin, Bjorn; Sartisohn, Georg; Sasaki, Osamu; Sasaki, Yuichi; Sasao, Noboru; Satsounkevitch, Igor; Sauvage, Gilles; Sauvan, Emmanuel; Sauvan, Jean-Baptiste; Savard, Pierre; Savinov, Vladimir; Savu, Dan Octavian; Sawyer, Craig; Sawyer, Lee; Saxon, David; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaelicke, Andreas; Schaepe, Steffen; Schaetzel, Sebastian; Schafer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R. Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Christopher; Schmitt, Sebastian; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schram, Malachi; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schroer, Nicolai; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwartzman, Ariel; Schwegler, Philipp; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scott, Bill; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, Jos\\'e; Sekhniaidze, Givi; Sekula, Stephen; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellers, Graham; Seman, Michal; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Seuster, Rolf; Severini, Horst; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shank, James; Shao, Qi Tao; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Sherwood, Peter; Shimizu, Shima; Shimojima, Makoto; Shin, Taeksu; Shiyakova, Mariya; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silbert, Ohad; Silva, Jos\\'e; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simoniello, Rosa; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjolin, Jorgen; Sjursen, Therese; Skinnari, Louise Anastasia; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snow, Joel; Snyder, Scott; Sobie, Randall; Socher, Felix; Sodomka, Jaromir; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solfaroli Camillocci, Elena; Solodkov, Alexander; Solovyanov, Oleg; Solovyev, Victor; Soni, Nitesh; Sood, Alexander; Sopko, Vit; Sopko, Bruno; Sosebee, Mark; Soualah, Rachik; Soueid, Paul; Soukharev, Andrey; South, David; Spagnolo, Stefania; Span\\`o, Francesco; Spearman, William Robert; Spighi, Roberto; Spigo, Giancarlo; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Stahlman, Jonathan; Stamen, Rainer; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steele, Genevieve; Steinbach, Peter; Steinberg, Peter; Stekl, Ivan; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoerig, Kathrin; Stoicea, Gabriel; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Strohmer, Raimund; Strom, David; Stroynowski, Ryszard; Stucci, Stefania Antonia; Stugu, Bjarne; Stumer, Iuliu; Stupak, John; Sturm, Philipp; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramania, Halasya Siva; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takahashi, Yuta; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tamsett, Matthew; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanasijczuk, Andres Jorge; Tani, Kazutoshi; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Christopher; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timoth\\'ee; Thoma, Sascha; Thomas, Juergen; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thong, Wai Meng; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tic, Tom\\'{a}\\v{s}; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tok\\'ar, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Topilin, Nikolai; Torrence, Eric; Torres, Heberth; Torr\\'o Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Tran, Huong Lan; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Triplett, Nathan; Trischuk, William; Trocm\\'e, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsung, Jieh-Wen; Tsuno, Soshi; Tsybychev, Dmitri; Tua, Alan; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turk Cakir, Ilkay; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Urbaniec, Dustin; Urquijo, Phillip; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Berg, Richard; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Virzi, Joseph; Vitells, Ofer; Viti, Michele; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Adrian; Vokac, Petr; Volpi, Guido; Volpi, Matteo; Volpini, Giovanni; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Wolfgang; Wagner, Peter; Wahrmund, Sebastian; Wakabayashi, Jun; Walch, Shannon; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Walsh, Brian; Wang, Chiho; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watanabe, Ippei; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Anthony; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weigell, Philipp; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wendland, Dennis; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Whittington, Denver; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Hugh; Williams, Sarah; Willis, William; Willocq, Stephane; Wilson, John; Wilson, Alan; Wingerter-Seez, Isabelle; Winkelmann, Stefan; Winklmeier, Frank; Wittgen, Matthias; Wittig, Tobias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wong, Wei-Cheng; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wraight, Kenneth; Wright, Michael; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xu, Chao; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yamada, Miho; Yamaguchi, Hiroshi; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Un-Ki; Yang, Yi; Yanush, Serguei; Yao, Liwen; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yen, Andy L; Yildirim, Eda; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zaytsev, Alexander; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; \\v{Z}eni\\v{s}, Tibor; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhang, Dongliang; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Lei; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Lei; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Zinonos, Zinonas; Ziolkowski, Michael; Zitoun, Robert; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zutshi, Vishnu; Zwalinski, Lukasz

2014-01-01

The prompt and non-prompt production cross-sections for the $\\chi_{c1}$ and $\\chi_{c2}$ charmonium states are measured in $pp$ collisions at $\\sqrt{s}=7$ TeV with the ATLAS detector at the LHC using 4.5 fb-1 of integrated luminosity. The $\\chi_{c}$ states are reconstructed through the radiative decay $\\chi_{c}\\rightarrow J/\\psi\\,\\gamma$ (with $J/\\psi\\rightarrow\\mu^{+}\\mu^{-}$) where photons are reconstructed from $\\gamma\\rightarrow e^{+}e^{-}$ conversions. The production rate of the $\\chi_{c2}$ state relative to the $\\chi_{c1}$ state is measured for prompt and non-prompt $\\chi_{c}$ as a function of $J/\\psi$ transverse momentum. The prompt $\\chi_{c}$ cross-sections are combined with existing measurements of prompt $J/\\psi$ production to derive the fraction of prompt $J/\\psi$ produced in feed-down from $\\chi_{c}$ decays. The fractions of $\\chi_{c1}$ and $\\chi_{c2}$ produced in $b$-hadron decays are also measured. In addition to measurements of inclusive $\\chi_{c}$ production, the branching fraction ${\\cal B}(B^...

THE CALIBRATION OF MONOCHROMATIC FAR-INFRARED STAR FORMATION RATE INDICATORS

International Nuclear Information System (INIS)

Calzetti, D.; Wu, S.-Y.; Hong, S.; Kennicutt, R. C.; Hao, C.-N.; Begum, A.; Johnson, B.; Lee, J. C.; Dale, D. A.; Engelbracht, C. W.; Block, M.; Van Zee, L.; Draine, B. T.; Gordon, K. D.; Regan, M.; Moustakas, J.; Murphy, E. J.; Dalcanton, J.; Funes, J.; Gil de Paz, A.

2010-01-01

Spitzer data at 24, 70, and 160 μm and ground-based Hα images are analyzed for a sample of 189 nearby star-forming and starburst galaxies to investigate whether reliable star formation rate (SFR) indicators can be defined using the monochromatic infrared dust emission centered at 70 and 160 μm. We compare recently published recipes for SFR measures using combinations of the 24 μm and observed Hα luminosities with those using 24 μm luminosity alone. From these comparisons, we derive a reference SFR indicator for use in our analysis. Linear correlations between SFR and the 70 μm and 160 μm luminosity are found for L(70) ∼> 1.4 x 10 42 erg s -1 and L(160) ∼> 2 x 10 42 erg s -1 , corresponding to SFR ∼> 0.1-0.3 M sun yr -1 , and calibrations of SFRs based on L(70) and L(160) are proposed. Below those two luminosity limits, the relation between SFR and 70 μm (160 μm) luminosity is nonlinear and SFR calibrations become problematic. A more important limitation is the dispersion of the data around the mean trend, which increases for increasing wavelength. The scatter of the 70 μm (160 μm) data around the mean is about 25% (factor ∼2) larger than the scatter of the 24 μm data. We interpret this increasing dispersion as an effect of the increasing contribution to the infrared emission of dust heated by stellar populations not associated with the current star formation. Thus, the 70 (160) μm luminosity can be reliably used to trace SFRs in large galaxy samples, but will be of limited utility for individual objects, with the exception of infrared-dominated galaxies. The nonlinear relation between SFR and the 70 and 160 μm emission at faint galaxy luminosities suggests a variety of mechanisms affecting the infrared emission for decreasing luminosity, such as increasing transparency of the interstellar medium, decreasing effective dust temperature, and decreasing filling factor of star-forming regions across the galaxy. In all cases, the calibrations hold

On the sensitivity of heterodyne detectors in far infrared astronomy

International Nuclear Information System (INIS)

Bueren, H.G. van

1976-01-01

The signal-to-noise ratio of astronomical heterodyne detection infrared spectrographs is considered, taking into account background, linewidth and seeing effects. A comparison with incoherent detector systems is presented. (author)

Direct observation of the discrete energy spectrum of two lanthanide-based single-chain magnets by far-infrared spectroscopy

Science.gov (United States)

Haas, Sabrina; Heintze, Eric; Zapf, Sina; Gorshunov, Boris; Dressel, Martin; Bogani, Lapo

2014-05-01

The far-infrared optical transmission has been studied for two lanthanide-based single-chain magnets DyPhOPh and TbPhOPh in the frequency range between 3 and 80 cm-1. The spectra were acquired at temperatures between 2 and 80 K and magnetic fields up to 6 T. Based on their magnetic field dependence in DyPhOPh two of the observed absorption lines are identified as transitions inside the crystal field split Dy3+ ground multiplet 6H15/2, coupled to the neighboring spins. In TbPhOPh one transition was observed inside the crystal-field-split Tb3+ ground multiplet 7F6. The results allow a spectroscopic investigation of the role of single-ion anisotropy and exchange in Glauber dynamics.

HERschel key program heritage: A far-infrared source catalog for the Magellanic Clouds

International Nuclear Information System (INIS)

Seale, Jonathan P.; Meixner, Margaret; Sewiło, Marta; Babler, Brian; Engelbracht, Charles W.; Misselt, Karl; Montiel, Edward; Gordon, Karl; Roman-Duval, Julia; Hony, Sacha; Okumura, Koryo; Panuzzo, Pasquale; Sauvage, Marc; Boyer, Martha L.; Chen, C.-H. Rosie; Indebetouw, Remy; Matsuura, Mikako; Oliveira, Joana M.; Loon, Jacco Th. van; Srinivasan, Sundar

2014-01-01

Observations from the HERschel Inventory of the Agents of Galaxy Evolution (HERITAGE) have been used to identify dusty populations of sources in the Large and Small Magellanic Clouds (LMC and SMC). We conducted the study using the HERITAGE catalogs of point sources available from the Herschel Science Center from both the Photodetector Array Camera and Spectrometer (PACS; 100 and 160 μm) and Spectral and Photometric Imaging Receiver (SPIRE; 250, 350, and 500 μm) cameras. These catalogs are matched to each other to create a Herschel band-merged catalog and then further matched to archival Spitzer IRAC and MIPS catalogs from the Spitzer Surveying the Agents of Galaxy Evolution (SAGE) and SAGE-SMC surveys to create single mid- to far-infrared (far-IR) point source catalogs that span the wavelength range from 3.6 to 500 μm. There are 35,322 unique sources in the LMC and 7503 in the SMC. To be bright in the FIR, a source must be very dusty, and so the sources in the HERITAGE catalogs represent the dustiest populations of sources. The brightest HERITAGE sources are dominated by young stellar objects (YSOs), and the dimmest by background galaxies. We identify the sources most likely to be background galaxies by first considering their morphology (distant galaxies are point-like at the resolution of Herschel) and then comparing the flux distribution to that of the Herschel Astrophysical Terahertz Large Area Survey (ATLAS) survey of galaxies. We find a total of 9745 background galaxy candidates in the LMC HERITAGE images and 5111 in the SMC images, in agreement with the number predicted by extrapolating from the ATLAS flux distribution. The majority of the Magellanic Cloud-residing sources are either very young, embedded forming stars or dusty clumps of the interstellar medium. Using the presence of 24 μm emission as a tracer of star formation, we identify 3518 YSO candidates in the LMC and 663 in the SMC. There are far fewer far-IR bright YSOs in the SMC than the LMC

HERschel key program heritage: A far-infrared source catalog for the Magellanic Clouds

Energy Technology Data Exchange (ETDEWEB)

Seale, Jonathan P.; Meixner, Margaret; Sewiło, Marta [The Johns Hopkins University, Department of Physics and Astronomy, 366 Bloomberg Center, 3400 N. Charles Street, Baltimore, MD 21218 (United States); Babler, Brian [Department of Astronomy, 475 North Charter St., University of Wisconsin, Madison, WI 53706 (United States); Engelbracht, Charles W.; Misselt, Karl; Montiel, Edward [Steward Observatory, University of Arizona, 933 North Cherry Ave., Tucson, AZ 85721 (United States); Gordon, Karl; Roman-Duval, Julia [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Hony, Sacha; Okumura, Koryo; Panuzzo, Pasquale; Sauvage, Marc [CEA, Laboratoire AIM, Irfu/SAp, Orme des Merisiers, F-91191 Gif-sur-Yvette (France); Boyer, Martha L. [Observational Cosmology Laboratory, Code 665, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Chen, C.-H. Rosie [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Indebetouw, Remy [National Radio Astronomy Observatory, 520 Edgemont Road Charlottesville, VA 22903 (United States); Matsuura, Mikako [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Oliveira, Joana M.; Loon, Jacco Th. van [School of Physical and Geographical Sciences, Lennard-Jones Laboratories, Keele University, Staffordshire ST5 5BG (United Kingdom); Srinivasan, Sundar [UPMC-CNRS UMR7095, Institute d' Astrophysique de Paris, F-75014 Paris (France); and others

2014-12-01

Observations from the HERschel Inventory of the Agents of Galaxy Evolution (HERITAGE) have been used to identify dusty populations of sources in the Large and Small Magellanic Clouds (LMC and SMC). We conducted the study using the HERITAGE catalogs of point sources available from the Herschel Science Center from both the Photodetector Array Camera and Spectrometer (PACS; 100 and 160 μm) and Spectral and Photometric Imaging Receiver (SPIRE; 250, 350, and 500 μm) cameras. These catalogs are matched to each other to create a Herschel band-merged catalog and then further matched to archival Spitzer IRAC and MIPS catalogs from the Spitzer Surveying the Agents of Galaxy Evolution (SAGE) and SAGE-SMC surveys to create single mid- to far-infrared (far-IR) point source catalogs that span the wavelength range from 3.6 to 500 μm. There are 35,322 unique sources in the LMC and 7503 in the SMC. To be bright in the FIR, a source must be very dusty, and so the sources in the HERITAGE catalogs represent the dustiest populations of sources. The brightest HERITAGE sources are dominated by young stellar objects (YSOs), and the dimmest by background galaxies. We identify the sources most likely to be background galaxies by first considering their morphology (distant galaxies are point-like at the resolution of Herschel) and then comparing the flux distribution to that of the Herschel Astrophysical Terahertz Large Area Survey (ATLAS) survey of galaxies. We find a total of 9745 background galaxy candidates in the LMC HERITAGE images and 5111 in the SMC images, in agreement with the number predicted by extrapolating from the ATLAS flux distribution. The majority of the Magellanic Cloud-residing sources are either very young, embedded forming stars or dusty clumps of the interstellar medium. Using the presence of 24 μm emission as a tracer of star formation, we identify 3518 YSO candidates in the LMC and 663 in the SMC. There are far fewer far-IR bright YSOs in the SMC than the LMC

CHI Research on NSTX-U

Science.gov (United States)

Lay, W.-S.; Raman, R.; Jarboe, T. R.; Nelson, B. A.; Mueller, D.; Ebrahimi, F.; Ono, M.; Jardin, S. C.; Taylor, G.

2017-10-01

At present about 20% of the total plasma current required for sustained operation has been generated by transient CHI. The present understanding suggests that it may be possible to generate all of the needed current in a ST / tokamak using transient CHI. In such a scenario, one could transition directly from a CHI produced plasma to a non-inductively sustained plasma, without the difficult intermediate step that involves non-inductive current ramp-up. STs based on this new configuration would take advantage of evolving developments in high-temperature superconductor technology to develop a simpler design ST that relies primarily on CHI for plasma current generation. Motivated by the very good results from NSTX and HIT-II, we are examining the potential application of transient CHI for reactor configurations through these studies. (1) Study of the maximum levels of start-up currents that could be generated on NSTX-U, (2) application of a single biased electrode configuration on QUEST to protect the insulator from neutron damage in a CHI reactor installation, and (3) QUEST-like, but a double biased electrode configuration for PEGASUS and NSTX-U. Results from these on-going studies will be described. This work is supported by U.S. DOE Contracts: DE-AC02-09CH11466, DE-FG02-99ER54519 AM08, and DE-SC0006757.

Integrative Multi-Spectral Sensor Device for Far-Infrared and Visible Light Fusion

Science.gov (United States)

Qiao, Tiezhu; Chen, Lulu; Pang, Yusong; Yan, Gaowei

2018-06-01

Infrared and visible light image fusion technology is a hot spot in the research of multi-sensor fusion technology in recent years. Existing infrared and visible light fusion technologies need to register before fusion because of using two cameras. However, the application effect of the registration technology has yet to be improved. Hence, a novel integrative multi-spectral sensor device is proposed for infrared and visible light fusion, and by using the beam splitter prism, the coaxial light incident from the same lens is projected to the infrared charge coupled device (CCD) and visible light CCD, respectively. In this paper, the imaging mechanism of the proposed sensor device is studied with the process of the signals acquisition and fusion. The simulation experiment, which involves the entire process of the optic system, signal acquisition, and signal fusion, is constructed based on imaging effect model. Additionally, the quality evaluation index is adopted to analyze the simulation result. The experimental results demonstrate that the proposed sensor device is effective and feasible.

Measurement of B(psi -> gamma chi(c1)) and search for psi -> gamma chi(c2)

NARCIS (Netherlands)

Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Liao, J. B.; Liao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Komicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiging; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thomdike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zheruchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

2015-01-01

We report a measurement of the branching fraction for psi(3770) -> gamma chi(c1) and search for the transition psi(3770) -> gamma chi(c2) based on 2.92 fb(-1) of e(+)e(-) data accumulated at root s = 3.773 GeV with the BESIII detector at the BEPCII collider. We measure B(psi(3770) -> gamma chi(c1))

a Question of Mass : Accounting for all the Dust in the Crab Nebula with the Deepest Far Infrared Maps

Science.gov (United States)

Matar, J.; Nehmé, C.; Sauvage, M.

2017-12-01

Supernovae represent significant sources of dust in the interstellar medium. In this work, deep far-infrared (FIR) observations of the Crab Nebula are studied to provide a new and reliable constraint on the amount of dust present in this supernova remnant. Deep exposures between 70 and 500 μm taken by PACS and SPIRE instruments on-board the Herschel Space Telescope, compiling all observations of the nebula including PACS observing mode calibration, are refined using advanced processing techniques, thus providing the most accurate data ever generated by Herschel on the object. We carefully find the intrinsic flux of each image by masking the source and creating a 2D polynomial fit to deduce the background emission. After subtracting the estimated non-thermal synchrotron component, two modified blackbodies were found to best fit the remaining infrared continuum, the cold component with T_c = 8.3 ± 3.0 K and M_d = 0.27 ± 0.05 M_{⊙} and the warmer component with T_w = 27.2 ± 1.3 K and M_d = (1.3 ± 0.4) ×10^{-3} M_{⊙}.

Dicty_cDB: CHI134 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

Tai Chi research review.

Science.gov (United States)

Field, Tiffany

2011-08-01

This review briefly summarizes recent Tai Chi research on physical benefits including balance and muscle strength and psychological benefits including attentiveness, sleep and anxiety. Cardiovascular changes following Tai Chi include decreased heart rate and blood pressure, increased vagal activity and decreased cholesterol. Pain syndromes that have been affected include fibromyalgia, osteoarthritis and rheumatoid arthritis. Autoimmune and immune conditions recently researched and reviewed here include osteoporosis, diabetes and HIV. Methodological problems with this research include the variability in forms (series of postures) used across studies as well as the intensity of the Tai Chi schedule. Further, most of the studies are based on within group changes rather than attention control group comparisons. Nonetheless, significant clinical improvements have been noted. Copyright © 2010 Elsevier Ltd. All rights reserved.

Micro-Spec: An Ultra-Compact, High-Sensitivity Spectrometer for Far-Infrared and Sub-Millimeter Astronomy

Science.gov (United States)

Cataldo, Giuseppe; Hsieh, Wen-Ting; Huang, Wei-Chung; Moseley, S. Harvey; Stevenson, Thomas R.; Wollack, Edward J.

2013-01-01

High-performance, integrated spectrometers operating in the far-infrared and sub-millimeter promise to be powerful tools for the exploration of the epochs of reionization and initial galaxy formation. These devices, using high-efficiency superconducting transmission lines, can achieve the performance of a meter-scale grating spectrometer in an instrument implemented on a four-inch silicon wafer. Such a device, when combined with a cryogenic telescope in space, provides an enabling capability for studies of the early universe. Here, the optical design process for Micro-Spec (mu-Spec) is presented, with particular attention given to its two-dimensional diffractive region, where the light of different wavelengths is focused on the different detectors. The method is based on the stigmatization and minimization of the light path function in this bounded region, which results in an optimized geometrical configuration. A point design with an efficiency of approx. 90% has been developed for initial demonstration, and can serve as the basis for future instruments. Design variations on this implementation are also discussed, which can lead to lower efficiencies due to diffractive losses in the multimode region.

Frequency stabilization of an optically pumped far-infrared laser to the harmonic of a microwave synthesizer.

Science.gov (United States)

Danylov, A A; Light, A R; Waldman, J; Erickson, N

2015-12-10

Measurements of the frequency stability of a far-infrared molecular laser have been made by mixing the harmonic of an ultrastable microwave source with a portion of the laser output signal in a terahertz (THz) Schottky diode balanced mixer. A 3 GHz difference-frequency signal was used in a frequency discriminator circuit to lock the laser to the microwave source. Comparisons of the short- and long-term laser frequency stability under free-running and locked conditions show a significant improvement with locking. Short-term frequency jitter was reduced by an order of magnitude, from approximately 40 to 4 kHz, and long-term drift was reduced by more than three orders of magnitude, from approximately 250 kHz to 80 Hz. The results, enabled by the efficient Schottky diode balanced mixer downconverter, demonstrate that ultrastable microwave-based frequency stabilization of THz optically pumped lasers (OPLs) will now be possible at frequencies extending well above 4.0 THz.

Far infrared near normal specular reflectivity of Nix(SiO2)1-x (x = 1.0, 0.84, 0.75, 0.61, 0.54, 0.28) granular films

KAUST Repository

Massa, Né stor E.; Denardin, Juliano C.; Socolovsky, Leandro M.; Knobel, Marcelo; De La Cruz, Fernando Pablo; Zhang, Xixiang

2010-01-01

of transition metal granular films with different metal fractions against what is known for conducting oxides. Films for Nix(SiO2)1-x (x = 1.0, 0.84, 0.75, 0.61, 0.54, 0.28) were studied by temperature dependent far infrared measurements. While for pure Ni

Theory of nonlinear harmonic generation in free-electron lasers with helical wigglers

International Nuclear Information System (INIS)

Geloni, G.; Saldin, E.; Schneidmiller, E.; Yurkov, M.

2007-05-01

CoherentHarmonicGeneration (CHG), and in particularNonlinearHarmonicGeneration (NHG), is of importance for both short wavelength Free-Electron Lasers (FELs), in relation with the achievement of shorter wavelengths with a fixed electron-beam energy, and high-average power FEL resonators, in relation with destructive effects of higher harmonics radiation on mirrors. In this paper we present a treatment of NHG from helical wigglers with particular emphasis on the second harmonic. Our study is based on an exact analytical solution of Maxwell's equations, derived with the help of a Green's function method. In particular, we demonstrate that nonlinear harmonic generation (NHG) fromhelicalwigglers vanishes on axis. Our conclusion is in open contrast with results in literature, that include a kinematical mistake in the description of the electron motion. (orig.)

Measurements of downwelling far-infrared radiance during the RHUBC-II campaign at Cerro Toco, Chile and comparisons with line-by-line radiative transfer calculations

Science.gov (United States)

Mast, Jeffrey C.; Mlynczak, Martin G.; Cageao, Richard P.; Kratz, David P.; Latvakoski, Harri; Johnson, David G.; Turner, David D.; Mlawer, Eli J.

2017-09-01

Downwelling radiances at the Earth's surface measured by the Far-Infrared Spectroscopy of the Troposphere (FIRST) instrument in an environment with integrated precipitable water (IPW) as low as 0.03 cm are compared with calculated spectra in the far-infrared and mid-infrared. FIRST (a Fourier transform spectrometer) was deployed from August through October 2009 at 5.38 km MSL on Cerro Toco, a mountain in the Atacama Desert of Chile. There FIRST took part in the Radiative Heating in Unexplored Bands Campaign Part 2 (RHUBC-II), the goal of which is the assessment of water vapor spectroscopy. Radiosonde water vapor and temperature vertical profiles are input into the Atmospheric and Environmental Research (AER) Line-by-Line Radiative Transfer Model (LBLRTM) to compute modeled radiances. The LBLRTM minus FIRST residual spectrum is calculated to assess agreement. Uncertainties (1-σ) in both the measured and modeled radiances are also determined. Measured and modeled radiances nearly all agree to within combined (total) uncertainties. Features exceeding uncertainties can be corrected into the combined uncertainty by increasing water vapor and model continuum absorption, however this may not be necessary due to 1-σ uncertainties (68% confidence). Furthermore, the uncertainty in the measurement-model residual is very large and no additional information on the adequacy of current water vapor spectral line or continuum absorption parameters may be derived. Similar future experiments in similarly cold and dry environments will require absolute accuracy of 0.1% of a 273 K blackbody in radiance and water vapor accuracy of ∼3% in the profile layers contributing to downwelling radiance at the surface.

Use of a Far-Infrared Active Warming Device in Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Zarndt, Bethany S; Buchta, Jessica N; Garver, Lindsey S; Davidson, Silas A; Rowton, Edgar D; Despain, Kenneth E

2015-11-01

Small mammals have difficulty maintaining body temperature under anesthesia. This hypothermia is a potential detriment not only to the health and comfort of the animal but also to the integrity of any treatment given or data gathered during the anesthetic period. Using an external warming device to assist with temperature regulation can mitigate these effects. In this study, we investigated the ability of an advanced warming device that uses far-infrared (FIR) heating and responds to real-time core temperature monitoring to maintain a normothermic core temperature in guinea pigs. Body temperatures were measured during 30 min of ketamine-xylazine general anesthesia with and without application of the heating device. The loss of core body heat from anesthetized guinea pigs under typical (unwarmed) conditions was significant, and this loss was almost completely mitigated by application of the FIR heating pad. The significant difference between the temperatures of the actively warmed guinea pigs as compared with the control group began as early as 14 min after anesthetic administration, leading to a 2.6 °C difference at 30 min. Loss of core body temperature was not correlated with animals' body weight; however, weight influences the efficiency of FIR warming slightly. These study results show that the FIR heating device accurately controls core body temperature in guinea pigs, therefore potentially alleviating the effects of body heat loss on animal physiology.

Two-photon widths of the chi(c0,2) states and helicity analysis for chi(c2) -> gamma gamma

NARCIS (Netherlands)

Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, Kun; Liu, P. L.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Thorndike, E. H.; Tian, H. L.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. F.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Werner, M.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. G.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.

2012-01-01

Based on a data sample of 106 X 10(6) psi' events collected with the BESIII detector, the decays psi' -> gamma chi(c0,2), chi(c0,2) -> gamma gamma are studied to determine the two-photon widths of the chi(c0,2) states. The two-photon decay branching fractions are determined to be B(chi(c0) -> gamma

Infrared spectroscopy by use of synchrotron radiation

International Nuclear Information System (INIS)

Nanba, Takao

1991-01-01

During five years since the author wrote the paper on the utilization of synchrotron radiation in long wavelength region, it seems to be recognized that in synchrotron radiation, the light from infrared to milli wave can be utilized, and is considerably useful. Recently the research on coherent synchrotron radiation in this region using electron linac has been developed by Tohoku University group, and the high capability of synchrotron radiation as light source is verified. This paper is the report on the infrared spectroscopic research using incoherent synchrotron radiation obtained from the deflection electromagnet part of electron storage rings. Synchrotron radiation is high luminance white light source including from X-ray to micro wave. The example of research that the author carried out at UVSOR is reported, and the perspective in near future is mentioned. Synchrotron radiation as the light source for infrared spectroscopy, the intensity and dimensions of the light source, far infrared region and mid infrared region, far infrared high pressure spectroscopic experiment, and the heightening of luminance of synchrotron radiation as infrared light source are described. (K.I.)

The Far Infrared Spectrum of Thiophosgene: Analysis of the νb{2} Fundamental Band at 500 wn

Science.gov (United States)

McKellar, A. R. W.; Billinghurst, B. E.

2009-06-01

Thiophosgene (Cl_2CS) is a model system for studies of vibrational dynamics. Many hundreds of vibrational levels in the ground electronic state have been experimentally observed, allowing a detailed anharmonic force field to be developed including all six vibrational modes. But there have been no previous high resolution studies of this molecule in the infrared, presumably because its mass and multiple isotopic species result in very congested spectra. Here we report a detailed study of the strong νb{2} fundamental band (symmetric C - Cl stretch) based on a spectrum obtained using synchrotron radiation with the Bruker IFS125 FT spectrometer at the Canadian Light Source far infrared beamline. Thiophosgene is an interesting example of an accidentally near-symmetric oblate rotor. Indeed, its inertial axes switch with isotopic substitution: for ^{35}Cl_2CS, the C_{2v} symmetry axis coincides with the a inertial axis, but for ^{37}Cl_2CS, this changes to the b axis. Fortunately for us, the ground state microwave spectrum has been well studied. Even so, it has required the full spectral resolution of the present results, with observed line widths of about 0.0008 wn, to achieve a true line-by-line analysis. [1] For example: P.D. Chowdary, B. Strickler, S. Lee, and M. Gruebele, Chem. Phys. Letters 434, 182 (2007). [2] J.H. Carpenter, D.F. Rimmer, J.G. Smith, and D.H. Whiffen, J. Chem. Soc. Faraday Trans. 2 71, 1752 (1971).

Chi-Nu Level 2 Review

Energy Technology Data Exchange (ETDEWEB)

Haight, Robert Cameron [Los Alamos National Laboratory; Lee, Hye Young [Los Alamos National Laboratory; Mosby, Shea Morgan [Los Alamos National Laboratory; O' Donnell, John M. [Los Alamos National Laboratory; Solomon, Clell Jeffrey Jr. [Los Alamos National Laboratory; Taddeucci, Terry Nicholas [Los Alamos National Laboratory; Fotiadis, Nikolaos [Los Alamos National Laboratory; Devlin, Matthew James [Los Alamos National Laboratory; Ullmann, John Leonard [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Jandel, Marian [Los Alamos National Laboratory; Nelson, Ronald Owen [Los Alamos National Laboratory; Wender, Stephen Arthur [Los Alamos National Laboratory; Neudecker, Denise [Los Alamos National Laboratory; Rising, Michael Evan [Los Alamos National Laboratory; White, Morgan Curtis [Los Alamos National Laboratory; Wu, Ching-Yen [Los Alamos National Laboratory; Bucher, Brian Michael [Los Alamos National Laboratory; Buckner, Matthew Quinn [Los Alamos National Laboratory; Henderson, Roger Alan [Los Alamos National Laboratory

2015-09-18

This series of slides presents information on Chi-Nu measurements and analysis of prompt fission neutron spectra (PFNS) for neutron energy below 1 MeV for ²³⁵U. A key focus of the Chi-Nu measurement is to address the energy dependence of the low-energy emissions. The ²³⁵U PFNS evaluation is in progress. Chi-Nu delivered preliminary experimental data and input for part of the old experimental data base. The ²³⁹Pu PFNS evaluation is finalized and submitted for testing. Data from ²⁵²Cf spontaneous fission will also be obtained.

Far infrared promotes wound healing through activation of Notch1 signaling.

Science.gov (United States)

Hsu, Yung-Ho; Lin, Yuan-Feng; Chen, Cheng-Hsien; Chiu, Yu-Jhe; Chiu, Hui-Wen

2017-11-01

The Notch signaling pathway is critically involved in cell proliferation, differentiation, development, and homeostasis. Far infrared (FIR) has an effect that promotes wound healing. However, the underlying molecular mechanisms are unclear. In the present study, we employed in vivo and HaCaT (a human skin keratinocyte cell line) models to elucidate the role of Notch1 signaling in FIR-promoted wound healing. We found that FIR enhanced keratinocyte migration and proliferation. FIR induced the Notch1 signaling pathway in HaCaT cells and in a microarray dataset from the Gene Expression Omnibus database. We next determined the mRNA levels of NOTCH1 in paired normal and wound skin tissues derived from clinical patients using the microarray dataset and Ingenuity Pathway Analysis software. The result indicated that the Notch1/Twist1 axis plays important roles in wound healing and tissue repair. In addition, inhibiting Notch1 signaling decreased the FIR-enhanced proliferation and migration. In a full-thickness wound model in rats, the wounds healed more rapidly and the scar size was smaller in the FIR group than in the light group. Moreover, FIR could increase Notch1 and Delta1 in skin tissues. The activation of Notch1 signaling may be considered as a possible mechanism for the promoting effect of FIR on wound healing. FIR stimulates keratinocyte migration and proliferation. Notch1 in keratinocytes has an essential role in FIR-induced migration and proliferation. NOTCH1 promotes TWIST1-mediated gene expression to assist wound healing. FIR might promote skin wound healing in a rat model. FIR stimulates keratinocyte migration and proliferation. Notch1 in keratinocytes has an essential role in FIR-induced migration and proliferation. NOTCH1 promotes TWIST1-mediated gene expression to assist wound healing. FIR might promote skin wound healing in a rat model.

A novel, highly efficient cavity backshort design for far-infrared TES detectors

Science.gov (United States)

Bracken, C.; de Lange, G.; Audley, M. D.; Trappe, N.; Murphy, J. A.; Gradziel, M.; Vreeling, W.-J.; Watson, D.

2018-03-01

In this paper we present a new cavity backshort design for TES (transition edge sensor) detectors which will provide increased coupling of the incoming astronomical signal to the detectors. The increased coupling results from the improved geometry of the cavities, where the geometry is a consequence of the proposed chemical etching manufacturing technique. Using a number of modelling techniques, predicted results of the performance of the cavities for frequencies of 4.3-10 THz are presented and compared to more standard cavity designs. Excellent optical efficiency is demonstrated, with improved response flatness across the band. In order to verify the simulated results, a scaled model cavity was built for testing at the lower W-band frequencies (75-100 GHz) with a VNA system. Further testing of the scale model at THz frequencies was carried out using a globar and bolometer via an FTS measurement set-up. The experimental results are presented, and compared to the simulations. Although there is relatively poor comparison between simulation and measurement at some frequencies, the discrepancies are explained by means of higher-mode excitation in the measured cavity which are not accounted for in the single-mode simulations. To verify this assumption, a better behaved cylindrical cavity is simulated and measured, where excellent agreement is demonstrated in those results. It can be concluded that both the simulations and the supporting measurements give confidence that this novel cavity design will indeed provide much-improved optical coupling for TES detectors in the far-infrared/THz band.

Atomic carbon in an infrared dark cloud

NARCIS (Netherlands)

Ossenkopf, Volker; Ormel, Chris W.; Simon, Robert; Sun, Kefeng; Stutzki, Jürgen

2010-01-01

Infrared dark clouds (IRDCs) are potential sites of massive star formation, dark in the near-infrared, but in many cases already with indications of active star-formation from far-infrared and submm observations. They are an ideal test bed to study the role of internal and external heating on the

Far-infrared spectroscopy in ordered and disordered BaMg1/3Nb2/3O3 microwave ceramics

Science.gov (United States)

Dias, Anderson; Moreira, Roberto Luiz

2003-09-01

Ba(Mg1/3Nb2/3)O3 ceramics with suitable microwave dielectric properties for application in wireless communications and information access technologies were studied by far-infrared spectroscopy. Samples with different B-site ordering degrees, obtained by hydrothermal synthesis followed by sintering at various temperatures, were employed in this investigation. The sixteen infrared modes predicted by factor-group analysis were observed and adjusted according to a four-parameter semiquantum model. The dispersion parameters were determined in order to calculate the real part of the dielectric permittivity and the quality factors associated with the dielectric losses in the microwave region. The materials exhibited increasing ɛ0 and Q values up to 1100 °C, increasing more substantially when the temperature attained 1300 °C. The B-site ordering played an important role on this behavior along with the microstructural evolution above 1100 °C (grain growth), which also increased the phonon lifetime and contributed to the Q improvement. Kramers-Kronig analyses were carried out in all experimental data and the contributions of the main optical polar modes to the dielectric and microwave properties were carefully analyzed in order to identify and attribute the Ba-BO3 external mode, the inner modes related to the O-Mg-O and O-Nb-O bending vibrations, and the stretching modes of each MgO6 and NbO6 octahedron.

H-ATLAS: THE COSMIC ABUNDANCE OF DUST FROM THE FAR-INFRARED BACKGROUND POWER SPECTRUM

Energy Technology Data Exchange (ETDEWEB)

Thacker, Cameron; Cooray, Asantha; Smidt, Joseph; De Bernardis, Francesco; Mitchell-Wynne, K. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Amblard, A. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Auld, R.; Eales, S.; Pascale, E. [School of Physics and Astronomy, Cardiff University, The Parade, Cardiff, CF24 3AA (United Kingdom); Baes, M.; Michalowski, M. J. [Sterrenkundig Observatorium, Universiteit Gent, KrijgslAAn 281 S9, B-9000 Gent (Belgium); Clements, D. L.; Dariush, A.; Hopwood, R. [Physics Department, Imperial College London, South Kensington campus, London, SW7 2AZ (United Kingdom); De Zotti, G. [INAF, Osservatorio Astronomico di Padova, Vicolo Osservatorio 5, I-35122 Padova (Italy); Dunne, L.; Maddox, S. [Department of Physics and Astronomy, University of Canterbury, Private Bag 4800, Christchurch (New Zealand); Hoyos, C. [School of Physics and Astronomy, University of Nottingham, University Park, Nottingham, NG7 2RD (United Kingdom); Ibar, E. [UK Astronomy Technology Centre, The Royal Observatory, Blackford Hill, Edinburgh, EH9 3HJ (United Kingdom); Jarvis, M. [Astrophysics, Department of Physics, Keble Road, Oxford, OX1 3RH (United Kingdom); and others

2013-05-01

We present a measurement of the angular power spectrum of the cosmic far-infrared background (CFIRB) anisotropies in one of the extragalactic fields of the Herschel Astrophysical Terahertz Large Area Survey at 250, 350, and 500 {mu}m bands. Consistent with recent measurements of the CFIRB power spectrum in Herschel-SPIRE maps, we confirm the existence of a clear one-halo term of galaxy clustering on arcminute angular scales with large-scale two-halo term of clustering at 30 arcmin to angular scales of a few degrees. The power spectrum at the largest angular scales, especially at 250 {mu}m, is contaminated by the Galactic cirrus. The angular power spectrum is modeled using a conditional luminosity function approach to describe the spatial distribution of unresolved galaxies that make up the bulk of the CFIRB. Integrating over the dusty galaxy population responsible for the background anisotropies, we find that the cosmic abundance of dust, relative to the critical density, to be between {Omega}{sub dust} = 10{sup -6} and 8 Multiplication-Sign 10{sup -6} in the redshift range z {approx} 0-3. This dust abundance is consistent with estimates of the dust content in the universe using quasar reddening and magnification measurements in the Sloan Digital Sky Survey.

Far-infrared line images of dwarf galaxies

Science.gov (United States)

Poglitsch, A.; Geis, N.; Herrmann, F.; Madden, S. C.; Stacey, G. J.; Townes, C. H.; Genzel, R.

1993-01-01

Irregular dwarf galaxies are about ten times more widespread in the universe than regular spiral galaxies. They are characterized by a relatively low metallicity, i.e., lower abundance of the heavier elements (metals) with respect to hydrogen than in the solar neighborhood. These heavier elements in the form of molecules, atoms, or ions, which have radiative transitions in the infrared play a decisive role in the energy balance of the ISM and thereby for the formation of stars. Dwarf galaxies are thus model cases for the physical conditions in the early phase of the universe. Large Magellanic Cloud: 30 Doradus. The two nearest dwarf galaxies are the Magellanic clouds at a distance approximately 50 kpc. The LMC contains 30 Dor, a region with young, extremely massive stars which strongly interact with the surrounding ISM on account of their stellar winds and intense UV radiation. 30 Dor is the brightest object in the LMC at almost all wavelengths.

CHY loop integrands from holomorphic forms

Energy Technology Data Exchange (ETDEWEB)

Gomez, Humberto [Facultad de Ciencias Basicas, Universidad Santiago de Cali,Calle 5 62-00 Barrio Pampalinda, Cali, Valle (Colombia); Perimeter Institute for Theoretical Physics,31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada); Mizera, Sebastian; Zhang, Guojun [Perimeter Institute for Theoretical Physics,31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada); Department of Physics & Astronomy, University of Waterloo,Waterloo, ON N2L 3G1 (Canada)

2017-03-16

Recently, the Cachazo-He-Yuan (CHY) approach for calculating scattering amplitudes has been extended beyond tree level. In this paper, we introduce a way of constructing CHY integrands for Φ{sup 3} theory up to two loops from holomorphic forms on Riemann surfaces. We give simple rules for translating Feynman diagrams into the corresponding CHY integrands. As a complementary result, we extend the L-algorithm, originally introduced in https://arxiv.org/abs/1604.05373, to two loops. Using this approach, we are able to analytically verify our prescription for the CHY integrands up to seven external particles at two loops. In addition, it gives a natural way of extending to higher-loop orders.

SAFARI : A Far Infrared Imaging FTS-Spectrometer for SPICA

NARCIS (Netherlands)

Goicoechea, J. R.; Roelfsema, P. R.; Jellema, W.; Swinyard, B. M.

The far-IR spectral window plays host to a critical range of both spectroscopic and photometric diagnostics with which to study our Galaxy and beyond, at wavelengths completely blocked by the Earth’s atmosphere. The proposed Japanese-led IR space telescope SPICA, with its cryogenically cooled ~3.2m

Prospects for searching axion-like particle dark matter with dipole, toroidal and wiggler magnets

Energy Technology Data Exchange (ETDEWEB)

Baker, Oliver K. [Yale Univ., New Haven, CT (United States). Dept. of Physics; Betz, Michael; Caspers, Fritz [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Jaeckel, Joerg [Institute for Particle Physics Phenomenology, Durham (United Kingdom); Lindner, Axel; Ringwald, Andreas [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Semertzidis, Yannis [Brookhaven National Lab., Upton, NY (United States); Sikivie, Pierre [Florida Univ., Gainesville, FL (United States). Dept. of Physics; Zioutas, Konstantin [Patras Univ. (Greece)

2011-10-15

In this work we consider searches for dark matter made of axions or axion-like particles (ALPs) using resonant radio frequency cavities inserted into dipole magnets from particle accelerators, wiggler magnets developed for accelerator based advanced light sources, and toroidal magnets similar to those used in particle physics detectors. We investigate the expected sensitivity of such ALP dark matter detectors and discuss the engineering aspects of building and tuning them. Brief mention is also made of even stronger field magnets that are becoming available due to improvements in magnetic technology. It is concluded that new experiments utilizing already existing magnets could greatly enlarge the mass region in searches for axion-like dark matter particles. (orig.)

Prospects for searching axion-like particle dark matter with dipole, toroidal and wiggler magnets

International Nuclear Information System (INIS)

Baker, Oliver K.; Jaeckel, Joerg; Lindner, Axel; Ringwald, Andreas; Semertzidis, Yannis; Sikivie, Pierre

2011-10-01

In this work we consider searches for dark matter made of axions or axion-like particles (ALPs) using resonant radio frequency cavities inserted into dipole magnets from particle accelerators, wiggler magnets developed for accelerator based advanced light sources, and toroidal magnets similar to those used in particle physics detectors. We investigate the expected sensitivity of such ALP dark matter detectors and discuss the engineering aspects of building and tuning them. Brief mention is also made of even stronger field magnets that are becoming available due to improvements in magnetic technology. It is concluded that new experiments utilizing already existing magnets could greatly enlarge the mass region in searches for axion-like dark matter particles. (orig.)

Imaging live humans through smoke and flames using far-infrared digital holography.

Science.gov (United States)

Locatelli, M; Pugliese, E; Paturzo, M; Bianco, V; Finizio, A; Pelagotti, A; Poggi, P; Miccio, L; Meucci, R; Ferraro, P

2013-03-11

The ability to see behind flames is a key challenge for the industrial field and particularly for the safety field. Development of new technologies to detect live people through smoke and flames in fire scenes is an extremely desirable goal since it can save human lives. The latest technologies, including equipment adopted by fire departments, use infrared bolometers for infrared digital cameras that allow users to see through smoke. However, such detectors are blinded by flame-emitted radiation. Here we show a completely different approach that makes use of lensless digital holography technology in the infrared range for successful imaging through smoke and flames. Notably, we demonstrate that digital holography with a cw laser allows the recording of dynamic human-size targets. In this work, easy detection of live, moving people is achieved through both smoke and flames, thus demonstrating the capability of digital holography at 10.6 μm.

Extending pure luminosity evolution models into the mid-infrared, far-infrared and submillimetre

Science.gov (United States)

Hill, Michael D.; Shanks, Tom

2011-07-01

Simple pure luminosity evolution (PLE) models, in which galaxies brighten at high redshift due to increased star formation rates (SFRs), are known to provide a good fit to the colours and number counts of galaxies throughout the optical and near-infrared. We show that optically defined PLE models, where dust reradiates absorbed optical light into infrared spectra composed of local galaxy templates, fit galaxy counts and colours out to 8 μm and to at least z≈ 2.5. At 24-70 μm, the model is able to reproduce the observed source counts with reasonable success if 16 per cent of spiral galaxies show an excess in mid-IR flux due to a warmer dust component and a higher SFR, in line with observations of local starburst galaxies. There remains an underprediction of the number of faint-flux, high-z sources at 24 μm, so we explore how the evolution may be altered to correct this. At 160 μm and longer wavelengths, the model fails, with our model of normal galaxies accounting for only a few percent of sources in these bands. However, we show that a PLE model of obscured AGN, which we have previously shown to give a good fit to observations at 850 μm, also provides a reasonable fit to the Herschel/BLAST number counts and redshift distributions at 250-500 μm. In the context of a ΛCDM cosmology, an AGN contribution at 250-870 μm would remove the need to invoke a top-heavy IMF for high-redshift starburst galaxies.

Design of a High-Throughput Biological Crystallography Beamline for Superconducting Wiggler

International Nuclear Information System (INIS)

Tseng, P.C.; Chang, C.H.; Fung, H.S.; Ma, C.I.; Huang, L.J.; Jean, Y.C.; Song, Y.F.; Huang, Y.S.; Tsang, K.L.; Chen, C.T.

2004-01-01

We are constructing a high-throughput biological crystallography beamline BL13B, which utilizes the radiation generated from a 3.2 Tesla, 32-pole superconducting multipole wiggler, for multi-wavelength anomalous diffraction (MAD), single-wavelength anomalous diffraction (SAD), and other related experiments. This beamline is a standard double crystal monochromator (DCM) x-ray beamline equipped with a collimating mirror (CM) and a focusing mirror (FM). Both the CM and FM are one meter long and made of Si substrate, and the CM is side-cooled by water. Based on detailed thermal analysis, liquid nitrogen (LN2) cooling for both crystals of the DCM has been adopted to optimize the energy resolution and photon beam throughput. This beamline will deliver, through a 100 μm diameter pinhole, photon flux of greater than 1011 photons/sec in the energy range from 6.5 keV to 19 keV, which is comparable to existing protein crystallography beamlines from bending magnet source at high energy storage rings

Infrared Sky Surveys

Science.gov (United States)

Price, Stephan D.

2009-02-01

A retrospective is given on infrared sky surveys from Thomas Edison’s proposal in the late 1870s to IRAS, the first sensitive mid- to far-infrared all-sky survey, and the mid-1990s experiments that filled in the IRAS deficiencies. The emerging technology for space-based surveys is highlighted, as is the prominent role the US Defense Department, particularly the Air Force, played in developing and applying detector and cryogenic sensor advances to early mid-infrared probe-rocket and satellite-based surveys. This technology was transitioned to the infrared astronomical community in relatively short order and was essential to the success of IRAS, COBE and ISO. Mention is made of several of the little known early observational programs that were superseded by more successful efforts.

Thermal imaging method to visualize a hidden painting thermally excited by far infrared radiations

Science.gov (United States)

Davin, T.; Wang, X.; Chabane, A.; Pawelko, R.; Guida, G.; Serio, B.; Hervé, P.

2015-06-01

The diagnosis of hidden painting is a major issue for cultural heritage. In this paper, a non-destructive active infrared thermographic technique was considered to reveal paintings covered by a lime layer. An extended infrared spectral range radiation was used as the excitation source. The external long wave infrared energy source delivered to the surface is then propagated through the material until it encounters a painting zone. Due to several thermal effects, the sample surface then presents non-uniformity patterns. Using a high sensitive infrared camera, the presence of covered pigments can thus be highlighted by the analysis of the non-stationary phenomena. Reconstituted thermal contrast images of mural samples covered by a lime layer are shown.

Dispersion relation and growth in a two-stream free electron laser with helical wiggler and ion channel guiding

International Nuclear Information System (INIS)

Mehdian, Hassan; Abbasi, Negar

2008-01-01

A linear theory of two-stream free electron laser (FEL) with helical wiggler and ion channel guiding is presented. The dispersion relation is obtained with the help of fluid theory and the growth rate is analyzed through the numerical solutions. The considerable enhancement of the growth rate is demonstrated due to the two-stream instability and continuous tuning of peak growth rate ratio, two-stream FEL compared to single-stream FEL, in terms of varying the ion channel frequency is illustrated

Tai Chi Chuan in Medicine and Health Promotion

OpenAIRE

Lan, Ching; Chen, Ssu-Yuan; Lai, Jin-Shin; Wong, Alice May-Kuen

2013-01-01

Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to heal...

The effect of leg hyperthermia using far infrared rays in bedridden subjects with type 2 diabetes mellitus.

Science.gov (United States)

Kawaura, Akihiko; Tanida, Noritoshi; Kamitani, Masato; Akiyama, Junichi; Mizutani, Masatoshi; Tsugawa, Naoko; Okano, Toshio; Takeda, Eiji

2010-04-01

We examined the effect of leg hyperthermia on oxidative stress in bedridden subjects with type 2 diabetes mellitus using 15-min sessions of far infrared rays over a two-week period. Four subjects (male 1, female 3) incapacitated by a stroke were recruited for this study. All patients were admitted to Takahashi Central Hospital and ate the same hospital meals. Fasting plasma glucose, HbA1c, tumor necrosis factor (TNF)alpha, free fatty acid, leptin, adiponectin and plasma 8-epi-prostaglandin F2alpha (8-epi-PGF2alpha) levels as a marker of oxidative stress were measured on admission, just before and 2 weeks after local heating of the leg. Results showed that plasma total 8-epi-PGF2alpha levels were decreased significantly while TNFalpha levels were increased significantly. On the other hand, glucose, HbA1c, free fatty acid, leptin and adiponectin levels were not changed during the study period. These results suggest that repeated leg hyperthermia may protect against oxidative stress.

X-ray Synchrotron Radiation in a Plasma Wiggler

Energy Technology Data Exchange (ETDEWEB)

Wang, Shuoquin; /UCLA /SLAC, SSRL

2005-09-27

A relativistic electron beam can radiate due to its betatron motion inside an ion channel. The ion channel is induced by the electron bunch as it propagates through an underdense plasma. In the theory section of this thesis the formation of the ion channel, the trajectories of beam electrons inside the ion channel, the radiation power and the radiation spectrum of the spontaneous emission are studied. The comparison between different plasma wiggler schemes is made. The difficulties in realizing stimulated emission as the beam traverses the ion channel are investigated, with particular emphasis on the bunching mechanism, which is important for the ion channel free electron laser. This thesis reports an experiment conducted at the Stanford Linear Accelerator Center (SLAC) to measure the betatron X-ray radiations for the first time. They first describe the construction and characterization of the lithium plasma source. In the experiment, the transverse oscillations of the SLAC 28.5 GeV electron beam traversing through a 1.4 meter long lithium plasma source are clearly seen. These oscillations lead to a quadratic density dependence of the spontaneously emitted betatron X-ray radiation. The divergence angle of the X-ray radiation is measured. The absolute photon yield and the spectral brightness at 14.2 KeV photon energy are estimated and seen to be in reasonable agreement with theory.

Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+

Energy Technology Data Exchange (ETDEWEB)

Aubert, : B.

2008-08-13

The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.

Obituary: Chi Yuan (1937-2008)

Science.gov (United States)

Ho, Paul

2011-12-01

Chi Yuan graduated from the National Taiwan University in1959, and received his Masters of Science degree from the University of Florida in 1962, and his Doctor of Philosophy from the University of Michigan in 1966. He was a postdoctoral fellow with Professor C.C. Lin at MIT for three years, before taking his faculty post at the City College of New York in 1969. He attained full professorship at CCNY in 1981. From 1994-1996, Chi returned to Taiwan as Director of the newly found Academia Sinica Institute of Astronomy and Astrophysics (ASIAA). From 1997-2002, he was the recipient of an Outstanding Scholar Award, reserved for the most distinguished scientists employed in Taiwan. Chi retired from ASIAA in 2007, but continued to be active in his research during his two-year fight with brain cancer. Chi Yuan made his greatest impact with his work on the density-wave theory for spiral arm structures in galaxies, with C.C. Lin and Frank Shu. His early work elucidated the observational tests of density-wave theory, and the effects of magnetic fields in galactic shocks. In the 1980s, Chi Yuan worked on spiral density waves in Saturn's rings. In the past two decades, Chi Yuan concentrated on the problem of barred and spiral structures in the nuclei of galaxies, with their implications for fueling the central supermassive black holes. He also worked on the problem of the migration of giant extrasolar planets in their solar disks. These studies were made possible by his establishment of a program on computational fluid dynamics, which became one of the key initiatives in theory at the ASIAA. Among his academic records, two contributions are particularly notable. First, with Typhoon Lee, Fred Lo, and Frank Shu, Chi Yuan founded the ASIAA in order to stimulate the growth of astronomy in Taiwan. Second, and perhaps his greatest influence, has been his training and mentoring of a great number of students in astrophysics, especially for the last 20 years in Taiwan. Today, astronomy

Tai Chi Chuan in Medicine and Health Promotion

Directory of Open Access Journals (Sweden)

Ching Lan

2013-01-01

Full Text Available Tai Chi Chuan (Tai Chi is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi. Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction, rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia, orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder, cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure, chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

Tai chi chuan in medicine and health promotion.

Science.gov (United States)

Lan, Ching; Chen, Ssu-Yuan; Lai, Jin-Shin; Wong, Alice May-Kuen

2013-01-01

Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction), rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia), orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder), cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure), chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

Hadroproduction of the {chi}{sub 1} and {chi}{sub 2} states of charmonium in 800-GeV/c proton-silicon interactions

Energy Technology Data Exchange (ETDEWEB)

Alexopoulos, T. [University of Wisconsin, Madison, Wisconsin 53706 (United States); Antoniazzi, L. [University and INFN of Pavia, I-27100 Pavia, (Italy); Arenton, M. [University of Virginia, Charlottesville, Virginia 22901 (United States); Ballagh, H. C. [University of California at Berkeley, Berkeley, California 94720 (United States); Bingham, H. [University of California at Berkeley, Berkeley, California 94720 (United States); Blankman, A. [University of Pennsylvania, Philadelphia, Pennsylvania 19104 (United States); Block, M. [Northwestern University, Evanston, Illinois 60208 (United States); Boden, A. [University of California at Los Angeles, Los Angeles, California 90024 (United States); Bonomi, G. [University and INFN of Pavia, I-27100 Pavia, (Italy); Cao, Z. L. [University of Virginia, Charlottesville, Virginia 22901 (United States)] (and others)

2000-08-01

The cross sections for the hadroproduction of the {chi}{sub 1} and {chi}{sub 2} states of charmonium in proton-silicon collisions at {radical}(s)=38.8 GeV have been measured in Fermilab fixed target experiment 771. The {chi} states were observed via their radiative decay to J/{psi}{gamma}, where the photon converted to e{sup +}e{sup -} in the material of the spectrometer. The estimated values for the {chi}{sub 1} and {chi}{sub 2} cross sections for x{sub F}>0 are 263{+-}69(stat){+-}32(syst) and 498{+-}143(stat){+-}67(syst) nb per nucleon, respectively. The resulting {sigma}({chi}{sub 1})/{sigma}({chi}{sub 2}) ratio of 0.53{+-}0.20(stat){+-}0.07(syst), although somewhat larger than most theoretical expectations, can be accommodated by the latest theoretical estimates. (c) 2000 The American Physical Society.

Simplified Tai Chi Program Training versus Traditional Tai Chi on the Functional Movement Screening in Older Adults

Directory of Open Access Journals (Sweden)

Huiru Wang

2016-01-01

Full Text Available Background. The present study aimed to evaluate and compare the effect of two different types of Tai Chi programs on the Functional Movement Screening (FMS in older adults. Methods. Ninety older adults (65.5 ± 4.6 years old who met the eligibility criteria were randomized into three different groups based on a ratio of 1 : 1 : 1: a traditional Tai Chi exercise (TTC, a simplified Tai Chi exercise (TCRT, or a control group (routine activity. The FMS consisted of the deep squat, hurdle step, in-line lunge, shoulder mobility, active straight leg rise, trunk stability push-up, and rotatory stability, which was used to measure physical function before the present study and after six months of Tai Chi interventions. Results. Seventy-nine participants completed the present study (control = 27, TTC = 23, and TCRT = 29. Significant improvement on the FMS tests between the baseline and after the six-month intervention was observed in both Tai Chi programs, whereas no significant improvement was observed in the control group. In addition, participants in the TCRT group demonstrated greater improvement than those in the TTC group. Conclusions. The TCRT is more effective in improving the physical function in older adults when compared to the traditional Tai Chi modality, particularly for improving balance.

Theories of cometary origin and the brightness of the infrared sky

International Nuclear Information System (INIS)

Bailey, M.E.

1983-01-01

The far-infrared flux produced by a power-law density distribution of comets surrounding the planetary system is calculated. If the comet cloud is as massive and as dense as some recent ideas suggest, the total contribution by comets to the far-infrared background radiation may be significant and could be detected using current observational techniques. In this way observations of the infrared background could constrain theories of Solar System and cometary origins. (author)

Pierce-Wiggler electron beam system for 250 GHz GYRO-BWO: Final report

International Nuclear Information System (INIS)

Pirkle, D.R.; Alford, C.W.; Anderson, M.H.; Garcia, R.F.; Legarra, J.R.; Nordquist, A.L.

1989-01-01

This final report summarizes the design and performance of the VUW-8028 Pierce-Wiggler electron beam systems, which can be used to power high frequency gyro-BWO's. The operator's manual for this gyro-BWO beamstick is included as appendix A. Researchers at Lawrence Livermore National Laboratory (LLNL) are developing a gyro-BWO with a center frequency of 250 GHz, 6% bandwidth, and 10 kV peak output power. The gyro-BWO will be used to drive a free electron laser amplifier at LLNL. The electron beam requirements of the gyro-BWO application are: Small beam size, .100 inch at 2500 gauss axial magnetic field; a large fraction of the electron energy in rotational velocity; ability to vary the electrons' axial velocity easily, for electronic tuning; and low velocity spread i.e. little variation in the axial velocities of the electrons in the interaction region. 1 ref., 13 figs

Far-infrared properties of sol-gel derived PbZr0.52Ti0.48O3 thin films on Pt-coated substrates

International Nuclear Information System (INIS)

Kafadaryan, E A; Hovsepyan, R K; Khachaturova, A A; Aghamalyan, N R; Shirinyan, G O; Manukyan, A L; Vardanyan, R S; Hayrapetyan, A G; Grigoryan, S G; Vardanyan, E S

2003-01-01

Polycrystalline tetragonal PbZr 0.52 Ti 0.48 O 3 (PZT) thin films have been deposited on the nickel and (111) platinum coated (110) sapphire substrates by the sol-gel method. Optical properties of the PZT thin films were studied using far-infrared reflectivity spectroscopy in the 200-10 000 cm -1 frequency range at 300 K. The frequency dependence of the optical characteristics (σ, ε, -Im ε -1 ) of the films were calculated by the Kramers-Kronig transformation of the reflectivity spectra and analysed by the Drude-Lorentz model. The frequency dependence of the optical conductivity, σ(ω), of the PZT films deposited on platinum coated sapphire is well described by the free-carrier term and an overdamped mid-infrared component. Sapphire/Pt/PZT structures reveal semiconductor properties (effective carrier concentration N/m* is up to 10 20 cm -3 , plasma minimum is located near 3000 cm -1 ). This effect can be related to the favourable influence of the platinum electrode on the charge carrier density at Pt/PZT contact and formation of the interfacial conductive layer

mRNA expression of EgCHI1, EgCHI2, and EgCHI3 in oil palm leaves (Elaeis guineesis Jacq.) after treatment with Ganoderma boninense pat. and Trichoderma harzianum Rifai.

Science.gov (United States)

Naher, Laila; Tan, Soon Guan; Ho, Chai Ling; Yusuf, Umi Kalsom; Ahmad, Siti Hazar; Abdullah, Faridah

2012-01-01

Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

High-level expression and characterization of two chitinases, ChiCH and ChiCW, of Bacillus cereus 28-9 in Escherichia coli

International Nuclear Information System (INIS)

Huang, C.-J.; Chen, C.-Y.

2005-01-01

Many chitinase genes have been cloned and sequenced from prokaryotes and eukaryotes but overexpression of chitinases in Escherichia coli cells was less reported. ChiCH and ChiCW of Bacillus cereus 28-9 belong to two distinct groups based on their amino acid sequences of catalytic domains, and in addition, domain structures of two enzymes are different. In this study, we established an ideal method for high-level expression of chitinases in E. coli as glutathione-S-transferase fusion proteins using pGEX-6P-1 vector. Both ChiCH and ChiCW were successfully highly expressed in E. coli cells as soluble GST-chitinase fusion proteins, and recombinant native ChiCH and ChiCW could be purified after cleavage with PreScission protease to remove GST tag. Purified chitinases were used for biochemical characterization of kinetics, hydrolysis products, and binding activities. The results indicate that ChiCW is an endo-chitinase and effectively hydrolyzes chitin and chito-multimers to chito-oligomers and the end product chitobiose, and ChiCH is an exo-chitinase and degrades chito-oligomers to produce chitobiose. Furthermore, due to higher affinity of ChiCW toward colloidal chitin than Avicel, C-terminal domain of ChiCW should be classified as a chitin-binding domain not a cellulose-binding domain although that was revealed as a cellulose-binding domain by conserved domain analysis. Therefore, the method of high-level expression of chitinases is helpful to studies and applications of chitinases

Far-infrared spectra of yttrium-doped gold clusters Au(n)Y (n=1-9).

Science.gov (United States)

Lin, Ling; Claes, Pieterjan; Gruene, Philipp; Meijer, Gerard; Fielicke, André; Nguyen, Minh Tho; Lievens, Peter

2010-06-21

The geometric, spectroscopic, and electronic properties of neutral yttrium-doped gold clusters Au(n)Y (n=1-9) are studied by far-infrared multiple photon dissociation (FIR-MPD) spectroscopy and quantum chemical calculations. Comparison of the observed and calculated vibrational spectra allows the structures of the isomers present in the molecular beam to be determined. Most of the isomers for which the IR spectra agree best with experiment are calculated to be the energetically most stable ones. Attachment of xenon to the Au(n)Y cluster can cause changes in the IR spectra, which involve band shifts and band splittings. In some cases symmetry changes, as a result of the attachment of xenon atoms, were also observed. All the Au(n)Y clusters considered prefer a low spin state. In contrast to pure gold clusters, which exhibit exclusively planar lowest-energy structures for small sizes, several of the studied species are three-dimensional. This is particularly the case for Au(4)Y and Au(9)Y, while for some other sizes (n=5, 8) the 3D structures have an energy similar to that of their 2D counterparts. Several of the lowest-energy structures are quasi-2D, that is, slightly distorted from planar shapes. For all the studied species the Y atom prefers high coordination, which is different from other metal dopants in gold clusters.

Deriving simulators for hybrid Chi models

NARCIS (Netherlands)

Beek, van D.A.; Man, K.L.; Reniers, M.A.; Rooda, J.E.; Schiffelers, R.R.H.

2006-01-01

The hybrid Chi language is formalism for modeling, simulation and verification of hybrid systems. The formal semantics of hybrid Chi allows the definition of provably correct implementations for simulation, verification and realtime control. This paper discusses the principles of deriving an

Tai Chi and Rheumatic Diseases

OpenAIRE

Wang, Chenchen

2010-01-01

Many patients with chronic rheumatic diseases such as osteoarthritis, rheumatoid arthritis and fibromyalgia experience high levels of pain, psychological distress and negative emotions and have limited therapeutic options. Tai Chi is a complex multi-component mind-body exercise that increasing numbers of Americans are practicing, particularly those with musculoskeletal conditions. Clinical trials and observational studies have provided encouraging evidence that Tai Chi, both short and long-te...

A Journey to Wholeness Through Tai Chi

Science.gov (United States)

Al-Turki, Faiza

Healing is a multifaceted venture. Whereas many traditional cultures see healing as a journey that, by necessity, combines body, mind, and spirit, today's Western society frequently divides healing, relegating its parts to various experts--body to physicians, mind to psychologists, spirit to religions. Employing heuristic and alchemical hermeneutic methodologies, this thesis explores tai chi as a healing tool that bridges that division, exploring the following question: is it possible that the connection of body, mind, and spirit offered by tai chi is the very mechanism by which it facilitates healing? The cultural and historical context of tai chi is introduced, as well as research showing various Western views. A heuristic approach offers personal examples of the use of tai chi as a process partner, while a depth psychological lens informs the use of tai chi principles to guide moments of self-exploration and transformation in a therapeutic way.

T'ai Chi

Science.gov (United States)

... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq. after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

Directory of Open Access Journals (Sweden)

Laila Naher

2012-01-01

Full Text Available Background. Basal stem rot (BSR disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq. chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq.) after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

Science.gov (United States)

Naher, Laila; Tan, Soon Guan; Ho, Chai Ling; Yusuf, Umi Kalsom; Ahmad, Siti Hazar; Abdullah, Faridah

2012-01-01

Background. Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment. PMID:22919345

Off-shell CHY amplitudes

Energy Technology Data Exchange (ETDEWEB)

Lam, C.S., E-mail: Lam@physics.mcgill.ca [Department of Physics, McGill University, Montreal, Q.C., H3A 2T8 (Canada); Department of Physics and Astronomy, University of British Columbia, Vancouver, BC, V6T 1Z1 (Canada); Yao, York-Peng, E-mail: yyao@umich.edu [Department of Physics, The University of Michigan Ann Arbor, MI 48109 (United States)

2016-06-15

The Cachazo–He–Yuan (CHY) formula for on-shell scattering amplitudes is extended off-shell. The off-shell amplitudes (amputated Green's functions) are Möbius invariant, and have the same momentum poles as the on-shell amplitudes. The working principles which drive the modifications to the scattering equations are mainly Möbius covariance and energy momentum conservation in off-shell kinematics. The same technique is also used to obtain off-shell massive scalars. A simple off-shell extension of the CHY gauge formula which is Möbius invariant is proposed, but its true nature awaits further study.

Self-fields in free-electron lasers with planar wiggler and ion-channel guiding

International Nuclear Information System (INIS)

Farokhi, B; Jafary, F B; Maraghechi, B

2006-01-01

A theory of self-electric and self-magnetic fields of a relativistic electron beam passing through a one-dimensional planar wiggler and an ion-channel is presented. The equilibrium orbits and their stability, under the influence of self-electric and self-magnetic fields, are analysed. New unstable orbits, in the first part of the group I orbits, are found. It is shown that for a low energy and high density beam the self-fields can produce very large effects. Stabilities of quasi-steady-state orbits are investigated by analytical and numerical methods and perfect agreement was found. The theory of small signal gain is used to derive a formula for the gain with the self-field effects included. A numerical analysis is conducted to study the self-field effects on the quasi-steady-state orbits and the gain

Tai Chi for chronic obstructive pulmonary disease (COPD).

Science.gov (United States)

Ngai, Shirley P C; Jones, Alice Y M; Tam, Wilson Wai San

2016-06-07

Tai Chi, a systematic callisthenic exercise first developed in ancient China, involves a series of slow and rhythmic circular motions. It emphasises use of 'mind' or concentration to control breathing and circular body motions to facilitate flow of internal energy (i.e. 'qi') within the body. Normal flow of 'qi' is believed to be essential to sustain body homeostasis, ultimately leading to longevity. The effect of Tai Chi on balance and muscle strength in the elderly population has been reported; however, the effect of Tai Chi on dyspnoea, exercise capacity, pulmonary function and psychosocial status among people with chronic obstructive pulmonary disease (COPD) remains unclear. • To explore the effectiveness of Tai Chi in reducing dyspnoea and improving exercise capacity in people with COPD.• To determine the influence of Tai Chi on physiological and psychosocial functions among people with COPD. We searched the Cochrane Airways Group Specialised Register of trials (which included the Cochrane Central Register of Controlled Trials (CENTRAL), MEDLINE, EMBASE, the Cumulative Index to Nursing and Allied Health Literature (CINAHL), the Allied and Complementary Medicine Database (AMED) and PsycINFO); handsearched respiratory journals and meeting abstracts; and searched Chinese medical databases including Wanfang Data, Chinese Medical Current Contents (CMCC), Chinese Biomedical Database (CBM), China Journal Net (CJN) and China Medical Academic Conference (CMAC), from inception to September 2015. We checked the reference lists of all primary studies and review articles for relevant additional references. We included randomised controlled trials (RCTs) comparing Tai Chi (Tai Chi alone or Tai Chi in addition to another intervention) versus control (usual care or another intervention identical to that used in the Tai Chi group) in people with COPD. Two independent review authors screened and selected studies. Two independent review authors extracted data from included

Far-IR transparency and dynamic infrared signature control with novel conducting polymer systems

Science.gov (United States)

Chandrasekhar, Prasanna; Dooley, T. J.

1995-09-01

Materials which possess transparency, coupled with active controllability of this transparency in the infrared (IR), are today an increasingly important requirement, for varied applications. These applications include windows for IR sensors, IR-region flat panel displays used in camouflage as well as in communication and sight through night-vision goggles, coatings with dynamically controllable IR-emissivity, and thermal conservation coatings. Among stringent requirements for these applications are large dynamic ranges (color contrast), 'multi-color' or broad-band characteristics, extended cyclability, long memory retention, matrix addressability, small area fabricability, low power consumption, and environmental stability. Among materials possessing the requirements for variation of IR signature, conducting polymers (CPs) appear to be the only materials with dynamic, actively controllable signature and acceptable dynamic range. Conventional CPs such as poly(alkyl thiophene), poly(pyrrole) or poly(aniline) show very limited dynamic range, especially in the far-IR, while also showing poor transparency. We have developed a number of novel CP systems ('system' implying the CP, the selected dopant, the synthesis method, and the electrolyte) with very wide dynamic range (up to 90% in both important IR regions, 3 - 5 (mu) and 8 - 12 (mu) ), high cyclability (to 105 cycles with less than 10% optical degradation), nearly indefinite optical memory retention, matrix addressability of multi-pixel displays, very wide operating temperature and excellent environmental stability, low charge capacity, and processability into areas from less than 1 mm2 to more than 100 cm2. The criteria used to design and arrive at these CP systems, together with representative IR signature data, are presented in this paper.

Inverse Compton X-Ray Halos Around High-z Radio Galaxies: A Feedback Mechanism Powered by Far-Infrared Starbursts or the Cosmic Microwave Background?

Science.gov (United States)

Small, Ian; Blundell, Katherine M.; Lehmer, B. D.; Alexander, D. M.

2012-01-01

We report the detection of extended X-ray emission around two powerful radio galaxies at z approx. 3.6 (4C 03.24 and 4C 19.71) and use these to investigate the origin of extended, inverse Compton (IC) powered X-ray halos at high redshifts. The halos have X-ray luminosities of L(sub X) approx. 3 x 10(exp 44) erg/s and sizes of approx.60 kpc. Their morphologies are broadly similar to the approx.60 kpc long radio lobes around these galaxies suggesting they are formed from IC scattering by relativistic electrons in the radio lobes, of either cosmic microwave background (CMB) photons or far-infrared photons from the dust-obscured starbursts in these galaxies. These observations double the number of z > 3 radio galaxies with X-ray-detected IC halos. We compare the IC X-ray-to-radio luminosity ratios for the two new detections to the two previously detected z approx. 3.8 radio galaxies. Given the similar redshifts, we would expect comparable X-ray IC luminosities if millimeter photons from the CMB are the dominant seed field for the IC emission (assuming all four galaxies have similar ages and jet powers). Instead we see that the two z approx. 3.6 radio galaxies, which are 4 fainter in the far-infrared than those at z 3.8, also have approx.4x fainter X-ray IC emission. Including data for a further six z > or approx. 2 radio sources with detected IC X-ray halos from the literature, we suggest that in the more compact, majority of radio sources, those with lobe sizes < or approx.100-200 kpc, the bulk of the IC emission may be driven by scattering of locally produced far-infrared photons from luminous, dust-obscured starbursts within these galaxies, rather than millimeter photons from the CMB. The resulting X-ray emission appears sufficient to ionize the gas on approx.100-200 kpc scales around these systems and thus helps form the extended, kinematically quiescent Ly(alpha) emission line halos found around some of these systems. The starburst and active galactic nucleus

INVERSE COMPTON X-RAY HALOS AROUND HIGH-z RADIO GALAXIES: A FEEDBACK MECHANISM POWERED BY FAR-INFRARED STARBURSTS OR THE COSMIC MICROWAVE BACKGROUND?

Energy Technology Data Exchange (ETDEWEB)

Smail, Ian [Institute for Computational Cosmology, Durham University, South Road, Durham DH1 3LE (United Kingdom); Blundell, Katherine M. [Department of Astrophysics, University of Oxford, Keble Road, Oxford OX1 3RH (United Kingdom); Lehmer, B. D. [Department of Physics and Astronomy, The Johns Hopkins University, Homewood Campus, Baltimore, MD 21218 (United States); Alexander, D. M. [Department of Physics, Durham University, South Road, Durham DH1 3LE (United Kingdom)

2012-12-01

We report the detection of extended X-ray emission around two powerful radio galaxies at z {approx} 3.6 (4C 03.24 and 4C 19.71) and use these to investigate the origin of extended, inverse Compton (IC) powered X-ray halos at high redshifts. The halos have X-ray luminosities of L {sub X} {approx} 3 Multiplication-Sign 10{sup 44} erg s{sup -1} and sizes of {approx}60 kpc. Their morphologies are broadly similar to the {approx}60 kpc long radio lobes around these galaxies suggesting they are formed from IC scattering by relativistic electrons in the radio lobes, of either cosmic microwave background (CMB) photons or far-infrared photons from the dust-obscured starbursts in these galaxies. These observations double the number of z > 3 radio galaxies with X-ray-detected IC halos. We compare the IC X-ray-to-radio luminosity ratios for the two new detections to the two previously detected z {approx} 3.8 radio galaxies. Given the similar redshifts, we would expect comparable X-ray IC luminosities if millimeter photons from the CMB are the dominant seed field for the IC emission (assuming all four galaxies have similar ages and jet powers). Instead we see that the two z {approx} 3.6 radio galaxies, which are {approx}4 Multiplication-Sign fainter in the far-infrared than those at z {approx} 3.8, also have {approx}4 Multiplication-Sign fainter X-ray IC emission. Including data for a further six z {approx}> 2 radio sources with detected IC X-ray halos from the literature, we suggest that in the more compact, majority of radio sources, those with lobe sizes {approx}<100-200 kpc, the bulk of the IC emission may be driven by scattering of locally produced far-infrared photons from luminous, dust-obscured starbursts within these galaxies, rather than millimeter photons from the CMB. The resulting X-ray emission appears sufficient to ionize the gas on {approx}100-200 kpc scales around these systems and thus helps form the extended, kinematically quiescent Ly{alpha} emission line

From Tornadoes to Earthquakes: Forecast Verification for Binary Events Applied to the 1999 Chi-Chi, Taiwan,Earthquake

Directory of Open Access Journals (Sweden)

Chien-Chih Chen

2006-01-01

Full Text Available Forecast verification procedures for statistical events with binary outcomes typically rely on the use of contingency tables and Relative Operating Characteristic (ROC diagrams. Originally developed for the statistical evaluation of tornado forecasts on a county-by-county basis, these methods can be adapted to the evaluation of competing earthquake forecasts. Here we apply these methods retrospectively to two forecasts for the M 7.3 1999 Chi-Chi, Taiwan, earthquake. We show that a previously proposed forecast method that is based on evaluating changes in seismic intensity on a regional basis is superior to a forecast based only on the magnitude of seismic intensity in the same region. Our results confirm earlier suggestions that the earthquake preparation process for events such as the Chi-Chi earthquake involves anomalous activation or quiescence, and that signatures of these processes can be detected in seismicity data using appropriate methods.

Building Bridges: Psi Chi and International Psychology

Directory of Open Access Journals (Sweden)

Mercedes A McCormick

2014-12-01

Full Text Available “How can Psi Chi best partner with international psychologists to expand the honor society world-wide?” This has been an important question since 2009, when the 1,100 chapters of Psi Chi in the United States voted to become “The International Honor Society in Psychology”. This report updates and expands on a unique symposium offered at the 120th meeting of the American Psychological Association in Orlando, Florida, in August of 2012 - the first symposium on the Presidential theme of “Building Bridges” between Psi Chi and international psychology [8]. Here, seven leaders in international psychology in North and South America join to address different aspects of this timely question--with many suggestions on how to “build bridges” to expand Psi Chi globally. It was in part due to this historic symposium that in 2013 Guatemala became the first nation in Latin America, and Russia the first nation in mainland Europe to launch a chapter of Psi Chi.

The large scale infrared emission in the galactic plane - observations

International Nuclear Information System (INIS)

Okuda, H.

1981-01-01

Infrared radiation is deeply involved in a variety of matters and processes in the galaxy. Near infrared radiation is predominantly emitted by late type stars which include the major part of the mass in the Galaxy and hence govern its dynamics. Short wavelength radiation (UV and visible) emitted from early type stars is easily absorbed by dust around the stars themselves or by interstellar dust, and reemitted in middle or far infrared regions. A variety of emission lines, fine structure lines of neutral and ionized heavy elements, as well as many molecular lines are also clustered in the middle and far infrared regions. Since their line intensities are generally very weak, and, moreover, spectroscopic observations demand relatively difficult techniques in their detection, the surveys so far done have been limited mostly to continuum emission. This article compiles them and discusses briefly their implications to the structure of the Galaxy in its inner region. (Auth.)

The CHI 2013 interactive schedule

DEFF Research Database (Denmark)

Satyanarayan, Arvind; Strazzulla, Daniel; Klokmose, Clemens Nylandsted

2013-01-01

CHI 2013 offers over 500 separate events including paper presentations, panels, courses, case studies and special interest groups. Given the size of the conference, it is no longer practical to host live summaries of these events. Instead, a 30-second Video Preview summary of each event is availa......CHI 2013 offers over 500 separate events including paper presentations, panels, courses, case studies and special interest groups. Given the size of the conference, it is no longer practical to host live summaries of these events. Instead, a 30-second Video Preview summary of each event...... is available. The CHI'13 Interactive Schedule helps attendees navigate this wealth of video content in order to identify events they would like to attend. It consists of a number of large display screens throughout the conference venue which cycle through a video playlist of events. Attendees can interact...

Biological infrared microspectroscopy at the National Synchrotron Light Source

International Nuclear Information System (INIS)

Miller, Lisa M.; Carr, G. Lawrence; Williams, Gwyn P.; Sullivan, Michael; Chance, Mark R.

2000-01-01

Beamline U2B at the National Synchrotron Light Source has been designed and built as an infrared beamline dedicated to the study of biomedical problems. In 1997, the horizontal and vertical acceptances of Beamline U2B were increased in order to increase the overall flux of the beamline. A wedged, CVD diamond window separates the UHV vacuum of the VUV ring from the rough vacuum of the beamline. The endstation consists of a Nicolet Magna 860 step-scan FTIR and a NicPlan infrared microscope. The spectrometer is equipped with beamsplitter/detector combinations that permit data collection in the mid-and far-infrared regions. We have also made provisions for mounting an external detector (e.g. bolometer) for far infrared microspectroscopy. Thus far, Beamline U2B has been used to (1) perform chemical imaging of bone tissue and brain cells to address issues related to bone disease and epilepsy, respectively, and (2) examine time-resolved protein structure in the sub-millisecond folding of cytochrome c

Influence of Water Activated by Far infrared Porous Ceramics on Nitrogen Absorption in the Pig Feed.

Science.gov (United States)

Meng, Junping; Liu, Jie; Liang, Jinsheng; Zhang, Hongchen; Ding, Yan

2016-04-01

Under modern and, intensive feeding livestock and poultry density has increased, and brought a deterioration of the farm environment. The livestock and their excrement generate harmful gases such as ammonia, etc. which restricted the sustainable development and improvement of production efficiency of animal husbandry. In this paper, a new kind of far infrared porous ceramics was prepared to activate, the animal drinking water. The activated water and common water were then supplied to pigs, and the fresh pig feces of experimental group and:control group were collected on a regular basis. The residual protein content in feces was tested by Kjeldahl nitrogen method to study the influence law of the porous ceramics on absorbing nitrogen element in animal feces. The results showed that compared with the control group, the protein content in the experimental group decreased on average by 39.2%. The activated drinking water was conducive to the absorption of nitrogen in pig feed. The clusters of water molecules became smaller under the action of the porous ceramics. Hence, they were easy to pass through the water protein channel on the cell membrane for speeding up the metabolism.