WorldWideScience

Sample records for facility profiles co hu

  1. World Energy Data System (WENDS). Volume VIII. Nuclear facility profiles, CO--HU. [Brief tabulated information

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile.

  2. HU-GFP and DAPI co-localize on the Escherichia coli nucleoid.

    Science.gov (United States)

    Wery, M; Woldringh, C L; Rouviere-Yaniv, J

    2001-02-01

    The heterodimeric HU protein, one of the most abundant DNA binding proteins, plays a pleiotropic role in bacteria. Among others, HU was shown to contribute to the maintenance of DNA superhelical density in Escherichia coli. By its properties HU shares some traits with histones and HMG proteins. More recently, its specific binding to DNA recombination and repair intermediates suggests that HU should be considered as a DNA damage sensor. For all these reasons, it will be of interest to follow the localization of HU within the living bacterial cells. To this end, we constructed HU-GFP fusion proteins and compared by microscopy the GFP green fluorescence with images of the nucleoid after DAPI staining. We show that DAPI and HU-GFP colocalize on the E. coli nucleoid. HU, therefore, can be considered as a natural tracer of DNA in the living bacterial cell.

  3. GC–MS-Based Metabonomic Profiling Displayed Differing Effects of Borna Disease Virus Natural Strain Hu-H1 and Laboratory Strain V Infection in Rat Cortical Neurons

    Directory of Open Access Journals (Sweden)

    Siwen Liu

    2015-08-01

    Full Text Available Borna disease virus (BDV persists in the central nervous systems of a wide variety of vertebrates and causes behavioral disorders. Previous studies have revealed that metabolic perturbations are associated with BDV infection. However, the pathophysiological effects of different viral strains remain largely unknown. Rat cortical neurons infected with human strain BDV Hu-H1, laboratory BDV Strain V, and non-infected control (CON cells were cultured in vitro. At day 12 post-infection, a gas chromatography coupled with mass spectrometry (GC–MS metabonomic approach was used to differentiate the metabonomic profiles of 35 independent intracellular samples from Hu-H1-infected cells (n = 12, Strain V-infected cells (n = 12, and CON cells (n = 11. Partial least squares discriminant analysis (PLS-DA was performed to demonstrate discrimination between the three groups. Further statistical testing determined which individual metabolites displayed significant differences between groups. PLS-DA demonstrated that the whole metabolic pattern enabled statistical discrimination between groups. We identified 31 differential metabolites in the Hu-H1 and CON groups (21 decreased and 10 increased in Hu-H1 relative to CON, 35 differential metabolites in the Strain V and CON groups (30 decreased and 5 increased in Strain V relative to CON, and 21 differential metabolites in the Hu-H1 and Strain V groups (8 decreased and 13 increased in Hu-H1 relative to Strain V. Comparative metabonomic profiling revealed divergent perturbations in key energy and amino acid metabolites between natural strain Hu-H1 and laboratory Strain V of BDV. The two BDV strains differentially alter metabolic pathways of rat cortical neurons in vitro. Their systematic classification provides a valuable template for improved BDV strain definition in future studies.

  4. Facile formation of co-amorphous atenolol and hydrochlorothiazide mixtures via cryogenic-milling: Enhanced physical stability, dissolution and pharmacokinetic profile.

    Science.gov (United States)

    Moinuddin, Sakib M; Ruan, Sida; Huang, Yuting; Gao, Qin; Shi, Qin; Cai, Baochang; Cai, Ting

    2017-09-08

    The development of poorly water-soluble drugs faces the risk of low bioavailability and therapeutic efficacy. The co-amorphous drug delivery system has recently gained considerable interest because it offers an alternative approach to modify properties of poorly water-soluble drugs. Herein, we developed a co-amorphous system of atenolol (ATE) and poorly water-soluble hydrochlorothiazide (HCT) by means of cryogenic milling. The co-administration of ATE and HCT has been reported to show therapeutic advantages for patients with uncomplicated hypertension. The co-amorphous ATE-HCT sample with 1:1 molar ratio showed excellent physical stability, which could be attributed to the formation of strong molecular interactions between ATE and HCT as evidenced by FT-IR spectra. Compared to the pure crystalline form, amorphous form and physical mixture, HCT in the co-amorphous form exhibited the significantly increased intrinsic dissolution rate, as well as the enhanced bioavailability in the pharmacokinetic study. It was found that the enhanced bioavailability of HCT in the co-amorphous formulation was achieved by the synergistic effect of amorphized HCT and the water-soluble coformer ATE. The present study provides an improved approach to implement the combination therapy of ATE and HCT for potential clinical treatments. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Profile of Patients of the Auditory Health of the State of Santa Catarina Served at HU-UFSC

    Directory of Open Access Journals (Sweden)

    Dimatos, Oscar Cardoso

    2011-01-01

    Full Text Available Introduction: Hearing is one of the essential functions for the development of language and its deficiency may lead to several consequences. Objective: To describe the profile of patients of the Hearing Health Program of the State of Santa Catarina attended at the College Hospital of the Federal University of Santa Catarina. Method:We performed a retrospective study with the patients with hearing aid indication attended in the years 2007 and 2008. They were divided into 2 groups: children ( 18 years. We assessed the following: age, sex, loss type and degree, duration, co-morbidity and probable etiology. Results: 304 reports were reviewed, 10.2% of the children group and 80.8% of the adult group. In the children group, the mean age was of 7.7±5,4 years, with 58.06% boys and 41.94% girls, and in the adult group the mean age was of 61±16 years, with 52.38% women and 47.62% men. The neurosensorial hearing loss was found more frequently in both groups. In the children group, the severe degree loss was more frequent, and in the adult group, the moderate and moderate to severe degrees were more frequent. The main etiologies were genetic/unknown causes in the children group and presbycusis in the adults group. Conclusion:In the children group, most was formed by boys with neurosensorial loss of light and severe degrees, duration > 1 year and without co-morbidities. In the adult group, most was formed by women with neurosensorial loss of moderate and moderate-severe degrees, duration > 5 year and with co-morbidities.

  6. Computer Profile of School Facilities Energy Consumption.

    Science.gov (United States)

    Oswalt, Felix E.

    This document outlines a computerized management tool designed to enable building managers to identify energy consumption as related to types and uses of school facilities for the purpose of evaluating and managing the operation, maintenance, modification, and planning of new facilities. Specifically, it is expected that the statistics generated…

  7. Beam profile analyzer for CO2 lasers

    Directory of Open Access Journals (Sweden)

    Rubén López

    2015-12-01

    Full Text Available The development of an optoelectronic system to analyze the beam intensity profile of CO2 lasers is presented herein. The device collects the beam profile with a LiTaO3 pyroelectric detector and uses a sampling technique based on the acquisition of horizontal sections at different levels. The digital signal processing includes subroutines that drop down two dimensional and three dimensional beam profile displays to determine the laser beam parameters of optical power, peak pixel location, centroid location and width of the laser beam, with algorithms based on the ISO 11146 standard. With the systematic calibration of the analyzer was obtained in the measurement of power an error under 5%, for a 20–200 W range and an error under 1.6% for spatial measurements of a TEM00 laser. By design, the analyzer can be used during the laser process.

  8. An Electronic Pressure Profile Display system for aeronautic test facilities

    Science.gov (United States)

    Woike, Mark R.

    1990-01-01

    The NASA Lewis Research Center has installed an Electronic Pressure Profile Display system. This system provides for the real-time display of pressure readings on high resolution graphics monitors. The Electronic Pressure Profile Display system will replace manometer banks currently used in aeronautic test facilities. The Electronic Pressure Profile Display system consists of an industrial type Digital Pressure Transmitter (DPI) unit which interfaces with a host computer. The host computer collects the pressure data from the DPI unit, converts it into engineering units, and displays the readings on a high resolution graphics monitor in bar graph format. Software was developed to accomplish the above tasks and also draw facility diagrams as background information on the displays. Data transfer between host computer and DPT unit is done with serial communications. Up to 64 channels are displayed with one second update time. This paper describes the system configuration, its features, and its advantages over existing systems.

  9. CO{sub 2} Reuse in Petrochemical Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Jason Trembly; Brian Turk; Maruthi Pavani; Jon McCarty; Chris Boggs; Aqil Jamal; Raghubir Gupta

    2010-12-31

    To address public concerns regarding the consequences of climate change from anthropogenic carbon dioxide (CO{sub 2}) emissions, the U.S. Department of Energy's National Energy Technology Laboratory (DOE/NETL) is actively funding a CO{sub 2} management program to develop technologies capable of mitigating CO{sub 2} emissions from power plant and industrial facilities. Over the past decade, this program has focused on reducing the costs of carbon capture and storage technologies. Recently, DOE/NETL launched an alternative CO{sub 2} mitigation program focused on beneficial CO{sub 2} reuse to support the development of technologies that mitigate emissions by converting CO{sub 2} into valuable chemicals and fuels. RTI, with DOE/NETL support, has been developing an innovative beneficial CO{sub 2} reuse process for converting CO{sub 2} into substitute natural gas (SNG) by using by-product hydrogen (H{sub 2)-containing fuel gas from petrochemical facilities. This process leveraged commercial reactor technology currently used in fluid catalytic crackers in petroleum refining and a novel nickel (Ni)-based catalyst developed by RTI. The goal was to generate an SNG product that meets the pipeline specifications for natural gas, making the SNG product completely compatible with the existing natural gas infrastructure. RTI's technology development efforts focused on demonstrating the technical feasibility of this novel CO{sub 2} reuse process and obtaining the necessary engineering information to design a pilot demonstration unit for converting about 4 tons per day (tons/day) of CO{sub 2} into SNG at a suitable host site. This final report describes the results of the Phase I catalyst and process development efforts. The methanation activity of several commercial fixed-bed catalysts was evaluated under fluidized-bed conditions in a bench-scale reactor to identify catalyst performance targets. RTI developed two fluidizable Ni-based catalyst formulations (Cat-1 and Cat

  10. Internação domiciliar: o perfil dos pacientes assistidos pelo Programa HU em Casa Home care: profile of patients attended by a home care program

    Directory of Open Access Journals (Sweden)

    Daniella Reis Barbosa Martelli

    2011-01-01

    Full Text Available Internação domiciliar é uma modalidade de atendimento à saúde que está se transformando em uma alternativa importante para minimizar alguns dos principais problemas inerentes aos sistemas de saúde vigentes, especialmente os da rede pública. O objetivo do estudo foi descrever o perfil sociodemográfico e clínico da população assistida pelo Programa de Internação Domiciliar (PID HU em Casa do Hospital Universitário Clemente de Faria da Universidade Estadual de Montes Claros. O estudo foi descritivo e retrospectivo por meio da análise de prontuários, realizada de maio de 2005 a maio de 2008. Foram analisados 137 pacientes, sendo 75 do gênero feminino (54,7% e 62 do masculino (45,3%. O grupo de 61 a 80 anos foi mais prevalente (37,2% e 73% dos pacientes residiam em bairros periféricos do município de Montes Claros-MG. Dos agravos mais comuns na primeira internação, a pneumonia foi prevalente, 22 casos (16,1%. A maioria dos pacientes foi encaminhada ao PID pela clinica médica (84,7%, com intervalo de maior prevalência de duas a três internações (42,4%. Do total de pacientes, 120 (87,6% permaneceram internados por 16 a 30 dias e 51,8% não necessitaram passar novamente pelo PID para uma segunda internação. Com relação à resolutividade clínica, 130 (94,9% tiveram alta clínica, no PID, na primeira internação. O PID mostrou-se ser um programa de alta resolutividade, atendendo mais ao público idoso feminino, de baixa renda e com períodos de internação relativamente curtos.The home care is a modality of health care which is becoming an important alternative to minimize some of mainly relevant problems of world health, especially the public health network. This paper aimed to describe the socio-demographic and clinical population assisted by the Home Care Program HU em Casa, of the University Hospital Clemente de Faria, Universidade Estadual de Montes Claros. It is a descriptive and retrospective study analyzing

  11. Effect of nutrition on plasma lipid profile and mRNA levels of ovarian genes involved in steroid hormone synthesis in Hu sheep during luteal phase.

    Science.gov (United States)

    Ying, S J; Xiao, S H; Wang, C L; Zhong, B S; Zhang, G M; Wang, Z Y; He, D Y; Ding, X L; Xing, H J; Wang, F

    2013-11-01

    Ovarian steroid hormones regulate follicular growth and atresia. This study aims to determine whether key ovarian sterol-regulatory genes are differentially expressed in Hu sheep under different short-term nutritional regimens. Estrus was synchronized using intravaginal progestagen sponges. The ewes were assigned randomly to 3 groups. On d 6 to 12 of their estrous cycle, the control (CON) group received a maintenance diet (1.0×M), the supplemented (SUP) group received 1.5×M, and the restricted (R) group received 0.5×M. On d 7 to 12, blood samples were taken. The sheep were slaughtered at the end of the treatment, and their organs and ovaries were collected. The plasma concentrations of urea (P2.5 mm. Follicle size affected the mRNA expression of very low density lipoprotein receptor (VLDLR), estrogen receptor 2 (ESR2), FSH receptor (FSHR), CYP17A1, and CYP19A1 (P<0.05). In conclusion, we suggest that a potential mechanism by which short-term negative energy balance inhibits follicular growth may involve responses to disrupted reproductive hormone concentrations and influenced the intrafollicular expression of CYP17A1, CYP19A1, and ESR1. This result may be due to increased plasma urea and lipid concentrations.

  12. Company Profile Dengfeng Chunsheng Refractories Co., Ltd.

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ Dengfeng Chunsheng Refractories Co., Ltd. is an industrial enterprise integrating refractories research, design, manufacturing and engineering service into one and was entitled as one of China's high-quality silica bricks production and export bases.

  13. Company Profile Shandong Luyang Share Co. Ltd

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Shandong Luyang Share Co. Ltd, established in 1984, after more than double decades' struggle and effort, has been developed to be the biggest professional manufacturer of ceramic fiber products in Asia.

  14. World Energy Data System (WENDS). Volume VII. Nuclear facility profiles, AG--CH. [Brief tabulated information

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile.

  15. World Energy Data System (WENDS). Volume X. Nuclear facility profiles, PO--ZA. [Brief tabulated information

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile.

  16. World Energy Data System (WENDS). Volume IX. Nuclear facility profiles, IN--PL. [Brief tabulated information

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile.

  17. A simulation model for Carson Ice Co-Generation Facility

    Energy Technology Data Exchange (ETDEWEB)

    Lee, N.K.W.; Elmasri, M. [Thermoflow, Inc., Wellesley, MA (United States); Brownell, G. [SMUD, Sacramento, CA (United States)

    1995-12-31

    The paper describes a software system to simulate the performance of the Carson Ice Co-gen Facility operated by the Carson Energy Group. This 100 MW plant consists of a cogeneration combined cycle and a simple cycle unit powered by LM6000 gas turbine generators. Features of the system include inlet heating/absorption chilling for the gas turbines, supplementary firing capability, and a broad range of steam turbine extractions and admissions. The software enables the operator to model complex operating scenarios. It predicts technical and economic performance under a wide range of conditions, taking into account various equipment constraints and operation preferences. For any set of user-specified operating inputs, the corresponding heat and mass balance diagrams as well as economic figures may be viewed virtually instantaneously. Interactive plots of plant heat rate, incremental heat rate, operating income, and other parameters reveal issues and trade-offs involved in performance and economic optimization.

  18. Public radiation exposures from a CANDESAL Co-generation Facility

    Energy Technology Data Exchange (ETDEWEB)

    Khaloo, R. [Atomic Energy of Canada Limited, Mississauga, ON (Canada); Simanjuntak, A. [PRSG-BATAN, Tangerang (Indonesia)

    1998-07-01

    As part of an evaluation of the practical and economic viability of using the CANDESAL (CANDU DESALINATION) approach to desalinate water in an Indonesian environment, radiation doses to members of the public were conservatively calculated. The calculations show there is a negligible radiological impact on the public. Conservative radiation doses to members of the critical group (an adult male and a 1-year-old infant) were calculated, according to the CAN/CSA N288.1-M87 compartmental pathways analysis methodology, and show that use of the desalinated water supply would increase the dose to a member of the critical group (adult or infant) by less than 20 {mu}Sv{center_dot}a{sup -1}. About 99% of the dose from the CANDESAL facility is from tritiated heavy water (DTO or HTO) and the rest is from trace concentrations of beta and gamma emitters. The doses to a member of the critical group from a combined CANDU 6 and CANDESAL Co-generation Facility will be less than 4% of the ICRP-60 recommended effective dose limit of 1000 {mu}Sv{center_dot}a{sup -1} to a member of the public. These doses are not only a small fraction of the regulatory dose limits, but are also within the normal variations of natural background radiation levels. (author)

  19. Problem Severity Profiles of Substance Abusing Women in Therapeutic Treatment Facilities

    Science.gov (United States)

    Isralowitz, Richard; Reznik, Alexander

    2009-01-01

    This article aims to examine specific substance use profiles among former Soviet Union (FSU) immigrant and native-born women in Israeli therapeutic treatment facilities. Individuals were sampled at drug treatment facilities and assessed using the Addiction Severity Index. ASI scores suggest differences between the two groups. Among the findings…

  20. Wire Scanner Beam Profile Measurements: LANSCE Facility Beam Development

    Energy Technology Data Exchange (ETDEWEB)

    Gilpatrick, John D. [Los Alamos National Laboratory; Batygin, Yuri K. [Los Alamos National Laboratory; Gonzales, Fermin [Los Alamos National Laboratory; Gruchalla, Michael E. [Los Alamos National Laboratory; Kutac, Vincent G. [Los Alamos National Laboratory; Martinez, Derwin [Los Alamos National Laboratory; Sedillo, James Daniel [Los Alamos National Laboratory; Pillai, Chandra [Los Alamos National Laboratory; Rodriguez Esparza, Sergio [Los Alamos National Laboratory; Smith, Brian G. [Los Alamos National Laboratory

    2012-05-15

    The Los Alamos Neutron Science Center (LANSCE) is replacing Wire Scanner (WS) beam profile measurement systems. Three beam development tests have taken place to test the new wire scanners under beam conditions. These beam development tests have integrated the WS actuator, cable plant, electronics processors and associated software and have used H{sup -} beams of different beam energy and current conditions. In addition, the WS measurement-system beam tests verified actuator control systems for minimum profile bin repeatability and speed, checked for actuator backlash and positional stability, tested the replacement of simple broadband potentiometers with narrow band resolvers, and tested resolver use with National Instruments Compact Reconfigurable Input and Output (cRIO) Virtual Instrumentation. These beam tests also have verified how trans-impedance amplifiers react with various types of beam line background noise and how noise currents were not generated. This paper will describe these beam development tests and show some resulting data.

  1. The Beam Profile Monitoring System for the CERN IRRAD Proton Facility

    CERN Document Server

    Ravotti, F; Glaser, M; Matli, E; Pezzullo, G; Gan, K K; Kagan, H; Smith, S; Warner, J D

    2016-01-01

    To perform proton irradiation experiments, CERN built during LS1 a new irradiation facility in the East Area at the Proton Synchrotron accelerator. At this facility, named IR-RAD, a high-intensity 24 GeV/c proton beam is used. During beam steering and irradiation, the intensity and the transverse profile of the proton beam are monitored online with custom-made Beam Profile Monitor (BPM) devices. In this work, we present the design and the architecture of the IRRAD BPM system, some results on its performance with the proton beam, as well as its planned grades.

  2. Manufacture of Single 60Co Source Irradiation Facility and the Measurement of Reference Radiation Filed

    Institute of Scientific and Technical Information of China (English)

    GAO; Fei; WANG; Hong-yu; NI; Ning; ZHANG; Li; HOU; Jin-bing; SONG; Ming-zhe

    2012-01-01

    <正>Reference radiation filed produced by isotope source is necessary for calibration of radiation dose meter. 60Co single source radiation facility is an important method to produce reference radiation. Collimation design of the facility is good for characteristics of the field, but there are scattered photon influences however. Scattered radiation is mainly come from collimation, source shield, floor, walls and

  3. Profile of Co-morbidities in the Obese

    Directory of Open Access Journals (Sweden)

    Salati SA

    2015-07-01

    Full Text Available Objective: To study the profile of co-morbidities in obese patients reporting for bariatric surgical procedures. Methods: A retrospective study was conducted at the Bariatric Surgery Unit of Department of Surgery of the College of Medicine, Qassim University, Saudi Arabia. The records of all the obese patients (with Body Mass Index greater than 30, evaluated in the department over the period of two years from Jan 2012 to Dec 2014, were studied and co-morbidities were sought in all subjects. Results: Of the 172 subjects, 76.2% (n=131 were female and 23.8% (n=41 male. The age ranged from 17–49 years (Mean 29.9 years; Mode 28 years. The weight ranged from 82 kg–146kg and BMI ranged from 33–54 (mean BMI 44.7 kg/m. Out of the total of 172 patients, 96 (56 % including 72 females and 24 males had one or more co-morbidities. Conclusion: A wide range of co-morbidities occur in obese patients that have the potential to decrease the quality of life and the life span.

  4. Sensory symptom profiles and co-morbidities in painful radiculopathy.

    Directory of Open Access Journals (Sweden)

    Friederike Mahn

    Full Text Available Painful radiculopathies (RAD and classical neuropathic pain syndromes (painful diabetic polyneuropathy, postherpetic neuralgia show differences how the patients express their sensory perceptions. Furthermore, several clinical trials with neuropathic pain medications failed in painful radiculopathy. Epidemiological and clinical data of 2094 patients with painful radiculopathy were collected within a cross sectional survey (painDETECT to describe demographic data and co-morbidities and to detect characteristic sensory abnormalities in patients with RAD and compare them with other neuropathic pain syndromes. Common co-morbidities in neuropathic pain (depression, sleep disturbance, anxiety do not differ considerably between the three conditions. Compared to other neuropathic pain syndromes touch-evoked allodynia and thermal hyperalgesia are relatively uncommon in RAD. One distinct sensory symptom pattern (sensory profile, i.e., severe painful attacks and pressure induced pain in combination with mild spontaneous pain, mild mechanical allodynia and thermal hyperalgesia, was found to be characteristic for RAD. Despite similarities in sensory symptoms there are two important differences between RAD and other neuropathic pain disorders: (1 The paucity of mechanical allodynia and thermal hyperalgesia might be explained by the fact that the site of the nerve lesion in RAD is often located proximal to the dorsal root ganglion. (2 The distinct sensory profile found in RAD might be explained by compression-induced ectopic discharges from a dorsal root and not necessarily by nerve damage. These differences in pathogenesis might explain why medications effective in DPN and PHN failed to demonstrate efficacy in RAD.

  5. Validation Through Simulations of a Cn2 Profiler for the ESO/VLT Adaptive Optics Facility

    CERN Document Server

    Garcia-Rissmann, A; Kolb, J; Louarn, M Le; Madec, P -Y; Neichel, B

    2015-01-01

    The Adaptive Optics Facility (AOF) project envisages transforming one of the VLT units into an adaptive telescope and providing its ESO (European Southern Observatory) second generation instruments with turbulence corrected wavefronts. For MUSE and HAWK-I this correction will be achieved through the GALACSI and GRAAL AO modules working in conjunction with a 1170 actuators Deformable Secondary Mirror (DSM) and the new Laser Guide Star Facility (4LGSF). Multiple wavefront sensors will enable GLAO and LTAO capabilities, whose performance can greatly benefit from a knowledge about the stratification of the turbulence in the atmosphere. This work, totally based on end-to-end simulations, describes the validation tests conducted on a Cn2 profiler adapted for the AOF specifications. Because an absolute profile calibration is strongly dependent on a reliable knowledge of turbulence parameters r0 and L0, the tests presented here refer only to normalized output profiles. Uncertainties in the input parameters inherent t...

  6. Main: 1HU9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1HU9 大豆 Soybean Glycine max (L.) Merrill Seed Lipoxygenase-3 Name=Lox1.3; Synonyms=...2; CAA31664.1; ALT_SEQ.|EMBL; U50081; AAB41272.1; -.|PDB; 1HU9; X-ray; A=1-857.|PDB; 1IK3; X-ray; A=1-857.|P...WTSDTRALEAFKRFGNKLAQIENKLSERNNDEKLRNRCGPVQMPYTLLLPSSKEGLTFRGIPNSISI soybean_1HU9.jpg ...

  7. Assessment of disease profiles and drug prescribing patterns of health care facilities in Edo State, Nigeria

    Directory of Open Access Journals (Sweden)

    Ehijie F.O. Enato

    2012-10-01

    Full Text Available Few studies have systematically characterized drug-prescribing patterns, particularly at the primary care level in Nigeria, a country disproportionately burdened with disease. The aim of this study was to assess the disease profiles and drug-prescribing pattern in two health care facilities in Edo State, Nigeria. The medical records of 495 patients who attended a primary or secondary health care facility in Owan-East Local Government Area of Edo State, Nigeria, between June and November 2009 were reviewed. Disease profiles and drug prescribing patterns were assessed. Data were analyzed based on the World Health Organization Anatomic Therapeutic Chemical classification system, and core drug prescribing indicators. Five hundred and twelve clinical conditions were identified. Infectious disease was most prevalent (38.3%, followed by disorder of the alimentary tract (16.4%. Malaria was responsible for 55.6% of the infectious diseases seen, and 21.3% (109/512 of the total clinical conditions managed at the two health facilities during the study period. Consequently, anti-infective medications were the most frequently prescribed medicines (21.5%, followed by vitamins (18.2%. Use of artesunate monotherapy at both facilities (15.7%, and chloroquine at the primary health facility (24.9% were common. Paracetamol (41.8% and non-steroidal anti-inflammatory drugs (24.9% were the most frequently used analgesic/antipyretic. At the primary health care facility, dipyrone was used in 21.6% of cases. The core drug prescribing use indicators showed inappropriate prescribing, indicating poly-pharmacy, overuse of antibiotics and injectio. Inappropriate drug use patterns were identified at both health care facilities, especially with regard to the use of ineffective antimalarial drugs and the use of dipyrone.

  8. Profiling leucocyte subsets in tuberculosis-diabetes co-morbidity.

    Science.gov (United States)

    Kumar, Nathella Pavan; Moideen, Kadar; Dhakshinraj, Sharmila D; Banurekha, Vaithilingam V; Nair, Dina; Dolla, Chandrakumar; Kumaran, Paul; Babu, Subash

    2015-10-01

    The immune system plays an important role in the pathogenesis of pulmonary tuberculosis-type 2 diabetes mellitus (PTB-DM) co-morbidity. However, the phenotypic profile of leucocyte subsets at homeostasis in individuals with active or latent tuberculosis (LTB) with coincident diabetes is not known. To characterize the influence of diabetes on leucocyte phenotypes in PTB or LTB, we examined the frequency (Fo ) of leucocyte subsets in individuals with TB with (PTB-DM) or without (PTB) diabetes; individuals with latent TB with (LTB-DM) or without (LTB) diabetes and non-TB-infected individuals with (NTB-DM) or without (NTB) diabetes. Coincident DM is characterized by significantly lower Fo of effector memory CD4(+) T cells in LTB individuals. In contrast, DM is characterized by significantly lower Fo of effector memory CD8(+) T cells and significantly higher Fo of central memory CD8(+) T cells in PTB individuals. Coincident DM resulted in significantly higher Fo of classical memory B cells in PTB and significantly higher Fo of activated memory and atypical B cells in LTB individuals. Coincident DM resulted in significantly lower Fo of classical and intermediate monocytes in PTB, LTB and NTB individuals. Finally, DM resulted in significantly lower Fo of myeloid and plasmacytoid dendritic cells in PTB, LTB and NTB individuals. Our data reveal that coincident diabetes alters the cellular subset distribution of T cells, B cells, dendritic cells and monocytes in both individuals with active TB and those with latent TB, thus potentially impacting the pathogenesis of this co-morbid condition.

  9. First on-sky results of the CO-SLIDAR C(2)(n) profiler.

    Science.gov (United States)

    Voyez, Juliette; Robert, Clélia; Conan, Jean-Marc; Mugnier, Laurent M; Samain, Etienne; Ziad, Aziz

    2014-05-05

    COupled SLope and scIntillation Detection And Ranging (CO-SLIDAR) is a recent profiling method of the vertical distribution of atmospheric turbulence strength (C(2)(n) profile). It takes advantage of correlations of slopes and of scintillation, both measured with a Shack-Hartmann wavefront sensor on a binary star. In this paper, we present the improved CO-SLIDAR reconstruction method of the C(2)(n) profile and the first on-sky results of the CO-SLIDAR profiler. We examine CO-SLIDAR latest performance in simulation, taking into account the detection noise bias and estimating error bars along with the turbulence profile. The estimated C(2)(n) profiles demonstrate the accuracy of the CO-SLIDAR method, showing sensitivity to both low and high altitude turbulent layers. CO-SLIDAR is tested on-sky for the first time, on the 1.5 m MeO (Métrologie Optique) telescope at Observatoire de la Côte d'Azur (France). The reconstructed profiles are compared to turbulence profiles estimated from meteorological data and a good agreement is found. We discuss CO-SLIDAR's contribution in the C(2)(n) profilers' landscape and we propose some improvements of the instrument.

  10. Facile synthesis of porous Co3O4 nanoplates for supercapacitor applications

    Indian Academy of Sciences (India)

    Tao Geng; Li Zhang; Hongyan Wang; Keying Zhang; Xia Zhou

    2015-09-01

    Porous tricobalt tetraoxide (Co3O4) nanoplates with large aspect ratio have been obtained by annealing Co(OH)2 precursor nanoplates synthesized by a facile reflux method without the need for any template or surfactant. After the heat treatment, the as-obtained phase-pure Co3O4 nanoplates with a wellretained structure were applied as the electrode material for supercapacitors, and the sample exhibits excellent performance with a high specific capacitance of 225 F g–1 after 2000 charge–discharge cycles at 2 A g–1, corresponding to a retention of 97% of the initial capacitance.

  11. Pagure {sup 60}Co panoramic irradiation facility; Pagure irradiateur panoramique au {sup 60}Co

    Energy Technology Data Exchange (ETDEWEB)

    Puig, J.R.; Laizier, J.; Lorin, M.; Laroche, R. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-07-01

    After a description of the various parts of 'PAGURE', a 10 KCi panoramic irradiation facility, and of the operations data, a critic scrutiny is given. From the experience of five years operations, working of the facility can be thought of very satisfying. From the point of view of standardization of irradiation facilities, PAGURE can be taken, in its range, as a standard design. (authors) [French] Apres avoir decrit les differents elements constitutifs de 1'irradiateur panoramique de 10 KCi 'PAGURE' et precise les donnees d'exploitation, on en fait l'examen critique. A la lumiere de cinq annees d'utilisation, le fonctionnement de 1'irradiateur apparait extremement satisfaisant. Dans une perspective de standardisation des appareils, on peut, dans sa gamme, le considerer comme une realisation type. (auteurs)

  12. Co$_9$S$_8$ nanotubes: facile synthesis and application in the catalytic reduction of 4-nitrophenol

    Indian Academy of Sciences (India)

    TAO GENG; YONGHONG NI; HONGYAN WANG; XIA ZHOU

    2016-10-01

    Co$_9$S$_8$ nanotubes have been successfully synthesized via a facile two-step solvothermal method without the assistance of any template or surfactant, using cobalt sulphate (CoSO$_4$·7H$_2$O), urea and sodium sulphide (Na$_2$S·9H$_2$O) as starting reactants, and deionized water and glycol as the reactive medium. The phase and the morphologyof the as-obtained product were characterized by means of powder X-ray diffraction, energy dispersive spectrometry and scanning electron microscopy. The result displays that the Co9S8 nanotubes have hexagonal crosssections,the diameter of the nanotubes is about 200 nm and the wall thickness is of 50 nm. The experiments showed that the Co$_9$S$_8$ nanotubes could be used as new-type catalysts for the reduction of 4-nitrophenol. It was found thatthe as-obtained Co$_9$S$_8$ nanotubes contributed to the best catalytic activity.

  13. IMPACT OF CO2 ENHANCEMENT ON PHOTOSYNTHESIS AND PROTEIN PROFILE -RESPONSE STUDIES WITH A CO2 RESPONSIVE BLACK GRAM GENOTYPE

    Directory of Open Access Journals (Sweden)

    P. Sathish

    2014-09-01

    Full Text Available Black gram (Vigna mungo (L. Hepper var. IC-282009 - a highly CO2 responsive genotype for biomass and seed yield was grown in Open top chambers (OTCs under three levels of CO2 i.e. ambient (390 ppm and two elevated levels 550ppm and 700ppm to assess photosynthetic acclimation to elevated CO2. Net photosynthetic rate (PN, change in leaf soluble protein profile and leaf carbohydrate constituents such as total soluble sugars, reducing sugars and starch content in leaves was quantified at all three CO2 concentrations. Photosynthetic rate was enhanced by 78% and 30% at flowering stage with 550ppm and 700ppm CO2 as compared with ambient control. It was also observed a higher accumulation of starch, total soluble sugars and reducing sugars in leaves at elevated CO2 levels. However, the leaf protein content recorded a decrease and altered the profile of ploy peptides with enhanced CO2 levels. At elevated CO2 concentrations significant differences were observed in ploy peptide profile at vegetative and flowering stages, the intensity of 260 kDa poly peptide increased at vegetative stage, whereas 72 kDa polypeptide increased at flowering stage, while 52 kDa poly peptide decreased at both stages. Enhanced CO2 concentrations improved the PN though certain polypeptides of leaf protein are down regulated and necessitate further experimentation to confirm their involvement in responsiveness of the selected black gram genotype

  14. Infecciones en huéspedes inmunocomprometidos

    OpenAIRE

    Cuéllar Ponce de León, Luis Ernesto; Médico-Cirujano. Especialista en Enfermedades Infecciosas y Tropicales. Jefe del Servicio de Infectología. Instituto Nacional de Enfermedades Neoplásicas. Coordinador del Programa VIH/SIDA/TARGA-INEN. Profesor Asociado de Medicina de la Universidad Nacional Federico Villarreal. Lima.

    2013-01-01

    Las infecciones son causa frecuente de morbimortalidad en huéspedes inmunocomprometidos. La frecuencia y diversidad de infecciones en esta población dependerá del tipo de inmunocompromiso, tratamiento recibido y aspecto epidemiológico. Los huéspedes con neutropenia desarrollan infecciones por bacterias extracelulares no encapsuladas y hongos levaduriformes y filamentosos; el diagnóstico precoz y tratamiento oportuno de las mismas son considerados una emergencia por su severidad y gran mortali...

  15. The Beam Profile Monitoring System for the IRRAD Proton Facility at the CERN PS East Area

    CERN Document Server

    Gkotse, Blerina; Matli, Emanuele; Ravotti, Federico; Gan, Kock Kiam; Kagan, Harris; Smith, Shane; Warner, Joseph

    2016-01-01

    In High Energy Physics (HEP) experiments, devices are frequently required to withstand a certain radiation level. As a result, detectors and electronics must be irradiated to determine their level of radiation tolerance. To perform these irradiations, CERN built a new irradiation facility in the East Area at the Proton Synchrotron (PS) accelerator. At this facility, named IRRAD, a high-intensity 24 GeV/c proton beam is used. During irradiation, it is necessary to monitor the intensity and the transverse profile of the proton beam. The Beam Profile Monitor (BPM) for IRRAD uses 39-channel pixel detectors to monitor the beam position. These pixel detectors are constructed using thin foil copper pads positioned on a flex circuit. When protons pass through the copper pads, they induce a measurable current. To measure this current and determine the total flux of protons passing through the thin foil copper detectors, a new data acquisition system was designed as well as a new database and on-line display system. In...

  16. First on-sky results of the CO-SLIDAR Cn2 profiler

    CERN Document Server

    Voyez, Juliette; Conan, Jean-Marc; Mugnier, Laurent M; Samain, Etienne; Ziad, Aziz

    2014-01-01

    COupled SLope and scIntillation Detection And Ranging (CO-SLIDAR) is a recent profiling method of the vertical distribution of atmospheric turbulence strength ($C_n^2$ profile). It takes advantage of correlations of slopes and of scintillation, both measured with a Shack-Hartmann wavefront sensor on a binary star. In this paper, we present the improved CO-SLIDAR reconstruction method of the $C_n^2$ profile and the first on-sky results of the CO-SLIDAR profiler. We examine CO-SLIDAR latest performance in simulation, taking into account the detection noise bias and estimating error bars along with the turbulence profile. The estimated $C_n^2$ profiles demonstrate the accuracy of the CO-SLIDAR method, showing sensitivity to both low and high altitude turbulent layers. CO-SLIDAR is tested on-sky for the first time, on the $1.5$~m MeO (M\\'etrologie Optique) telescope at Observatoire de la Cote d'Azur (France). The reconstructed profiles are compared to turbulence profiles estimated from meteorological data and a g...

  17. Facilely synthesized porous NiCo2O4 flowerlike nanostructure for high-rate supercapacitors

    Science.gov (United States)

    Chen, Haichao; Jiang, Jianjun; Zhang, Li; Qi, Tong; Xia, Dandan; Wan, Houzhao

    2014-02-01

    We have developed a facile and scalable method to grow porous NiCo2O4 nanostructure. The conductivity is measured by a linear sweep voltammetry, which indicates that the conductivity of the NiCo2O4 sample is at least two orders of magnitude higher than those of NiO and Co3O4 samples. The conductive NiCo2O4 hybrid electrode delivers an enhanced specific capacitance of 658 F g-1 at 1 A g-1 compared to NiO and Co3O4. Excellent rate capability, 78% specific capacitance retention for a 20-time current density increase and 77% specific capacitance retention for a 50-time scan rate rise, is achieved. The NiCo2O4 sample demonstrates ultralong cycling lifespan, no observable degradation is found for the total cycle numbers as high as 10000 cycles. Furthermore, the excellent capacitive performance of porous NiCo2O4 electrode is also evaluated by a two-electrode asymmetric supercapacitor device. The asymmetric supercapacitor device delivers a 64% rate property for the current density increase 20 times. Remarkably, the asymmetric supercapacitor device also shows ultrahigh long-term stability, 93.5% of specific capacitance can still be retained after 10,000 cycles cycling. These excellent capacitive performances indicate the as-fabricated porous NiCo2O4 flowerlike nanostructure a promising electrode materials for supercapacitors.

  18. A 60Co multipurpose radiation processing facility at Bahia Blanca, Argentina

    Science.gov (United States)

    Curzio, O. A.; Croci, C. A.

    The aim of the project is to have a multipurpose facility which will enable us to show the techno-economic viability of the irradiation process applied to regional products, important from the economic point of view. The topics will fundamentally be connected with regional themes such as food preservation and the modification of polymer structures. This project will make it possible to carry out basic and applied studies related to radiation chemistry, dosimetry and engineering irradiation processes. The facility will operate in the Universidad Nacional del Sur (UNS) with a maximum activity of 18.5 PBq of Co-60. The viability and design of the irradiation facility is supported by the Government of the Buenos Aires Province since it is interested in the socio-economic benefit of this technology at the regional level.

  19. PM10 and CO Exposure of Hong Kong Population in Public Transit Facilities

    Institute of Scientific and Technical Information of China (English)

    TU Edward Y(涂有); CHAU C K(周志坤); CHAN Daniel W T(陈维田); BURNETT John; TU Guang-bei(涂光备)

    2003-01-01

    Taking public transit facilities (PTFs) is the major transport style in Hong Kong. Human exposure to indoor air pollutants may cause adverse health effects to the passengers. Exposure assessment on air pollutants is important for the control of human diseases caused by indoor air pollution. In this paper, the indoor PM10, CO and CO2 levels in various PTFs, such as public bus, subway, railway and ferry in Hong Kong, were mea-sured. Combining with the time budget survey of Hong Kong population,the human exposures were calculated through Monte-Carlo simulation.

  20. Communicational intervention in promoting effective environmental profile of teachers of integrated National School Jorge Basadre in Santa María del Valle, Huánuco, Perú-2011

    National Research Council Canada - National Science Library

    Angélica SOTOMAYOR BACA

    2015-01-01

    .... The objective of this research is to check whether along the communicational intervention is possible to improve the environmental profile of teachers Jorge Basadre Integrated National College...

  1. IHF and HU: flexible architects of bent DNA.

    Science.gov (United States)

    Swinger, Kerren K; Rice, Phoebe A

    2004-02-01

    The energetic cost of bending short segments of DNA is very high. This bending is critical for the packaging of DNA and is exploited to regulate many cellular processes. In prokaryotes, IHF and HU are key architectural proteins present at high concentrations. New protein-DNA co-crystal structures, and the adaptation of advanced biophysical and biochemical techniques have led to an improved understanding of how these proteins interact with DNA. These techniques include time-resolved synchrotron X-ray footprinting, differential scanning calorimetry, isothermal titration calorimetry and single-molecule experiments.

  2. Development and Field Testing of a Continuously Operating CO2 Lidar Profiling System

    Science.gov (United States)

    Ismail, S.; Refaat, T.; Koch, G. J.; Davis, K.; Abedin, N. M.; Rubio, M. A.; Singh, U. N.

    2009-05-01

    A ground-based 2-micron DIAL system for profiling atmospheric CO2 was developed at NASA Langley Research Center (LaRC) under the NASA Instrument Incubator Program. This system leverages 2-micron laser technology developed under a number of NASA programs to develop new solid-state YLF laser technology that provides high pulse energy, tunable, wavelength-stabilized, and double-pulsed lasers that are operable over pre-selected temperature insensitive strong CO2 absorption lines suitable for profiling of lower tropospheric CO2. It also incorporates new high quantum efficiency, high gain, and relatively low noise phototransistors, and a new receiver/signal processor system to achieve high precision DIAL measurements. The DIAL system was integrated and tested at LaRC, and then incorporated in a field experiment for evaluation. The field experiment was conducted during June-July 2008, at West Branch, Iowa, which is located at the center of a domain rich in complementary CO2 measurements. The objective of the experiment was to evaluate the accuracy and precision of the system and its ability to distinguish contents between boundary layer and free troposphere. Therefore, the experiment was co-located with other CO2 measurement setups that aid the evaluation. These setups include NOAA WBI tower with in-situ CO2 sampling sensors at 31, 99 and 379 m altitudes; NOAA airborne CO2 profiling; and radiosondes for atmospheric temperature, pressure and relative humidity profiling at the site. The lidar operations included daytime CO2 measurements to sense the well-mixed atmospheric boundary layer and overlying troposphere; day-to-night and night-to-day transitions; and night observations to capture CO2 mixing ratio differences within the boundary layer. Measurements included atmospheric CO2 spatial and temporal profiles as well as column measurements using high altitude clouds. Examples of CO2 DIAL system capability and measurements from the field experiment will be presented.

  3. The HU Regulon Is Composed of Genes Responding to Anaerobiosis, Acid Stress, High Osmolarity and SOS Induction

    Science.gov (United States)

    Oberto, Jacques; Nabti, Sabrina; Jooste, Valérie; Mignot, Hervé; Rouviere-Yaniv, Josette

    2009-01-01

    Background The Escherichia coli heterodimeric HU protein is a small DNA-bending protein associated with the bacterial nucleoid. It can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Cells lacking HU grow very poorly and display many phenotypes. Methodology/Principal Findings We analyzed the transcription profile of every Escherichia coli gene in the absence of one or both HU subunits. This genome-wide in silico transcriptomic approach, performed in parallel with in vivo genetic experimentation, defined the HU regulon. This large regulon, which comprises 8% of the genome, is composed of four biologically relevant gene classes whose regulation responds to anaerobiosis, acid stress, high osmolarity, and SOS induction. Conclusions/Significance The regulation a large number of genes encoding enzymes involved in energy metabolism and catabolism pathways by HU explains the highly pleiotropic phenotype of HU-deficient cells. The uniform chromosomal distribution of the many operons regulated by HU strongly suggests that the transcriptional and nucleoid architectural functions of HU constitute two aspects of a unique protein-DNA interaction mechanism. PMID:19194530

  4. The HU regulon is composed of genes responding to anaerobiosis, acid stress, high osmolarity and SOS induction.

    Directory of Open Access Journals (Sweden)

    Jacques Oberto

    Full Text Available BACKGROUND: The Escherichia coli heterodimeric HU protein is a small DNA-bending protein associated with the bacterial nucleoid. It can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Cells lacking HU grow very poorly and display many phenotypes. METHODOLOGY/PRINCIPAL FINDINGS: We analyzed the transcription profile of every Escherichia coli gene in the absence of one or both HU subunits. This genome-wide in silico transcriptomic approach, performed in parallel with in vivo genetic experimentation, defined the HU regulon. This large regulon, which comprises 8% of the genome, is composed of four biologically relevant gene classes whose regulation responds to anaerobiosis, acid stress, high osmolarity, and SOS induction. CONCLUSIONS/SIGNIFICANCE: The regulation a large number of genes encoding enzymes involved in energy metabolism and catabolism pathways by HU explains the highly pleiotropic phenotype of HU-deficient cells. The uniform chromosomal distribution of the many operons regulated by HU strongly suggests that the transcriptional and nucleoid architectural functions of HU constitute two aspects of a unique protein-DNA interaction mechanism.

  5. Anti-solar differential rotation on the active sub-giant HU Virginis

    Science.gov (United States)

    Harutyunyan, G.; Strassmeier, K. G.; Künstler, A.; Carroll, T. A.; Weber, M.

    2016-08-01

    Context. Measuring surface differential rotation (DR) on different types of stars is important when characterizing the underlying stellar dynamo. It has been suggested that anti-solar DR laws can occur when strong meridional flows exist. Aims: We aim to investigate the differential surface rotation on the primary star of the RS CVn binary, HU Vir, by tracking its starspot distribution as a function of time. We also aim to recompute and update the values for several system parameters of the triple system HU Vir (close and wide orbits). Methods: Time-series high-resolution spectroscopy for four continuous months was obtained with the 1.2-m robotic STELLA telescope. Nine consecutive Doppler images were reconstructed from these data, using our line-profile inversion code iMap. An image cross-correlation method was applied to derive the surface differential-rotation law for HU Vir. New orbital elements for the close and the wide orbits were computed using our new STELLA radial velocities (RVs) combined with the RV data available in the literature. Photometric observations were performed with the Amadeus Automatic Photoelectric Telescope (APT), providing contemporaneous Johnson-Cousins V and I data for approximately 20 yrs. This data was used to determine the stellar rotation period and the active longitudes. Results: We confirm anti-solar DR with a surface shear parameter α of -0.029 ± 0.005 and -0.026 ± 0.009, using single-term and double-term differential rotation laws, respectively. These values are in good agreement with previously claimed results. The best fit is achieved assuming a solar-like double-term law with a lap time of ≈400 d. Our orbital solutions result in a period of 10.387678 ± 0.000003 days for the close orbit and 2726 ± 7 d (≈7.5 yr) for the wide orbit. A Lomb-Scarge (L-S) periodogram of the pre-whitened V-band data reveals a strong single peak providing a rotation period of 10.391 ± 0.008 d, well synchronized to the short orbit. Based on

  6. Quantification of the advected CO2 concentration due to upstream surface fluxes in aircraft vertical profiles

    Science.gov (United States)

    Font, A.; Morguí, J.-A.; Curcoll, R.; Rodó, X.

    2009-04-01

    A model framework which couples the Lagrangian Particle Dispersion Model FLEXPART (LPDM) with the new global surface flux inversion CarbonTracker from NOAA-ESRL (2007B release) is used to quantify the advected CO2 concentration from outbound surface fluxes to measured vertical profiles carried out during different seasons in 2006 at La Muela site in Spain (LMU; 41.60°N, 1.1°W). The Lagrangian Particle Dispersion Model FLEXPART (LPDM) calculates the influence of surface CO2 fluxes upwind of the study area, allowing us to identify those sources or sink areas that strongly modify the CO2 content of air masses that arrives at different altitudes of measured profiles. CarbonTracker is a new assimilation system that informs of global carbon fluxes at 1°x1° at 3 hours resolution. Coupling LPDM results with surface fluxes allows assessing the net CO2 contribution of identified areas to measured concentrations along the profiles above a reference or background concentration. Furthermore, it allows the quantification of the percentage of each component flux (biospheric, anthropogenic and oceanic) to each vertical layer. At LMU, biospheric fluxes account ~70% of total CO2 advection; fossil fuel ~25%; and ~5% is attributed to the oceanic ones. By far, late spring and summer profiles are largely influence by the biospheric component (~90%). Finally, the CO2 concentration above the background value of profiles measured on 22nd February, 13th October and 30th November 2006 are well explained by the advection of upstream surface fluxes. In other profiles examined, the variation of CO2 along the profile is partially explained by the advection of CO2 outbound fluxes.

  7. A probabilistic Hu-Washizu variational principle

    Science.gov (United States)

    Liu, W. K.; Belytschko, T.; Besterfield, G. H.

    1987-01-01

    A Probabilistic Hu-Washizu Variational Principle (PHWVP) for the Probabilistic Finite Element Method (PFEM) is presented. This formulation is developed for both linear and nonlinear elasticity. The PHWVP allows incorporation of the probabilistic distributions for the constitutive law, compatibility condition, equilibrium, domain and boundary conditions into the PFEM. Thus, a complete probabilistic analysis can be performed where all aspects of the problem are treated as random variables and/or fields. The Hu-Washizu variational formulation is available in many conventional finite element codes thereby enabling the straightforward inclusion of the probabilistic features into present codes.

  8. For Hu Zhuanglin: A Prefatory Note

    Institute of Scientific and Technical Information of China (English)

    M. A. K. Halliday

    2012-01-01

    It is a very great pleasure to be able to congratulate Professor Hu Zhuanglin on the occasion of his eightieth birthday. It is also a time to remember that Professor Hu and I have known each other for 33 years, since the moment he arrived in Sydney, together with eight other Chinese scholars, to take part in a programme of studies arranged jointly by the Department of English and the Department of Linguistics at Sydney University. These first arrivals from China were people of some seniority,

  9. Tropospheric CO vertical profiles deduced from total columns using data assimilation: methodology and validation

    Directory of Open Access Journals (Sweden)

    L. El Amraoui

    2013-07-01

    Full Text Available This paper presents a validation of a method to derive the vertical profile of carbon monoxide (CO from its total column using data assimilation. The main motivation of this study is twofold. First, to deduce both the vertical CO profiles and the assimilated CO fields with good confidence. Second, for chemical species that can be measured only as the total column, this method provides an attractive alternative for estimating their vertical profiles in the troposphere. We choose version 3 (V3 of MOPITT CO total columns to validate the proposed method. MOPITT has the advantage of providing both the vertical profiles and the total columns of CO. Furthermore, this version has been extensively validated by comparison with many independent datasets, and has been used in many scientific studies. The first step of the paper consists in the specification of the observation errors based on the Chi-square (χ2 test. The observations have been binned according to day, night, land and sea (LAND_DAY, LAND_NIGHT and SEA, respectively. The respective optimal observation error values for which the χ2 metric is the closest to 1 are: 7%, 8% and 11% for SEA, LAND_DAY and LAND_NIGHT, respectively. In a second step, the CO total column, with its specified errors, is used within the assimilation system to estimate the vertical profiles. These are validated by comparison with vertical profiles of MOPITT V3 retrievals at global and regional scales. Generally, both datasets show similar patterns and good agreement at both global and regional scales. Nevertheless, the total column analyses (TOTCOL_ANALYSES slightly overestimate CO concentrations compared to MOPITT observations. In a third step, vertical profiles calculated from TOTCOL_ANALYSES have been compared to those calculated from the assimilation of MOPITT V3 vertical profiles (PROFILE_ANALYSES. Both datasets shows very good agreement, but TOTCOL_ANALYSES tend to slightly overestimate CO concentrations. The mean

  10. Tropospheric CO vertical profiles deduced from total columns using data assimilation: methodology and validation

    Science.gov (United States)

    El Amraoui, L.; Attié, J.-L.; Ricaud, P.; Lahoz, W. A.; Piacentini, A.; Peuch, V.-H.; Warner, J. X.; Abida, R.; Barré, J.

    2013-07-01

    This paper presents a validation of a method to derive the vertical profile of carbon monoxide (CO) from its total column using data assimilation. The main motivation of this study is twofold. First, to deduce both the vertical CO profiles and the assimilated CO fields with good confidence. Second, for chemical species that can be measured only as the total column, this method provides an attractive alternative for estimating their vertical profiles in the troposphere. We choose version 3 (V3) of MOPITT CO total columns to validate the proposed method. MOPITT has the advantage of providing both the vertical profiles and the total columns of CO. Furthermore, this version has been extensively validated by comparison with many independent datasets, and has been used in many scientific studies. The first step of the paper consists in the specification of the observation errors based on the Chi-square (χ2) test. The observations have been binned according to day, night, land and sea (LAND_DAY, LAND_NIGHT and SEA, respectively). The respective optimal observation error values for which the χ2 metric is the closest to 1 are: 7%, 8% and 11% for SEA, LAND_DAY and LAND_NIGHT, respectively. In a second step, the CO total column, with its specified errors, is used within the assimilation system to estimate the vertical profiles. These are validated by comparison with vertical profiles of MOPITT V3 retrievals at global and regional scales. Generally, both datasets show similar patterns and good agreement at both global and regional scales. Nevertheless, the total column analyses (TOTCOL_ANALYSES) slightly overestimate CO concentrations compared to MOPITT observations. In a third step, vertical profiles calculated from TOTCOL_ANALYSES have been compared to those calculated from the assimilation of MOPITT V3 vertical profiles (PROFILE_ANALYSES). Both datasets shows very good agreement, but TOTCOL_ANALYSES tend to slightly overestimate CO concentrations. The mean bias between

  11. Transcriptomic-Wide Discovery of Direct and Indirect HuR RNA Targets in Activated CD4+ T Cells.

    Directory of Open Access Journals (Sweden)

    Patsharaporn Techasintana

    Full Text Available Due to poor correlation between steady state mRNA levels and protein product, purely transcriptomic profiling methods may miss genes posttranscriptionally regulated by RNA binding proteins (RBPs and microRNAs (miRNAs. RNA immunoprecipitation (RIP methods developed to identify in vivo targets of RBPs have greatly elucidated those mRNAs which may be regulated via transcript stability and translation. The RBP HuR (ELAVL1 and family members are major stabilizers of mRNA. Many labs have identified HuR mRNA targets; however, many of these analyses have been performed in cell lines and oftentimes are not independent biological replicates. Little is known about how HuR target mRNAs behave in conditional knock-out models. In the present work, we performed HuR RIP-Seq and RNA-Seq to investigate HuR direct and indirect targets using a novel conditional knock-out model of HuR genetic ablation during CD4+ T activation and Th2 differentiation. Using independent biological replicates, we generated a high coverage RIP-Seq data set (>160 million reads that was analyzed using bioinformatics methods specifically designed to find direct mRNA targets in RIP-Seq data. Simultaneously, another set of independent biological replicates were sequenced by RNA-Seq (>425 million reads to identify indirect HuR targets. These direct and indirect targets were combined to determine canonical pathways in CD4+ T cell activation and differentiation for which HuR plays an important role. We show that HuR may regulate genes in multiple canonical pathways involved in T cell activation especially the CD28 family signaling pathway. These data provide insights into potential HuR-regulated genes during T cell activation and immune mechanisms.

  12. Hu on poolel teel / James Miles

    Index Scriptorium Estoniae

    Miles, James

    2006-01-01

    2007. aastal toimuv kommunistliku partei 17. kongress tähistab Hiina presidendi Hu Jintao jaoks oma võimuaja poole peale jõudmist, ees ootavad sellised väljakutsed nagu olümpiamängude korraldamine, valimiskeeris Taiwanis ning hullunud majanduse stabiliseerimine. Vt samas: Hiina avanemise pidu

  13. Hu on poolel teel / James Miles

    Index Scriptorium Estoniae

    Miles, James

    2006-01-01

    2007. aastal toimuv kommunistliku partei 17. kongress tähistab Hiina presidendi Hu Jintao jaoks oma võimuaja poole peale jõudmist, ees ootavad sellised väljakutsed nagu olümpiamängude korraldamine, valimiskeeris Taiwanis ning hullunud majanduse stabiliseerimine. Vt samas: Hiina avanemise pidu

  14. Measurement of tropospheric CO2 and aerosol extinction profiles with Raman lidar

    Institute of Scientific and Technical Information of China (English)

    Peitao Zhao; Yinchao Zhang; Lian Wang; Kaifa Cao; Jia Su; Shunxing Hu; Huanling Hu

    2008-01-01

    A prototype Raman lidar was designed for monitoring tropospheric CO2 profile and other scientific investigatious.The third harmonic of Nd:YAG laser (354.7-nm wavelength) was used as stimulated light source to provide nighttime measurements.Filter with high rejection ratio performance was used to extract CO2 Raman signals from Rayleigh-Mie scattering signals effectively.To improve the real time monitoring function,a two-channel signal collection system was designed to collect CO2 and N2 Raman scattering signals simultaneously. The N2 Raman scattering signals were used to retrieve aerosol extinction coefficient.Typical features of CO2 concentration profile and aerosol extinction coefficient in Herei were presented.The mixing ratio of atmospheric CO2 in Hefei can reach about 360-400 ppmv.

  15. Datgan, a reusable software system for facile interrogation and visualization of complex transcription profiling data

    Directory of Open Access Journals (Sweden)

    King Benjamin L

    2011-08-01

    Full Text Available Abstract Background We introduce Glaucoma Discovery Platform (GDP, an online environment for facile visualization and interrogation of complex transcription profiling datasets for glaucoma. We also report the availability of Datgan, the suite of scripts that was developed to construct GDP. This reusable software system complements existing repositories such as NCBI GEO or EBI ArrayExpress as it allows the construction of searchable databases to maximize understanding of user-selected transcription profiling datasets. Description Datgan scripts were used to construct both the underlying data tables and the web interface that form GDP. GDP is populated using data from a mouse model of glaucoma. The data was generated using the DBA/2J strain, a widely used mouse model of glaucoma. The DBA/2J-Gpnmb+ strain provided a genetically matched control strain that does not develop glaucoma. We separately assessed both the retina and the optic nerve head, important tissues in glaucoma. We used hierarchical clustering to identify early molecular stages of glaucoma that could not be identified using morphological assessment of disease. GDP has two components. First, an interactive search and retrieve component provides the ability to assess gene(s of interest in all identified stages of disease in both the retina and optic nerve head. The output is returned in graphical and tabular format with statistically significant differences highlighted for easy visual analysis. Second, a bulk download component allows lists of differentially expressed genes to be retrieved as a series of files compatible with Excel. To facilitate access to additional information available for genes of interest, GDP is linked to selected external resources including Mouse Genome Informatics and Online Medelian Inheritance in Man (OMIM. Conclusion Datgan-constructed databases allow user-friendly access to datasets that involve temporally ordered stages of disease or developmental stages

  16. Stratospheric CH4 and CO2 profiles derived from SCIAMACHY solar occultation measurements

    Directory of Open Access Journals (Sweden)

    S. Noël

    2015-11-01

    Full Text Available Stratospheric profiles of methane (CH4 and carbon dioxide (CO2 have been derived from solar occultation measurements of the SCanning Imaging Absorption spectroMeter for Atmospheric CHartographY (SCIAMACHY. The retrieval is performed using a method called "Onion Peeling DOAS" (ONPD which combines an onion peeling approach with a weighting function DOAS (Differential Optical Absorption Spectroscopy fit. By use of updated pointing information and optimisation of the data selection and of the retrieval approach the altitude range for reasonable CH4 could be extended to about 17 to 45 km. Furthermore, the quality of the derived CO2 has been assessed such that now the first stratospheric profiles of CO2 from SCIAMACHY are available. Comparisons with independent data sets yield an estimated accuracy of the new SCIAMACHY stratospheric profiles of about 5–10 % for CH4 and 2–3 % for CO2. The accuracy of the products is currently mainly restricted by the appearance of unexpected vertical oscillations in the derived profiles which need further investigation. Using the improved ONPD retrieval, CH4 and CO2 stratospheric data sets covering the whole SCIAMACHY time series (August 2002–April 2012 and the latitudinal range between about 50 and 70° N have been derived. Based on these time series, CH4 and CO2 trends have been estimated, which are in reasonable agreement with total column trends for these gases. This shows that the new SCIAMACHY data sets can provide valuable information about the stratosphere.

  17. Characterization of CO2 flow in a hypersonic impulse facility using DLAS

    Science.gov (United States)

    Meyers, J. M.; Paris, S.; Fletcher, D. G.

    2016-02-01

    This work documents diode laser absorption measurements of CO2 flow in the free stream of the Longshot hypersonic impulse facility at Mach numbers ranging from 10 to 12. The diode laser sensor was designed to measure absorption of the P12 (30013) ← (00001) transition near 1.6 \\upmum, which yields relatively weak direct absorption levels (3.5 % per meter at peak Longshot free-stream conditions). Despite this weak absorption, measurements yielded valuable flow property information during the first 20 ms of facility runs. Simultaneous measurements of static temperature, pressure, and velocity were acquired in the inviscid core flow region using a laser wavelength scanning frequency of 600 Hz. The free-stream values obtained from DLAS measurements were then compared to Longshot probe-derived values determined from settling chamber and probe measurements. This comparison enabled an assessment of the traditional method of flow characterization in the facility, which indicated negligible influence from possible vibrational freezing of reservoir gases.

  18. Communicational intervention in promoting effective environmental profile of teachers of integrated National School Jorge Basadre in Santa María del Valle, Huánuco, Perú-2011

    OpenAIRE

    Angélica SOTOMAYOR BACA

    2015-01-01

    In the search for mitigation and remediation of the environmental crisis, preparing teachers for Environmental Education is now recognized as a priority. This determines the need for a continuous transformation of the teaching role, becoming active agents in the formation of new generations, addressing environmental problems with emerging approaches.The objective of this research is to check whether along the communicational intervention is possible to improve the environmental profile of tea...

  19. Migrating the facility profile information management system into the world wide web

    Energy Technology Data Exchange (ETDEWEB)

    Kero, R.E.; Swietlik, C.E.

    1994-09-01

    The Department of Energy - Office of Special Projects and Argonne National Laboratory (ANL), along with the Department of Energy - office of Scientific and Technical Information have previously designed and implemented the Environment, Safety and Health Facility Profile Information Management System (FPIMS) to facilitate greater efficiency in searching, analyzing and disseminating information found within environment, safety and health oversight documents. This information retrieval based system serves as a central repository for full-text electronic oversight documents, as well as a management planning and decision making tool that can assist in trend and root cause analyses. Continuous improvement of environment, safety and health programs are currently aided through this personal computer-based system by providing a means for the open communication of lessons learned across the department. Overall benefits have included reductions in costs and improvements in past information management capabilities. Access to the FPIMS has been possible historically through a headquarters-based local area network equipped with modems. Continued demand for greater accessibility of the system by remote DOE field offices and sites, in conjunction with the Secretary of Energy` s call for greater public accessibility to Department of Energy (DOE) information resources, has been the impetus to expand access through the use of Internet technologies. Therefore, the following paper will discuss reasons for migrating the FPIMS system into the World Wide Web (Web), various lessons learned from the FPIMS migration effort, as well as future plans for enhancing the Web-based FPIMS.

  20. Development and Evaluation of a High Sensitivity DIAL System for Profiling Atmospheric CO2

    Science.gov (United States)

    Ismail, Syed; Koch, Grady J.; Refaat, Tamer F.; Abedin, M. N.; Yu, Jirong; Singh, Upendra N.

    2008-01-01

    A ground-based 2-micron Differential Absorption Lidar (DIAL) CO2 profiling system for atmospheric boundary layer studies and validation of space-based CO2 sensors is being developed and tested at NASA Langley Research Center as part of the NASA Instrument Incubator Program. To capture the variability of CO2 in the lower troposphere a precision of 1-2 ppm of CO2 (less than 0.5%) with 0.5 to 1 km vertical resolution from near surface to free troposphere (4-5 km) is one of the goals of this program. In addition, a 1% (3 ppm) absolute accuracy with a 1 km resolution over 0.5 km to free troposphere (4-5 km) is also a goal of the program. This DIAL system leverages 2-micron laser technology developed under NASA's Laser Risk Reduction Program (LRRP) and other NASA programs to develop new solid-state laser technology that provides high pulse energy, tunable, wavelength-stabilized, and double-pulsed lasers that are operable over pre-selected temperature insensitive strong CO2 absorption lines suitable for profiling of lower tropospheric CO2. It also incorporates new high quantum efficiency, high gain, and relatively low noise phototransistors, and a new receiver/signal processor system to achieve high precision DIAL measurements. This presentation describes the capabilities of this system for atmospheric CO2 and aerosol profiling. Examples of atmospheric measurements in the lidar and DIAL mode will be presented.

  1. Ship Targets Discrimination Algorithm in SAR Images Based on Hu Moment Feature and Texture Feature

    Directory of Open Access Journals (Sweden)

    Liu Lei

    2016-01-01

    Full Text Available To discriminate the ship targets in SAR images, this paper proposed the method based on combination of Hu moment feature and texture feature. Firstly,7 Hu moment features should be extracted, while gray level co-occurrence matrix is then used to extract the features of mean, variance, uniformity, energy, entropy, inertia moment, correlation and differences. Finally the k-neighbour classifier was used to analysis the 15 dimensional feature vectors. The experimental results show that the method of this paper has a good effect.

  2. Seasonal dynamics of soil CO2 efflux and soil profile CO2 concentrations in arboretum of Moscow botanical garden

    Science.gov (United States)

    Goncharova, Olga; Udovenko, Maria; Matyshak, Georgy

    2016-04-01

    To analyse and predict recent and future climate change on a global scale exchange processes of greenhouse gases - primarily carbon dioxide - over various ecosystems are of rising interest. In order to upscale land-use dependent sources and sinks of CO2, knowledge of the local variability of carbon fluxes is needed. Among terrestrial ecosystems, urban areas play an important role because most of anthropogenic emissions of carbon dioxide originate from these areas. On the other hand, urban soils have the potential to store large amounts of soil organic carbon and, thus, contribute to mitigating increases in atmospheric CO2 concentrations. Research objectives: 1) estimate the seasonal dynamics of carbon dioxide production (emission - closed chamber technique and profile concentration - soil air sampling tubes method) by soils of Moscow State University Botanical Garden Arboretum planted with Picea obovata and Pinus sylvestris, 1) identification the factors that control CO2 production. The study was conducted with 1-2 weeks intervals between October 2013 and November 2015 at two sites. Carbon dioxide soil surface efflux during the year ranged from 0 to 800 mgCO2/(m2hr). Efflux values above 0 mgCO2/(m2hr) was observed during the all cold period except for only 3 weeks. Soil CO2 concentration ranged from 1600-3000 ppm in upper 10-cm layer to 10000-40000 ppm at a depth of 60 cm. The maximum concentrations of CO2 were recorded in late winter and late summer. We associate it with high biological activity (both heterotrophic and autotrophic) during the summer, and with physical gas jamming in the winter. The high value of annual CO2 production of the studied soils is caused by high organic matter content, slightly alkaline reaction, good structure and texture of urban soils. Differences in soil CO2 production by spruce and pine urban forest soils (in the pine forest 1.5-2.0 times higher) are caused by urban soil profiles construction, but not temperature regimes. Seasonal

  3. Validation through simulations of a C_n^2 profiler for the ESO/VLT Adaptive Optics Facility

    Science.gov (United States)

    Garcia-Rissmann, A.; Guesalaga, A.; Kolb, J.; Le Louarn, M.; Madec, P.-Y.; Neichel, B.

    2015-04-01

    The Adaptive Optics Facility (AOF) project envisages transforming one of the VLT units into an adaptive telescope and providing its ESO (European Southern Observatory) second generation instruments with turbulence-corrected wavefronts. For MUSE and HAWK-I this correction will be achieved through the GALACSI and GRAAL AO modules working in conjunction with a 1170 actuators deformable secondary mirror (DSM) and the new Laser Guide Star Facility (4LGSF). Multiple wavefront sensors will enable GLAO (ground layer adaptive optics) and LTAO (laser tomography adaptive optics) capabilities, whose performance can greatly benefit from a knowledge about the stratification of the turbulence in the atmosphere. This work, totally based on end-to-end simulations, describes the validation tests conducted on a C_n^2 profiler adapted for the AOF specifications. Because an absolute profile calibration is strongly dependent on a reliable knowledge of turbulence parameters r0 and L0, the tests presented here refer only to normalized output profiles. Uncertainties in the input parameters inherent to the code are tested as well as the profiler response to different turbulence distributions. It adopts a correction for the unseen turbulence, critical for the GRAAL mode, and highlights the effects of masking out parts of the corrected wavefront on the results. Simulations of data with typical turbulence profiles from Paranal were input to the profiler, showing that it is possible to identify reliably the input features for all the AOF modes.

  4. Hu Xiaoyu—an Outstanding Pupil

    Institute of Scientific and Technical Information of China (English)

    1995-01-01

    HU Xiaoyu, 11, is a fifth grader at the Beijing Hepingli No. 4 Primary School. She is talkative, cheerful, active and likes to laugh. Her teachers say she is well-behaved and excels in her studies. She is intelligent and always asks many questions both in and outside the classroom. She has been elected a "Three Good" student every year since she started school.

  5. Hu Qiaomu and Hu Feng Event%胡乔木与胡风案

    Institute of Scientific and Technical Information of China (English)

    张成洁

    2015-01-01

    It had a gradual upgrade process on a critique of Hu Feng's literary thoughts and a political settlement to Hu Feng.As the senior vice minister of the Propaganda Department of the Central Committee of the CPC,Hu Qiaomu played an important role on it.In October 1945,Hu Qiaomu still stayed in Chungking after Chungking Negotiations and counter-acted the effects of Hu Feng's literary thoughts by criticizing"subjectiveness".Public criticism to Hufeng launched by"popular literature series" was supported by Hu Qiaomuin in Hongkong in 1948.The first two years of the founding of new China,Hu Qiaomu talked with Hufeng for many times to solve his ideological problems.Hu Qiaomu also organized criticism of Hu Feng's literary thoughts throught the opportunity of Shuwu self-criticism;Hu Qiaomu first mentioned publicly"a small cabal of literary headed by Hufeng"In his giving editorial notes of Shuwu's article.Hu Feng's private let-ters to Shuwu were disclosed which directly led to Hu Feng event upgrading to"anti-party and anti-revolution"problems in the process of the great criticism of Hu Feng.After 1954,this matter had an indirect relationship with Hu Qiaomu's suggest of writing Hu Feng sectarianism.However,Hu Qiaomu disapproved to determine Hu Feng and the people impli-cating with Hu Feng as"Hufeng Anti-Party Clique".He gave a claim in this connection before Mao Zedong.In the past, people very paid attention to Zhouyang who had deep historical grievances with Hu Feng and ignored the role of Hu Qiao-mu in Hu Feng event.%对胡风文艺思想的批判和对胡风的政治清算有一个渐次升级的过程。其中,在对胡风文艺思想的批判中,胡乔木起了重要作用。1945年10月,胡乔木随毛泽东去重庆谈判后逗留重庆,借批《论主观》来清除胡风文艺思想的影响;1948年香港的《大众文艺丛刊》对胡风发起的公开批评,也得到了胡乔木的支持;新中国成立头两年,胡乔木多次奉命找胡风谈话

  6. Communicational intervention in promoting effective environmental profile of teachers of integrated National School Jorge Basadre in Santa María del Valle, Huánuco, Perú-2011

    Directory of Open Access Journals (Sweden)

    Angélica SOTOMAYOR BACA

    2015-05-01

    Full Text Available In the search for mitigation and remediation of the environmental crisis, preparing teachers for Environmental Education is now recognized as a priority. This determines the need for a continuous transformation of the teaching role, becoming active agents in the formation of new generations, addressing environmental problems with emerging approaches.The objective of this research is to check whether along the communicational intervention is possible to improve the environmental profile of teachers Jorge Basadre Integrated National College in Santa Maria Valley, the district and province of Huanuco, Peru. And, therefore, optimize their abilities to teaching-learning environment care, incorporating the student’s commitment to protect the environment. The study was experimental, prospective, longitudinal, analytical, methodological with a single group before and after; volunteers participating on communication design based on a intervention, developed in monthly sessions in a five-month period thirtysix. A survey and two scales were validated and successfully applied. Hypotheses are tested by analysis of variance and multivariate contrasts stockings t-test shows a related; SPWS supported in V19. The influence of speech communication is demonstrated by the significant differences obtained in the moments after intervention from baseline. According to the findings, the hypotheses that differentiate in the normal behavior, teaching practice and perceptions towards environmental education participants are confirmed. However, the intervention did not improve the practice of environmental values and principles of teaching, which is the incidence of future studies that support such changes. In general, the communication intervention applied, is favorable in promoting effective environmental profile of teachers in the study.

  7. High intensity profile monitor for time resolved spectrometry at the CLIC Test Facility 3

    Science.gov (United States)

    Olvegård, M.; Adli, E.; Braun, H. H.; Bravin, E.; Chritin, N.; Corsini, R.; Dabrowski, A. E.; Döbert, S.; Dutriat, C.; Egger, D.; Lefèvre, T.; Mete, O.; Skowronski, P. K.; Tecker, F.

    2012-08-01

    The power source of the Compact LInear Collider (CLIC) relies on the generation and deceleration of a high-intensity electron drive beam. In order to provide the best radio-frequency (RF) to beam-energy transfer efficiency, the electron beam is accelerated using fully loaded RF cavities, which leads to strong beam loading effects resulting in a high-energy transient. The stability of the RF power produced by the drive beam depends on the stability of the drive beam energy and energy spread along the pulse. The control and the monitoring of the time evolution of the beam energy distribution are therefore crucial for the accelerator performance. For this purpose segmented beam dumps, which are simple and robust devices, have been designed and installed at the CLIC Test Facility 3 (CTF3). These devices are located at the end of spectrometer lines and provide horizontal beam profiles with a time resolution better than 10 ns. The segmented dumps are composed of parallel, vertical, metallic plates, and are based on the same principle as a Faraday cup: the impinging beam current is read by a fast acquisition channel. Both FLUKA and Geant4 simulations were performed to define the optimum detector geometry for beam energies ranging from 5 MeV to 150 MeV. This paper presents a detailed description of the different steps of the design: the optimization of the detector spatial resolution, the minimization of the thermal load and the long-term damage resulting from high radiation doses. Four segmented dumps are currently used in the CTF3 complex. Their measured performance and limitations are presented in this paper. Typical beam spectra as measured in the CTF3 linac are also presented along with a description of the RF manipulations needed for tuning the beam energy spectrum.

  8. The application and comparison of several flux profile relations in CoLM

    Institute of Scientific and Technical Information of China (English)

    ZhenChao Li; ZhiGang Wei; ZhiYuan Zheng; Hong Wei; Hui Liu

    2014-01-01

    This paper discusses the important role that flux profile relations play in momentum flux, sensible heat flux, and latent heat flux simulations in CoLM (Common Land Model) and compares the application of three flux profile relation schemes in CoLM by means of the Loess Plateau Land-Atmosphere Interaction Pilot Experiment (LOPEX) of 2005. It reveals that the results simulated by the model barely changed in the original flux profile schemes of the models after eliminating the very stable condition and the very unstable condition, and there were only tiny changes in numerical values. This indicates that the corrected terms added to fm(ζm), fh(ζh) were very tiny and can be ignored under very stable and very unstable circumstances. According to a comparison of the three flux profile relations, the simulation results were basically coherent by using any CoLM:the correlation coefficient of the simulation value and the observed value was 0.89, and this bears on the coherence with the numerical procedures for the flux pro-file relations under unstable circumstances. The simulation results were improved considerably by utilizing the Lobocki flux pro-file schemes, which numerical procedures under unstable circumstances differed significantly from other three flux profile schemes;in this case the correlation coefficient of the value of simulation and the observed value became 0.95. In the next itera-tion of this study, it will be of great importance for the development of the land surface process model to continue experimenting with the application of some novel flux profile schemes in the land surface process models in typical regions.

  9. Analysis of influence of atmosphere extinction to Raman lidar monitoring CO2 concentration profile

    Institute of Scientific and Technical Information of China (English)

    Zhao Pei-Tao; Zhang Yin-Chao; Wang Lian; Zhao Yue-Feng; Su Jia; Fang Xin; Cao Kai-Fa; Xie Jun; Du Xiao-Yong

    2007-01-01

    Lidar (Light detection and ranging) system monitoring of the atmosphere is a novel and powerful technique tool. The Raman lidar is well established today as a leading research tool in the study of numerous important areas in the atmospheric sciences. In this paper, the principle of Raman lidar technique measurement CO2 concentration profile is presented and the errors caused by molecular and aerosol extinction for CO2 concentration profile measurement with Raman lidar are also presented. The standard atmosphere extinction profile and 'real-time' Hefei area extinction profile are used to conduct correction and the corresponding results are yielded. Simulation results with standard atmosphere mode correction indicate that the errors caused by molecule and aerosol extinction should be counted for the reason that they could reach about 8 ppm and 5 ppm respectively. The relative error caused by Hefei area extinction correction could reach about 6%. The errors caused by the two components extinction influence could produce significant changes for CO2 concentration profile and need to be counted in data processing which could improve the measurement accuracies.

  10. Modeling atmospheric CO2 concentration profiles and fluxes above sloping terrain at a boreal site

    Directory of Open Access Journals (Sweden)

    T. Aalto

    2006-01-01

    Full Text Available CO2 fluxes and concentrations were simulated in the planetary boundary layer above subarctic hilly terrain using a three dimensional model. The model solves the transport equations in the local scale and includes a vegetation sub-model. A WMO/GAW background concentration measurement site and an ecosystem flux measurement site are located inside the modeled region at a hilltop and above a mixed boreal forest, respectively. According to model results, the concentration measurement at the hill site was representative for continental background. However, this was not the case for the whole model domain. Concentration at few meters above active vegetation represented mainly local variation. Local variation became inseparable from the regional signal at about 60-100 m above ground. Flow over hills changed profiles of environmental variables and height of inversion layer, however CO2 profiles were more affected by upwind land use than topography. The hill site was above boundary layer during night and inside boundary layer during daytime. The CO2 input from model lateral boundaries dominated in both cases. Daily variation in the CO2 assimilation rate was clearly seen in the CO2 profiles. Concentration difference between the hill site and the forest site was about 5ppm during afternoon according to both model and measurements. The average modeled flux to the whole model region was about 40% of measured and modeled local flux at the forest site.

  11. Classifying substance use disorder treatment facilities with co-located mental health services: A latent class analysis approach.

    Science.gov (United States)

    Mauro, Pia M; Furr-Holden, C Debra; Strain, Eric C; Crum, Rosa M; Mojtabai, Ramin

    2016-06-01

    The Affordable Care Act calls for increased integration and coordination of behavioral health services, as people with co-occurring disorders (CODs), meeting criteria for both substance use and psychiatric disorders, are overrepresented in treatment samples. Nationwide estimates of mental health (MH) service co-location in substance use disorder (SUD) treatment facilities are needed. We empirically derived a multiple-indicator categorization of services for CODs in SUD treatment facilities. We used latent class analysis to categorize 14,037 SUD treatment facilities in the United States and territories included in the 2012 National Survey of Substance Abuse Treatment Services. Latent class indicators included MH screening and diagnosis, MH support services, psychiatric medications, groups for CODs, and psychosocial approaches. Multinomial logistic regression compared facility-identified primary focus (i.e., SUD, MH, mix of SUD-MH, and general/other) and other facility characteristics across classes. A four-class solution was chosen with the following classes: Comprehensive MH/COD Services (25%), MH without COD Services (25%), MH Screening Services (21%), and Limited MH Services (29%). The former two classes with co-located MH services were less likely to report a SUD-primary focus than the latter classes reporting only MH screening or Limited MH Services. Only the Comprehensive MH/COD Services class also had a high probability of providing special groups for CODs. Approximately half of SUD treatment facilities were in classes with co-located mental health services, but only a quarter provided comprehensive COD services. Future studies should assess differences in patient experiences and treatment outcomes across facilities with and without COD services. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  12. Regulation of HuR by DNA Damage Response Kinases

    Directory of Open Access Journals (Sweden)

    Hyeon Ho Kim

    2010-01-01

    Full Text Available As many DNA-damaging conditions repress transcription, posttranscriptional processes critically influence gene expression during the genotoxic stress response. The RNA-binding protein HuR robustly influences gene expression following DNA damage. HuR function is controlled in two principal ways: (1 by mobilizing HuR from the nucleus to the cytoplasm, where it modulates the stability and translation of target mRNAs and (2 by altering its association with target mRNAs. Here, we review evidence that two main effectors of ataxia-telangiectasia-mutated/ATM- and Rad3-related (ATM/ATR, the checkpoint kinases Chk1 and Chk2, jointly influence HuR function. Chk1 affects HuR localization by phosphorylating (hence inactivating Cdk1, a kinase that phosphorylates HuR and thereby blocks HuR's cytoplasmic export. Chk2 modulates HuR binding to target mRNAs by phosphorylating HuR's RNA-recognition motifs (RRM1 and RRM2. We discuss how HuR phosphorylation by kinases including Chk1/Cdk1 and Chk2 impacts upon gene expression patterns, cell proliferation, and survival following genotoxic injury.

  13. Flexible DNA bending in HU-DNA cocrystal structures.

    Science.gov (United States)

    Swinger, Kerren K; Lemberg, Kathryn M; Zhang, Ying; Rice, Phoebe A

    2003-07-15

    HU and IHF are members of a family of prokaryotic proteins that interact with the DNA minor groove in a sequence-specific (IHF) or non-specific (HU) manner to induce and/or stabilize DNA bending. HU plays architectural roles in replication initiation, transcription regulation and site-specific recombination, and is associated with bacterial nucleoids. Cocrystal structures of Anabaena HU bound to DNA (1P71, 1P78, 1P51) reveal that while underlying proline intercalation and asymmetric charge neutralization mechanisms of DNA bending are similar for IHF and HU, HU stabilizes different DNA bend angles ( approximately 105-140 degrees ). The two bend angles within a single HU complex are not coplanar, and the resulting dihedral angle is consistent with negative supercoiling. Comparison of HU-DNA and IHF-DNA structures suggests that sharper bending is correlated with longer DNA binding sites and smaller dihedral angles. An HU-induced bend may be better modeled as a hinge, not a rigid bend. The ability to induce or stabilize varying bend angles is consistent with HU's role as an architectural cofactor in many different systems that may require differing geometries.

  14. Facile synthesis of Co3O4 spheres and their unexpected high specific discharge capacity for Lithium-ion batteries

    Science.gov (United States)

    Wang, Zhengdong; Qu, Shaohua; Cheng, Yonghong; Zheng, Chenghui; Chen, Siyu; Wu, Hongjing

    2017-09-01

    We report a facile, one-pot hydrothermal synthesis of Co3O4 solid spheres and multi-shelled Co3O4 hollow spheres with a controlled number of movable internal Co3O4 shells. Moreover, the magnetic properties of the multi-shelled Co3O4 hollow spheres were first investigated by the SQUID magnetometer. Interestingly, the Co3O4 solid spheres calcined at 430 °C deliver an unexpected high specific discharge capacity of 1976 and 1129 mAh g-1 for the 17th and 100th cycle at 100 mA g-1, respectively. In addition, the Co3O4 solid spheres calcined at 430 °C also show good capacity retention (i.e., 1129 mAh g-1 after 100 cycles). The significant performance improvement offers the potential to open up an avenue for next-generation LIBs.

  15. Retrieval of MetOp-A/IASI CO profiles and validation with MOZAIC data

    Directory of Open Access Journals (Sweden)

    E. De Wachter

    2012-11-01

    Full Text Available The IASI (Infrared Atmospheric Sounding Interferometer nadir-looking thermal infrared sounder onboard MetOp-A enables the monitoring of atmospheric constituents on a global scale. This paper presents a quality assessment of IASI CO profiles retrieved by the two different retrieval algorithms SOFRID and FORLI, by an intercomparison with airborne in-situ CO profiles from the MOZAIC program for the 2008–2009 period. Lower (surface–480 hPa and upper tropospheric partial column (480–225 hPa comparisons as well as profile comparisons are made. The retrieval errors of the IASI products are less than 21% in the lower troposphere and less than 10% in the upper troposphere. A statistical analysis shows similar correlation coefficients for the two retrieval algorithms and smoothed MOZAIC of r ~ 0.8 and r ~ 0.7 in the lower and upper troposphere respectively. Comparison with smoothed MOZAIC data of the temporal variation of the CO profiles at the airports of Frankfurt and Windhoek demonstrates that the IASI products are able to capture the seasonal variability at these sites. At Frankfurt SOFRID (respectively FORLI is positively biased by 10.5% (13.0% compared to smoothed MOZAIC in the upper (lower troposphere, and the limited sensitivity of the IASI instrument to the boundary layer when thermal contrast is low is identified. At Windhoek, the impact of the vegetation fires in Southern Africa from July to November is captured by both SOFRID and FORLI, with an overestimation of the CO background values (fire maxima by SOFRID (FORLI by 12.8% (10%. Profile comparisons at Frankfurt and Windhoek show that the largest discrepancies are found between the two IASI products and MOZAIC for the nighttime retrievals.

  16. Isolation and characterization of a catalase gene "HuCAT3" from pitaya (Hylocereus undatus) and its expression under abiotic stress.

    Science.gov (United States)

    Nie, Qiong; Gao, Guo-Li; Fan, Qing-jie; Qiao, Guang; Wen, Xiao-Peng; Liu, Tao; Peng, Zhi-Jun; Cai, Yong-Qiang

    2015-05-25

    Abiotic stresses usually cause H2O2 accumulation, with harmful effects, in plants. Catalase may play a key protective role in plant cells by detoxifying this excess H2O2. Pitaya (Hylocereus undatus) shows broad ecological adaptation due to its high tolerance to abiotic stresses, e.g. drought, heat and poor soil. However, involvement of the pitaya catalase gene (HuCAT) in tolerance to abiotic stresses is unknown. In the present study, a full-length HuCAT3 cDNA (1870 bp) was isolated from pitaya based on our previous microarray data and RACE method. The cDNA sequence and deduced amino acid sequence shared 73-77% and 75-80% identity with other plant catalases, respectively. HuCAT3 contains conserved catalase family domain and catalytic sites. Pairwise comparison and phylogenetic analysis indicated that HuCAT3 is most similar to Eriobotrya japonica CAT, followed by Dimocarpus longan CAT and Nicotiana tabacum CAT1. Expression profile analysis demonstrated that HuCAT3 is mainly expressed in green cotyledons and mature stems, and was regulated by H2O2, drought, cold and salt stress, whereas, its expression patterns and maximum expression levels varied with stress types. HuCAT activity increased as exposure to the tested stresses, and the fluctuation of HuCAT activity was consistent with HuCAT3 mRNA abundance (except for 0.5 days upon drought stress). HuCAT3 mRNA elevations and HuCAT activities changes under cold stress were also in conformity with the cold tolerances among the four genotypes. The obtained results confirmed a major role of HuCAT3 in abiotic stress response of pitaya. This may prove useful in understanding pitaya's high tolerance to abiotic stresses at molecular level.

  17. HU-446 and HU-465, Derivatives of the Non-psychoactive Cannabinoid Cannabidiol, Decrease the Activation of Encephalitogenic T Cells.

    Science.gov (United States)

    Kozela, Ewa; Haj, Christeene; Hanuš, Lumir; Chourasia, Mukesh; Shurki, Avital; Juknat, Ana; Kaushansky, Nathali; Mechoulam, Raphael; Vogel, Zvi

    2016-01-01

    Cannabidiol (CBD), the non-psychoactive cannabinoid, has been previously shown by us to decrease peripheral inflammation and neuroinflammation in mouse experimental autoimmune encephalomyelitis (EAE) model of multiple sclerosis (MS). Here we have studied the anti-inflammatory effects of newly synthesized derivatives of natural (-)-CBD ((-)-8,9-dihydro-7-hydroxy-CBD; HU-446) and of synthetic (+)-CBD ((+)-8,9-dihydro-7-hydroxy-CBD; HU-465) on activated myelin oligodendrocyte glycoprotein (MOG)35-55-specific mouse encephalitogenic T cells (T(MOG) ) driving EAE/MS-like pathologies. Binding assays followed by molecular modeling revealed that HU-446 has negligible affinity toward the cannabinoid CB1 and CB2 receptors while HU-465 binds to both CB1 and CB2 receptors at the high nanomolar concentrations (Ki = 76.7 ± 5.8 nm and 12.1 ± 2.3 nm, respectively). Both, HU-446 and HU-465, at 5 and 10 μm (but not at 0.1 and 1 μm), inhibited the MOG35-55-induced proliferation of autoreactive T(MOG) cells via CB1/CB2 receptor independent mechanisms. Moreover, both HU-446 and HU-465, at 5 and 10 μm, inhibited the release of IL-17, a key autoimmune cytokine, from MOG35-55-stimulated T(MOG) cells. These results suggest that HU-446 and HU-465 have anti-inflammatory potential in inflammatory and autoimmune diseases.

  18. Facile synthesis of mesoporous spinel NiCo2O4 nanostructures as highly efficient electrocatalysts for urea electro-oxidation

    Science.gov (United States)

    Ding, Rui; Qi, Li; Jia, Mingjun; Wang, Hongyu

    2014-01-01

    Mesoporous spinel nickel cobaltite (NiCo2O4) nanostructures were synthesized via a facile chemical deposition method coupled with a simple post-annealing process. The physicochemical properties were characterized via X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray photoelectron spectra (XPS) and nitrogen sorption measurements. The electrocatalytic performances were investigated by cyclic voltammetry (CV), chronoamperometry (CA) and electrochemical impedance spectroscopy (EIS) tests. The obtained NiCo2O4 materials exhibit typical agglomerate mesoporous nanostructures with a large surface area (190.1 m2 g-1) and high mesopore volume (0.943 cm3 g-1). Remarkably, the NiCo2O4 shows much higher catalytic activity, lower overpotential, better stability and greater tolerance towards urea electro-oxidation compared to those of cobalt oxide (Co3O4) synthesized by the same procedure. The NiCo2O4 electrode delivers a current density of 136 mA cm-2 mg-1 at 0.7 V (vs. Hg/HgO) in 1 M KOH and 0.33 M urea electrolytes accompanied with a desirable stability. The impressive electrocatalytic activity is largely ascribed to the high intrinsic electronic conductivity, superior mesoporous nanostructures and rich surface Ni active species of the NiCo2O4 materials, which can largely boost the interfacial electroactive sites and charge transfer rates for urea electro-oxidation, indicating promising applications in future wastewater remediation, hydrogen production and fuel cells.Mesoporous spinel nickel cobaltite (NiCo2O4) nanostructures were synthesized via a facile chemical deposition method coupled with a simple post-annealing process. The physicochemical properties were characterized via X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray photoelectron spectra (XPS) and nitrogen sorption measurements. The electrocatalytic performances were investigated by cyclic voltammetry

  19. Development of Laser, Detector, and Receiver Systems for an Atmospheric CO2 Lidar Profiling System

    Science.gov (United States)

    Ismail, Syed; Koch, Grady; Abedin, Nurul; Refaat, Tamer; Rubio, Manuel; Singh, Upendra

    2008-01-01

    A ground-based Differential Absorption Lidar (DIAL) is being developed with the capability to measure range-resolved and column amounts of atmospheric CO2. This system is also capable of providing high-resolution aerosol profiles and cloud distributions. It is being developed as part of the NASA Earth Science Technology Office s Instrument Incubator Program. This three year program involves the design, development, evaluation, and fielding of a ground-based CO2 profiling system. At the end of a three-year development this instrument is expected to be capable of making measurements in the lower troposphere and boundary layer where the sources and sinks of CO2 are located. It will be a valuable tool in the validation of NASA Orbiting Carbon Observatory (OCO) measurements of column CO2 and suitable for deployment in the North American Carbon Program (NACP) regional intensive field campaigns. The system can also be used as a test-bed for the evaluation of lidar technologies for space-application. This DIAL system leverages 2-micron laser technology developed under a number of NASA programs to develop new solid-state laser technology that provides high pulse energy, tunable, wavelength-stabilized, and double-pulsed lasers that are operable over pre-selected temperature insensitive strong CO2 absorption lines suitable for profiling of lower tropospheric CO2. It also incorporates new high quantum efficiency, high gain, and relatively low noise phototransistors, and a new receiver/signal processor system to achieve high precision DIAL measurements.

  20. Biases of CO2 Storage in Eddy Flux Measurements pertinent to Vertical Configurations of a Profile System and CO2 Density Averaging

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Bai [ORNL; Hanson, Paul J [ORNL; Riggs, Jeffery S [ORNL; Pallardy, Stephen G. [University of Missouri; Hosman, K. P. [University of Missouri; Meyers, T. P. [NOAA ATDD; Wullschleger, Stan D [ORNL; Gu, Lianhong [ORNL; Heuer, Mark [ATDD, NOAA

    2007-01-01

    CO2 storage in a 30-minute period in a tall forest canopy often makes significant contributions to net ecosystem exchange (NEE) in the early morning and at night. When CO2 storage is properly measured and taken into account, underestimations of NEE on calm nights can be greatly reduced. Using CO2 data from a 12-level profile, we demonstrate that the lower canopy layer (below the thermal inversion) is a disproportional contributor to the total CO2 storage. This is because time derivative of CO2 density ( c/ t) generally shows increasing magnitude of mean and standard deviation with decreasing heights at night and from sunrise to 1000 hr in both growing and dormant seasons. Effects of resolution and configuration in a profiling system on the accuracy of CO2 storage estimation are evaluated by comparing subset profiles to the 12-level benchmark profile. It is demonstrated that the effectiveness of a profiling system in estimating CO2 storage is not only determined by its number of sampling levels but, more importantly, by its vertical configuration. To optimize a profile, one needs to balance the influence of two factors, c/ t and layer thickness, among all vertical sections within a forest. As a key contributor to the total CO2 storage, the lower canopy (with relatively large means and standard deviations of c/ t) requires a higher resolution in a profile system than the layers above. However, if the upper canopy is over-sparsely sampled relative to the lower canopy, the performance of a profile system might be degraded since, in such a situation, the influence of layer thickness dominates over that of c/ t. We also find that, because of different level of complexity in canopy structure, more sampling levels are necessary at our site in order to achieve the same level of accuracy as at a boreal aspen site. These results suggest that, in order to achieve an adequate accuracy in CO2 storage measurements, the number of sampling levels in a profile and its design should

  1. Multiple defects in Escherichia coli mutants lacking HU protein.

    OpenAIRE

    Huisman, O; Faelen, M; Girard, D; Jaffé, A; Toussaint, A; Rouvière-Yaniv, J

    1989-01-01

    The HU protein isolated from Escherichia coli, composed of two partially homologous subunits, alpha and beta, shares some of the properties of eucaryotic histones and is a major constituent of the bacterial nucleoid. We report here the construction of double mutants totally lacking both subunits of HU protein. These mutants exhibited poor growth and a perturbation of cell division, resulting in the formation of anucleate cells. In the absence of HU, phage Mu was unable to grow, to lysogenize,...

  2. Underground reconnaissance and environmental monitoring related to geologic CO2 sequestration studies at the DUSEL Facility, Homestake Mine, South Dakota

    Energy Technology Data Exchange (ETDEWEB)

    Dobson, Patrick F.; Salve, Rohit

    2009-11-20

    Underground field reconnaissance was carried out in the Deep Underground Science and Engineering Laboratory (DUSEL) to identify potential locations for the planned geologic carbon sequestration experimental facility known as DUSEL CO{sub 2}. In addition, instrumentation for continuous environmental monitoring of temperature, pressure, and relative humidity was installed at various locations within the Homestake mine. The motivation for this work is the need to locate and design the DUSEL CO{sub 2} facility currently being planned to host CO{sub 2} and water flow and reaction experiments in long column pressure vessels over large vertical length scales. Review of existing geologic data and reconnaissance underground revealed numerous potential locations for vertical experimental flow columns, with limitations of existing vertical boreholes arising from limited vertical extent, poor continuity between drifts, and small diameter. Results from environmental monitoring over 46 days reveal spatial and temporal variations related to ventilation, weather, and ongoing dewatering of the mine.

  3. Experimental and numerical results for CO2 concentration and temperature profiles in an occupied room

    Science.gov (United States)

    Cotel, Aline; Junghans, Lars; Wang, Xiaoxiang

    2014-11-01

    In recent years, a recognition of the scope of the negative environmental impact of existing buildings has spurred academic and industrial interest in transforming existing building design practices and disciplinary knowledge. For example, buildings alone consume 72% of the electricity produced annually in the United States; this share is expected to rise to 75% by 2025 (EPA, 2009). Significant reductions in overall building energy consumption can be achieved using green building methods such as natural ventilation. An office was instrumented on campus to acquire CO2 concentrations and temperature profiles at multiple locations while a single occupant was present. Using openFOAM, numerical calculations were performed to allow for comparisons of the CO2 concentration and temperature profiles for different ventilation strategies. Ultimately, these results will be the inputs into a real time feedback control system that can adjust actuators for indoor ventilation and utilize green design strategies. Funded by UM Office of Vice President for Research.

  4. Retrieval of MetOp-A/IASI CO profiles and validation with MOZAIC data

    Directory of Open Access Journals (Sweden)

    E. De Wachter

    2012-05-01

    Full Text Available The IASI nadir looking thermal infrared sounder onboard MetOp-A enables the monitoring of atmospheric constituents on a global scale. This paper presents a quality assessment of IASI CO profiles retrieved by the two different retrieval algorithms SOFRID and FORLI, by an intercomparison with airborne in-situ CO profiles from the MOZAIC program. A statistical analysis shows a very good agreement between the two retrieval algorithms and smoothed MOZAIC data for the lower troposphere (surface-480 hPa with correlation coefficients r ~ 0.8, and a good agreement in the upper troposphere (480–225 hPa with r ~ 0.7. Closer investigation of the temporal variation of the CO profiles at the airports of Frankfurt and Windhoek demonstrates that on the overall a very good agreement is found between the IASI products and smoothed MOZAIC data in terms of seasonal variability. At Frankfurt SOFRID (resp. FORLI is positively biased by 10.5% (resp. 13.0% compared to smoothed MOZAIC in the upper (resp. lower troposphere, and the limited sensitivity of the IASI instrument to the boundary layer when thermal contrast is low is identified. At Windhoek, we find a good reproduction of the impact of the vegetation fires in Southern Africa from July to November by both SOFRID and FORLI, with an overestimation of the CO background values (resp. fire maxima by SOFRID (resp. FORLI by 12.8% (resp. ~10%. Profile comparisons at Frankfurt and Windhoek identify a reduced performance of the nighttime retrievals of both products compared to daytime retrievals.

  5. Evaluation of Co and Cr mobility in soil profiles collected in a scrapyard of impounded vehicles

    Energy Technology Data Exchange (ETDEWEB)

    Lange, Camila N.; Figueiredo, Ana Maria G., E-mail: clange@usp.br, E-mail: anamaria@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Enzweiler, Jacinta, E-mail: jacinta@ige.unicamp.br [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil). Instituto de Geociencias

    2015-07-01

    The number of motor vehicles in urban environments has increased dramatically in the past years. As a result, so has the number of impounded and end-of-life vehicles. Car wastes can have a very high metal content, which can cause important environmental impacts to the soil where these vehicles are kept. Most Brazilian vehicle impound scrapyards are currently operating at their maximum capacity and soils may have become contaminated by past or current vehicle handling practices. Most of these areas do not present an impermeable surface. The level of soil contamination with heavy metals depends on the type of soil, climate and management practices. Metals, such as Co and Cr, that are present in many auto-parts, may be considered potentially toxic elements in these areas. The aim of this study was to evaluate Co and Cr levels and behavior in soil profiles located in a scrapyard of impounded vehicles of Ribeirao Pires-SP city. For this purpose, samples from distinct horizons of three soil profiles were collected. Element concentrations were determined by Instrumental Neutron Activation Analysis (INAA). Soil parameters such as pH, organic matter content and clay, silt and sand percentage were also determined. The obtained data were statistically analyzed in order to establish correlations between elemental concentrations and the impounded vehicles scrapyard soil. Soil acidity showed to be the most remarkable property for Cr and Co mobility through soil profile. (author)

  6. SUPPORT FOR HU CFRT SUMMER HIGH SCHOOL FUSION WORKSHOP

    Energy Technology Data Exchange (ETDEWEB)

    Punjabi, Alkesh

    2010-02-09

    researchers in the HU CFRT mentor the students during summers. Mentors spend a considerable amount of time and efforts in training, teaching, guiding and supervising research projects. The HU CFRT has so far conducted nine workshops during the summers of 1996-2000 and 2002-2005. The first workshop was conducted in summer 1996. Students for the workshop are chosen from a national pool of exceptionally talented high school rising seniors/juniors. To our knowledge, most of these students have gone on to prestigious universities such as Duke University, John Hopkins University, CalTech, UCLA, Hampton University, etc. after completing their high school. For instance, Tiffany Fisher, participant of the 1996 summer workshop completed her BS in Mathematics at Hampton University in May 2001. She then went on to Wake Forest University at Winston-Salem, North Carolina to pursue graduate studies. Anshul Haldipur, participant of the 1999 summer workshop, began his undergraduate studies at Duke University in 2000. Christina Nguyen and Ilissa Martinez, participants of the 2000 summer workshop, are pursuing their undergraduate degrees at the UCLA and Florida State University respectively. The organizing committee of the APS DPP annual meeting invited Dr. Punjabi to deliver an invited talk on training the next generation of fusion scientists and engineers at the 2005 APS DPP meeting in Denver, CO. The organizing committee distributed a special flier with the Bulletin to highlight this invited talk and another talk on education as well the expo. This has given wide publicity and recognition to our workshops and Hampton University. Prof. Punjabi's talk: 'LI2 2: Training the next generation of fusion scientists and engineers: summer high school fusion science workshop, Bull. Amer. Phys. Soc. 50, 221 (2005)' was very well-received. He talked about HU education and outreach initiative and the HU CFRT Summer High School Workshop. The audience had a considerable number of questions

  7. Attention-deficit/Hyperactivity Disorder in Children: Clinical Profile and Co-morbidity

    Directory of Open Access Journals (Sweden)

    C Venkatesh

    2012-01-01

    Full Text Available Background: To study the clinical profile and co-morbidity in Indian children with attention-deficit/hyperactivity disorder (ADHD. Materials and Methods: A prospective analytical study of 2 years duration at the Child Guidance Clinic of a pediatric tertiary care hospital in a south Indian city using Diagnostic and statistical manual of Mental Disorders-1V based questionnaires. Results: Of the 251 referrals, 51 (20.3% children met the inclusion criteria for the diagnosis of ADHD. M:F ratio was 6.3:1. The mean age was 5.7 years. A majority of the children belonged to middle and lower socio-economic class and were first-born children. Most children were brought up in nuclear families. History of delayed speech and language development was commonly seen in these children. Combined type of ADHD was the most common type. At least one co-morbid diagnosis was seen in 86.3% of children, and learning disability was the most common co-morbid diagnosis. The mean IQ was 90 (SD±12. Conclusion: Early markers of cognitive dysfunction like delayed speech, language and social and adaptive development may be a pointer towards the diagnosis of ADHD in children. Knowledge about their sociodemographic profile and other co-morbid conditions that are associated with ADHD is necessary to fully understand the magnitude of the problem and to plan effective therapy for them.

  8. Lithium recycling and cathode material regeneration from acid leach liquor of spent lithium-ion battery via facile co-extraction and co-precipitation processes.

    Science.gov (United States)

    Yang, Yue; Xu, Shengming; He, Yinghe

    2017-06-01

    A novel process for extracting transition metals, recovering lithium and regenerating cathode materials based on facile co-extraction and co-precipitation processes has been developed. 100% manganese, 99% cobalt and 85% nickel are co-extracted and separated from lithium by D2EHPA in kerosene. Then, Li is recovered from the raffinate as Li2CO3 with the purity of 99.2% by precipitation method. Finally, organic load phase is stripped with 0.5M H2SO4, and the cathode material LiNi1/3Co1/3Mn1/3O2 is directly regenerated from stripping liquor without separating metal individually by co-precipitation method. The regenerative cathode material LiNi1/3Co1/3Mn1/3O2 is miro spherical morphology without any impurities, which can meet with LiNi1/3Co1/3Mn1/3O2 production standard of China and exhibits good electrochemical performance. Moreover, a waste battery management model is introduced to guarantee the material supply for spent battery recycling. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Profiling of cytosolic and peroxisomal acetyl-CoA metabolism in Saccharomyces cerevisiae.

    Directory of Open Access Journals (Sweden)

    Yun Chen

    Full Text Available As a key intracellular metabolite, acetyl-coenzyme A (acetyl-CoA plays a major role in various metabolic pathways that link anabolism and catabolism. In the yeast Saccharomyces cerevisiae, acetyl-CoA involving metabolism is compartmentalized, and may vary with the nutrient supply of a cell. Membranes separating intracellular compartments are impermeable to acetyl-CoA and no direct transport between the compartments occurs. Thus, without carnitine supply the glyoxylate shunt is the sole possible route for transferring acetyl-CoA from the cytosol or the peroxisomes into the mitochondria. Here, we investigate the physiological profiling of different deletion mutants of ACS1, ACS2, CIT2 and MLS1 individually or in combination under alternative carbon sources, and study how various mutations alter carbon distribution. Based on our results a detailed model of carbon distribution about cytosolic and peroxisomal acetyl-CoA metabolism in yeast is suggested. This will be useful to further develop yeast as a cell factory for the biosynthesis of acetyl-CoA-derived products.

  10. Facile synthesis of NiCo2O4@Polyaniline core-shell nanocomposite for sensitive determination of glucose.

    Science.gov (United States)

    Yu, Zhiyuan; Li, Hejun; Zhang, Xinmeng; Liu, Ningkun; Tan, Wenlong; Zhang, Xu; Zhang, Leilei

    2016-01-15

    In this work, the core-shell structure of NiCo2O4@Polyaniline (NiCo2O4@PANI) nanocomposite is fabricated via a facile hydrothermal treatment followed by a post-Polyaniline (PANI) coating process. The synthesized materials are characterized by Transmission electron microscopy (TEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and Raman spectrometer. The biosensing properties of NiCo2O4@PANI composite and NiCo2O4 nanoparticles toward glucose are studied based on glassy carbon electrode. Electrochemical studies indicate that the obtained core-shell NiCo2O4@PANI composite shows higher electrocatalytic activity toward the oxidation of glucose, compared with NiCo2O4 nanoparticles. The enhanced performance is related to the core-shell structure of NiCo2O4@PANI composite and the outstanding conductivity of the polyaniline shell. At a potential of +0.5V, the NiCo2O4@PANI nanocomposite modified glass carbon electrode demonstrates a wide linear range up to 4.7350mM with sensitivity of 4.55mAmM(-1)cm(-2) and detection limit of 0.3833μM. It also shows significant electrochemical stability, good reproducibility and excellent selectivity. The results suggest that the NiCo2O4@PANI nanocomposite is a promising electrode material for electrochemical biosensor. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. A Working Day of Professor Hu Yamei

    Institute of Scientific and Technical Information of China (English)

    1997-01-01

    Professor Hu Yamei is a well-known pediatrician and one of the first group of academicians to the Institute of Medical Science attached to the Chinese Academy of Engineering. At the start of her career in the 1950s, she focused on nutritional anemia that afflicts children, developing treatment and methods of prevention. Later she researched etiology, pathology and physiology of pediatric toxic indigestion, helping to reduce the child death rate from 20 percent to 1 percent. Over the past 20 years, she has concentrated on pediatric acute lymphoblastic leukemia. As a result, the five-years living rate of the disease treated by Hu’s group has reached 74 percent, approaching the highest level in the world.

  12. An inverse analysis reveals limitations of the soil-CO2 profile method to calculate CO2 production and efflux for well-structured soils

    Directory of Open Access Journals (Sweden)

    M. D. Corre

    2010-08-01

    Full Text Available Soil respiration is the second largest flux in the global carbon cycle, yet the underlying below-ground process, carbon dioxide (CO2 production, is not well understood because it can not be measured in the field. CO2 production has frequently been calculated from the vertical CO2 diffusive flux divergence, known as "soil-CO2 profile method". This relatively simple model requires knowledge of soil CO2 concentration profiles and soil diffusive properties. Application of the method for a tropical lowland forest soil in Panama gave inconsistent results when using diffusion coefficients (D calculated based on relationships with soil porosity and moisture ("physically modeled" D. Our objective was to investigate whether these inconsistencies were related to (1 the applied interpolation and solution methods and/or (2 uncertainties in the physically modeled profile of D. First, we show that the calculated CO2 production strongly depends on the function used to interpolate between measured CO2 concentrations. Secondly, using an inverse analysis of the soil-CO2 profile method, we deduce which D would be required to explain the observed CO2 concentrations, assuming the model perception is valid. In the top soil, this inversely modeled D closely resembled the physically modeled D. In the deep soil, however, the inversely modeled D increased sharply while the physically modeled D did not. When imposing a constraint during the fit parameter optimization, a solution could be found where this deviation between the physically and inversely modeled D disappeared. A radon (Rn mass balance model, in which diffusion was calculated based on the physically modeled or constrained inversely modeled D, simulated observed Rn profiles reasonably well. However, the CO2 concentrations which corresponded to the constrained inversely modeled D were too small compared to the measurements. We suggest that, in well-structured soils, a missing description of steady state CO2

  13. Notas sobre el paisaje de Huánuco Pampa

    OpenAIRE

    Román Godines, Oscar; Ministerio de Cultura

    2013-01-01

    El complejo arqueológico Huánuco Pampa se encuentra ubicado en la provincia Dos de Mayo en el departamento de Huánuco y en la actualidad es quizás el principal vestigio de la cosmovisión y la planificación urbana inca.

  14. Rapid purification of HU protein from Halobacillus karajensis

    Directory of Open Access Journals (Sweden)

    Parinaz Ghadam

    2014-03-01

    Full Text Available The histone-like protein HU is the most-abundant DNA-binding protein in bacteria. The HU protein non-specifically binds and bends DNA as a hetero- or homodimer, and can participate in DNA supercoiling and DNA condensation. It also takes part in DNA functions such as replication, recombination, and repair. HU does not recognize any specific sequences but shows a certain degree of specificity to cruciform DNA and repair intermediates such as nick, gap, bulge, etc. To understand the features of HU binding to DNA and repair intermediates, a fast and easy HU protein purification method is required. Here we report a two-step purification procedure of HU from Halobacillus karajensis (the gram positive and moderately halophilic bacteria isolated from Karaj surface soil. The method of HU purification allows obtaining a pure non-tagged protein. Salting out and ion exchange chromatography were applied for purification, and the purified protein was identified by immunoblotting. Results showed that the molecular weight of the purified protein was approximately 11 kDa which is immunologically similar to the Bacillus subtilis HU protein (HBsu.

  15. Enhanced photocatalytic activity of Co doped ZnO nanodisks and nanorods prepared by a facile wet chemical method.

    Science.gov (United States)

    Kuriakose, Sini; Satpati, Biswarup; Mohapatra, Satyabrata

    2014-07-07

    Cobalt doped ZnO nanodisks and nanorods were synthesized by a facile wet chemical method and well characterized by X-ray diffraction, field emission scanning electron microscopy (FESEM), high resolution transmission electron microscopy (HRTEM) with energy dispersive X-ray spectroscopy, photoluminescence spectroscopy, Raman spectroscopy and UV-visible absorption spectroscopy. The photocatalytic activities were evaluated for sunlight driven degradation of an aqueous methylene blue (MB) solution. The results showed that Co doped ZnO nanodisks and nanorods exhibit highly enhanced photocatalytic activity, as compared to pure ZnO nanodisks and nanorods. The enhanced photocatalytic activities of Co doped ZnO nanostructures were attributed to the combined effects of enhanced surface area of ZnO nanodisks and improved charge separation efficiency due to optimal Co doping which inhibit recombination of photogenerated charge carriers. The possible mechanism for the enhanced photocatalytic activity of Co doped ZnO nanostructures is tentatively proposed.

  16. Drug Transporter Expression and Activity in Human Hepatoma HuH-7 Cells

    Directory of Open Access Journals (Sweden)

    Elodie Jouan

    2016-12-01

    Full Text Available Human hepatoma cells may represent a valuable alternative to the use of human hepatocytes for studying hepatic drug transporters, which is now a regulatory issue during drug development. In the present work, we have characterized hepatic drug transporter expression, activity and regulation in human hepatoma HuH-7 cells, in order to determine the potential relevance of these cells for drug transport assays. HuH-7 cells displayed notable multidrug resistance-associated protein (MRP activity, presumed to reflect expression of various hepatic MRPs, including MRP2. By contrast, they failed to display functional activities of the uptake transporters sodium taurocholate co-transporting polypeptide (NTCP, organic anion-transporting polypeptides (OATPs and organic cation transporter 1 (OCT1, and of the canalicular transporters P-glycoprotein and breast cancer resistance protein (BCRP. Concomitantly, mRNA expressions of various sinusoidal and canalicular hepatic drug transporters were not detected (NTCP, OATP1B1, organic anion transporter 2 (OAT2, OCT1 and bile salt export pump or were found to be lower (OATP1B3, OATP2B1, multidrug and toxin extrusion protein 1, BCRP and MRP3 in hepatoma HuH-7 cells than those found in human hepatocytes, whereas other transporters such as OAT7, MRP4 and MRP5 were up-regulated. HuH-7 cells additionally exhibited farnesoid X receptor (FXR- and nuclear factor erythroid 2-related factor 2 (Nrf2-related up-regulation of some transporters. Such data indicate that HuH-7 cells, although expressing rather poorly some main hepatic drug transporters, may be useful for investigating interactions of drugs with MRPs, notably MRP2, and for studying FXR- or Nrf2-mediated gene regulation.

  17. Sparks sädeleb Rabarocki öös. Ettevaatust! Eliidi rünnak. Hu? Hu da hell?

    Index Scriptorium Estoniae

    2007-01-01

    Ameerika ansamblist Sparks. Vaiko Eplik & Eliit heliplaatidest "1: Aastaajad", "2: Aastaajad" ja "3: Kosmoseodüsseia", esinemisest festivalil Rabarock. Hannaliisa Uusma, Leslie Da Bassi ja DJ Criticali projektist HU?, singlitest "Kosmos" ja "Absoluutselt" (Rabarockil esitusel materjal HU? debüütalbumilt "Film")

  18. Sparks sädeleb Rabarocki öös. Ettevaatust! Eliidi rünnak. Hu? Hu da hell?

    Index Scriptorium Estoniae

    2007-01-01

    Ameerika ansamblist Sparks. Vaiko Eplik & Eliit heliplaatidest "1: Aastaajad", "2: Aastaajad" ja "3: Kosmoseodüsseia", esinemisest festivalil Rabarock. Hannaliisa Uusma, Leslie Da Bassi ja DJ Criticali projektist HU?, singlitest "Kosmos" ja "Absoluutselt" (Rabarockil esitusel materjal HU? debüütalbumilt "Film")

  19. [Measurements of CO2 Concentration Profile in Troposphere Based on Balloon-Borne TDLAS System].

    Science.gov (United States)

    Yao, Lu; Liu, Wen-qing; Liu, Jian-guo; Kan, Rui-feng; Xu, Zhen-yu; Ruan, Jun; Yuan, Song

    2015-10-01

    The main source and sink of CO2 in the atmosphere are concentrated in the troposphere. It is of great significance to the study of CO2 flux and global climate change to obtain the accurate tropospheric CO2 concentration profile. For the characteristics of high resolution, high sensitivity and fast response of tunable diode laser absorption spectroscopy (TDLAS), a compact balloon-borne system based on direct absorption was developed to detect the CO2 concentration profiles by use of the 2 004. 02 nm, R(16), v1+v3 line without the interfere of H2O absorption and the CO2 density of the number of molecules below 10 km in the troposphere was obtained. Due to the balloon-borne environment, a compact design of one single board integrated with laser driver, signal conditioning, spectra acquiring and concentration retrieving was developed. Limited by the working capability and hardware resources of embedded micro-processor, the spectra processing algorithm was optimized to reduce the time-cost. Compared with the traditional TDLAS sensors with WMS technique, this system was designed based on the direct absorption technique by means of an open-path Herriott cell with 20 m optical-path, which avoided the process of standardization and enhanced the environmental adaptation. The universal design of hardware and software platform achieved diverse gas measuring by changing the laser and adjusting some key parameters in algorithm. The concept of compact design helped to reduce the system's power and volume and balanced the response speed and measure precision. The power consumes below 1.5 W in room temperature and the volume of the single board is 120 mm x 100 mm x 25 mm, and the measurement accuracy is ± 0.6 x 10(-6) at 1.5 s response time. It has been proved that the system can realize high precision detection of CO2 profile at 15 m vertical resolution in troposphere and TDLAS is an available method for balloon-borne detection.

  20. SUPPORT FOR HU CFRT SUMMER HIGH SCHOOL FUSION WORKSHOP

    Energy Technology Data Exchange (ETDEWEB)

    Punjabi, Alkesh

    2010-02-09

    researchers in the HU CFRT mentor the students during summers. Mentors spend a considerable amount of time and efforts in training, teaching, guiding and supervising research projects. The HU CFRT has so far conducted nine workshops during the summers of 1996-2000 and 2002-2005. The first workshop was conducted in summer 1996. Students for the workshop are chosen from a national pool of exceptionally talented high school rising seniors/juniors. To our knowledge, most of these students have gone on to prestigious universities such as Duke University, John Hopkins University, CalTech, UCLA, Hampton University, etc. after completing their high school. For instance, Tiffany Fisher, participant of the 1996 summer workshop completed her BS in Mathematics at Hampton University in May 2001. She then went on to Wake Forest University at Winston-Salem, North Carolina to pursue graduate studies. Anshul Haldipur, participant of the 1999 summer workshop, began his undergraduate studies at Duke University in 2000. Christina Nguyen and Ilissa Martinez, participants of the 2000 summer workshop, are pursuing their undergraduate degrees at the UCLA and Florida State University respectively. The organizing committee of the APS DPP annual meeting invited Dr. Punjabi to deliver an invited talk on training the next generation of fusion scientists and engineers at the 2005 APS DPP meeting in Denver, CO. The organizing committee distributed a special flier with the Bulletin to highlight this invited talk and another talk on education as well the expo. This has given wide publicity and recognition to our workshops and Hampton University. Prof. Punjabi's talk: 'LI2 2: Training the next generation of fusion scientists and engineers: summer high school fusion science workshop, Bull. Amer. Phys. Soc. 50, 221 (2005)' was very well-received. He talked about HU education and outreach initiative and the HU CFRT Summer High School Workshop. The audience had a considerable number of questions

  1. The CoLaPipe--the new Cottbus large pipe test facility at Brandenburg University of Technology Cottbus-Senftenberg.

    Science.gov (United States)

    König, Franziska; Zanoun, El-Sayed; Öngüner, Emir; Egbers, Christoph

    2014-07-01

    The CoLaPipe is a novel test facility at the Department of Aerodynamics and Fluid Mechanics, Brandenburg University of Technology Cottbus-Senftenberg (BTU Cottbus-Senftenberg), set up to investigate fully developed pipe flow at high Reynolds numbers (Re(m) ⩽ 1.5 × 10(6)). The design of the CoLaPipe is closed-return with two available test sections providing a length-to-diameter ratio of L/D = 148 and L/D = 79. Within this work, we introduce the CoLaPipe and describe the various components in detail, i.e., the settling chamber, the inlet contraction, the blower, bends, and diffusers as well as the cooling system. A special feature is the numerically optimized contraction design. The applications of different measuring techniques such as hot-wire anemometry and static pressure measurements to quantitatively evaluate the mean flow characteristics and turbulence statistics are discussed as well. In addition, capabilities and limitations of available and new pipe flow facilities are presented and reconsidered based on their length-to-diameter ratio, the achieved Reynolds numbers, and the resulting spatial resolution. Here, the focus is on the facility design, the presentation of some basic characteristics, and its contribution to a reviewed list of specific questions still arising, e.g., scaling and structural behavior of turbulent pipe flow as well as the influence of the development length on turbulence investigations.

  2. A power ramped pulsed mode laser piercing technique for improved CO 2 laser profile cutting

    Science.gov (United States)

    Tirumala Rao, B.; Ittoop, M. O.; Kukreja, L. M.

    2009-11-01

    Laser piercing is one of the inevitable requirements of laser profile cutting process and it has a direct bearing on the quality of the laser cut profiles. We have developed a novel power ramped pulsed mode (PRPM) laser piercing technique to produce much finer pierced holes and to achieve a better control on the process parameters compared to the existing methodology based on normal pulsed mode (NPM). Experiments were carried out with both PRPM and NPM laser piercing on 1.5-mm-thick mild steel using an in-house developed high-power transverse flow continuous wave (CW)-CO 2 laser. Significant improvements in the spatter, circularity of the pierced hole and reproducibility were achieved through the PRPM technique. We studied, in detail, the dynamics of processes involved in PRPM laser piercing and compared that with those of the NPM piercing.

  3. MRS/IS facility co-located with a repository: preconceptual design and life-cycle cost estimates

    Energy Technology Data Exchange (ETDEWEB)

    Smith, R.I.; Nesbitt, J.F.

    1982-11-01

    A program is described to examine the various alternatives for monitored retrievable storage (MRS) and interim storage (IS) of spent nuclear fuel, solidified high-level waste (HLW), and transuranic (TRU) waste until appropriate geologic repository/repositories are available. The objectives of this study are: (1) to develop a preconceptual design for an MRS/IS facility that would become the principal surface facility for a deep geologic repository when the repository is opened, (2) to examine various issues such as transportation of wastes, licensing of the facility, and environmental concerns associated with operation of such a facility, and (3) to estimate the life cycle costs of the facility when operated in response to a set of scenarios which define the quantities and types of waste requiring storage in specific time periods, which generally span the years from 1990 until 2016. The life cycle costs estimated in this study include: the capital expenditures for structures, casks and/or drywells, storage areas and pads, and transfer equipment; the cost of staff labor, supplies, and services; and the incremental cost of transporting the waste materials from the site of origin to the MRS/IS facility. Three scenarios are examined to develop estimates of life cycle costs of the MRS/IS facility. In the first scenario, HLW canisters are stored, starting in 1990, until the co-located repository is opened in the year 1998. Additional reprocessing plants and repositories are placed in service at various intervals. In the second scenario, spent fuel is stored, starting in 1990, because the reprocessing plants are delayed in starting operations by 10 years, but no HLW is stored because the repositories open on schedule. In the third scenario, HLW is stored, starting in 1990, because the repositories are delayed 10 years, but the reprocessing plants open on schedule.

  4. Analysis of behaviour of transonic profiles with strong curvature: Test facilities, instrumentation, test results, theoretical interpretations

    Energy Technology Data Exchange (ETDEWEB)

    Pittaluga, G.; Benvenuto, G. (Udine Univ. (Italy); L' Aquila Univ. (Italy))

    1988-06-01

    Relevant to experimental investigations on the performance of a transonic turbine blade cascade, this paper discusses recent developments regarding the following topics: the experimental equipment and relative instrumentation; the results of tests on turbine blade cascades; the conceptual methods specifically developed and aimed at the optimized design of steam turbines systems and turbine blades; the theoretical-numerical procedures developed and applied as supports for theoretical-experimental analyses and the redesign of blade profiles to increase efficiency.

  5. Study of Excipients Affecting Dissolution Profile of Drug with Special Emphasis on Co Processed Excipients

    Directory of Open Access Journals (Sweden)

    Parmar K

    2013-06-01

    Full Text Available The main aim of present work is to study the impact of various excipients and co-processed excipientson dissolution rate. Direct compression is the preferred method for the preparation of tablets. Coprocessing is the one of the most widely explored and commercially utilized method for the preparationof directly compressible vehicle. The objective of present study is to prepare and characterize various coprocessed excipients and its application in tablet formulation. Co-processed excipient prepared wascharacterized by flow properties, solubility, Hardness, Friability, % drug content in tablet formulation.FTIR and SEM show no physical interaction between them with no chemical change. Co processing ofexcipients was evaluated for Drug release, mean dissolution time and dissolution efficiency Sucrose:MCC (2:1 used to extend the drug release up to 6 hr, we can prepare sustain release tablet of this COprocessing by incorporation of sustain release polymer. MCC: Kyron was used to prepare immediatedrug release. So based on these properties we was prepared immediate release formulation and sustainrelease formulation. Co-processing of Sucrose: MCC have been used to achieve sustain release byincorporation of pectin, by using this combination we can achieve sustain release up to 10 hr similarlyKyron: MCC was used in immediate release formulation. Comparison with both IR and SR marketedproduct and evaluated for F2 test shows there is similarity in dissolution profile between both thebatches.

  6. Testing the planetary models of HU Aquarii

    CERN Document Server

    Bours, M; Breedt, E; Copperwheat, C; Dhillon, V; Leckngam, A; Littlefair, S; Parsons, S; Prasit, A

    2014-01-01

    We present new eclipse observations of the polar (i.e. semi-detached magnetic white dwarf + M-dwarf binary) HU Aqr, and mid-egress times for each eclipse, which continue to be observed increasingly early. Recent eclipses occurred more than 70 seconds earlier than the prediction from the latest model that invoked a single circumbinary planet to explain the observed orbital period variations, thereby conclusively proving this model to be incorrect. Using ULTRACAM data, we show that mid-egress times determined for simultaneous data taken at different wavelengths agree with each other. The large variations in the observed eclipse times cannot be explained by planetary models containing up to three planets, because of poor fits to the data as well as orbital instability on short time scales. The peak-to-peak amplitude of the O-C diagram of almost 140 seconds is also too great to be caused by Applegate's mechanism, movement of the accretion spot on the surface of the white dwarf, or by asynchronous rotation of the ...

  7. Application of vertical advection-diffusion model for studying CO2 and O2 profiles in central Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    AnilKumar, N.; Singbal, S.Y.S.

    The vertical advection-diffusion model proposed by Craig has been applied to the study of CO sub(2) and O sub(2) profiles in Central Arabian Sea. Distributions of total CO Sub(2) and O sub(2) are explained better by expressions involving exponential...

  8. Experimental determination of noble gas, SF6 and CO2 flow profiles through a porous sandstone

    Science.gov (United States)

    Kilgallon, Rachel; Gilfillan, Stuart; Edlmann, Katriona; McDermott, Chris

    2016-04-01

    The noble gases (He, Ne, Ar, Kr and Xe) and SF6 have recently been used as artificial and inherent tracers of CO2 flow and migration from within[1,2] and from geological reservoirs[3]. However, outstanding questions remain, particularly regarding the flow behaviour of the noble gases compared to CO2. Here we present results from specially constructed experimental equipment, which has been used to determine the factors affecting transport of noble gases relative to CO2 in a porous sandstone. The experimental setup consists of a sample loop that can be loaded with a desired gas mixture. This sample can be released as a pulse into a feeder gas stream through a flow cell. The flow cell consists of a 3.6 cm diameter core, which can be of any length. The sample is surrounded by aluminium foil and treated with epoxy resin inside stainless steel tubing. The flow cell is encased by two purpose designed dispersion end plates. Real-time analysis of the arrival peaks of the gases downstream is recorded using a Quadrupole Mass Spectrometer (QMS). For the experiments, a 0.96 m core of Fell Sandstone was selected to represent a porous media. Noble gases and SF6 pulses were flowed through a CO2 carrier gas at five different pressure gradients (10 - 50 kPa) with arrival profiles measured using the QMS. Surprisingly, peak arrival times of He were slower than the other noble gases at each pressure gradient. The differences in peak arrival times between He and other noble gases increased as pressure decreased and the curve profiles for each noble gas differ significantly. The heavier noble gases (Kr and Xe) along with SF6 show a steeper peak rise at initial appearance, but have a longer duration profile than the He curves. Interestingly, the breakthrough curve profiles for both Kr and Xe were similar to SF6 indicating that Kr and Xe could be substituted for SF6, which is a potent greenhouse gas, in tracing applications. In addition, CO2 pulses were passed through a N2 carrier gas. The

  9. Shortage of CO{sub 2} storage facilities for biomass CCS; Knappe CO{sub 2}-Speicherstaetten fuer Biomasse-CCS

    Energy Technology Data Exchange (ETDEWEB)

    Hartmann, Claus [Flensburg Univ. (Germany); Stadtwerke Flensburg GmbH, Flensburg (Germany); Hohmeyer, Olav [Flensburg Univ. (Germany)

    2010-01-15

    Carbon Capture and Storage (CCS) poses an option for the continued combustion of fossil fuels which would permit a coal-based energy supply with reduced net CO{sub 2} emissions starting in the time between 2020 and 2030. However, there will foreseeably be a competition for storage facilities between carbon from coal and carbon removed from the atmosphere through biomass CCS. An expansion in the use of coal in conjunction with CCS would exhaust between 58% to (theoretically) 122% of Germany's reservoir capacities by the year 2100, so that these could no longer be used for the removal of carbon from the atmosphere through biomass CCS. The plan of reducing coal production as envisaged by the German Environment Ministry in its Lead Study must be rigorously pursued to ensure that sufficient storage facilities are available for biomass CSS from 2070 on.

  10. CB2 cannabinoid receptor agonist enantiomers HU-433 and HU-308: An inverse relationship between binding affinity and biological potency.

    Science.gov (United States)

    Smoum, Reem; Baraghithy, Saja; Chourasia, Mukesh; Breuer, Aviva; Mussai, Naama; Attar-Namdar, Malka; Kogan, Natalya M; Raphael, Bitya; Bolognini, Daniele; Cascio, Maria G; Marini, Pietro; Pertwee, Roger G; Shurki, Avital; Mechoulam, Raphael; Bab, Itai

    2015-07-14

    Activation of the CB2 receptor is apparently an endogenous protective mechanism. Thus, it restrains inflammation and protects the skeleton against age-related bone loss. However, the endogenous cannabinoids, as well as Δ(9)-tetrahydrocannabinol, the main plant psychoactive constituent, activate both cannabinoid receptors, CB1 and CB2. HU-308 was among the first synthetic, selective CB2 agonists. HU-308 is antiosteoporotic and antiinflammatory. Here we show that the HU-308 enantiomer, designated HU-433, is 3-4 orders of magnitude more potent in osteoblast proliferation and osteoclast differentiation culture systems, as well as in mouse models, for the rescue of ovariectomy-induced bone loss and ear inflammation. HU-433 retains the HU-308 specificity for CB2, as shown by its failure to bind to the CB1 cannabinoid receptor, and has no activity in CB2-deficient cells and animals. Surprisingly, the CB2 binding affinity of HU-433 in terms of [(3)H]CP55,940 displacement and its effect on [(35)S]GTPγS accumulation is substantially lower compared with HU-308. A molecular-modeling analysis suggests that HU-433 and -308 have two different binding conformations within CB2, with one of them possibly responsible for the affinity difference, involving [(35)S]GTPγS and cAMP synthesis. Hence, different ligands may have different orientations relative to the same binding site. This situation questions the usefulness of universal radioligands for comparative binding studies. Moreover, orientation-targeted ligands have promising potential for the pharmacological activation of distinct processes.

  11. Silicon detectors for the neutron flux and beam profile measurements of the n_TOF facility at CERN

    Science.gov (United States)

    Musumarra, Agatino; Cosentino, Luigi; Barbagallo, Massimo; Colonna, Nicola; Damone, Lucia; Pappalardo, Alfio; Piscopo, Massimo; Finocchiaro, Paolo

    2016-09-01

    The demand of new and high precision cross section data for neutron-induced reactions is continuously growing, driven by the requirements from several fields of fundamental physics, as well as from nuclear technology, medicine, etc. Several neutron facilities are operational worldwide, and new ones are being built. In the coming years, neutron beam intensities never reached up to now will be available, thus opening new scientific and technological frontiers. Among existing facilities, n_TOF at CERN provides a high intensity pulsed neutron beam in a wide energy range (thermal to GeV) and with an extremely competitive energy resolution that also allows spectroscopy studies. In order to ensure high quality measurements, the neutron beams must be fully characterized as a function of the neutron energy, in particular by measuring the neutron flux and the beam transverse profile with high accuracy. In 2014 a new experimental area (EAR2), with a much higher neutron flux, has been completed and commissioned at n_TOF. In order to characterize the neutron beam in the newly built experimental area at n_TOF, two suitable diagnostics devices have been built by the INFN-LNS group. Both are based on silicon detectors coupled with 6Li converter foils, in particular Single Pad for the flux measurement and Position Sensitive (strips and others) for the beam profile. The devices have been completely characterized with radioactive sources and with the n_TOF neutron beam, fulfilling all the specifications and hence becoming immediately operational. The performances of these devices and their high versatility, in terms of neutron beam intensity, make them suitable to be used in both n_TOF experimental areas. A description of the devices and the main results obtained so far will be presented.

  12. On the HU Aquarii planetary system hypothesis

    Science.gov (United States)

    Goździewski, Krzysztof; Nasiroglu, Ilham; Słowikowska, Aga; Beuermann, Klaus; Kanbach, Gottfried; Gauza, Bartosz; Maciejewski, Andrzej J.; Schwarz, Robert; Schwope, Axel D.; Hinse, Tobias C.; Haghighipour, Nader; Burwitz, Vadim; Słonina, Mariusz; Rau, Arne

    2012-09-01

    In this paper, we investigate the eclipse timing of the polar binary HU Aquarii that has been observed for almost two decades. Recently, Qian et al. attributed large (O-C) deviations between the eclipse ephemeris and observations to a compact system of two massive Jovian companions. We improve the Keplerian, kinematic model of the light travel time effect and re-analyse the whole currently available data set. We add almost 60 new, yet unpublished, mostly precision light curves obtained using the time high-resolution photopolarimeter Optical Timing Analyzer (OPTIMA), as well as photometric observations performed at the Monitoring Network of Telescopes/North, Physics Innovations Robotic Astronomical Telescope Explorer and Carlos Sánchez Telescope. We determine new mid-egress times with a mean uncertainty at the level of 1 s or better. We claim that because the observations that currently exist in the literature are non-homogeneous with respect to spectral windows (ultraviolet, X-ray, visual and polarimetric mode) and the reported mid-egress measurements errors, they may introduce systematics that affect orbital fits. Indeed, we find that the published data, when taken literally, cannot be explained by any unique solution. Many qualitatively different and best-fit two-planet configurations, including self-consistent, Newtonian N-body solutions may be able to explain the data. However, using high-resolution, precision OPTIMA light curves, we find that the (O-C) deviations are best explained by the presence of a single circumbinary companion orbiting at a distance of ˜4.5 au with a small eccentricity and having ˜7 Jupiter masses. This object could be the next circumbinary planet detected from the ground, similar to the announced companions around close binaries HW Vir, NN Ser, UZ For, DP Leo, FS Aur or SZ Her, and planets of this type around Kepler-16, Kepler-34 and Kepler-35.

  13. Modeling the convective stability of CO2 sequestration by a discontinuous and unstably stratified density profile

    Science.gov (United States)

    Wanstall, Taber; Hadji, Layachi

    2016-11-01

    The convective stability associated with carbon sequestration is modeled by adopting an unstably stratified basic profile having a step function density with top heavy carbon saturated layer overlying a lighter carbon free layer. The model takes into account the anisotropy in both permeability and carbon dioxide diffusion, and chemical reactions between the CO2 rich brine and host mineralogy. We carry out a linear stability analysis to derive the instability threshold parameters for a variety of CO2 boundary conditions. We solve for the minimum thickness of the carbon-rich layer at which convection sets in and quantify how its value is influenced by diffusion, anisotropy, permeability, reaction and type of boundary conditions. The discontinuity leads to convective concentration contours that have the shape of an asymmetric lens which we quantify by deriving and making use of the CO2 flux expressions at the interface. The linear problem is extended to the nonlinear regime, the analysis of which leads to the determination of a uniformly valid super critical steady solution.

  14. A facile synthesis of MPd (M = Co, Cu) nanoparticles and their catalysis for formic acid oxidation.

    Science.gov (United States)

    Mazumder, Vismadeb; Chi, Miaofang; Mankin, Max N; Liu, Yi; Metin, Önder; Sun, Daohua; More, Karren L; Sun, Shouheng

    2012-02-08

    Monodisperse CoPd nanoparticles (NPs) were synthesized and studied for catalytic formic acid (HCOOH) oxidation (FAO). The NPs were prepared by coreduction of Co(acac)(2) (acac = acetylacetonate) and PdBr(2) at 260 °C in oleylamine and trioctylphosphine, and their sizes (5-12 nm) and compositions (Co(10)Pd(90) to Co(60)Pd(40)) were controlled by heating ramp rate, metal salt concentration, or metal molar ratios. The 8 nm CoPd NPs were activated for HCOOH oxidation by a simple ethanol wash. In 0.1 M HClO(4) and 2 M HCOOH solution, their catalytic activities followed the trend of Co(50)Pd(50) > Co(60)Pd(40) > Co(10)Pd(90) > Pd. The Co(50)Pd(50) NPs had an oxidation peak at 0.4 V with a peak current density of 774 A/g(Pd). As a comparison, commercial Pd catalysts showed an oxidation peak at 0.75 V with peak current density of only 254 A/g(Pd). The synthesis procedure could also be extended to prepare CuPd NPs when Co(acac)(2) was replaced by Cu(ac)(2) (ac = acetate) in an otherwise identical condition. The CuPd NPs were less active catalysts than CoPd or even Pd for FAO in HClO(4) solution. The synthesis provides a general approach to Pd-based bimetallic NPs and will enable further investigation of Pd-based alloy NPs for electro-oxidation and other catalytic reactions. © 2012 American Chemical Society

  15. Conceptual design of a solar cogeneration facility at Pioneer Mill Co. , Ltd

    Energy Technology Data Exchange (ETDEWEB)

    1981-04-01

    Results are reported of a conceptual design study of the retrofit of a solar central receiver system to an existing cogeneration facility at a Hawaii raw sugar factory. Background information on the site, the existing facility, and the project organization is given. Then the results are presented o the work to select the site specific configuration, including the working fluid, receiver concept, heliostat field site, and the determination of the solar facility size and of the role of thermal storage. The system selected would use water-steam as its working fluid in a twin-cavity receiver collecting sunlight from 41,420 m/sup 2/ of heliostat mirrors. The lates version of the system specification is appended, as are descriptions of work to measure site insolation and a site insolation mathematical model and interface data for the local utility. (LEW)

  16. Anti-solar differential rotation on the active sub-giant HU Virginis

    CERN Document Server

    Harutyunyan, G; Künstler, A; Carroll, T A; Weber, M

    2016-01-01

    Measuring surface differential rotation (DR) on different types of stars is important when characterizing the underlying stellar dynamo. It has been suggested that anti-solar DR laws can occur when strong meridional flows exist. We aim to investigate the differential surface rotation on the primary star of the RS CVn binary HU Vir by tracking its starspot distribution as a function of time. We also aim to recompute and update the values for several system parameters of the triple system HU Vir (close and wide orbits). Time-series high-resolution spectroscopy for four continuous months was obtained with the 1.2-m robotic STELLA telescope. Nine consecutive Doppler images were reconstructed from these data, using our line-profile inversion code iMap. An image cross-correlation method was applied to derive the surface differential-rotation law for HU Vir. New orbital elements for the close and the wide orbits were computed using our new STELLA radial velocities (RVs) combined with the RV data available in the lit...

  17. Cannabinoids & Stress: impact of HU-210 on behavioral tests of anxiety in acutely stressed mice.

    Science.gov (United States)

    Kinden, Renee; Zhang, Xia

    2015-05-01

    Anxiety disorders are one of the most prevalent classes of mental disorders affecting the general population, but current treatment strategies are restricted by their limited efficacy and side effect profiles. Although the cannabinoid system is speculated to be a key player in the modulation of stress responses and emotionality, the vast majority of current research initiatives had not incorporated stress exposure into their experimental designs. This study was the first to investigate the impact of exogenous cannabinoid administration in an acutely stressed mouse model, where CD1 mice were pre-treated with HU-210, a potent CB1R agonist, prior to acute stress exposure and subsequent behavioral testing. Exogenous cannabinoid administration induced distinct behavioral phenotypes in stressed and unstressed mice. While low doses of HU-210 were anxiolytic in unstressed subjects, this effect was abolished when mice were exposed to an acute stressor. The administration of higher HU-210 doses in combination with acute stress exposure led to severe locomotor deficits that were not previously observed at the same dose in unstressed subjects. These findings suggest that exogenous cannabinoids and acute stress act synergistically in an anxiogenic manner. This study underlies the importance of including stress exposure into future anxiety-cannabinoid research due to the differential impact of cannabinoid administration on stressed and unstressed subjects.

  18. Facile synthesis of α-Fe{sub 2}O{sub 3} nanoparticles for high-performance CO gas sensor

    Energy Technology Data Exchange (ETDEWEB)

    Cuong, Nguyen Duc, E-mail: nguyenduccuong@hueuni.edu.vn [College of Sciences, Hue University, 77 Nguyen Hue, Phu Nhuan Ward, Hue City (Viet Nam); Faculty of Hospitality and Tourism, Hue University, 22 Lam Hoang, Vy Da Ward, Hue City (Viet Nam); Khieu, Dinh Quang; Hoa, Tran Thai [College of Sciences, Hue University, 77 Nguyen Hue, Phu Nhuan Ward, Hue City (Viet Nam); Quang, Duong Tuan [College of Education, Hue University, 34 Le Loi, Hue City (Viet Nam); Viet, Pham Hung [Centre for Environmental Technology and Sustainable Development (CETASD), Hanoi University of Science, 334 Nguyen Trai, Hanoi (Viet Nam); Lam, Tran Dai [Graduate University of Science and Technology, Vietnamese Academy of Science and Technology, Hanoi (Viet Nam); Hoa, Nguyen Duc [International Training Institute for Materials Science (ITIMS), Hanoi University of Science and Technology (HUST), No. 1, Dai Co Viet, Hanoi (Viet Nam); Hieu, Nguyen Van, E-mail: hieu@itims.edu.vn [International Training Institute for Materials Science (ITIMS), Hanoi University of Science and Technology (HUST), No. 1, Dai Co Viet, Hanoi (Viet Nam)

    2015-08-15

    Highlights: • We have demonstrated a facile method to prepare Fe{sub 2}O{sub 3} nanoparticles. • The gas sensing properties of α-Fe{sub 2}O{sub 3} have been invested. • The results show potential application of α-Fe{sub 2}O{sub 3} NPs for CO sensors in environmental monitoring. - Abstract: Iron oxide nanoparticles (NPs) were prepared via a simple hydrothermal method for high performance CO gas sensor. The synthesized α-Fe{sub 2}O{sub 3} NPs were characterized by X-ray diffraction, nitrogen adsorption/desorption isotherm, scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution transmission electron microscopy (HRTEM), and selected area electron diffraction (SAED). The SEM, TEM results revealed that obtained α-Fe{sub 2}O{sub 3} particles had a peanut-like geometry with hemispherical ends. The response of the α-Fe{sub 2}O{sub 3} NPs based sensor to carbon monoxide (CO) and various concentrations of other gases were measured at different temperatures. It found that the sensor based on the peanut-like α-Fe{sub 2}O{sub 3} NPs exhibited high response, fast response–recovery, and good selectivity to CO at 300 °C. The experimental results clearly demonstrated the potential application of α-Fe{sub 2}O{sub 3} NPs as a good sensing material in the fabrication of CO sensor.

  19. Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent

    Directory of Open Access Journals (Sweden)

    Rael Horwitz

    2014-09-01

    Full Text Available Ocean acidification (OA is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments—the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone’s tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data

  20. Development of balloon-borne CO2 sonde: CO2 vertical profile (0-10km) observations and comparison with the air craft measurements

    Science.gov (United States)

    Ouchi, M.; Matsumi, Y.; Nakayama, T.; Machida, T.; Matsueda, H.; Sawa, Y.; Tanaka, T.; Morino, I.; Uchino, O.

    2012-12-01

    The atmospheric CO2 concentration has drastically increased since the Industrial Revolution due to the mass consumption of fossil fuels and natural gas by human activities. CO2 is considered to be a major factor of global warming; therefore it is important to measure CO2 correctly. CO2 vertical profile measurement is the key to estimate CO2 sources and sinks in high precision. However, current CO2 monitoring sites are limited and there are few CO2 vertical profile measurements. We have been developing a balloon-borne instrument that can measure the vertical distribution of CO2 in any place in the world under any kind of weather conditions (CO2 sonde). The target specifications of altitude range is from surface to 10 km. Time resolution is 1min. The CO2 sensor, originally developed for upper air sounding by our team, is based on the non-dispersed infrared absorption spectroscopy technique (NDIR) at the wavelengths of 4.0 and 4.3 micrometer. The data of the optical infrared absorption are transmitted through a GPS sonde with temperature, humidity and GPS data every second. In this study, we will show simultaneous measurement campaigns of the balloon-borne instruments and in-situ aircraft measurements in January and February 2011 in the Tokyo metropolitan area in Japan. We will present the comparisons between the results of CO2 sonde (5 flights) and two types of aircraft measurements. One is observed by the CONTRAIL (Comprehensive Observation Network for TRace gases by AIrLiner) and the other is chartered flight measurements operated by NIES/JAXA.

  1. miR-29b, miR-205 and miR-221 enhance chemosensitivity to gemcitabine in HuH28 human cholangiocarcinoma cells.

    Directory of Open Access Journals (Sweden)

    Kinya Okamoto

    Full Text Available BACKGROUND AND AIMS: Cholangiocarcinoma (CCA is highly resistant to chemotherapy, including gemcitabine (Gem treatment. MicroRNAs (miRNAs are endogenous, non-coding, short RNAs that can regulate multiple genes expression. Some miRNAs play important roles in the chemosensitivity of tumors. Here, we examined the relationship between miRNA expression and the sensitivity of CCA cells to Gem. METHODS: Microarray analysis was used to determine the miRNA expression profiles of two CCA cell lines, HuH28 and HuCCT1. To determine the effect of candidate miRNAs on Gem sensitivity, expression of each candidate miRNA was modified via either transfection of a miRNA mimic or transfection of an anti-oligonucleotide. Ontology-based programs were used to identify potential target genes of candidate miRNAs that were confirmed to affect the Gem sensitivity of CCA cells. RESULTS: HuCCT1 cells were more sensitive to Gem than were HuH28 cells, and 18 miRNAs were differentially expressed whose ratios over ± 2log2 between HuH28 and HuCCT1. Among these 18 miRNAs, ectopic overexpression of each of three downregulated miRNAs in HuH28 (miR-29b, miR-205, miR-221 restored Gem sensitivity to HuH28. Suppression of one upregulated miRNA in HuH28, miR-125a-5p, inhibited HuH28 cell proliferation independently to Gem treatment. Selective siRNA-mediated downregulation of either of two software-predicted targets, PIK3R1 (target of miR-29b and miR-221 or MMP-2 (target of miR-29b, also conferred Gem sensitivity to HuH28. CONCLUSIONS: miRNA expression profiling was used to identify key miRNAs that regulate Gem sensitivity in CCA cells, and software that predicts miRNA targets was used to identify promising target genes for anti-tumor therapies.

  2. Gene co-expression networks and profiles reveal potential biomarkers of boar taint in pigs

    DEFF Research Database (Denmark)

    Drag, Markus; Skinkyté-Juskiené, Rúta; Do, Duy Ngoc;

    potential BT biomarkers for optimized breeding. Male pigs (n=48) with low, medium and high genetic merit of BT were selected and tissues from liver and testis were subjected to transcriptomic profiling by RNA-Seq. The reads were mapped to the Sus scrofa reference genome (Ensembl, ver. 79) which resulted...... synthesis. In testis, >80 DE genes were functionally classified by the PANTHER tool to “Gonadotropin releasing hormone receptor” and “Wnt signaling” pathways which play a role in reproductive maturation and proliferation of spermatogonia, respectively. WGCNA was used to build co-expression modules...... and enrichment analysis and semantic filtering revealed the GO terms “catalytic activity” and “transferase activity” to be overrepresented (p hormones. Extraction of hub...

  3. Facile synthesis of hybrid CNTs/NiCo2S4 composite for high performance supercapacitors.

    Science.gov (United States)

    Li, Delong; Gong, Youning; Pan, Chunxu

    2016-07-11

    In this work, a novel carbon nanotubes (CNTs)/NiCo2S4 composite for high performance supercapacitors was prepared via a simple chemical bath deposition combined with a post-anion exchange reaction. The morphologies and phase structures of the composites were characterized using scanning electron microscopy (SEM), X-ray diffraction (XRD), Raman spectroscopy (Raman), X-ray photoelectron spectroscopy (XPS) and low-temperature sorption of nitrogen (BET). The electro-chemical tests revealed that the CNT/NiCo2S4 composite exhibited high electrochemical performance, because the CNTs were used as a conductive network for the NiCo2S4 hexagonal nanoplates. Compared with pure NiCo2S4 and the mechanically mixed CNTs/NiCo2S4 composite, the CNTs/NiCo2S4 composite electrode material exhibited excellent supercapacitive performance, such as a high specific capacitance up to 1537 F/g (discharge current density of 1 A/g) and an outstanding rate capability of 78.1% retention as the discharge current density increased to 100 A/g. It is therefore expected to be a promising alternative material in the area of energy storage.

  4. Spinel CuCo2O4 Nanoparticles: Facile One-Step Synthesis, Optical, and Electrochemical properties

    Science.gov (United States)

    Silambarasan, M.; Padmanathan, N.; Ramesh, P. S.; Geetha, D.

    2016-09-01

    Nanocrystalline CuCo2O4 spinel structure was prepared by a facile one-step route without any surfactant. The materials physio-chemical properties were systematically investigated with different analytical methods. It is observed that the spinel type CuCo2O4 nanoparticles showed interesting multi-functional features for both optical and electrochemical applications.Typical x-ray diffraction pattern indicates the growth of well-crystalline CuCo2O4 nanoparticles with a cubic spinel structure. From the transmission electron microscope images, a uniform particle distribution with an average size of ˜20 nm can be seen. UV-visible spectrum shows the absorption maximum at 264.5 nm and exhibits an optical band gap 4.02 eV. Electrochemical analysis further reveals the pseudo-capacitive behaviour with the specific capacitance of 290 F g-1 at 2 mA cm-2. In addition, the magnetic study of CuCo2O4 substantiates the presence of room temperature weak ferromagnetic ordering at low magnetic field strength.

  5. MiR-291b-3p Induces Apoptosis in Liver Cell Line NCTC1469 by Reducing the Level of RNA-binding Protein HuR

    Directory of Open Access Journals (Sweden)

    Jun Guo

    2014-03-01

    Full Text Available Background: There is increasing evidence that miRNAs are involved in cellular apoptosis. However, the specific role of miR-291b-3p in apoptosis has not been elucidated. In the present study, we investigated the effect of miR-291b-3p on NCTC1469 cell growth and apoptosis. Methods: Cell viability and apoptosis were examined in NCTC1469 cells transfected with miR-291b-3p mimics, inhibitor miRNA or negative control. Using computational miRNA target prediction databases, HuR was predicted as a target of miR-291b-3p. Luciferase assay, immunofluorescence and western blot were used to further explore the effects of miR-291b-3p on HuR expression. In addition, the effect of HuR on cell apoptosis was evaluated using a HuR-specific siRNA. Results: TNF-α-induced hepatocyte apoptosis was accompanied by enhanced expression of miR-291b-3p, suggesting that miR-291b-3p might contribute to the apoptotic process. Follow-up experiments showed that upregulation of miR-291b-3p decreased cell viability and induced NCTC1469 cell apoptosis. Additionally, similar to the activity of miR-519, which is another member of the same miRNA family, miR-291b-3p suppressed HuR translation through binding to the HuR coding region (CR. We further showed that the downregulation of HuR expression by miR-291b-3p was accompanied by reduced Bcl-2 expression. Moreover, knockdown of HuR also impaired Bcl-2 expression and increased the ratio of Bax/Bcl-2. More significantly, downregulation of miR-291b-3p failed to increase Bcl2 expression in NCTC1469 cells that were co-transfected with siRNA-HuR. Finally, inhibition of miR-291b-3p led to reduced apoptosis, while knockdown of HuR by siRNA promoted apoptosis, even in NCTC1469 cells that were co-transfected with the miR-291b-3p inhibitor. Conclusion: The current data suggested that miR-291b-3p contributed to NCTC1469 cell apoptosis by regulating the expression of HuR, which in turn increased Bcl-2 stability.

  6. Facile method for modulating the profiles and periods of self-ordered three-dimensional alumina taper-nanopores.

    Science.gov (United States)

    Li, Juan; Li, Congshan; Chen, Cheng; Hao, Qingli; Wang, Zhijia; Zhu, Jie; Gao, Xuefeng

    2012-10-24

    We report a facile nanofabrication method, one-step hard anodizing and etching peeling (OS-HA-EP) of aluminum foils followed by multistep mild anodizing and etching pore-widening (MS-MA-EW), for the controllable tailoring of hexagonally packed three-dimensional alumina taper-nanopores. Their profiles can be precisely tailored by the synergistic control of anodizing time, etching time and cyclic times at the MS-MA-EW stage, exemplified by linear cones, whorl-embedded cones, funnels, pencils, parabolas, and trumpets. Meantime, their periods can also be modulated in the range of 70-370 nm by choosing matched anodizing electrolytes (e.g., H(2)C(2)O(4), H(2)SO(4), H(2)C(2)O(4)-H(2)SO(4), and H(2)C(2)O(4)-C(2)H(5)OH mixture) and anodizing voltages at the OS-HA-EP stage. We also demonstrated that the long-range ordering of nanopits and the peak voltage of stable self-ordered HA, which are unachievable in a single H(2)C(2)O(4) electrolyte system, can be effectively tuned by simply adding tiny quantity of H(2)SO(4) and C(2)H(5)OH to keep an appropriate HA current density, respectively. This method of using the combination of simple pure chemical nanofabrication technologies is very facile and efficient in realizing the controllable tailoring of large-area alumina membranes containing self-ordered taper-nanopores. Our work opens a door for exploring the novel physical and chemical properties of different materials of nanotaper arrays.

  7. Clinical Profile, Co-Morbidities and Health Related Quality of Life in Pediatric Patients with Allergic Rhinitis and Asthma

    OpenAIRE

    Keya R. Lahiri, Milind S. Tullu* and Rachna Kalra

    2010-01-01

    Background: Co-existence of allergic rhinitis (AR) and bronchial asthma (BA) is well known. We planned to study the clinical profile of patients with AR & BA, the associated co-morbidities and the effect of AR &/ or BA on health related quality of life (HRQOL) in Pediatric patients. Methods: Patients attending the Pediatric out-patients department and Pediatric Chest Clinic of tertiary care center were enrolled. The sample size included 100 subjects with BA & AR (Group 1) with control groups ...

  8. Potential Risk of Hybridization in Ex Situ Collections of Two Endangered Species of Sinojackia Hu (Styracaceae)

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Spontaneous hybridization in ex situ facilities can undermine the genetic integrity of ex situ collections and potentially contaminate open-pollinated seeds or seedlings destined for the reintroduction of endangered plant species into the wild. In the present study, the potential risk of hybridization between two endangered Chinese endemic species, namely Sinojackia xylocarpa Hu and S. rehderiana Hu, which are naturally allopatric species but were conserved ex situ in Wuhan Botanical Garden (WBG), Wuhan, China, were investigated over three consecutive years from 2003 to 2005. The entire overlapping flowering period of the two species was 14-20 d and the two species shared the same pollinator insects during the entire flowering season in WBG. The floral isolation between the two species was not an issue in the ex situ collection at WBG. The results suggest an opportunity for pollen transfer between species and a potential risk of genetic introgression and loss of genetic identity of open-pollinated seeds produced in the ex situ collection of these two endangered species. An artificial reciprocal cross between S. xylocarpa and S. rehderiana confirmed that the two congener species could readily set seeds, indicating no post-pollination barriers to hybridization and the importance of spatial isolation as a barrier to inter-specific crossing. Therefore, to manage these crossable species with overlapping flowering times and shared pollination vectors in ex situ facilities, spatial isolation should be carefully considered to minimize the possibility of spontaneous hybridization.

  9. A Facile Synthesis of Monodisperse Au Nanoparticles and Their Catalysis of CO Oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Dai, Sheng [ORNL; Peng, Sheng [Brown University; Lee, Youngmin [Brown University; Wang, Chao [Brown University; Yin, Hongfeng [ORNL; Sun, Shouheng [ORNL

    2008-01-01

    Monodisperse Au nanoparticles (NPs) have been synthesized at room temperature via a burst nucleation of Au upon injection of the reducing agent t-butylamine-borane complex into a 1, 2, 3, 4-tetrahydronaphthalene solution of HAuCl{sub 4} {center_dot} 3H{sub 2}O in the presence of oleylamine. The as-synthesized Au NPs show size-dependent surface plasmonic properties between 520 and 530 nm. They adopt an icosahedral shape and are polycrystalline with multiple-twinned structures. When deposited on a graphitized porous carbon support, the NPs are highly active for CO oxidation, showing 100% CO conversion at -45 C.

  10. Purchase of Microwave Reactors for Implementation of Small-scale Microwave-accelerated Organic Chemistry Laboratory Program in Undergraduate Curriculum and Synthetic Chemistry Research at HU

    Science.gov (United States)

    2015-05-16

    Microwave-accelerated Organic Chemistry Laboratory Program in Undergraduate Curriculum and Synthetic Chemistry Research at HU The views, opinions and/or...Research Triangle Park, NC 27709-2211 Microwave laboratory facility, Undergraduate organic chemistry laboratory, Implementation/Development of...Purchase of Microwave Reactors for Implementation of Small-scale Microwave-accelerated Organic Chemistry Laboratory Program in Undergraduate

  11. A facile hydrothermal synthesis, characterization and magnetic properties of mesoporous CoFe{sub 2}O{sub 4} nanospheres

    Energy Technology Data Exchange (ETDEWEB)

    Reddy, M. Penchal, E-mail: reddy@nimte.ac.cn [Center for Advanced Materials, Qatar University, Doha 2713 (Qatar); Mohamed, A.M.A. [Center for Advanced Materials, Qatar University, Doha 2713 (Qatar); Department of Metallurgical and Materials Engineering, Faculty of Petroleum and Mining Engineering, Suez University, Suez 4372 (Egypt); Zhou, X.B.; Du, S.; Huang, Q. [Ningbo Institute of Materials Technology and Engineering (NIMTE), Chinese Academy of Sciences (CAS), Ningbo 315201, Zhejiang, RP China (China)

    2015-08-15

    Mesoporous CoFe{sub 2}O{sub 4} nanospheres with an average size of 180 nm were fabricated via a facile hydrothermal process using ethylene glycol as solvent and sodium acetate (NaAc) as electrostatic stabilizer. In this method, ethylene glycol plays a vital role in the formation of cobalt nanoospheres as a solvent and reducing agent. The structure and morphology of the prepared materials were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution TEM (HRTEM), Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS). The nanospheres exhibited ferromagnetic properties with high saturation magnetization value of about 60.19 emu/g at room temperature. The BET surface area of the nanospheres was determined using the nitrogen absorption method. The porous CoFe{sub 2}O{sub 4} nanospheres displayed good magnetic properties, which may provide a very promising candidate for their applications in target drug delivery. - Highlights: • CoFe{sub 2}O{sub 4} nanospheres were prepared by hydrothermal synthesis for the first time. • Average grain size was found to be 180 nm. • Its structural, morphological, magnetic behavior was studied. • TEM observations confirmed the spherical morphology of the mesoporous ferrites.

  12. Relationship of SARS-CoV to other pathogenic RNA viruses explored by tetranucleotide usage profiling

    Directory of Open Access Journals (Sweden)

    Danchin Antoine

    2003-09-01

    Full Text Available Abstract Background The exact origin of the cause of the Severe Acute Respiratory Syndrome (SARS is still an open question. The genomic sequence relationship of SARS-CoV with 30 different single-stranded RNA (ssRNA viruses of various families was studied using two non-standard approaches. Both approaches began with the vectorial profiling of the tetra-nucleotide usage pattern V for each virus. In approach one, a distance measure of a vector V, based on correlation coefficient was devised to construct a relationship tree by the neighbor-joining algorithm. In approach two, a multivariate factor analysis was performed to derive the embedded tetra-nucleotide usage patterns. These patterns were subsequently used to classify the selected viruses. Results Both approaches yielded relationship outcomes that are consistent with the known virus classification. They also indicated that the genome of RNA viruses from the same family conform to a specific pattern of word usage. Based on the correlation of the overall tetra-nucleotide usage patterns, the Transmissible Gastroenteritis Virus (TGV and the Feline CoronaVirus (FCoV are closest to SARS-CoV. Surprisingly also, the RNA viruses that do not go through a DNA stage displayed a remarkable discrimination against the CpG and UpA di-nucleotide (z = -77.31, -52.48 respectively and selection for UpG and CpA (z = 65.79,49.99 respectively. Potential factors influencing these biases are discussed. Conclusion The study of genomic word usage is a powerful method to classify RNA viruses. The congruence of the relationship outcomes with the known classification indicates that there exist phylogenetic signals in the tetra-nucleotide usage patterns, that is most prominent in the replicase open reading frames.

  13. HuD interacts with Bdnf mRNA and is essential for activity-induced BDNF synthesis in dendrites.

    Directory of Open Access Journals (Sweden)

    Filip Vanevski

    Full Text Available Highly specific activity-dependent neuronal responses are necessary for modulating synapses to facilitate learning and memory. We present evidence linking a number of important processes involved in regulating synaptic plasticity, suggesting a mechanistic pathway whereby activity-dependent signaling, likely through protein kinase C (PKC-mediated phosphorylation of HuD, can relieve basal repression of Bdnf mRNA translation in dendrites, allowing for increased TrkB signaling and synaptic remodeling. We demonstrate that the neuronal ELAV family of RNA binding proteins associates in vivo with several Bdnf mRNA isoforms present in the adult brain in an activity-dependent manner, and that one member, HuD, interacts directly with sequences in the long Bdnf 3' untranslated region (3'UTR and co-localizes with Bdnf mRNA in dendrites of hippocampal neurons. Activation of PKC leads to increased dendritic translation of mRNAs containing the long Bdnf 3'UTR, a process that is dependent on the presence of HuD and its phosphorylation at threonine residues 149 and/or 165. Thus, we found a direct effect of HuD on regulating translation of dendritic Bdnf mRNAs to mediate local and activity-dependent increases in dendritic BDNF synthesis.

  14. Hu Shi's Study of Chinese Medieval intellectual History

    Institute of Scientific and Technical Information of China (English)

    Lou Yulie

    2006-01-01

    Hu Shi frequently gave lectures on the history of Chinese philosophy,especially the history of ancient Chinese philosophy,from the year 1919 to 1937.A large number of papers and dissertations published during this period are related to his research on this topic.In his opinion,there are three characteristics of the history of ancient Chinese philosophy:" religionalization of thought," "Indianization of philosophy," and "conflict between Chinese thought and Indian thought." In this paper,I explore Hu Shi's deep insight into the religionalization of Confucianism in Han dynasty and into the thought of Taoism in the medieval times.

  15. Microbial Indicator Profiling of Fresh Produce and Environmental Samples from Farms and Packing Facilities in Northern Mexico.

    Science.gov (United States)

    Heredia, Norma; Caballero, Cindy; Cárdenas, Carmen; Molina, Karina; García, Rafael; Solís, Luisa; Burrowes, Vanessa; Bartz, Faith E; de Aceituno, Anna Fabiszewski; Jaykus, Lee-Ann; García, Santos; Leon, Juan

    2016-07-01

    To compare microbiological indicator and pathogen contamination among different types of fresh produce and environmental samples along the production chain, 636 samples of produce (rinsates from cantaloupe melons, jalapeño peppers, and tomatoes) and environmental samples (rinsates from hands of workers, soil, and water) were collected at four successive steps in the production process (from the field before harvest through the packing facility) on 11 farms in northern Mexico during 2011 and 2012. Samples were assayed for enteric pathogens (Escherichia coli O157:H7, other Shiga toxigenic E. coli, Salmonella, and Listeria monocytogenes) and microbial indicators (coliforms, other E. coli strains, and Enterococcus spp.). Salmonella was the only pathogen detected; it was found in one preharvest jalapeño sample (detection limits: 0.0033 CFU/ml in produce and hand samples, 0.0013 CFU/ml in water, and 0.04 CFU/g in soil). Microbial indicator profiles for produce, worker hands, and soil from jalapeño and tomato farms were similar, but cantaloupe farm samples had higher indicator levels (P < 0.05 for all comparisons) on fruit (6.5, 2.8, and 7.2 log CFU per fruit) and hands (6.6, 3.1, and 7.1 log CFU per hand) for coliforms, E. coli, and Enterococcus, respectively, and lower E. coli levels in soil (<1 CFU/g). In water from tomato farms, E. coli indicators were significantly more prevalent (70 to 89% of samples were positive; P = 0.01 to 0.02), and geometric mean levels were higher (0.3 to 0.6 log CFU/100 ml) than those in cantaloupe farm water (32 to 38% of samples were positive, geometric mean <1 CFU/100 ml). Microbial indicators were present during all production steps, but prevalence and levels were generally highest at the final on-farm production step (the packing facility) (P < 0.03 for significant comparisons). The finding that microbial contamination on produce farms is influenced by produce type and production step can inform the design of effective approaches to

  16. Facile synthesis of Co{sub 3}O{sub 4} hierarchical microspheres with improved lithium storage performances

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Xiaojuan, E-mail: houxiaojuan@nuc.edu.cn; He, Jian; An, Kun; Mu, Jiliang; Chou, Xiujian; Xue, Chenyang

    2016-10-15

    Highlights: • The Co{sub 3}O{sub 4} microspheres were first fabricated without any surfactant. • The Co{sub 3}O{sub 4} microspheres present excellent electrochemical performances. • The excellent performances result from porous nanosheets assembled architectures. • The microspheres exhibit a high specific capacity of 1000 mA h g at 100 mA g. - Abstract: Porous nanosheets-assembled Co{sub 3}O{sub 4} microspheres have been first successfully fabricated by a facile solvothermal method without any surfactant followed by a relatively low annealing temperature (400 °C) with a higher specific surface area compared to the annealing temperature of 600 °C. The nanosheets-assembled microspheres exhibit a high discharge capacity of 1000 mA h g{sup −1} at a current density of 100 mA g{sup −1} after 50 cycles and 850 mA h g{sup −1} at a current density of 500 mA g{sup −1} after 80 cycles, even at a high current density of 1.6 A g{sup −1} the cycling reversible capacity can still keep 750 mA h g{sup −1}, the representative capacities are relatively higher than most of reports about pure Co{sub 3}O{sub 4}. We attribute the excellent electrochemical performances to the porous nanosheets structure and architectures, which can provide more effective electrode/electrolyte contact area and direct ion transmission path, then lead to faster lithium-ion diffusion, confirmed by EIS measurements. The high specific capacity, excellent cycling and rate performances demonstrate that the porous nanosheets assembled microspheres present promising application in lithium storage.

  17. Treatment of β-Thalassemia With Hydroxyurea (HU)——Effects of HU on Globin Gene Expression

    Institute of Scientific and Technical Information of China (English)

    黄淑帧; 任兆瑞; 陈美珏; 许洪平; 曾溢滔; G.P.Rodgers; 曾凡一; A.N.Schechter

    1994-01-01

    A newly developed method of RT-PCR/competitive PCR for measuring the relative and ab-solute content of globin mRNAs as well as micro-globin chain biosynthetic assay have been used to study thealterations of globin gene expressions in the patients with β-thalassemia pre-and post-hydroxyurea(HU)treatment.It was found for the first time that HU had the effect of enhancing β-globin gene expression insome patients.Two cases with β-thalassemia who were subjected to HU treatment for over two years showeda marked increase in β-globin mRNA level and β-globin chain synthesis,resulting in more effective erythro-poiesis and the alleviation of clinical symptoms.

  18. A Parametric Analysis of CO2 Laser Heat Absorption Profile of 5083 Aluminum Alloy

    Directory of Open Access Journals (Sweden)

    JOSEPH .I. ACHEBO

    2010-06-01

    Full Text Available Aluminum alloys are amongst the most difficult everyday metals that can be welded using the laser welding process. For this reason, high power density lasers are needed to weld these alloys because they require higher thermal diffusivity to form a key hole than would be needed for other metals such as steel. This means that more heat wouldhave to be applied while welding aluminum alloys than would be needed to weld steel to achieve a satisfactory coupling effect. The heat input generated from laser welding is affected by the absorptivity coefficient, the welding speed and the time spent. Once the optimum heat input is attained, it is expected to create less heat distortion, its energy is more concentrated within the weld area and deep weld penetration is achieved. Determining optimum values of welding parameters would lead to acceptable weld quality. In this study, the heat absorption profile of a CO2 laser welding of 5083 aluminum alloy was investigated using the models proposed by Bramson in 1968 and Okon et al in 2002. The 4mm thick aluminum alloy investigated was as received from the vendors. The calculated laser beam absorptivity coefficient, irradiance and boiling temperature were 0.12, 2.3 x 106 Wcm-2 and 2482oC respectively. These calculated values compared well with reported values in other literature.

  19. A facile route to monodisperse MPd (M = Co or Cu) alloy nanoparticles and their catalysis for electrooxidation of formic acid

    Science.gov (United States)

    Ho, Sally Fae; Mendoza-Garcia, Adriana; Guo, Shaojun; He, Kai; Su, Dong; Liu, Sheng; Metin, Önder; Sun, Shouheng

    2014-05-01

    MPd (M = Co, or Cu) nanoparticles (NPs) were synthesized by borane-amine reduction of metal acetylacetonates. The size of the MPd NPs was controlled at 3.5 nm and their compositions were tuned by the molar ratios of the metal precursors. These MPd NPs were active catalysts for electrochemical oxidation of formic acid and the Cu30Pd70 NPs showed the highest mass activity at 1192.9 A gPd-1, much higher than 552.6 A gPd-1 obtained from the 3.5 nm Pd NPs. Our synthesis provides a facile route to MPd NPs, allowing further investigation of MPd NP catalysts for electrochemical oxidation and many other chemical reactions.MPd (M = Co, or Cu) nanoparticles (NPs) were synthesized by borane-amine reduction of metal acetylacetonates. The size of the MPd NPs was controlled at 3.5 nm and their compositions were tuned by the molar ratios of the metal precursors. These MPd NPs were active catalysts for electrochemical oxidation of formic acid and the Cu30Pd70 NPs showed the highest mass activity at 1192.9 A gPd-1, much higher than 552.6 A gPd-1 obtained from the 3.5 nm Pd NPs. Our synthesis provides a facile route to MPd NPs, allowing further investigation of MPd NP catalysts for electrochemical oxidation and many other chemical reactions. Electronic supplementary information (ESI) available: Detailed synthetic and electrochemical analysis procedures, and XRD of the NPs. See DOI: 10.1039/c4nr01107d

  20. Direct Detection 1.6?m DIAL / Doppler Lidar for Measurements of CO2 Concentration and Wind Profiles (Invited)

    Science.gov (United States)

    Shibata, Y.; Nagasawa, C.; Abo, M.

    2013-12-01

    Knowledge of present carbon sources and sinks including their spatial distribution and their variation in time is one of the essential information for predicting future CO2 atmospheric concentration levels. Moreover, wind information is an important parameter for transport simulations and inverse estimation of surface CO2 flux. The differential absorption lidar (DIAL) and the Doppler wind lidar with the range resolution is expected to measure atmospheric CO2 profiles and wind profiles in the atmospheric boundary layer and lower troposphere from a ground platform. We have succeeded to develop a scanning 1.6 μm DIAL and incoherent Doppler lidar system for simultaneously measuring CO2 concentration and wind speed profiles. Our 1.6 μm DIAL system consists of the Optical Parametric Generator (OPG) transmitter that excited by the LD pumped Nd: YAG laser with high repetition rate (500 Hz) and the receiving optics that included the near-infrared photomultiplier tube with high quantum efficiency operating at the photon counting mode, a fiber Bragg grating (FBG) filter to detect a Doppler shift, and a 25 cm telescope [1] [2]. We had developed an optical parametric oscillator (OPO) system for 1.6 μm CO2 DIAL[3]. To achieve continuous tuning of the resonant OPO output without mode hopping, it is necessary to vary the OPO cavity length synchronously with the seed-frequency. On the other hand, the OPG does not require a cavity and instead rely on sufficient conversion efficiency to be obtained with a single pass through the crystal. The single-frequency oscillation of the OPG was achieved by injection seeding. The CO2-DIAL was operated with the range-height indicator (RHI) mode, and the 2-D measurement provided inhomogeneity in the boundary layer. Vertical CO2 concentration profiles and wind profiles were also measured simultaneously. The elevation angle was fixed at 52 deg and CO2 concentration profiles were obtained up to 1 km altitude with 200 m height resolution. Vertical

  1. A facile synthesis of poly(3-octylthiophene)-titanium dioxide nanocomposite particles in supercritical CO2.

    Science.gov (United States)

    Yuvaraj, Haldorai; Woo, Min Hee; Park, Eun Ju; Gal, Yeong-Soon; Lim, Kwon Taek

    2008-09-01

    Poly(3-octylthiophene) (P3OT)-titanium dioxide (TiO2) nanocomposite powder where TiO2 was embedded with homogeneous dispersion was synthesized by in-situ chemical oxidative polymerization of 3-octylthiophene in the presence of TiO2 nanoparticles in supercritical carbon dioxide (scCO2), using ferric chloride as the oxidant. The synthesized materials could be obtained as dry powder upon venting of CO2 after the polymerization. The composites were subsequently characterized by FT-IR spectroscopy, transmission electron microscopy (TEM), X-ray diffraction studies (XRD), thermogravimetric analysis (TGA) and photoluminescence (PL). The incorporation of TiO2 in the composite was endorsed by FT-IR studies. TGA revealed enhanced thermal stability of P3OT/TiO2 nanocomposite compared to 3-octylthiophene. TEM analysis showed that well dispersed TiO2 nanoparticles in the polymer matrix. Photoluminescence quenching increased with increasing TiO2 concentration in the composite.

  2. HU-444, a Novel, Potent Anti-Inflammatory, Nonpsychotropic Cannabinoid.

    Science.gov (United States)

    Haj, Christeene G; Sumariwalla, Percy F; Hanuš, Lumír; Kogan, Natalya M; Yektin, Zhana; Mechoulam, Raphael; Feldmann, Mark; Gallily, Ruth

    2015-10-01

    Cannabidiol (CBD) is a component of cannabis, which does not cause the typical marijuana-type effects, but has a high potential for use in several therapeutic areas. In contrast to Δ(9)-tetrahydrocannabinol (Δ(9)-THC), it binds very weakly to the CB1 and CB2 cannabinoid receptors. It has potent activity in both in vitro and in vivo anti-inflammatory assays. Thus, it lowers the formation of tumor necrosis factor (TNF)-α, a proinflammatory cytokine, and was found to be an oral antiarthritic therapeutic in murine collagen-induced arthritis in vivo. However, in acidic media, it can cyclize to the psychoactive Δ(9)-THC. We report the synthesis of a novel CBD derivative, HU-444, which cannot be converted by acid cyclization into a Δ(9)-THC-like compound. In vitro HU-444 had anti-inflammatory activity (decrease of reactive oxygen intermediates and inhibition of TNF-α production by macrophages); in vivo it led to suppression of production of TNF-α and amelioration of liver damage as well as lowering of mouse collagen-induced arthritis. HU-444 did not cause Δ(9)-THC-like effects in mice. We believe that HU-444 represents a potential novel drug for rheumatoid arthritis and other inflammatory diseases.

  3. Geological and Geotechnical Site Investigation for the Design of a CO2 Rich Flue Gas Direct Injection and Storage Facility

    Energy Technology Data Exchange (ETDEWEB)

    Metz, Paul; Bolz, Patricia

    2013-03-25

    With international efforts to limit anthropogenic carbon in the atmosphere, various CO{sub 2} sequestration methods have been studied by various facilities worldwide. Basalt rock in general has been referred to as potential host material for mineral carbonation by various authors, without much regard for compositional variations due to depositional environment, subsequent metamorphism, or hydrothermal alteration. Since mineral carbonation relies on the presence of certain magnesium, calcium, or iron silicates, it is necessary to study the texture, mineralogy, petrology, and geochemistry of specific basalts before implying potential for mineral carbonation. The development of a methodology for the characterization of basalts with respect to their susceptibility for mineral carbonation is proposed to be developed as part of this research. The methodology will be developed based on whole rock data, petrography and microprobe analyses for samples from the Caledonia Mine in Michigan, which is the site for a proposed small-scale demonstration project on mineral carbonation in basalt. Samples from the Keweenaw Peninsula will be used to determine general compositional trends using whole rock data and petrography. Basalts in the Keweenaw Peninsula have been subjected to zeolite and prehnite-pumpellyite facies metamorphism with concurrent native copper deposition. Alteration was likely due to the circulation of CO{sub 2}-rich fluids at slightly elevated temperatures and pressures, which is the process that is attempted to be duplicated by mineral carbonation.

  4. HuR in pheochromocytomas and paragangliomas - overexpression in verified malignant tumors.

    Science.gov (United States)

    Leijon, Helena; Salmenkivi, Kaisa; Heiskanen, Ilkka; Hagström, Jaana; Louhimo, Johanna; Heikkilä, Päivi; Ristimäki, Ari; Paavonen, Timo; Metso, Saara; Mäenpää, Hanna; Haglund, Caj; Arola, Johanna

    2016-09-01

    Pheochromocytomas and paragangliomas are rare, neural crest-originating, neuroendocrine tumors. HuR is an mRNA-binding protein of the ELAV/Hu-protein family, which participates in posttranscriptional regulation of many cancer-associated genes. HuR expression has been connected with aggressive behavior of several malignancies. Cyclooxygenase-2 (COX-2) is also expressed in several malignant tumors, and its expression is regulated by HuR. Tissue microarray of 153 primary pheochromocytomas and paragangliomas was investigated for the expression of HuR and COX-2 proteins by immunohistochemistry using two different HuR antibodies (HuR19F12 and HuR3A). In these tumors, the expression of both intranuclear and cytoplasmic HuR was detectable. Increased cytoplasmic HuR expression was significantly associated with metastatic tumors. Increased COX-2 and MIB-1 expression also was associated with metastatic potential, and moreover, HuR and COX-2 expression correlated with each other. Our data suggest that increased expression of HuR protein is associated with metastatic potential of paragangliomas and pheochromocytomas, and COX-2 seems to be a target of HuR.

  5. Structure-based analysis of HU-DNA binding.

    Science.gov (United States)

    Swinger, Kerren K; Rice, Phoebe A

    2007-01-26

    HU and IHF are prokaryotic proteins that induce very large bends in DNA. They are present in high concentrations in the bacterial nucleoid and aid in chromosomal compaction. They also function as regulatory cofactors in many processes, such as site-specific recombination and the initiation of replication and transcription. HU and IHF have become paradigms for understanding DNA bending and indirect readout of sequence. While IHF shows significant sequence specificity, HU binds preferentially to certain damaged or distorted DNAs. However, none of the structurally diverse HU substrates previously studied in vitro is identical with the distorted substrates in the recently published Anabaena HU(AHU)-DNA cocrystal structures. Here, we report binding affinities for AHU and the DNA in the cocrystal structures. The binding free energies for formation of these AHU-DNA complexes range from approximately 10-14.5 kcal/mol, representing K(d) values in the nanomolar to low picomolar range, and a maximum stabilization of at least approximately 6.3 kcal/mol relative to complexes with undistorted, non-specific DNA. We investigated IHF binding and found that appropriate structural distortions can greatly enhance its affinity. On the basis of the coupling of structural and relevant binding data, we estimate the amount of conformational strain in an IHF-mediated DNA kink that is relieved by a nick (at least 0.76 kcal/mol) and pinpoint the location of the strain. We show that AHU has a sequence preference for an A+T-rich region in the center of its DNA-binding site, correlating with an unusually narrow minor groove. This is similar to sequence preferences shown by the eukaryotic nucleosome.

  6. Structure-based Analysis to Hu-DNA Binding

    Energy Technology Data Exchange (ETDEWEB)

    Swinger,K.; Rice, P.

    2007-01-01

    HU and IHF are prokaryotic proteins that induce very large bends in DNA. They are present in high concentrations in the bacterial nucleoid and aid in chromosomal compaction. They also function as regulatory cofactors in many processes, such as site-specific recombination and the initiation of replication and transcription. HU and IHF have become paradigms for understanding DNA bending and indirect readout of sequence. While IHF shows significant sequence specificity, HU binds preferentially to certain damaged or distorted DNAs. However, none of the structurally diverse HU substrates previously studied in vitro is identical with the distorted substrates in the recently published Anabaena HU(AHU)-DNA cocrystal structures. Here, we report binding affinities for AHU and the DNA in the cocrystal structures. The binding free energies for formation of these AHU-DNA complexes range from 10-14.5 kcal/mol, representing K{sub d} values in the nanomolar to low picomolar range, and a maximum stabilization of at least 6.3 kcal/mol relative to complexes with undistorted, non-specific DNA. We investigated IHF binding and found that appropriate structural distortions can greatly enhance its affinity. On the basis of the coupling of structural and relevant binding data, we estimate the amount of conformational strain in an IHF-mediated DNA kink that is relieved by a nick (at least 0.76 kcal/mol) and pinpoint the location of the strain. We show that AHU has a sequence preference for an A+T-rich region in the center of its DNA-binding site, correlating with an unusually narrow minor groove. This is similar to sequence preferences shown by the eukaryotic nucleosome.

  7. Facile Carbonization of Microporous Organic Polymers into Hierarchically Porous Carbons Targeted for Effective CO2 Uptake at Low Pressures.

    Science.gov (United States)

    Gu, Shuai; He, Jianqiao; Zhu, Yunlong; Wang, Zhiqiang; Chen, Dongyang; Yu, Guipeng; Pan, Chunyue; Guan, Jianguo; Tao, Kai

    2016-07-20

    The advent of microporous organic polymers (MOPs) has delivered great potential in gas storage and separation (CCS). However, the presence of only micropores in these polymers often imposes diffusion limitations, which has resulted in the low utilization of MOPs in CCS. Herein, facile chemical activation of the single microporous organic polymers (MOPs) resulted in a series of hierarchically porous carbons with hierarchically meso-microporous structures and high CO2 uptake capacities at low pressures. The MOPs precursors (termed as MOP-7-10) with a simple narrow micropore structure obtained in this work possess moderate apparent BET surface areas ranging from 479 to 819 m(2) g(-1). By comparing different activating agents for the carbonization of these MOPs matrials, we found the optimized carbon matrials MOPs-C activated by KOH show unique hierarchically porous structures with a significant expansion of dominant pore size from micropores to mesopores, whereas their microporosity is also significantly improved, which was evidenced by a significant increase in the micropore volume (from 0.27 to 0.68 cm(3) g(-1)). This maybe related to the collapse and the structural rearrangement of the polymer farmeworks resulted from the activation of the activating agent KOH at high temperature. The as-made hierarchically porous carbons MOPs-C show an obvious increase in the BET surface area (from 819 to 1824 m(2) g(-1)). And the unique hierarchically porous structures of MOPs-C significantly contributed to the enhancement of the CO2 capture capacities, which are up to 214 mg g(-1) (at 273 K and 1 bar) and 52 mg g(-1) (at 273 K and 0.15 bar), superior to those of the most known MOPs and porous carbons. The high physicochemical stabilities and appropriate isosteric adsorption heats as well as high CO2/N2 ideal selectivities endow these hierarchically porous carbon materials great potential in gas sorption and separation.

  8. CO{sub 2} laser diagnostics for measurements of the plasma density profile and plasma density fluctuations on LHD

    Energy Technology Data Exchange (ETDEWEB)

    Vyacheslavov, L.N. [Budker Institute of Nuclear Physics, Novosibirsk (Russian Federation); Tanaka, K.; Kawahata, K. [National Inst. for Fusion Science, Toki, Gifu (Japan)

    2001-04-01

    A CO{sub 2} laser based diagnostics complimentary to the existing FIR interferometer is proposed. It combines interferometry for plasma density profile measurement under conditions of large density gradients, and both imaging and scattering techniques for observation of plasma fluctuations. Two-colour interferometer with a slablike probe beam and a single multichannel linear detector array provide observation of plasma density profile and density fluctuations at two locations along the probe beam. Basic characteristics of the diagnostics are considered as well as some effects that include dispersion and are critical for two colour imaging technique. The results of the bench-top experiments with the prototype of the interferometer are presented. (author)

  9. Facile synthesis of porous Pd nanoflowers with excellent catalytic activity towards CO oxidation☆

    Institute of Scientific and Technical Information of China (English)

    Tareque Odoom-Wubah; Mingming Du; Williams Brown Osei; Daohua Sun; Jiale Huang; Qingbiao Li

    2015-01-01

    Microorganism-mediated, hexadecyltrimethylammonium chloride (CTAC)-directed (MCD) method was employed in this work to synthesize Pd nanoflowers (PdNFs). Proper Pichia pastoris cel s (PPCs) dosage, ascorbic acid (AA), Pd(NO3)2 and CTAC concentrations were essential for the growth of the PdNFs. The size of the as-synthesized PdNFs could be tuned by adjusting the amount of Pd(NO3)2 solution and dosage of PPCs used. Char-acterization techniques such as X-ray diffraction, transmission electron microscopy, and X-ray photoelectron spectroscopy were used to verify the nature of the PdNFs. Finally the PdNF/PPC nanocomposites were immobilized onto TiO2 supports to obtain bio-PdNF/TiO2 catalysts which showed excellent catalytic activity for CO oxidation, obtaining 100%conversion at 100 °C and remaining stable over a period of 52 h of reaction time.

  10. Targeting Mycobacterium tuberculosis nucleoid-associated protein HU with structure-based inhibitors

    Science.gov (United States)

    Bhowmick, Tuhin; Ghosh, Soumitra; Dixit, Karuna; Ganesan, Varsha; Ramagopal, Udupi A.; Dey, Debayan; Sarma, Siddhartha P.; Ramakumar, Suryanarayanarao; Nagaraja, Valakunja

    2014-06-01

    The nucleoid-associated protein HU plays an important role in maintenance of chromosomal architecture and in global regulation of DNA transactions in bacteria. Although HU is essential for growth in Mycobacterium tuberculosis (Mtb), there have been no reported attempts to perturb HU function with small molecules. Here we report the crystal structure of the N-terminal domain of HU from Mtb. We identify a core region within the HU-DNA interface that can be targeted using stilbene derivatives. These small molecules specifically inhibit HU-DNA binding, disrupt nucleoid architecture and reduce Mtb growth. The stilbene inhibitors induce gene expression changes in Mtb that resemble those induced by HU deficiency. Our results indicate that HU is a potential target for the development of therapies against tuberculosis.

  11. Antiretroviral treatment among co-infected tuberculosis patients in integrated and non-integrated facilities.

    Science.gov (United States)

    Ledibane, T D; Motlhanke, S C; Rose, A; Kruger, W H; Ledibane, N R T; Claassens, M M

    2015-06-21

    Contexte : L'Afrique du Sud est au deuxième rang dans le monde de la « syndémie » tuberculose/virus d'immunodéficience humaine (TB-VIH) : en 2011, le taux de coïnfection TB-VIH a été estimé à 65%. L'intégration des services de soins de la TB et du VIH a été mise en œuvre pour augmenter la mise sous traitement antirétroviral (ART) chez les patients éligibles.Objectif : Evaluer si les structures intégrant TB et VIH comparées aux structures non-intégrées ont un meilleur taux de prise d'ART parmi les patients éligibles.Méthodes : Etude transversale utilisant les données de routine des programmes TB de janvier à décembre 2010. L'éligibilité à l'ART a été définie comme un comptage de CD4+ VIH inconnu (31,8% contre 24,5%; P VIH dans le Free State (2009–2010) n'a pas été associée à une amélioration de la prise de l'ART. Les raisons n'en sont pas très claires. Par contre, il est préoccupant de constater la proportion élevée de statut VIH inconnu et d'absence de résultats de comptage des CD4+, surtout dans les structures intégrées, et la faible proportion de patients sous ART, qui témoigne d'une mise en œuvre médiocre de l'intégration.

  12. Facile synthesis of urchin-like NiCo2O4 hollow microspheres with enhanced electrochemical properties in energy and environmentally related applications.

    Science.gov (United States)

    Yu, Xin-Yao; Yao, Xian-Zhi; Luo, Tao; Jia, Yong; Liu, Jin-Huai; Huang, Xing-Jiu

    2014-03-12

    A facile synthesis of novel urchin-like NiCo2O4 hierarchical hollow microspheres has been developed based on a template-free solvothermal and subsequent calcination method. The growth process of NiCo2O4 hollow microsphere precursors has been investigated, and a plausible mechanism was proposed. Because of their unique structure and high specific surface area, these NiCo2O4 hollow microspheres displayed enhanced electrochemical properties in methanol electrooxidation and determination of heavy-metal ions compared with solid urchin-like NiCo2O4 microspheres, Co3O4, and NiO microspheres. The good electrochemical performances suggested that these unique hierarchical NiCo2O4 hollow microspheres could be promising materials for energy and environmentally related applications.

  13. A shallow subsurface controlled release facility in Bozeman, Montana, USA, for testing near surface CO2 detection techniques and transport models

    Energy Technology Data Exchange (ETDEWEB)

    Spangler, Lee H.; Dobeck, Laura M.; Repasky, Kevin S.; Nehrir, Amin R.; Humphries, Seth D.; Barr, Jamie L.; Keith, Charlie J.; Shaw, Joseph A.; Rouse, Joshua H.; Cunningham, Alfred B.; Benson, Sally M.; Oldenburg, Curtis M.; Lewicki, Jennifer L.; Wells, Arthur W.; Diehl, J. R.; Strazisar, Brian; Fessenden, Julianna; Rahn, Thom A.; Amonette, James E.; Barr, Jonathan L.; Pickles, William L.; Jacobson, James D.; Silver, Eli A.; Male, Erin J.; Rauch, Henry W.; Gullickson, Kadie; Trautz, Robert; Kharaka, Yousif; Birkholzer, Jens; Wielopolski, Lucien

    2010-03-01

    A facility has been constructed to perform controlled shallow releases of CO2 at flow rates that challenge near surface detection techniques and can be scalable to desired retention rates of large scale CO2 storage projects. Preinjection measurements were made to determine background conditions and characterize natural variability at the site. Modeling of CO2 transport and concentration in saturated soil and the vadose zone was also performed to inform decisions about CO2 release rates and sampling strategies. Four releases of CO2 were carried out over the summer field seasons of 2007 and 2008. Transport of CO2 through soil, water, plants, and air was studied using near surface detection techniques. Soil CO2 flux, soil gas concentration, total carbon in soil, water chemistry, plant health, net CO2 flux, atmospheric CO2 concentration, movement of tracers, and stable isotope ratios were among the quantities measured. Even at relatively low fluxes, most techniques were able to detect elevated levels of CO2 in the soil, atmosphere, or water. Plant stress induced by CO2 was detectable above natural seasonal variations.

  14. Facile and cost effective synthesis of mesoporous spinel NiCo2O4 as an anode for high lithium storage capacity

    Science.gov (United States)

    Jadhav, Harsharaj S.; Kalubarme, Ramchandra S.; Park, Choong-Nyeon; Kim, Jaekook; Park, Chan-Jin

    2014-08-01

    To fulfill the high power and high energy density demands for Li-ion batteries (LIBs) new anode materials need to be explored to replace conventional graphite. Herein, we report the urea assisted facile co-precipitation synthesis of spinel NiCo2O4 and its application as an anode material for LIBs. The synthesized NiCo2O4 exhibited an urchin-like microstructure and polycrystalline and mesoporous nature. In addition, the mesoporous NiCo2O4 electrode exhibited an initial discharge capacity of 1095 mA h g-1 and maintained a reversible capacity of 1000 mA h g-1 for 400 cycles at 0.5 C-rate. The reversible capacity of NiCo2O4 could still be maintained at 718 mA h g-1, even at 10 C. The mesoporous NiCo2O4 exhibits great potential as an anode material for LIBs with the advantages of unique performance and facile preparation.To fulfill the high power and high energy density demands for Li-ion batteries (LIBs) new anode materials need to be explored to replace conventional graphite. Herein, we report the urea assisted facile co-precipitation synthesis of spinel NiCo2O4 and its application as an anode material for LIBs. The synthesized NiCo2O4 exhibited an urchin-like microstructure and polycrystalline and mesoporous nature. In addition, the mesoporous NiCo2O4 electrode exhibited an initial discharge capacity of 1095 mA h g-1 and maintained a reversible capacity of 1000 mA h g-1 for 400 cycles at 0.5 C-rate. The reversible capacity of NiCo2O4 could still be maintained at 718 mA h g-1, even at 10 C. The mesoporous NiCo2O4 exhibits great potential as an anode material for LIBs with the advantages of unique performance and facile preparation. Electronic supplementary information (ESI) available: Experimental details and additional experimental results. See DOI: 10.1039/c4nr02183e

  15. Facile synthesis of Pd-Pt alloy nanocages and their enhanced performance for preferential oxidation of CO in excess hydrogen.

    Science.gov (United States)

    Zhang, Hui; Jin, Mingshang; Liu, Hongyang; Wang, Jinguo; Kim, Moon J; Yang, Deren; Xie, Zhaoxiong; Liu, Jingyue; Xia, Younan

    2011-10-25

    This article describes a new method for the facile synthesis of Pd-Pt alloy nanocages with hollow interiors and porous walls by using Pd nanocubes as sacrificial templates. Differing from our previous work (Zhang, H.; Jin, M. S.; Wang, J. G.; Li, W. Y.; Camargo, P. H. C.; Kim, M. J.; Yang, D. R.; Xie, Z. X.; Xia, Y. Synthesis of Pd-Pt Bimetallic Nanocrystals with a Concave Structure through a Bromide-Induced Galvanic Replacement Reaction. J. Am. Chem. Soc.2011, 133, 6078-6079), we complemented the galvanic replacement (between Pd nanocubes and PtCl(4)(2-)) with a coreduction process (for PdCl(4)(2-) from the galvanic reaction and PtCl(4)(2-) from the feeding) to generate Pd-Pt alloy nanocages in one step. We found that the rate of galvanic replacement (as determined by the concentrations of Br(-) and PtCl(4)(2-) and temperature) and the rates of coreduction (as determined by the type of reductant and temperature) played important roles in controlling the morphology of resultant Pd-Pt alloy nanocages. The Pd-Pt nanocages exhibited both enhanced activity and selectivity for the preferential oxidation (PROX) of CO in excess hydrogen than those of Pd nanocubes and the commercial Pt/C thanks to the alloy composition and hollow structure. In addition, as the sizes of the Pd-Pt nanocages decreased, they exhibited higher CO conversion rates and lower maximum conversion temperatures due to the increase in specific surface area.

  16. Ice hydrometeor profile retrieval algorithm for high frequency microwave radiometers: application to the CoSSIR instrument during TC4

    Directory of Open Access Journals (Sweden)

    K. F. Evans

    2012-04-01

    Full Text Available A Bayesian algorithm to retrieve profiles of cloud ice water content (IWC, ice particle size (Dme, and relative humidity from millimeter-wave/submillimeter-wave radiometers is presented. The first part of the algorithm prepares an a priori file with cumulative distribution functions (CDFs and empirical orthogonal functions (EOFs of profiles of temperature, relative humidity, three ice particle parameters (IWC, Dme, distribution width, and two liquid cloud parameters. The a priori CDFs and EOFs are derived from CloudSat radar reflectivity profiles and associated ECMWF temperature and relative humidity profiles combined with three cloud microphysical probability distributions obtained from in situ cloud probes. The second part of the algorithm uses the CDF/EOF file to perform a Bayesian retrieval with a hybrid technique that uses Monte Carlo integration (MCI or, when too few MCI cases match the observations, uses optimization to maximize the posterior probability function. The very computationally intensive Markov chain Monte Carlo (MCMC method also may be chosen as a solution method. The radiative transfer model assumes mixtures of several shapes of randomly oriented ice particles, and here random aggregates of hexagonal plates, spheres, and dendrites are used for tropical convection. A new physical model of stochastic dendritic snowflake aggregation is developed. The retrieval algorithm is applied to data from the Compact Scanning Submillimeter-wave Imaging Radiometer (CoSSIR flown on the ER-2 aircraft during the Tropical Composition, Cloud and Climate Coupling (TC4 experiment in 2007. Example retrievals with error bars are shown for nadir profiles of IWC, Dme, and relative humidity, and nadir and conical scan swath retrievals of ice water path and average Dme. The ice cloud retrievals are evaluated by retrieving integrated 94 GHz backscattering from CoSSIR for comparison

  17. Ice hydrometeor profile retrieval algorithm for high frequency microwave radiometers: application to the CoSSIR instrument during TC4

    Science.gov (United States)

    Evans, K. F.; Wang, J. R.; O'C Starr, D.; Heymsfield, G.; Li, L.; Tian, L.; Lawson, R. P.; Heymsfield, A. J.; Bansemer, A.

    2012-04-01

    A Bayesian algorithm to retrieve profiles of cloud ice water content (IWC), ice particle size (Dme), and relative humidity from millimeter-wave/submillimeter-wave radiometers is presented. The first part of the algorithm prepares an a priori file with cumulative distribution functions (CDFs) and empirical orthogonal functions (EOFs) of profiles of temperature, relative humidity, three ice particle parameters (IWC, Dme, distribution width), and two liquid cloud parameters. The a priori CDFs and EOFs are derived from CloudSat radar reflectivity profiles and associated ECMWF temperature and relative humidity profiles combined with three cloud microphysical probability distributions obtained from in situ cloud probes. The second part of the algorithm uses the CDF/EOF file to perform a Bayesian retrieval with a hybrid technique that uses Monte Carlo integration (MCI) or, when too few MCI cases match the observations, uses optimization to maximize the posterior probability function. The very computationally intensive Markov chain Monte Carlo (MCMC) method also may be chosen as a solution method. The radiative transfer model assumes mixtures of several shapes of randomly oriented ice particles, and here random aggregates of hexagonal plates, spheres, and dendrites are used for tropical convection. A new physical model of stochastic dendritic snowflake aggregation is developed. The retrieval algorithm is applied to data from the Compact Scanning Submillimeter-wave Imaging Radiometer (CoSSIR) flown on the ER-2 aircraft during the Tropical Composition, Cloud and Climate Coupling (TC4) experiment in 2007. Example retrievals with error bars are shown for nadir profiles of IWC, Dme, and relative humidity, and nadir and conical scan swath retrievals of ice water path and average Dme. The ice cloud retrievals are evaluated by retrieving integrated 94 GHz backscattering from CoSSIR for comparison with the Cloud Radar System (CRS) flown on the same aircraft. The rms difference in

  18. Facile preparation of C, N co-modified Nb2O5 nanoneedles with enhanced visible light photocatalytic activity

    KAUST Repository

    Xue, Jiao

    2016-09-28

    C, N co-modified niobium pentoxide (Nb2O5) nanoneedles have been successfully synthesized via a facile hydrothermal method with Niobium Chloride (NbCl5) as a precursor and triethylamine as both the carbon and nitrogen source. The formation process of Nb2O5 nanoneedles has been presented in detail by investigating the effect of the crystallization temperature, the amount of triethylamine and the calcination temperature. The as-prepared Nb2O5 nanoneedles exhibit more efficient photocatalytic activity than commercial Degussa P25 and commercial Nb2O5 towards photodegradation of Rhodamine B (RhB) at a concentration of 10 mg L−1 under visible light. Special chemical species, such as carbonate species and NOX species, that exist on the surface of the as-prepared catalyst could extend the absorption into the visible region and thus enhance the photocatalytic activity of the Nb2O5 nanoneedles. At the same time, the obtained Nb2O5 nanoneedles exhibit excellent stability even after three successive cycles. A possible photodegradation mechanism was proposed and the corresponding photodecomposition process of RhB over the Nb2O5 nanoneedles was elucidated by a reactive species trapping experiment, suggesting that h+ and O2˙− play a major role in the photodegradation of RhB in aqueous solution.

  19. Facile preparation of nitrogen/sulfur co-doped and hierarchical porous graphene hydrogel for high-performance electrochemical capacitor

    Science.gov (United States)

    Li, Jinhui; Zhang, Guoping; Fu, Chaopeng; Deng, Libo; Sun, Rong; Wong, Ching-Ping

    2017-03-01

    Nitrogen/sulfur co-doped and hierarchical porous graphene hydrogels (DHGHs) are prepared by facile self-assembly process. The results show that the pH values of preparation process significantly affect the microstructures and electrochemical properties of DHGHs and the mechanism has been discussed. The as-prepared DHGHs can be directly used as binder-free electrodes to assemble full-cell supercapacitor devices. It is surprising that the DHGHs prepared at basic condition (DHGH-12) delivers a specific capacitance of 251 F g-1 (0.5 A g-1). Moreover, the DHGH-12 shows rectangular cyclic voltammetry shape at a high scan rate of 3000 mV s-1 and symmetrical galvanostatic charge/discharge curves at 100 A g-1 which exhibits a specific capacitance of 136.5 F g-1, a high energy density of 4.74 Wh kg-1 and high power density of 25.47 kW kg-1. Additionally, DHGH-12 presents superior cycling stability (96.8% retention after 2000 cycles at 20 A g-1) in 6 M KOH solution. Therefore, the novel DHGHs can be considered as promising candidate for high energy density supercapacitors at high rates.

  20. CO2 Injection Profile Logging Method and Its Application%CO2驱注入剖面测井方法及应用

    Institute of Scientific and Technical Information of China (English)

    吴华磊; 王卫国

    2013-01-01

    We carry out oil displacement experiments in three blocks of Daqing oilfield to explore the effective development technology for Fuyang reservoir with low permeability and fracture underdevelopment.Based on the present injection profile logging technology and combined with the characteristics of the CO2 flooding,we improve logging techniques,optimize log technologies and establish better log interpretation methods.The CO2 injection profile logging methods,which are five-parameter injection profile logging technology and pulse neutron oxygen activation logging technology,are applied in 38 wells.Log datum statistical analyse shows that temperature curve of five parameter injection profile logging technology is obvious and can qualitatively indicate injection layers combining with temperature inflection points.Pulse neutron oxygen activation logging technology can quantitatively calculate injection sizes of every layer,but the peak more disperses in low flow,the characteristics of peak location are not fully in line with normal distribution.Peak has slight trailing due to instrument spacing restriction.Minimum measure value of oxygen activation logging tool is 10 m3/d.%基于现有注入剖面测井技术,结合CO2驱井特点,改进测井工艺、优化技术选择、建立解释方法.利用研究形成的CO2驱注入剖面测井方法,即五参数吸气剖面测井技术和脉冲中子氧活化测井技术,现场测井应用38井次,从所测资料统计分析,五参数吸气剖面测井技术井温曲线指示明显,结合温度拐点的情况,可定性分析吸气层;脉冲中子氧活化测井技术可以定量给出各层的吸入量,但低流量时成峰较为发散,其峰位特征不完全符合正态分布,由于受仪器源距的限制有轻微拖尾现象,氧活化测井仪的测量下限为10m3/d.

  1. Genesis Research与Morphosys扩展HuCAL抗体协议

    Institute of Scientific and Technical Information of China (English)

    黄晓燕(摘)

    2008-01-01

    Genesis Research与Morphosys扩展协议后,靶向FGFR5蛋白的抗体将继续作为其研究的焦点。Genesis将利用Morphosys分公司Serotec开发的人组织抗体库(HuCAL)继续开发成纤维细胞生长因子受体5(FGFR5)靶点。

  2. An exploration of the socio-economic profile of women and costs of receiving abortion services at public health facilities of Madhya Pradesh, India.

    Science.gov (United States)

    Banerjee, Sushanta K; Kumar, Rakesh; Warvadekar, Janardan; Manning, Vinoj; Andersen, Kathryn Louise

    2017-03-21

    Maternal mortality, which primarily burdens developing countries, reflects the greatest health divide between rich and poor. This is especially pronounced for access to safe abortion services which alone avert 1 of every 10 maternal deaths in India. Primarily due to confidentiality concerns, poor women in India prefer private services which are often offered by untrained providers and may be expensive. In 2006 the state government of Madhya Pradesh (population 73 million) began a concerted effort to ensure access to safe abortion services at public health facilities to both rural and urban poor women. This study aims to understand the socio-economic profile of women seeking abortion services in public health facilities across this state and out of pocket cost accessing abortion services. In particular, we examine the level of access that poor women have to safe abortion services in Madhya Pradesh. This study consisted of a cross-sectional client follow-up design. A total of 19 facilities were selected using two-stage random sampling and 1036 women presenting to chosen facilities with abortion and post-abortion complications were interviewed between May and December 2014. A structured data collection tool was developed. A composite wealth index computed using principal component analysis derived weights from consumer durables and asset holding and classified women into three categories, poor, moderate, and rich. Findings highlight that overall 57% of women who received abortion care at public health facilities were poor, followed by 21% moderate and 22% rich. More poor women sought care at primary level facilities (58%) than secondary level facilities and among women presenting for postabortion complications (67%) than induced abortion. Women reported spending no money to access abortion services as abortion services are free of cost at public facilities. However, poor women spend INR 64 (1 USD) while visiting primary level facilities and INR 256 (USD 4) while

  3. Results concerning a clean co-combustion technology of waste biomass with fossil fuel, in a pilot fluidised bed combustion facility

    Energy Technology Data Exchange (ETDEWEB)

    Ionel, Ioana; Trif-Tordai, Gavril; Ungureanu, Corneliu; Popescu, Francisc; Lontis, Nicolae [Politehnica Univ. Timisoara (Romania). Faculty for Mechanical Engineering

    2008-07-01

    The research focuses on a facility, the experimental results, interpretation and future plans concerning a new developed technology of using waste renewable energy by applying the cocombustion of waste biomass with coal, in a fluidised bed system. The experimental facility is working entirely in accordance to the allowed limits for the exhaust flue gas concentration, with special concern for typical pollutants. The experiments conclude that the technology is cleaner, has as main advantage the possibility to reduce both the SO{sub 2} and CO{sub 2} exhaust in comparison to standard fossil fuel combustion, under comparable circumstances. The combustion is occurring in a stable fluidised bed. (orig.)

  4. A direct detection 1.6μm DIAL with three wavelengths for high accuracy measurements of vertical CO2 concentration and temperature profiles

    Science.gov (United States)

    Shibata, Yasukuni; Nagasawa, Chikao; Abo, Makoto

    2013-10-01

    The accurate vertical CO2 profiles in the troposphere are highly desirable in the inverse techniques to improve quantification and understanding of the global budget of CO2 and also global climate changes. Moreover, wind information is an important parameter for transport simulations and inverse estimation of surface CO2 flux. A differential absorption lidar (DIAL) is an attractive method for obtaining vertical CO2 profiles and we have developed an 1.6μm DIAL system to perform simultaneous measurements of CO2 concentration, atmospheric temperature profile and wind profile. The absorption cross sections of gas and air density depends on atmospheric temperature and pressure. Then precise temperature and pressure profiles are necessary for accurate CO2 mixing ratio measurement by DIAL. Laser beams of three wavelengths around a CO2 absorption line are transmitted alternately to the atmosphere for simultaneous measurements of CO2 concentration and temperature. The receiving optics include the near-infrared photomultiplier tube and a fiber Bragg grating (FBG) filter to detect a Doppler shift.

  5. Distributions, profiles and formation mechanisms of polychlorinated naphthalenes in cement kilns co-processing municipal waste incinerator fly ash.

    Science.gov (United States)

    Liu, Guorui; Zhan, Jiayu; Zhao, Yuyang; Li, Li; Jiang, Xiaoxu; Fu, Jianjie; Li, Chunping; Zheng, Minghui

    2016-07-01

    Co-processing municipal solid waste incinerator (MSWI) fly ash in cement kilns is challenging because the unintentional production of persistent organic pollutants (POPs) during the process is not well understood. The distributions, profiles and formation mechanisms of polychlorinated naphthalenes (PCNs) as new POPs covered under Stockholm Convention in two cement kilns co-processing MSWI fly ash were studied. The average concentrations of PCNs in stack gas samples were 710 ng m(-3). The PCN concentration in particle samples collected from different process stages in the cement kilns ranged from 1.1 to 84.7 ng g(-1). Three process sites including suspension pre-heater boiler, humidifier tower, and the kiln back-end bag filter were identified to be the major formation sites of PCNs in cement kilns co-processing MSWI fly ash. The PCN distribution patterns were similar to that of polychlorinated dibenzo-p-dioxin and dibenzofuran (PCDD/Fs), which indicates the possibility for simultaneous control of PCNs and PCDD/Fs in cement kilns co-processing fly ash. Chlorination was suggested to be an important formation mechanism of PCNs, and chlorination pathways of PCN congeners are proposed based on the congener profiles. Thermodynamic calculations, including relative thermal energies (ΔE) and standard free energy of formation (ΔG), and the charge densities of the carbon atoms in PCN supported the proposed chlorination mechanisms for PCN formation. The results presented in this study might provide helpful information for developing techniques and strategies to control PCN emissions during cement kilns co-processing MSWI fly ash.

  6. Facile scalable synthesis of Co{sub 3}O{sub 4}/carbon nanotube hybrids as superior anode materials for lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Zhiguo; Xu, Weiwei [Key Lab of Synthetic and Natural Functional Molecule Chemistry of Ministry of Education, and the College of Chemistry and Materials Science, Northwest University, Xi’an 710069 (China); Huang, Tao [Department of Chemistry, Fudan University, Shanghai 210024 (China); Li, Maolin; Wang, Wanren; Liu, Yanping; Mao, Chaochao; Meng, Fanli; Wang, Mengjiao [Key Lab of Synthetic and Natural Functional Molecule Chemistry of Ministry of Education, and the College of Chemistry and Materials Science, Northwest University, Xi’an 710069 (China); Cheng, Minghai [Suzhou Institute of Nano-Tech and Nano-Bionics, Chinese Academy of Sciences (China); Yu, Aishui [Department of Chemistry, Fudan University, Shanghai 210024 (China); Guo, Xiaohui, E-mail: guoxh2009@nwu.edu.cn [Key Lab of Synthetic and Natural Functional Molecule Chemistry of Ministry of Education, and the College of Chemistry and Materials Science, Northwest University, Xi’an 710069 (China)

    2013-10-15

    Graphical abstract: Co{sub 3}O{sub 4}/MWCNT hybrids were synthesized via strong ultra-sonication assisted shaking processes. The resultant samples as anode electrode display enhanced cycling performance and rate capability compared with pure Co{sub 3}O{sub 4} particle. - Highlights: • Co{sub 3}O{sub 4}/MWCNT hybrids were synthesized via ultra-sonication assisted shaking process. • The resulting Co{sub 3}O{sub 4} nanoparticles are highly dispersed onto MWCNT network backbone. • Co{sub 3}O{sub 4}/MWCNT hybrid displays highly enhanced lithium storage properties. • The present synthetic approach is facile, controllable, and scalable. - Abstract: In this report, Co{sub 3}O{sub 4}/multiple-wall carbon nanotube (MWCNT) hybrid materials were synthesized via strong ultrasonication-assisted shaking and magnetic stirring processes. The prepared samples were well characterized by utilizing powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and Raman spectroscopy techniques. Results indicated that the resulting Co{sub 3}O{sub 4} nanoparticles were highly dispersed in the MWCNT network backbone and further form Co{sub 3}O{sub 4}/MWCNT hybrid materials. The obtained Co{sub 3}O{sub 4}/MWCNT hybrids can be employed as anode electrode in Lithium-ion batteries and deliver as high as discharge capacity of 1250 mA h g{sup −1} at a current density of 0.2 C, additionally, 81% of the discharge capacity for sample 2 with 20 wt.% MWCNT loading could be retained after 70 cycles, which could be associated with the specific hybrid structure of the electrode as well as the addition of MWCNT. Most importantly, the present synthetic approach is facile, controllable, and scalable, which allowing it more easily adapted to prepare other hybrid materials with specific architectures.

  7. Industrial sector-based volatile organic compound (VOC) source profiles measured in manufacturing facilities in the Pearl River Delta, China.

    Science.gov (United States)

    Zheng, Junyu; Yu, Yufan; Mo, Ziwei; Zhang, Zhou; Wang, Xinming; Yin, Shasha; Peng, Kang; Yang, Yang; Feng, Xiaoqiong; Cai, Huihua

    2013-07-01

    Industrial sector-based VOC source profiles are reported for the Pearl River Delta (PRD) region, China, based source samples (stack emissions and fugitive emissions) analyzed from sources operating under normal conditions. The industrial sectors considered are printing (letterpress, offset and gravure printing processes), wood furniture coating, shoemaking, paint manufacturing and metal surface coating. More than 250 VOC species were detected following US EPA methods TO-14 and TO-15. The results indicated that benzene and toluene were the major species associated with letterpress printing, while ethyl acetate and isopropyl alcohol were the most abundant compounds of other two printing processes. Acetone and 2-butanone were the major species observed in the shoemaking sector. The source profile patterns were found to be similar for the paint manufacturing, wood furniture coating, and metal surface coating sectors, with aromatics being the most abundant group and oxygenated VOCs (OVOCs) as the second largest contributor in the profiles. While OVOCs were one of the most significant VOC groups detected in these five industrial sectors in the PRD region, they have not been reported in most other source profile studies. Such comparisons with other studies show that there are differences in source profiles for different regions or countries, indicating the importance of developing local source profiles. Crown Copyright © 2013. Published by Elsevier B.V. All rights reserved.

  8. Comment on "Tropospheric temperature response to stratospheric ozone recovery in the 21st century" by Hu et al. (2011

    Directory of Open Access Journals (Sweden)

    M. Previdi

    2012-01-01

    Full Text Available Stratospheric ozone recovery is expected to figure prominently in twenty-first century climate change. In a recent paper, Hu et al. (2011 argue that one impact of ozone recovery will be to enhance the warming of the surface-troposphere system produced by increases in well-mixed greenhouse gases; furthermore, this enhanced warming would be strongest in the Northern Hemisphere, which is surprising since previous studies have consistently shown the effects of stratospheric ozone changes to be most pronounced in the Southern Hemisphere. Hu et al. (2011 base their claims largely on differences in the simulated temperature change between two groups of IPCC climate models, one group which included stratospheric ozone recovery in its twenty-first century simulations and a second group which did not. Both groups of models were forced with the same increases in well-mixed greenhouse gases according to the A1B emissions scenario. In the current work, we compare the surface temperature responses of the same two groups of models in a different experiment in which atmospheric CO2 was increased by 1% per year until doubling. We find remarkably similar differences in the simulated surface temperature change between the two sets of models as Hu et al. (2011 found for the A1B experiment, suggesting that the enhanced warming which they attribute to stratospheric ozone recovery is actually a reflection of different responses of the two model groups to greenhouse gas forcing.

  9. Effect of Scanning Beam Profile to Fabricate Fused Fiber Tapers by CO_2 Laser Irradiation Method

    Institute of Scientific and Technical Information of China (English)

    Bayle; Fabien; Luo; Aiping; Marin; Emmanuel; Meunier; Jean-Pierre

    2003-01-01

    Beam uniformity is a crucial building block of CO2 experiments aimed at fusing and stretching optical fibers in a lossless manner. When the irradiation beam is expanded through a galvanometer mirror, ways to achieve beam uniformity are investigated.

  10. Effect of Scanning Beam Profile to Fabricate Fused Fiber Tapers by CO2 Laser Irradiation Method

    Institute of Scientific and Technical Information of China (English)

    Bayle Fabien; Luo Aiping; Marin Emmanuel; Meunier Jean-Pierre

    2003-01-01

    Beam uniformity is a crucial building block of CO2 experiments aimed at fusing and stretching optical fibers in a lossless manner. When the irradiation beam is expanded through a galvanometer mirror, ways to achieve beam uniformity are investigated.

  11. Morbidity profile of elderly outpatients attending selected sub-district Siddha health facilities in Tamil Nadu, India

    Directory of Open Access Journals (Sweden)

    Kalaiselvi Selvaraj

    2016-01-01

    Conclusion: Elderly constitute more than one fourth of outpatients load from siddha health facilities. Degenerative diseases like arthritis and non-communicable diseases were the common morbidities in this age group. Geriatric clinics and mobile clinics under siddha system may help in improving health care services.

  12. Facile preparation of superparamagnetic Fe3O4/poly(St-co-MPS)/SiO2 composite particles with high magnetization by introduction of silanol groups.

    Science.gov (United States)

    Yan, Feng; Li, Jun; Fu, Rong; Lu, Ziyang; Yang, Wensheng

    2009-10-01

    Fe3O4/poly(St-co-MPS) particles were prepared by encapsulation of Fe3O4 nanoparticles into copolymers of styrene (St) and 3-trimethoxysilylpropylmethacrylate (MPS) (poly(St-co-MPS)) prepared by miniemulsion copolymerization. It is found that the structure of the Fe3O4/poly(St-co-MPS)/SiO2 composite particles prepared by direct silica deposition on surface of the Fe3O4/poly(St-co-MPS) particles is dependent on the volume fraction of MPS used in the copolymerization. It is identified that the surface of the Fe3O4/poly(St-co-MPS) particles becomes more negatively charged with increased volume fraction of MPS used in the copolymerization, attributed to the increased amount of the silanol groups on the particles surface. Introduction of silanol groups on the particle surface is effective to improve the dispersibility of the Fe3O4/poly(St-co-MPS) particles and their compatibility with silica, allowing the facile preparation of Fe3O4/poly(St-co-MPS)/SiO2 composite particles with defined core-shell structure. The as-prepared Fe3O4/poly(St-co-MPS)/SiO2 composite particles show high magnetization, for example, saturation magnetization of the particles with average size of 140 nm and 6 nm silica shell is as high as 45 emu/g at 300 K.

  13. A Green and Facile Synthesis of Carbon-Incorporated Co3O4 Nanoparticles and Their Photocatalytic Activity for Hydrogen Evolution

    Directory of Open Access Journals (Sweden)

    Libo Gao

    2015-01-01

    Full Text Available Carbon-incorporated Co3O4 nanoparticles with an average diameter of 50 nm were prepared via a facile and environmentally friendly one-pot carbon-assisted method using degreasing cotton as a template as well as a reactant. The elemental analysis indicates the incorporation of carbon species into the Co3O4 nanoparticles and the XPS measurements demonstrate the presence of carbon species which comes from the incomplete combustion of the degreasing cotton. Interestingly, the resultant sample was able to split pure water into hydrogen under visible light irradiation without any cocatalyst, which is mainly due to the enhanced light absorption behavior confirmed by the UV-Vis absorption spectra. This facile method provided a potential strategy for applying narrow bandgap semiconductors in pure water splitting.

  14. Facile Synthesis of Core/Shell-like NiCo2O4-Decorated MWCNTs and its Excellent Electrocatalytic Activity for Methanol Oxidation

    OpenAIRE

    Tae-Hoon Ko; Kesavan Devarayan; Min-Kang Seo; Hak-Yong Kim; Byoung-Suhk Kim

    2016-01-01

    The design and development of an economic and highly active non-precious electrocatalyst for methanol electrooxidation is challenging due to expensiveness of the precursors as well as processes and non-ecofriendliness. In this study, a facile preparation of core-shell-like NiCo2O4 decorated MWCNTs based on a dry synthesis technique was proposed. The synthesized NiCo2O4/MWCNTs were characterized by infrared spectroscopy, scanning electron microscopy, transmission electron microscopy, X-ray dif...

  15. HuCOP1 contributes to the regulation of DNA repair in keratinocytes.

    Science.gov (United States)

    Fazekas, B; Carty, M P; Németh, I; Kemény, L; Széll, M; Ádám, É

    2017-03-01

    We have previously demonstrated that the E3 ligase Human Constitutive Photomorphogenic Protein (huCOP1) is expressed in human keratinocytes and negatively regulates p53. The MutS homolog 2 (MSH2) protein plays a central role in DNA MMR mechanism and is implicated in the cellular response to anticancer agents, such as cisplatin. Our aim was to clarify whether huCOP1 plays a role in DNA MMR by affecting MSH2 protein level in human keratinocytes. To define the role of huCOP1 in DNA mismatch repair, we determined whether huCOP1 affects MSH2 abundance. MSH2 protein level was detected by immunocytochemical staining using a keratinocyte cell line in which the expression level of huCOP1 was stably decreased (siCOP1). To investigate whether huCOP1 silencing influences cisplatin-induced cell death, control and siCOP1 keratinocyte cells were treated with increasing concentrations of cisplatin and cell viability was recorded after 48 and 96 h. Stable silencing of huCOP1 in human keratinocytes resulted in a reduced level of MSH2 protein. huCOP1 silencing also sensitized keratinocytes to the interstrand crosslinking inducer cisplatin. Our results indicate that decreased huCOP1 correlates with lower MSH2 levels. These protein level changes lead to increased sensitivity toward cisplatin treatment, implicating that huCOP1 plays a positive role in maintaining genome integrity in human keratinocytes.

  16. Facile synthesis of PbTiO3 truncated octahedra via solid-state reaction and their application in low-temperature CO oxidation by loading Pt nanoparticles

    KAUST Repository

    Yin, Simin

    2014-01-01

    Perovskite PbTiO3 (PTO) nanocrystals with a truncated octahedral morphology have been prepared by a facile solid-state reaction. Pt nanoparticles preferentially nucleated on the {111} facet of PTO nanocrystals exhibit a remarkable low-temperature catalytic activity towards CO oxidation from a temperature as low as 30 °C and achieve 100% conversion at ∼50 °C. © 2014 the Partner Organisations.

  17. Boosting the catalytic performance of MoSx cocatalysts over CdS nanoparticles for photocatalytic H2 evolution by Co doping via a facile photochemical route

    Science.gov (United States)

    Lei, Yonggang; Hou, Jianhua; Wang, Fang; Ma, Xiaohua; Jin, Zhiliang; Xu, Jing; Min, Shixiong

    2017-10-01

    Low-crystalline or amorphous molybdenum sulfides (MoSx), bearing abundant unsaturated active sites, have been identified as efficient catalysts for electrocatalytic and photocatalytic H2 evolution reactions, however, their intrinsic activity is still low and need to be further improved for large-scale applications. In this paper, we report that low-crystalline MoSx doped with Co (Co-MoSx) as efficient cocatalysts could be loaded on CdS nanoparticles through a facile and controllable photochemical reduction method and showed high performances in catalyzing H2 evolution under visible light irradiation (≥420 nm). The photochemical loading of Co-MoSx was accomplished by using an in-situ formed molecular complex precursor and photogenerated electrons on CdS as reductants under mild conditions. The optimized CdS/Co-MoSx (Co:Mo = 1:4, 2 mol% loading) photocatalyst exhibited a catalytic H2 evolution rate of 535 μmol h-1, which is 1.8 times higher than that of CdS/MoSx, and an apparent quantum efficiency (AQE) of 23.5% was achieved over CdS/Co-MoSx photocatalyst at 420 nm. Co-MoSx catalyst also shows a long-term stability without noticeable activity degradation. Notably, Co-MoSx cocatalyst was found more efficient than that of noble metals in catalyzing photocatalytic H2 evolution on CdS. The formation of CoMoS phase, the enhanced electrocatalytic activity as well as reduced electron transfer resistance due to the doping effects of Co ions, account for the enhanced catalytic activity of this Co-MoSx cocatalyst.

  18. Low level anti-Hu reactivity: a risk marker for small cell lung cancer?

    Science.gov (United States)

    Tsou, Jeffrey A.; Kazarian, Meleeneh; Patel, Ankur; Galler, Janice S.; Laird-Offringa, Ite A.; Carpenter, Catherine L.; London, Stephanie J.

    2010-01-01

    Background Previous experimental and laboratory studies have implicated antibodies against Hu proteins (anti-Hu) as a potential marker for small cell lung cancer (SCLC); there are no estimates of the association between anti-Hu and SCLC using a population-based design. Methods We used stored plasma specimens to evaluate anti-Hu reactivity in relationship to small cell lung cancer in a population-based case-control study. Using Western Blot analysis, we measured anti-Hu reactivity against recombinant Hu family member, HuD, in plasma samples from forty-one (41) SCLC cases and seventy-nine (79) controls individually matched for age, race, sex, and smoking status (never, past, current). We analyzed the association between anti-Hu reactivity and SCLC using conditional logistic regression. Results Anti-Hu reactivity was associated with SCLC, both before and after adjustment for amount of smoking. We observed a smoking-adjusted odds ratio of 3.2 (95 % confidence interval from 0.98 to 13.4) comparing subjects above 1800 units (the lower limit of the second tertile of the distribution among antibody positive controls) to subjects with lower reactivity. We also found suggestive evidence in follow-up of our cases that anti-Hu above 1800 units was related to longer-term survival from SCLC. The present research is the first report of anti-Hu reactivity and SCLC in a population-based study. Conclusions Given the suggestive evidence in this study, prospective analyses to examine whether anti-Hu reactivity might predict risk of developing SCLC, or whether anti-Hu reactivity could serve as an early marker for SCLC, may be warranted. PMID:19070439

  19. Expression profile of germ stem cell-specific genes in human spermatogonial stem cells after co culture with sertoli cells

    Directory of Open Access Journals (Sweden)

    Maria Zahiri

    2014-05-01

    Full Text Available Background: Human spermatogonial stem cells (SSCs, are the foundation of spermatogenesis. Because of low number and lack of significant marker in human SSCs, studying their characteristics, could provide better understanding about the biology of male fertility. This study was designed to examine the effects of in vitro co-culture with sertoli cells on SSC colonization and germ cells specific gene expression of human spermatogonial stem cells. Material and Methods: Testicular cells were isolated from testis biopsies by using two step enzymatic digestion and differential plating. two culture system were designed: co-culture with patient Sertoli cells and culture of SSC without co-culture(as control group. The number and diameter of colonies were evaluated during 3 weeks of culture. The expression of alpha 6 integrin, beta1 integrin and PLZF, as germ stem cell specific markers, was assessed using quantitative RT-PCR. Statistical analysis was performed using one way ANOVA in SPSS vesion 16 software with 95% Confidence interval . Result: Our results were showed that the number and diameter of colonies increased significantly in co-culture with sertoli cells (P<0.05. The expression profile of genes in 2nd and 3rd weeks of culture revealed that there is significant higher expression of germ stem cell markers in our co-culture group versus control group. Conclusion: Based on the optimal effects of sertoli cells on spermatogonial stem cells, co culture of the human SSCs with the feeder layer sertoli may be used as a suitable method for the enrichment of human spermatogonial stem cells.

  20. Mechanism of RNA binding protein HuR in regulating the activity of prostate cancer cells%RNA结合蛋白HuR调控前列腺癌细胞活力机制的研究

    Institute of Scientific and Technical Information of China (English)

    周宁; 程娟; 钟毅; 冉新建; 于文燕; 马琪

    2016-01-01

    目的 前列腺癌在我国的发病率及病死率逐年上升,但其发病机制尚未明确,本研究从转录后水平初步探讨RNA结合蛋白HuR参与调控前列腺癌细胞活力的机制.方法 免疫荧光检测前列腺增生细胞(BPH)及前列腺癌细胞(PC3)中HuR蛋白的定位,蛋白质印迹法检测HuR及环氧合酶-2(cyclooxygenase,COX-2)蛋白在细胞内的表达,MTT法检测细胞活力,脂质体转染法转染质粒及干扰片段,qPCR检测干扰效率,RNA-pull down实验验证HuR对COX-2的调控.结果 HuR在BPH细胞主要定位于细胞核,在PC3细胞中主要定位于胞质.PC3细胞中HuR表达水平为1.699±0.011,高于BPH细胞的0.654±0.028,差异有统计学意义,t=58.67,P<0.001.PC3细胞中过表达HuR后,转染空质粒组细胞活力为1.038±0.117,转染HuR表达质粒后细胞活力为1.838±0.057,差异有统计学意义,t=10.656,P<0.001.干扰HuR表达后,转染siNC组细胞活力为1.254±0.095,转染siHuR干扰片段组细胞活力为0.66±0.102,t=7.383,P=0.002;BPH组和PC3组COX-2表达水平分别为0.449±0.055和1.066±0.068,t=12.147,P<0.001;过表达COX-2后PC3细胞活力明显增加,转染空质粒组细胞活力为1.296±0.114,转染COX-2表达质粒后细胞活力为1.954±0.062,t=18.062,P<0.001.干扰COX-2表达后,PC3细胞活力明显降低,转染siNC组细胞活力为1.233±0.145,转染siCOX-2干扰片段后细胞活力为0.661±0.096,t=5.688,P=0.005.HuR可以结合于COX-2的3′-UTR并上调COX-2蛋白表达,转染空质粒组COX-2蛋白表达水平为0.638±0.067,转染HuR表达质粒组为1.703±0.022,t=26.26,P<0.001.结论 HuR参与调控前列腺癌细胞活力可能是通过上调COX-2表达而实现.

  1. Observation of vertcal CO2 concentration profiles in the lower-atmosphere using a compact direct detection 1.6 μm DIAL

    Science.gov (United States)

    Nagasawa, C.; Shibata, Y.; Abo, M.

    2015-12-01

    Knowledge of present carbon sources and sinks including their spatial profile and their variation in time is one of the essential informations for predicting future CO2 atmospheric concentration levels. Moewover, for the detailed analysis of forest carbon dynamics and CO2 fluxes of urban area, the CO2 concentration measurement techniques with high spatial and temporal resolution are required in the lower atmosphere. A differential absorption lidar (DIAL) is expected to measure atmospheric CO2 concentration profiles in the atmospheric boundary layer from a ground platform. We have succeeded to develop a compact direct detection 1.6 μm DIAL system for measuring CO2 concentration profiles in the lower atmosphere. This DIAL system consists of the optical parametric generator (OPG) transmitter that excited by the LD pumped Nd:YAG laser with high repetition rate and the receiving optics that included the near-infrared photomultiplier tube operating at the analog mode and the 25 cm telescope. We have succeeded in observing the daytime temporal change of vertical CO2 concentration profiles for the range from 0.25 to 2.5 km with integration time of 30 minutes and range resolution of 300 m. This compact direct detection CO2 DIAL is usefull for the estimation of CO2 flux. This work was financially supported by the System Development Program for Advanced Measurement and Analysis of the Japan Science and Technology Agency.

  2. Facile synthesis of ultrafine Co{sub 3}O{sub 4} nanocrystals embedded carbon matrices with specific skeletal structures as efficient non-enzymatic glucose sensors

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mian; Han, Ce; Zhang, Yufan; Bo, Xiangjie, E-mail: baoxj133@nenu.edu.cn; Guo, Liping, E-mail: guolp078@nenu.edu.cn

    2015-02-25

    Highlights: • Novel hyperfine Co{sub 3}O{sub 4} nanocrystals decorated porous carbon matrixes. • Facile synthesis without use of any harmful dispersing reagents or surfactants. • High dispersion degree of Co{sub 3}O{sub 4} nanocrystals and excellent e{sup −} transport rates. • A large current sensitivity of 955.9 μA cm{sup −2} mM{sup −1} toward glucose. • Excellent anti-interference and stability for glucose detection. - Abstract: A facile, effective, and environmentally friendly method has been adopted for the first time to prepare tiny Co{sub 3}O{sub 4} nanocrystals embedded carbon matrices without using surfactants, harmful organic reagents or extreme conditions. Structural characterizations reveal that the size-controlled Co{sub 3}O{sub 4} nanocrystals are uniformly dispersed on carbon matrices. Electrochemical measurements reveal that Co{sub 3}O{sub 4}-ordered mesoporous carbon (OMC) can more efficiently catalyze glucose oxidation and acquire better detection parameters compared with those for the Co{sub 3}O{sub 4}-macroporous carbon, Co{sub 3}O{sub 4}-reduced graphene oxide, and free Co{sub 3}O{sub 4} nanoparticles (NPs) (such as: the large sensitivity (2597.5 μA cm{sup −2} mM{sup −1} between 0 and 0.8 mM and 955.9 μA cm{sup −2} mM{sup −1} between 0.9 and 7.0 mM), fast response time, wide linear range, good stability, and surpassingly selective capability to electroactive molecules or Cl{sup −}). Such excellent performances are attributed to the synergistic effect of the following three factors: (1) the high catalytic sites provided by the uniformly dispersed and size-controlled Co{sub 3}O{sub 4} nanocrystals embedded on OMC; (2) the excellent reactant transport efficiency caused by the abundant mesoporous structures of OMC matrix: (3) the improved electron transport in high electron transfer rate (confinement of the Co{sub 3}O{sub 4} NPs in nanoscale spaces ensured intimate contact between Co{sub 3}O{sub 4} nanocrystals and the

  3. Facile synthesis of surface N-doped Bi2O2CO3: Origin of visible light photocatalytic activity and in situ DRIFTS studies.

    Science.gov (United States)

    Zhou, Ying; Zhao, Ziyan; Wang, Fang; Cao, Kun; Doronkin, Dmitry E; Dong, Fan; Grunwaldt, Jan-Dierk

    2016-04-15

    Bi2O2CO3 nanosheets with exposed {001} facets were prepared by a facile room temperature chemical method. Due to the high oxygen atom density in {001} facets of Bi2O2CO3, the addition of cetyltrimethylammonium bromide (CTAB) does not only influence the growth of crystalline Bi2O2CO3, but also modifies the surface properties of Bi2O2CO3 through the interaction between CTAB and Bi2O2CO3. Nitrogen from CTAB as dopant interstitially incorporates in the Bi2O2CO3 surface evidenced by both experimental and theoretical investigations. Hence, the formation of localized states from NO bond improves the visible light absorption and charge separation efficiency, which leads to an enhancement of visible light photocatalytic activity toward to the degradation of Rhodamine B (RhB) and oxidation of NO. In addition, the photocatalytic NO oxidation over Bi2O2CO3 nanosheets was successfully monitored for the first time using in situ diffuse reflectance infrared Fourier-transform spectroscopy (DRIFTS). Both bidentate and monodentate nitrates were identified on the surface of catalysts during the photocatalytic reaction process. The application of this strategy to another relevant bismuth based photocatalyst, BiOCl, demonstrated that surface interstitial N doping could also be achieved in this case. Therefore, our current route seems to be a general option to modify the surface properties of bismuth based photocatalysts.

  4. A facile approach to prepare crumpled CoTMPyP/electrochemically reduced graphene oxide nanohybrid as an efficient electrocatalyst for hydrogen evolution reaction

    Science.gov (United States)

    Ma, Juanjuan; Liu, Lin; Chen, Qian; Yang, Min; Wang, Danping; Tong, Zhiwei; Chen, Zhong

    2017-03-01

    Elaborate design and synthesis of efficient and stable non-Pt electrocatalysts for some renewable energy related conversion/storage processes are one of the major goals of sustainable chemistry. Herein, we report a facile method to fabricate Co porphyrin functionalized electrochemically reduced graphene oxide (CoTMPyP/ERGO) thin film by direct assembly of oppositely charged tetrakis(N-methylpyridyl) porphyrinato cobalt (CoTMPyP) and GO nanosheets under mild conditions followed by an electrochemical reduction procedure. STEM analysis confirms that CoTMPyP nanoaggregates are homogeneously distributed over the graphene surface. The electrochemical properties of CoTMPyP/ERGO were investigated by cyclic voltammetry, linear sweep voltammetry and electrochemical impedance spectroscopy. The results demonstrate that CoTMPyP/ERGO nanohybrid film can serve as excellent electrocatalyst for hydrogen evolution in alkaline solution with high activity and stability. The intimate contact and efficient electron transfer between CoTMPyP and ERGO, as well as the crumpled structure, contribute to the improvement of the electrocatalytic performance.

  5. 1.6 μm DIAL Measurement and Back Trajectory Analysis of CO2 Concentration Profiles in the Lower-Atmosphere

    Science.gov (United States)

    Shibata, Y.; Nagasawa, C.; Abo, M.

    2016-12-01

    Carbon dioxide (CO2) is the primary greenhouse gas emitted through human activities. In addition to the ground level CO2 network, vertical CO2 concentration profiles also play an important role for the estimation of the carbon budget and global warming in the inversion method. Especially, for the detailed analysis of forest carbon dynamics and CO2 fluxes of urban area, vertical CO2 concentration profiles with high spatial and temporal resolution in the lower atmosphere have been conducted by a differential absorption lidar (DIAL). We have observed several vertical profiles of CO2 concentrations for nighttime and daytime from 0.25 to 2.5 km altitude with range resolution of 300 m and integration time of 1 hour. In order to extract information on the origin of the CO2 masses, one day back trajectories were calculated by using a three dimensional (3-D) atmospheric transport model. In many cases, CO2 low concentration layers of over 1.5km altitude were flown by westerly winds from the forest. In another case, high concentration layers of CO2 were flown from the urban areas. As the spectra of absorption lines of any molecules are influenced basically by the temperature in the atmosphere, laser beams of three wavelengths around a CO2 absorption spectrum are transmitted alternately to the atmosphere for simultaneous measurements of CO2 concentration and temperature profiles. Moreover, a few processing algorithms of CO2-DIAL are also performed for improvement of measurement accuracy. For computation of trajectories and drawing their figures, the JRA-25 data provided by the cooperative research project for the JRA-25 long-term reanalysis of the Japan Meteorological Agency (JMA) and the Central Research Institute of Electric Power Industry (CRIEPI) and the NIPR trajectory model (Tomikawa and Sato, 2005; http://firp-nitram.nipr.ac.jp) were used. This work was financially supported by the System Development Program for Advanced Measurement and Analysis of the Japan Science and

  6. Challenges facing effective implementation of co-trimoxazole prophylaxis in children born to HIV-infected mothers in the public health facilities

    Directory of Open Access Journals (Sweden)

    Kamuhabwa AAR

    2015-10-01

    Full Text Available Appolinary AR Kamuhabwa,1 Vicky Manyanga21Unit of Pharmacology and Therapeutics, 2Department of Medicinal Chemistry, School of Pharmacy, Muhimbili University of Health and Allied Sciences, Dar es Salaam, TanzaniaBackground: If children born to HIV-infected mothers are not identified early, approximately 30% of them will die within the first year of life due to opportunistic infections. In order to prevent morbidity and mortality due to opportunistic infections in children, the World Health Organization recommends the use of prophylaxis using co-trimoxazole. However, the challenges affecting effective implementation of this policy in Tanzania have not been documented.Aim: In this study, we assessed the challenges facing the provision of co-trimoxazole prophylaxis among children born to HIV-infected mothers in the public hospitals of Dar es Salaam, Tanzania.Methodology: Four hundred and ninety-eight infants' PMTCT (Prevention of Mother-to-Child Transmission of HIV register books for the past 2 years were reviewed to obtain information regarding the provision of co-trimoxazole prophylaxis. One hundred and twenty-six health care workers were interviewed to identify success stories and challenges in the provision of co-trimoxazole prophylaxis in children. In addition, 321 parents and guardians of children born to HIV-infected mothers were interviewed in the health facilities.Results: Approximately 80% of children were initiated with co-trimoxazole prophylaxis within 2 months after birth. Two hundred and ninety-one (58.4% children started using co-trimoxazole within 4 weeks after birth. Majority (n=458, 91.8% of the children were prescribed 120 mg of co-trimoxazole per day, whereas 39 (7.8% received 240 mg per day. Only a small proportion (n=1, 0.2% of children received 480 mg/day. Dose determination was based on the child's age rather than body weight. Parents and guardians reported that 42 (13.1% children had missed one or more doses of co

  7. HuPSON: the human physiology simulation ontology.

    Science.gov (United States)

    Gündel, Michaela; Younesi, Erfan; Malhotra, Ashutosh; Wang, Jiali; Li, Hui; Zhang, Bijun; de Bono, Bernard; Mevissen, Heinz-Theodor; Hofmann-Apitius, Martin

    2013-11-22

    Large biomedical simulation initiatives, such as the Virtual Physiological Human (VPH), are substantially dependent on controlled vocabularies to facilitate the exchange of information, of data and of models. Hindering these initiatives is a lack of a comprehensive ontology that covers the essential concepts of the simulation domain. We propose a first version of a newly constructed ontology, HuPSON, as a basis for shared semantics and interoperability of simulations, of models, of algorithms and of other resources in this domain. The ontology is based on the Basic Formal Ontology, and adheres to the MIREOT principles; the constructed ontology has been evaluated via structural features, competency questions and use case scenarios.The ontology is freely available at: http://www.scai.fraunhofer.de/en/business-research-areas/bioinformatics/downloads.html (owl files) and http://bishop.scai.fraunhofer.de/scaiview/ (browser). HuPSON provides a framework for a) annotating simulation experiments, b) retrieving relevant information that are required for modelling, c) enabling interoperability of algorithmic approaches used in biomedical simulation, d) comparing simulation results and e) linking knowledge-based approaches to simulation-based approaches. It is meant to foster a more rapid uptake of semantic technologies in the modelling and simulation domain, with particular focus on the VPH domain.

  8. HIV-1 infection and CD4 T cell depletion in the humanized Rag2-/-γc-/- (RAG-hu mouse model

    Directory of Open Access Journals (Sweden)

    Connick Elizabeth

    2006-11-01

    Full Text Available Abstract Background The currently well-established humanized mouse models, namely the hu-PBL-SCID and SCID-hu systems played an important role in HIV pathogenesis studies. However, despite many notable successes, several limitations still exist. They lack multi-lineage human hematopoiesis and a functional human immune system. These models primarily reflect an acute HIV infection with rapid CD4 T cell loss thus limiting pathogenesis studies to a short-term period. The new humanized Rag2-/-γc-/- mouse model (RAG-hu created by intrahepatic injection of CD34 hematopoietic stem cells sustains long-term multi-lineage human hematopoiesis and is capable of mounting immune responses. Thus, this model shows considerable promise to study long-term in vivo HIV infection and pathogenesis. Results Here we demonstrate that RAG-hu mice produce human cell types permissive to HIV-1 infection and that they can be productively infected by HIV-1 ex vivo. To assess the capacity of these mice to sustain long-term infection in vivo, they were infected by either X4-tropic or R5-tropic HIV-1. Viral infection was assessed by PCR, co-culture, and in situ hybridization. Our results show that both X4 and R5 viruses are capable of infecting RAG-hu mice and that viremia lasts for at least 30 weeks. Moreover, HIV-1 infection leads to CD4 T cell depletion in peripheral blood and thymus, thus mimicking key aspects of HIV-1 pathogenesis. Additionally, a chimeric HIV-1 NL4-3 virus expressing a GFP reporter, although capable of causing viremia, failed to show CD4 T cell depletion possibly due to attenuation. Conclusion The humanized RAG-hu mouse model, characterized by its capacity for sustained multi-lineage human hematopoiesis and immune response, can support productive HIV-1 infection. Both T cell and macrophage tropic HIV-1 strains can cause persistent infection of RAG-hu mice resulting in CD4 T cell loss. Prolonged viremia in the context of CD4 T cell depletion seen in this

  9. ELEVATED CO{sub 2} IN A PROTOTYPE FREE-AIR CO{sub 2} ENRICHMENT FACILITY AFFECTS PHOTOSYNTHETIC NITROGEN RELATIONS IN A MATURING PINE FOREST

    Energy Technology Data Exchange (ETDEWEB)

    ELLSWORTH,D.S.; LA ROCHE,J.; HENDREY,G.R.

    1998-03-01

    A maturing loblolly pine (Pinus taeda L.) forest was exposed to elevated CO{sub 2} in the natural environment in a perturbation study conducted over three seasons using the free-air CO{sub 2} enrichment (FACE) technique. At the time measurements were begun in this study, the pine canopy was comprised entirely of foliage which had developed under elevated CO{sub 2} conditions (atmospheric [CO{sub 2}] {approx} 550 {micro}mol mol{sup {minus}1}). Measurements of leaf photosynthetic responses to CO{sub 2} were taken to examine the effects of elevated CO{sub 2} on photosynthetic N nutrition in a pine canopy under elevated CO{sub 2}. Photosynthetic CO{sub 2} response curves (A-c{sub i} curves) were similar in FACE trees under elevated CO{sub 2} compared with counterpart trees in ambient plots for the first foliage cohort produced in the second season of CO{sub 2} exposure, with changes in curve form detected in the foliage cohorts subsequently produced under elevated CO{sub 2}. Differences in the functional relationship between carboxylation rate and N{sub a} suggest that for a given N{sub a} allocated among successive cohorts of foliage in the upper canopy, V{sub c max} was 17% lower in FACE versus Ambient trees. The authors also found that foliar Rubisco content per unit total protein derived from Western blot analysis was lower in late-season foliage in FACE foliage compared with ambient-grown foliage. The results illustrate a potentially important mode of physiological adjustment to growth conditions that may operate in forest canopies. Their findings suggest that mature loblolly pine trees growing in the field may have the capacity for shifts in intrinsic nitrogen utilization for photosynthesis under elevated CO{sub 2} that are not dependent on changes in leaf N. While carboxylation efficiency per unit N apparently decreased under elevated CO{sub 2}, photosynthetic rates in trees at elevated CO{sub 2} concentrations {approx} 550 pmol mol{sub {minus}1} are still

  10. A sustainable protocol for the facile synthesis of zinc-glutamate MOF: an efficient catalyst for room temperature CO2 fixation reactions under wet conditions.

    Science.gov (United States)

    Kathalikkattil, Amal Cherian; Roshan, Roshith; Tharun, Jose; Babu, Robin; Jeong, Gyeong-Seon; Kim, Dong-Woo; Cho, Sung June; Park, Dae-Won

    2016-01-07

    A water stable zinc-MOF (ZnGlu) catalyst was facilely prepared from the proteinogenic amino acid, l-glutamic acid at room temperature in aqueous medium. CO2 fixations were promoted by the ZnGlu catalyst's inherently coordinated water and externally added water in yielding cyclic carbonate and cyclic urethane at room temperature. This eliminates the need for catalyst activation, making ZnGlu a ready-to-use catalyst. The enhanced CO2 cycloaddition with added water hints at the application of ZnGlu in wet flue gas conversions. This is the first reported attempt for the use of an MOF in the cycloaddition of aziridine and CO2.

  11. Calculation of the Composition Profile of a Functionally Graded Material Produced by Co-sedimentation

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    A sedimentation method is proposed to fabricate functionally graded materials (FGMs) with the continuous andsmooth variations of composition. The relations between the compositional distribution of deposited body and thepowder characteristics of raw materials as well as settling parameters are derived. Subsequently, the mathematicalmodel of forming FGM based on the co-sedimentation has been established. At last, numerical simulations areconducted to explore the effects of the particle sizes of raw materials and suspension height on the compositionaldistribution of final products.

  12. Discriminability of Personality Profiles in Isolated and Co-Morbid Marijuana and Nicotine Users

    OpenAIRE

    Ketcherside, Ariel; Jeon-Slaughter, Haekyung; Baine, Jessica L.; Filbey, Francesca M

    2016-01-01

    Specific personality traits have been linked with substance use disorders (SUDs), genetic mechanisms, and brain systems. Thus, determining the specificity of personality traits to types of SUD can advance the field towards defining SUD endophenotypes as well as understanding the brain systems involved for the development of novel treatments. Disentangling these factors is particularly important in highly co-morbid SUDs, such as marijuana and nicotine use, so treatment can occur effectively fo...

  13. Facile synthesis of MoS2/Bi2WO6 nanocomposites for enhanced CO2 photoreduction activity under visible light irradiation

    Science.gov (United States)

    Dai, Weili; Yu, Juanjuan; Deng, Yiqiang; Hu, Xu; Wang, Tengyao; Luo, Xubiao

    2017-05-01

    A novel composite material, MoS2/Bi2WO6, has been fabricated via a facile two-step approach. The few layered MoS2 as a cocatalyst has intimate interactions with the hierarchical flower-like Bi2WO6 microspheres, which boosts the visible light harvesting and charge transferring, and promotes the separation of electron-hole pairs, thus leading to the superior photocatalytic activity. It was found that the as-synthesized MoS2/Bi2WO6 nanocomposites exhibited significantly enhanced performance for the photoreduction of CO2 into hydrocarbons, i.e. methanol and ethanol, as compared with pure Bi2WO6. The yields of methanol and ethanol obtained over the composite with optimal content of MoS2 (0.4 wt%) were 36.7 and 36.6 μmol gcat-1 after 4 h of visible light irradiation, respectively, which were 1.94 times higher than that over pure Bi2WO6. Furthermore, the mechanism of CO2 photoreduction was also investigated. It indicates that the CO32-, HCO3- and H2CO3 generated in CO2 aqueous solution would be the reactive substrates during the photoreduction reaction, proving the thermodynamic feasibility of CO2 photoreduction. This work demonstrated that MoS2 is a very promising candidate for development of highly active photocatalysts, and supplied a facile and simple strategy for designing environmentally benign, cheap non-noble metal, and highly efficient semiconductor composites.

  14. Facile conversion of commercial coarse-type LiCoO2 to nanocomposite-separated nanolayer architectures as a way for electrode performance enhancement.

    Science.gov (United States)

    Zhao, Yinan; Sha, Yujing; Lin, Qian; Zhong, Yijun; Tade, Moses O; Shao, Zongping

    2015-01-28

    Coarse-type LiCoO2 is the state-of-the-art cathode material in small-scale lithium-ion batteries (LIBs); however, poor rate performance and cycling stability limit its large-scale applications. Here we report the modification of coarse-type LiCoO2 (LCO) with nanosized lithium lanthanum titanate (Li3xLa2/3-xTiO3, LLTO) through a facile sol-gel process, the electrochemical performance of commercial LiCoO2 is improved effectively, in particular at high rates. The crystalline structure of pristine LiCoO2 is not affected by the introduction of the LLTO phase, while nanosized LLTO particles are likely incorporated into the space of the LiCoO2 layers to form a LCO-LLTO nanocomposite, which separate the LCO layers with the increase of layer spacing to ∼100 nm. The LLTO incorporation through the facile post-treatment effectively reduces the charge-transfer resistance and increases the electrode reactions; consequently, the LLTO-incorporated LCO electrode shows higher capacity than LiCoO2 at a higher rate and prolonging cycling stability in both potential ranges of 2.7-4.2 V and 2.7-4.5 V, making it also suitable for high-rate operation. This novel concept is general, which may also be applicable to other electrode materials. It thus introduces a new way for the development of high rate-performance electrodes for LIBs for large scale applications such as electric vehicles and electrochemical energy storage for smart grids.

  15. Simulation of Binary CO2/CH4 Mixture Breakthrough Profiles in MIL-53 (Al

    Directory of Open Access Journals (Sweden)

    Luis Fernando Gomez

    2015-01-01

    Full Text Available MIL-53 (Al aluminum terephthalate, a commercial metal-organic framework, has been studied as a potential candidate for pressure swing adsorption separation of CO2/CH4 binary mixtures. Pure gas isotherms of CH4 and CO2 measured over 0–6 MPa and at room temperature are fitted with the Dubinin-Astakhov (D-A model. The D-A model parameters are used in the Doong-Yang Multicomponent adsorption model to predict the binary mixture isotherms. A one-dimensional multicomponent adsorption breakthrough model is then used to perform a parametric study of the effect of adsorbent particle diameter, inlet pressures, feed flow rates, and feed compositions on the breakthrough performance. Commercial MIL-53 with a particle diameter of 20 μm renders high tortuous flow; therefore it is less effective for separation. More effective separation can be achieved if MIL-53 monoliths of diameters above 200 μm are used. Faster separation is possible by increasing the feed pressure or if the starting compositions are richer in CO2. More CH4 is produced per cycle at higher feed pressures, but the shortened time at higher pressures can result in the reduction of the CH4 purity.

  16. A Facile Synthesis of ZnCo2O4 Nanocluster Particles and the Performance as Anode Materials for Lithium Ion Batteries

    Science.gov (United States)

    Pan, Yue; Zeng, Weijia; Li, Lin; Zhang, Yuzi; Dong, Yingnan; Cao, Dianxue; Wang, Guiling; Lucht, Brett L.; Ye, Ke; Cheng, Kui

    2017-04-01

    ZnCo2O4 nanocluster particles (NCPs) were prepared through a designed hydrothermal method, with the assistance of a surfactant, sodium dodecyl benzene sulfonate. The crystalline structure and surface morphology of ZnCo2O4 were investigated by XRD, XPS, SEM, TEM, and BET analyses. The results of SEM and TEM suggest a clear nanocluster particle structure of cubic ZnCo2O4 ( 100 nm in diameter), which consists of aggregated primary nanoparticles ( 10 nm in diameter), is achieved. The electrochemical behavior of synthesized ZnCo2O4 NCPs was investigated by galvanostatic discharge/charge measurements and cyclic voltammetry. The ZnCo2O4 NCPs exhibit a high reversible capacity of 700 mAh g-1 over 100 cycles under a current density of 100 mA g-1 with an excellent coulombic efficiency of 98.9% and a considerable cycling stability. This work demonstrates a facile technique designed to synthesize ZnCo2O4 NCPs which show great potential as anode materials for lithium ion batteries.

  17. Stratification of co-evolving genomic groups using ranked phylogenetic profiles

    Directory of Open Access Journals (Sweden)

    Tsoka Sophia

    2009-10-01

    Full Text Available Abstract Background Previous methods of detecting the taxonomic origins of arbitrary sequence collections, with a significant impact to genome analysis and in particular metagenomics, have primarily focused on compositional features of genomes. The evolutionary patterns of phylogenetic distribution of genes or proteins, represented by phylogenetic profiles, provide an alternative approach for the detection of taxonomic origins, but typically suffer from low accuracy. Herein, we present rank-BLAST, a novel approach for the assignment of protein sequences into genomic groups of the same taxonomic origin, based on the ranking order of phylogenetic profiles of target genes or proteins across the reference database. Results The rank-BLAST approach is validated by computing the phylogenetic profiles of all sequences for five distinct microbial species of varying degrees of phylogenetic proximity, against a reference database of 243 fully sequenced genomes. The approach - a combination of sequence searches, statistical estimation and clustering - analyses the degree of sequence divergence between sets of protein sequences and allows the classification of protein sequences according to the species of origin with high accuracy, allowing taxonomic classification of 64% of the proteins studied. In most cases, a main cluster is detected, representing the corresponding species. Secondary, functionally distinct and species-specific clusters exhibit different patterns of phylogenetic distribution, thus flagging gene groups of interest. Detailed analyses of such cases are provided as examples. Conclusion Our results indicate that the rank-BLAST approach can capture the taxonomic origins of sequence collections in an accurate and efficient manner. The approach can be useful both for the analysis of genome evolution and the detection of species groups in metagenomics samples.

  18. Density profiles of Ar adsorbed in slits of CO2: Spontaneous symmetry breaking revisited

    Science.gov (United States)

    Szybisz, Leszek; Sartarelli, Salvador A.

    2008-03-01

    A recently reported symmetry breaking of density profiles of fluid argon confined by two parallel solid walls of carbon dioxide is studied. The calculations are performed in the framework of a nonlocal density functional theory. It is shown that the existence of such asymmetrical solutions is restricted to a special choice for the adsorption potential, where the attraction of the solid-fluid interaction is reduced by the introduction of a hard-wall repulsion. The behavior as a function of the slit's width is also discussed. All the results are placed in the context of the current knowledge on this matter.

  19. Elevated CO{sub 2} in a prototype free-air CO{sub 2} enrichment facility affects photosynthetic nitrogen relations in a maturing pine forest

    Energy Technology Data Exchange (ETDEWEB)

    Ellsworth, D.S.; LaRoche, J.; Hendrey, G.R.

    1998-03-01

    A maturing loblolly pine (Pinus taeda L.) forest was exposed to elevated CO{sub 2} in the natural environment in a perturbation study conducted over three seasons using the free-air CO{sub 2} enrichment (FACE) technique. At the time measurements were begun in this study, the pine canopy was comprised entirely of foliage which had developed under elevated CO{sub 2} conditions (atmospheric CO{sub 2} {approx} 550 {micro}mol/mol{sup {minus}1}). Measurements of leaf photosynthetic responses to CO{sub 2} were taken to examine the effects of elevated CO{sub 2} on photosynthetic N nutrition in a pine canopy under elevated CO{sub 2}. Photosynthetic CO{sub 2} response curves (A-c{sub i} curves) were similar in FACE trees under elevated CO{sub 2} compared with counterpart trees in ambient plots for the first foliage cohort produced in the second season of CO{sub 2} exposure, with changes in curve form detected in the foliage cohorts subsequently produced under elevated CO{sub 2}. Differences in the functional relationship between carboxylation rate and N{sub a} suggest that for a given N{sub a} allocated among successive cohorts of foliage in the upper canopy, V{sub c max} was 17% lower in FACE versus Ambient trees. The authors also found that foliar Rubisco content per unit total protein derived from Western blot analysis was lower in late-season foliage in FACE foliage compared with ambient-grown foliage. The results illustrate a potentially important mode of physiological adjustment to growth conditions that may operate in forest canopies. Findings suggest that mature loblolly pine trees growing in the field may have the capacity for shifts in intrinsic nitrogen utilization for photosynthesis under elevated CO{sub 2} that are not dependent on changes in leaf N. Findings suggest a need for continued examination of internal feedbacks at the whole-tree and ecosystem level in forests that may influence long-term photosynthetic responses to elevated CO{sub 2}.

  20. Separation of CO2 in a Solid Waste Management Incineration Facility Using Activated Carbon Derived from Pine Sawdust

    Directory of Open Access Journals (Sweden)

    Inés Durán

    2017-06-01

    Full Text Available The selective separation of CO2 from gas mixtures representative of flue gas generated in waste incineration systems is studied on two activated carbons obtained from pine sawdust and compared to a commercial activated carbon. Dynamic adsorption experiments were conducted in a fixed-bed adsorption column using a binary mixture (N2/CO2 with a composition representative of incineration streams at temperatures from 30 to 70 °C. The adsorption behavior of humid mixtures (N2/CO2/H2O was also evaluated in order to assess the influence of water vapor in CO2 adsorption at different relative humidity in the feed gas: 22% and 60%. Moreover, CO2 adsorption was studied in less favorable conditions, i.e., departing from a bed initially saturated with H2O. In addition, the effect of CO2 on H2O adsorption was examined. Experimental results showed that the CO2 adsorption capacity can be reduced significantly by the adsorption of H2O (up to 60% at high relative humidity conditions. On the other hand, the breakthrough tests over the adsorbent initially saturated with water vapor indicated that H2O is little affected by CO2 adsorption. The experimental results pointed out the biomass based carbons as best candidates for CO2 separation under incineration flue gas conditions.

  1. FACTORS ASSOCIATED WITH TB/HIV CO-INFECTION AMONG DRUG SENSITIVE TUBERCULOSIS PATIENTS MANAGED IN A SECONDARY HEALTH FACILITY IN LAGOS, NIGERIA.

    Science.gov (United States)

    Adejumo, Olusola A; Daniel, Olusoji J; Otesanya, Andrew F; Adegbola, Adebukola A; Femi-Adebayo, Temitope; Bowale, Abimbola; Adesola, Sunday; Kuku, Olugbenga O; Otemuyiwa, Kehinde O; Oladega, Shafaatu N; Johnson, Eze O; Falana, Ayodeji A; Dawodu, Olusola; Owuna, Henry; Osoba, Ganiyat; Dacosta, Adetokunbo

    2017-01-01

    This study assessed factors associated with TB/HIV co-infection among TB patients managed in a secondary health facility in Lagos Nigeria. A retrospective review of treatment cards of patients seen at a secondary referral hospital between January 1 2014 and December 31 2014 was conducted. Treatment outcomes and factors associated with TB/HIV co-infection were assessed. Of the 334 records of patients reviewed, the proportion of patients with TB/HIV co-infection was 21.6%. The odds of having TB/HIV co-infection was 2.7 times higher among patients above 40 years than patients less than 25 years (AOR 2.7 95% CI 1.1 - 6.5, p =0.030). In addition, the odds of having TB/HIV co-infection was 3.3 higher among extra-pulmonary TB cases (AOR 3.3; 95% CI 1.2 - 9.5; p = 0.026) and 2.1 times higher among retreated patients (AOR 2.1; 95% CI 1.1 - 3.9; p = 0.017) than pulmonary TB and new patients respectively. The chance of having TB/HIV co-infection was 2.7-fold more in patients with poor treatment outcomes than patients with treatment success (AOR 2.7; 95%CI 1.3 - 5.4; p =0.006). TB/HIV co-infection rate was high in the study area. There is need to put measures in place to improve treatment outcomes of TB/HIV co-infected patients.

  2. Adaptive and maladaptive expression of the mRNA regulatory protein HuR

    Institute of Scientific and Technical Information of China (English)

    Suman; Govindaraju; Beth; S; Lee

    2013-01-01

    The RNA-binding proteins involved in regulation of mRNA post-transcriptional processing and translation control the fates of thousands of mRNA transcripts and basic cellular processes. The best studied of these, HuR, is well characterized as a mediator of mRNA stability and translation, and more recently, as a factor in nuclear functions such as pre-mRNA splicing. Due to HuR’s role in regulating thousands of mRNA transcripts, including those for other RNA-binding proteins, HuR can act as a master regulator of cell survival and proliferation. HuR itself is subject to multiple post-translationa modifications including regulation of its nucleocytoplasmic distribution. However, the mechanisms that govern HuR levels in the cell have only recently begun to be defined. These mechanisms are critical to cell health, as it has become clear in recent years that aberrant expression of HuR can lead alternately to decreased cell viability or to promotion of pathological proliferation and invasiveness. HuR is expressed as alternate mRNAs that vary in their untranslated regions, leading to differences in transcript stability and translatability. Multiple transcription factors and modulators of mRNA stability that regulate HuR mRNA expression have been identified. In addition, translation of HuR is regulated by numerous microRNAs, several of which have been demonstrated to have anti-tumor properties due to their suppression of HuR expression. This review summarizes the current state of knowledge of the factors that regulate HuR expression, along with the circumstances under which these factors contribute to cancer and inflammation.

  3. Quantification of greenhouse gas emissions from a biological waste treatment facility

    DEFF Research Database (Denmark)

    Jensen, Morten Bang; Møller, Jacob; Mønster, Jacob

    2017-01-01

    influence on the overall environmental impact of the treatment facility, assessed by consequential life cycle assessment. Including the higher whole-site fugitive emissions led to an increase in global warming potential, from a saving of 97kgCO2-eq.tonne-1 of treated waste (wet weight) to a loading of 71kg......Whole-site emissions of methane and nitrous oxide, from a combined dry anaerobic digestion and composting facility treating biowaste, were quantified using a tracer dispersion technique that combines a controlled tracer gas release from the treatment facility with time-resolved concentration...... CO2-eq. tonne-1, ultimately flipping the environmental profile of the treatment facility....

  4. Concentrations, profiles, and estimated human exposures for polychlorinated dibenzo-p-dioxins and dibenzofurans from electronic waste recycling facilities and a chemical industrial complex in Eastern China.

    Science.gov (United States)

    Ma, Jing; Kannan, Kurunthachalam; Cheng, Jinping; Horii, Yuichi; Wu, Qian; Wang, Wenhua

    2008-11-15

    Environmental pollution arising from electronic waste (e-waste) disposal and recycling has received considerable attention in recent years. Treatment, at low temperatures, of e-wastes that contain polyvinylchloride and related polymers can release polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs). Although several studies have reported trace metals and polybrominated diphenyl ethers (PBDEs) released from e-waste recycling operations, environmental contamination and human exposure to PCDD/Fs from e-waste recycling operations are less well understood. In this study, electronic shredder waste and dust from e-waste facilities, and leaves and surface soil collected in the vicinity of a large scale e-waste recycling facility in Taizhou, Eastern China, were analyzed for total PCDD/ Fs including 2,3,7,8-substituted congeners. We also determined PCDD/Fs in surface agricultural soils from several provinces in China for comparison with soils from e-waste facilities. Concentrations of total PCDD/Fs were high in all of the matrices analyzed and ranged from 30.9 to 11400 pg/g for shredder waste, 3460 to 9820 pg/g dry weight for leaves, 2560 to 148000 pg/g dry weight for workshop-floor dust, and 854 to 10200 pg/g dry weight for soils. We also analyzed surface soils from a chemical industrial complex (a coke-oven plant, a coal-fired power plant, and a chlor-alkali plant) in Shanghai. Concentrations of total PCDD/Fs in surface soil (44.5-531 pg/g dry wt) from the chemical industrial complex were lower than the concentrations found in soils from e-waste recycling plants, but higher than the concentrations found in agricultural soils. Agricultural soils from six cities in China contained low levels (3.44-33.8 pg/g dry wt) of total PCDD/Fs. Profiles of dioxin toxic equivalents (TEQs) of 2,3,7,8-PCDD/Fs in soils from e-waste facilities in Taizhou differed from the profiles found in agricultural soils. The estimated daily intakes of TEQs of PCDD/ Fs via soil/dust ingestion

  5. A Facile Synthesis of MPd (M=Co, Cu) Nanoparticles and Their Catalysis for Formic Acid Oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Mazumder, Vismadeb [Brown University; Chi, Miaofang [ORNL; Mankin, Max [Brown University; Liu, Yi [Brown University; Metin, Onder [Ataturk University; Sun, Daohua [Xiamen University, China; More, Karren Leslie [ORNL; Sun, Shouheng [Brown University

    2012-01-01

    Monodisperse CoPd nanoparticles (NPs) were synthesized and studied for catalytic formic acid (HCOOH) oxidation (FAO). The NPs were prepared by coreduction of Co(acac)2 (acac = acetylacetonate) and PdBr2 at 260 C in oleylamine and trioctylphosphine, and their sizes (5-12 nm) and compositions (Co10Pd90 to Co60Pd40) were controlled by heating ramp rate, metal salt concentration, or metal molar ratios. The 8 nm CoPd NPs were activated for HCOOH oxidation by a simple ethanol wash. In 0.1 M HClO4 and 2 M HCOOH solution, their catalytic activities followed the trend of Co50Pd50 > Co60Pd40 > Co10Pd90 > Pd. The Co50Pd50 NPs had an oxidation peak at 0.4 V with a peak current density of 774 A/gPd. As a comparison, commercial Pd catalysts showed an oxidation peak at 0.75 V with peak current density of only 254 A/gPd. The synthesis procedure could also be extended to prepare CuPd NPs when Co(acac)2 was replaced by Cu(ac)2 (ac = acetate) in an otherwise identical condition. The CuPd NPs were less active catalysts than CoPd or even Pd for FAO in HClO4 solution. The synthesis provides a general approach to Pd-based bimetallic NPs and will enable further investigation of Pd-based alloy NPs for electro-oxidation and other catalytic reactions.

  6. Fingerprint Recognition Using Local Features and Hu Moments

    Directory of Open Access Journals (Sweden)

    G. Aguilar-Torres

    2012-10-01

    Full Text Available Person identification systems based on fingerprint patterns called Automatic Fingerprint Identification Systems, AFIS,are some of the most widely used biometric methods since they provide a high degree of success. The accuracy ofAFIS is mainly due to some unique characteristics called minutiae, which are points where a curve track finishes,intersects with another curve track, or branches off. During past decades several efficient minutia-based fingerprintrecognition algorithms have been proposed which achieve false recognition rates close to 1%, however, theirrecognition rate may be still improved. To this end, this paper presents a fingerprint recognition method using acombination of the Fast Fourier Transform (FFT with Gabor filters for image enhancement. Next, fingerprintrecognition is carried out using a novel recognition stage based on Local Features and Hu invariant moments forverification.

  7. MORPHOLOGY, IN VITRO - DEGRADATION AND DRUG RELEASE PROFILE OF POLY (ETHYLENE-CO-VINYL ACETATE / MICROCRYSTALLINE CELLULOSE ACETATE

    Directory of Open Access Journals (Sweden)

    K. Lakshmi Narayana

    2011-06-01

    Full Text Available Microcrystalline cellulose acetate (MCC was incorporated in poly (ethylene-co-vinyl acetate (EVA at different loading. The morphology, swelling properties and drug release profile were studied with respect to MCC loading to study its potential application as ocular inserts. The XRD patterns showed a good compatibility between the components. However swelling ratio and in-vitro degradation of EVA increase with MCC loading. This has been explained in terms of the hygroscopic nature of cellulose acetate. The study shows that EVA/MCC system can be tuned in terms of important parameters such as swelling behavior, in vitro release and degradation by varying blend composition, thus fulfilling specific biomedical requirements.

  8. Facile Synthesis of Core/Shell-like NiCo2O4-Decorated MWCNTs and its Excellent Electrocatalytic Activity for Methanol Oxidation

    Science.gov (United States)

    Ko, Tae-Hoon; Devarayan, Kesavan; Seo, Min-Kang; Kim, Hak-Yong; Kim, Byoung-Suhk

    2016-02-01

    The design and development of an economic and highly active non-precious electrocatalyst for methanol electrooxidation is challenging due to expensiveness of the precursors as well as processes and non-ecofriendliness. In this study, a facile preparation of core-shell-like NiCo2O4 decorated MWCNTs based on a dry synthesis technique was proposed. The synthesized NiCo2O4/MWCNTs were characterized by infrared spectroscopy, scanning electron microscopy, transmission electron microscopy, X-ray diffraction, and selected area energy dispersive spectrum. The bimetal oxide nanoparticles with an average size of 6 ± 2 nm were homogeneously distributed onto the surface of the MWCNTs to form a core-shell-like nanostructure. The NiCo2O4/MWCNTs exhibited excellent electrocatalytic activity for the oxidation of methanol in an alkaline solution. The NiCo2O4/MWCNTs exhibited remarkably higher current density of 327 mA/cm2 and a lower onset potential of 0.128 V in 1.0 M KOH with as high as 5.0 M methanol. The impressive electrocatalytic activity of the NiCo2O4/MWCNTs is promising for development of direct methanol fuel cell based on non-Pt catalysts.

  9. Adsorption Profile of Basic Dye onto Novel Fabricated Carboxylated Functionalized Co-Polymer Nanofibers

    Directory of Open Access Journals (Sweden)

    Marwa F. Elkady

    2016-04-01

    Full Text Available Acrylonitrile-Styrene co-polymer was prepared by solution polymerization and fabricated into nanofibers using the electrospinning technique. The nanofiber polarization was enhanced through its surface functionalization with carboxylic acid groups by simple chemical modification. The carboxylic groups’ presence was dedicated using the FT-IR technique. SEM showed that the nanofiber attains a uniform and porous structure. The equilibrium and kinetic behaviors of basic violet 14 dye sorption onto the nanofibers were examined. Both Langmuir and Temkin models are capable of expressing the dye sorption process at equilibrium. The intraparticle diffusion and Boyd kinetic models specified that the intraparticle diffusion step was the main decolorization rate controlling the process.

  10. Gene co-expression networks and profiles reveal potential biomarkers of boar taint in pigs

    DEFF Research Database (Denmark)

    Drag, M.; Skinkyté-Juskiené, R.; Do, D. N.

    Boar taint (BT) is an offensive odour or taste of porcine meat which may occur in entire male pigs due to skatole and androstenone accumulation. To avoid BT, castration of young piglets is performed but this strategy is under debate due to animal welfare concerns. The study aimed to reveal...... synthesis. In testis, >80 DE genes were functionally classified by the PANTHER tool to “Gonadotropin releasing hormone receptor” and “Wnt signaling” pathways which play a role in reproductive maturation and proliferation of spermatogonia, respectively. WGCNA was used to build co-expression modules...... and enrichment analysis and semantic filtering revealed the GO terms “catalytic activity” and “transferase activity” to be overrepresented (p hormones. Extraction of hub...

  11. CO

    NARCIS (Netherlands)

    Hoins, M.; Eberlein, T.; Van de Waal, D.B.; Sluijs, A.; Reichart, G.-J.; Rost, B.

    2016-01-01

    Carbon isotope fractionation (ep) between the inorganic carbon source and organic matter has been proposed tobe a function of pCO2. To understand the CO2-dependency of ep and species-specific differences therein, inorganiccarbon fluxes in the four dinoflagellate species Alexandriumfundyense, Scripps

  12. “Meticulous Crafting” and “Plain Style”: Hu Shi's Prose

    Institute of Scientific and Technical Information of China (English)

    ChenPingyuan; ZhuShida; DavidKelly

    2004-01-01

    Hu Shi's Outline History of Chinese Philosophy, despite a number of shortcomings, opened a new era for an academic prose in vernacular Chinese. Hu set great store by the structural features of a """"work,"""" arguing that it was not enough to assemble quotes,

  13. A Meta Analysis and Hierarchical Classification of HU-Based Atherosclerotic Plaque Characterization Criteria

    NARCIS (Netherlands)

    Kristanto, Wisnumurti; van Ooijen, Peter M. A.; Jansen-van der Weide, Marijke C.; Vliegenthart, Rozemarijn; Oudkerk, Matthijs

    2013-01-01

    Background: Many computed tomography (CT) studies have reported that lipid-rich, presumably rupture-prone atherosclerotic plaques can be characterized according to their Hounsfield Unit (HU) value. However, the published HU-based characterization criteria vary considerably. The present study aims to

  14. HuD Regulates Coding and Noncoding RNA to Induce APP→Aβ Processing

    Directory of Open Access Journals (Sweden)

    Min-Ju Kang

    2014-06-01

    Full Text Available The primarily neuronal RNA-binding protein HuD is implicated in learning and memory. Here, we report the identification of several HuD target transcripts linked to Alzheimer’s disease (AD pathogenesis. HuD interacted with the 3′ UTRs of APP mRNA (encoding amyloid precursor protein and BACE1 mRNA (encoding β-site APP-cleaving enzyme 1 and increased the half-lives of these mRNAs. HuD also associated with and stabilized the long noncoding (lncRNA BACE1AS, which partly complements BACE1 mRNA and enhances BACE1 expression. Consistent with HuD promoting production of APP and APP-cleaving enzyme, the levels of APP, BACE1, BACE1AS, and Aβ were higher in the brain of HuD-overexpressing mice. Importantly, cortex (superior temporal gyrus from patients with AD displayed significantly higher levels of HuD and, accordingly, elevated APP, BACE1, BACE1AS, and Aβ than did cortical tissue from healthy age-matched individuals. We propose that HuD jointly promotes the production of APP and the cleavage of its amyloidogenic fragment, Aβ.

  15. Cobicistat versus ritonavir boosting and differences in the drug-drug interaction profiles with co-medications.

    Science.gov (United States)

    Marzolini, Catia; Gibbons, Sara; Khoo, Saye; Back, David

    2016-07-01

    Nearly all HIV PIs and the integrase inhibitor elvitegravir require a pharmacokinetic enhancer in order to achieve therapeutic plasma concentrations at the desired dose and frequency. Whereas ritonavir has been the only available pharmacokinetic enhancer for more than a decade, cobicistat has recently emerged as an alternative boosting agent. Cobicistat and ritonavir are equally strong inhibitors of cytochrome P450 (CYP) 3A4 and consequently were shown to be equivalent pharmacokinetic enhancers for elvitegravir and for the PIs atazanavir and darunavir. Since cobicistat is a more selective CYP inhibitor than ritonavir and is devoid of enzyme-inducing properties, differences are expected in their interaction profiles with some co-medications. Drugs whose exposure might be altered by ritonavir but unaltered by cobicistat are drugs primarily metabolized by CYP1A2, CYP2B6, CYP2C8, CYP2C9 and CYP2C19 or drugs undergoing mainly glucuronidation. Thus, co-medications should be systematically reviewed when switching the pharmacokinetic enhancer to anticipate potential dosage adjustments. © The Author 2016. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  16. Facile Synthesis of SrCO3-Sr(OH2/PPy Nanocomposite with Enhanced Photocatalytic Activity under Visible Light

    Directory of Open Access Journals (Sweden)

    Alfredo Márquez-Herrera

    2016-01-01

    Full Text Available Pyrrole monomer was chemically polymerized onto SrCO3-Sr(OH2 powders to obtain SrCO3-Sr(OH2/polypyrrole nanocomposite to be used as a candidate for photocatalytic degradation of methylene blue dye (MB. The material was characterized by Fourier transform infrared (FTIR spectroscopy, UV/Vis spectroscopy, and X-ray diffraction (XRD. It was observed from transmission electronic microscopy (TEM analysis that the reported synthesis route allows the production of SrCO3-Sr(OH2 nanoparticles with particle size below 100 nm which were embedded within a semiconducting polypyrrole matrix (PPy. The SrCO3-Sr(OH2 and SrCO3-Sr(OH2/PPy nanocomposites were tested in the photodegradation of MB dye under visible light irradiation. Also, the effects of MB dye initial concentration and the catalyst load on photodegradation efficiency were studied and discussed. Under the same conditions, the efficiency of photodegradation of MB employing the SrCO3-Sr(OH2/PPy nanocomposite increases as compared with that obtained employing the SrCO3-Sr(OH2 nanocomposite.

  17. Development of an integrated methodology in support of remaining life assessment of Co-60 based gamma irradiation facilities

    NARCIS (Netherlands)

    Varde, P. V.; Joshi, N. S.; Agarwal, Mayank; Shrivastava, Amit; Bandi, L. N.; Kohli, A. K.

    2011-01-01

    An integrated approach has been developed for the remaining life assessment of an irradiation facility. The probabilistic safety assessment (PSA) was performed for the plant to develop the quantified indicators of safety for various situations. PSA results were used to identify and prioritize the sy

  18. Usability of optical spectrum analyzer in measuring atmospheric CO2 and CH4 column densities: inspection with FTS and aircraft profiles in situ

    Directory of Open Access Journals (Sweden)

    I. Morino

    2012-11-01

    Full Text Available The practical usefulness of a desktop optical spectrum analyzer (OSA for measuring atmospheric CO2 and CH4 column densities at surface sites was examined in two separate measurement campaigns. The first comparison involved operating the OSA in parallel with a high resolution Fourier transform spectroscopy (FTS situated at the University of Wollongong in Australia. Scale factors for the OSA were assigned for the column average volume mixing ratios of xCO2 and xCH4 by comparing with the well-studied FTS. The second method is a calibration against aircraft CO2 profiles in situ over Tsukuba in Japan obtained during a GOSAT validation campaign carried out from 28 January to 7 February 2011. The xCO2 values in the campaign, deduced by use of a derived OSA scale factor, were in excellent agreement with the integrated aircraft profiles.

  19. Usability of optical spectrum analyzer in measuring atmospheric CO2 and CH4 column densities: substantiation with FTS and aircraft profiles in situ

    Directory of Open Access Journals (Sweden)

    I. Morino

    2012-06-01

    Full Text Available The practical usefulness of a desktop optical spectrum analyzer (OSA for measuring atmospheric CO2 and CH4 column densities at surface sites was examined in two separate measurement campaigns. The first involved a long term measurement in parallel with a high resolution Fourier transform spectroscopy (FTS studies at the University of Wollongong in Australia. Scale factors of the OSA were assigned for the column average volume mixing ratios of xCO2 and xCH4 by comparing with the well-studied FTS. The second method is a calibration against aircraft CO2 profiles in situ over Tsukuba in Japan obtained during a GOSAT validation campaign carried out from 28 January to 7 February 2011. The xCO2 values in the campaign, deduced by use of a derived OSA scale factor, were in excellent agreement with the integrated aircraft profiles.

  20. Immune response in lung cancer mouse model mimics human anti-Hu reactivity

    Science.gov (United States)

    Kazarian, Meleeneh; Calbo, Joaquim; Proost, Natalie; Carpenter, Catherine L.; Berns, Anton; Laird-Offringa, Ite A.

    2009-01-01

    Most patients with paraneoplastic encephalomyelitis/sensory neuronopathy PEM/SN have small-cell lung cancer (SCLC) and develop antibodies against neuronal-specific Hu proteins, which are abnormally expressed in the tumor. Anti-Hu reactivity is present in ~16% of SCLC patients without PEM/SN. Here we test the hypothesis that engineered SCLC-prone mice may exhibit anti-Hu reactivity. We show that tumors from SCLC-prone mice misexpress Hu proteins, and 14% of mice harbor anti-Hu antibodies. Mice appear to show reactivity prior to clinical diagnosis of SCLC. This mouse model system will be useful to study SCLC-associated autoimmunity, its diagnostic value, and the potential protective role of oncoantigen-directed autoantibodies. PMID:19765830

  1. Facile synthesis of hierarchical CoMn2O4 microspheres with porous and micro-/nanostructural morphology as anode electrodes for lithium-ion batteries

    Science.gov (United States)

    Li, Yana; Hou, Xianhua; Li, Yajie; Ru, Qiang; Wang, Shaofeng; Hu, Shejun; Lam, Kwok-ho

    2017-09-01

    Hierarchical CoMn2O4 microspheres assembled by nanoparticles have been successfully synthesized by a facile hydrothermal method and a subsequent annealing treatment. XRD detection indicate the crystal structure. SEM and TEM results reveal the 3-dimensional porous and micro-/nanostructural microsphere assembled by nanoparticles with a size of 20-100 nm. The CoMn2O4 electrode show initial specific discharge capacity of approximately 1546 mAh/g at the current rates 100 mA/g with a coulombic efficiency of 66.7% and remarkable specific capacities (1029-485 mAh/g) at various current rates (100-2800 mA/g). [Figure not available: see fulltext.

  2. Facilely Tuning Porous NiCo2 O4 Nanosheets with Metal Valence-State Alteration and Abundant Oxygen Vacancies as Robust Electrocatalysts Towards Water Splitting.

    Science.gov (United States)

    Zhu, Chengzhou; Fu, Shaofang; Du, Dan; Lin, Yuehe

    2016-03-14

    Great efforts in developing clean electrochemical water splitting technology leads to the rational design and synthesis of highly efficient oxygen evolution reaction (OER) catalysts with low overpotential and fast reaction kinetics. Herein, we focus on the role that morphology and composition play in the OER performance to rationally design freestanding 3D porous NiCo2O4 nanosheets with metal valence states alteration and abundant oxygen vacancies as robust electrocatalysts towards water splitting. Besides metal valence-state alteration, surface modification regarding the evolution of oxygen vacancies is facilely realized upon the sodium borohydride treatment, which is beneficial for the enhanced OER performance. Taking advantage of the porous nanostructures and abundant surface activity sites with high reactivity, the resultant nanostructures exhibit excellent OER activity and stability in alkaline electrolytes that outperform that of pristine NiCo2O4 and commercial RuO2, thus holding great potential for the water splitting.

  3. Investigation of the HU-density conversion method and comparison of dose distribution for dose calculation on MV cone beam CT images

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Joo; Lee, Seu Ran; Suh, Tae Suk [Dept. of Biomedical Engineering, The Catholic University of Korea, Bucheon (Korea, Republic of)

    2011-11-15

    Modern radiation therapy techniques, such as Image-guided radiation therapy (IGRT), Adaptive radiation therapy (ART) has become a routine clinical practice on linear accelerators for the increase the tumor dose conformity and improvement of normal tissue sparing at the same time. For these highly developed techniques, megavoltage cone beam computed tomography (MVCBCT) system produce volumetric images at just one rotation of the x-ray beam source and detector on the bottom of conventional linear accelerator for real-time application of patient condition into treatment planning. MV CBCT image scan be directly registered to a reference CT data set which is usually kilo-voltage fan-beam computed tomography (kVFBCT) on treatment planning system and the registered image scan be used to adjust patient set-up error. However, to use MV CBCT images in radiotherapy, reliable electron density (ED) distribution are required. Patients scattering, beam hardening and softening effect caused by different energy application between kVCT, MV CBCT can cause cupping artifacts in MV CBCT images and distortion of Houns field Unit (HU) to ED conversion. The goal of this study, for reliable application of MV CBCT images into dose calculation, MV CBCT images was modified to correct distortion of HU to ED using the relationship of HU and ED from kV FBCT and MV CBCT images. The HU-density conversion was performed on MV CBCT image set using Dose difference map was showing in Figure 1. Finally, percentage differences above 3% were reduced depending on applying density calibration method. As a result, total error co uld be reduced to under 3%. The present study demonstrates that dose calculation accuracy using MV CBCT image set can be improved my applying HU-density conversion method. The dose calculation and comparison of dose distribution from MV CBCT image set with/without HU-density conversion method was performed. An advantage of this study compared to other approaches is that HU

  4. HuR knockdown changes the oncogenic potential of oral cancer cells.

    Science.gov (United States)

    Kakuguchi, Wataru; Kitamura, Tetsuya; Kuroshima, Takeshi; Ishikawa, Makoto; Kitagawa, Yoshimasa; Totsuka, Yasunori; Shindoh, Masanobu; Higashino, Fumihiro

    2010-04-01

    HuR binds to AU-rich element-containing mRNA to protect them from rapid degradation. Here, we show that knockdown of HuR changes the oncogenic properties of oral cancer cells. Oral squamous cell carcinoma cell lines, HSC-3 and Ca9.22, which express HuR protein and cytoplasmic AU-rich element mRNA more abundantly than normal cells, were subjected to HuR knockdown. In the HuR-knockdown cancer cells, the cytoplasmic expression of c-fos, c-myc, and COX-2 mRNAs was inhibited compared with those in cells that had been transfected with a control small interfering RNA, and the half-lives of these mRNAs were shorter than those of their counterparts in the control cells. HuR-knockdown cells failed to make colonies in soft agar, suggesting that the cells had lost their ability for anchorage-independent cell growth. Additionally, the motile and invasive activities of the cells decreased remarkably by HuR knockdown. Furthermore, the expression of cell cycle-related proteins, such as cyclin A, cyclin B1, cyclin D1, and cyclin-dependent kinase 1, was reduced in HuR-knockdown cancer cells, and HuR bound to cdk1 mRNA to stabilize it. These findings suggest that HuR knockdown changes the features of oral cancer cells, at least in part, by affecting their cell cycle and shows potential as an effective therapeutic approach.

  5. HuR contributes to Hepatic Stellate Cell activation and liver fibrosis

    Science.gov (United States)

    Woodhoo, A.; Iruarrizaga-Lejarreta, M.; Beraza, N.; García-Rodríguez, J.L.; Embade, N.; Fernández-Ramos, D.; Matinez-Lopez, N.; Gutiérrez, Virginia; Arteta, B.; Caballeria, J.; Lu, S.C.; Mato, J.M.; Varela-Rey, M.; Martinez-Chantar, M.L.

    2012-01-01

    RNA-binding proteins (RBPs) play a major role in control of mRNA turnover and translation rates. We examined the role of the RBP human antigen R (HuR) during cholestatic liver injury and hepatic stellate cells (HSC) activation. HuR silencing attenuated fibrosis development in vivo after BDL, reducing liver damage, oxidative stress, inflammation, and collagen and α-SMA (α-smooth muscle actin) expression. HuR expression increased in activated HSC from BDL mice and during HSC activation in vitro, and HuR silencing markedly reduced HSC activation. HuR regulated platelet-derived growth factor (PDGF)-induced proliferation and migration, and controlled expression of several mRNAs involved in these processes (Actin, MMP9, Cyclin D1 and B1). These functions of HuR were linked to its abundance and cytoplasmic localisation, controlled by PDGF, via ERK and PI3K activation, and ERK-LKB1 activation respectively. More importantly, we identified the tumor suppressor LKB1 as a novel downstream target of PDGF-induced ERK activation in HSC. HuR also controlled transforming growth factor beta (TGF-β-induced profibrogenic actions by regulating expression of TGF-β, α-SMA, and p21. This was likely due to an increased cytoplasmic localisation of HuR, controlled by TGF-β-induced p38 MAPK activation. Finally, we found that HuR and LKB1 (Ser428) levels were highly expressed in activated HSC in human cirrhotic samples. Conclusion: Our results show that HuR is important for pathogenesis of liver fibrosis development in the cholestatic injury model, for HSC activation, and for the response of activated HSC to PDGF and TGF-β. PMID:22576182

  6. Facile preparation of graphene supported Co{sub 3}O{sub 4} and NiO for reducing fire hazards of polyamide 6 composites

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Ningning; Song, Lei [State Key Laboratory of Fire Science, University of Science and Technology of China, Hefei, Anhui 230026 (China); Hull, T. Richard; Stec, Anna A. [Centre for Fire and Hazards Science, University of Central Lancashire, Preston PR1 2HE (United Kingdom); Wang, Bibo; Pan, Ying [State Key Laboratory of Fire Science, University of Science and Technology of China, Hefei, Anhui 230026 (China); Hu, Yuan, E-mail: yuanhu@ustc.edu.cn [State Key Laboratory of Fire Science, University of Science and Technology of China, Hefei, Anhui 230026 (China)

    2013-11-01

    Graphene nanosheets coated with Co{sub 3}O{sub 4} and NiO (denoted as GNS–Co{sub 3}O{sub 4} and GNS–NiO) have been facilely synthesized and then melt-mixed with polyamide 6 (PA6) to investigate the fire retardant properties of the composites. The Co{sub 3}O{sub 4} (20–40 nm) and NiO (8–15 nm) nanoparticles are homogeneously dispersed on the graphene surface, which has been demonstrated by X-ray diffraction, Raman spectroscopy, X-ray photoelectron spectroscopy and transmission electron microscopy. Scanning electron microscopy clearly shows that graphene, GNS–Co{sub 3}O{sub 4} and GNS–NiO are well dispersed in PA6 due to the electrostatic interaction. The visible increment in decomposition temperature and reduction in maximum decomposition rate are observed from thermogravimetric analysis for both PA6/GNS–Co{sub 3}O{sub 4} and PA6/GNS–NiO composites. Testing in the cone calorimeter shows that incorporating GNS–Co{sub 3}O{sub 4} and GNS–NiO confers PA6 with improved fire safety, as evidenced by the obvious delay in time to peak heat release and visible reduction in heat release rate, CO production rate and total smoke production. The result of the smoke density chamber indicates that GNS–Co{sub 3}O{sub 4} and GNS–NiO perform better than bare graphene in inhibiting the smoke emission. The flammable gaseous products are largely reduced with the addition of GNS–Co{sub 3}O{sub 4} and GNS–NiO as revealed from the thermogravimetric analysis/infrared spectrometry. The improvement in the fire safety is mainly due to the combination effect of physical barrier of graphene layers and catalytic carbonization of metal compounds. - Highlights: • Graphene are uniformly coated with Co{sub 3}O{sub 4} and NiO by chemical method. • The graphene hybrids could confer PA6 with improved fire safety. • The graphene hybrids perform well in inhibiting the smoke emission of PA6. • This work attempts to design a novel graphene based hybrids as flame retardants.

  7. Capability of Raman lidar for monitoring the variation of atmospheric CO2 profile

    Institute of Scientific and Technical Information of China (English)

    Zhao Pei-Tao; Zhang Yin-Chao; Wang Lian; Hu Shun-Xing; Su Jia; Cao Kai-Fa; Zhao Yue-Feng; Hu Huan-Ling

    2008-01-01

    Lidar (Light detection and ranging) has special capabilities for remote sensing of many different behaviours of the atmosphere.One of the techniques which show a great deal of promise for several applications is Raman scattering.The detecting capability,including maximum operation range and minimum detectable gas concentration is one of the most significant parameters for lidar remote sensing of pollutants.In this paper,based on the new method for evaluating the capabilities of a Raman lidar system,we present an evaluation of detecting capability of Raman lidar for monitoring atmospheric CO2 in Hefei.Numerical simulations about the influence of atmospheric conditions on lidar detecting capability were carried out,and a conclusion can be drawn that the maximum difference of the operation ranges caused by the weather conditions alone can reach about 0.4 to 0.5kin with a measuring precision within 30ppmv.The range of minimum detectable concentration caused by the weather conditions alone can reach about 20 to 35 ppmv in vertical direction for 20000 shots at a distance of 1 km on the assumption that other parameters are kept constant.The other corresponding parameters under different conditions are also given.The capability of Raman lidar operated in vertical direction was found to be superior to that operated in horizontal direction.During practical measurement with the Raman lidar whose hardware components were fixed,aerosol scattering extinction effect would be a significant factor that influenced the capability of Raman lidar.This work may be a valuable reference for lidar system designing,measurement accuracy improving and data processing.

  8. Pharmacokinetic and pharmacodynamic profile of empagliflozin, a sodium glucose co-transporter 2 inhibitor.

    Science.gov (United States)

    Scheen, André J

    2014-03-01

    Empagliflozin is an orally active, potent and selective inhibitor of sodium glucose co-transporter 2 (SGLT2), currently in clinical development to improve glycaemic control in adults with type 2 diabetes mellitus (T2DM). SGLT2 inhibitors, including empagliflozin, are the first pharmacological class of antidiabetes agents to target the kidney in order to remove excess glucose from the body and, thus, offer new options for T2DM management. SGLT2 inhibitors exert their effects independently of insulin. Following single and multiple oral doses (0.5-800 mg), empagliflozin was rapidly absorbed and reached peak plasma concentrations after approximately 1.33-3.0 h, before showing a biphasic decline. The mean terminal half-life ranged from 5.6 to 13.1 h in single rising-dose studies, and from 10.3 to 18.8 h in multiple-dose studies. Following multiple oral doses, increases in exposure were dose-proportional and trough concentrations remained constant after day 6, indicating a steady state had been reached. Oral clearance at steady state was similar to corresponding single-dose values, suggesting linear pharmacokinetics with respect to time. No clinically relevant alterations in pharmacokinetics were observed in mild to severe hepatic impairment, or in mild to severe renal impairment and end-stage renal disease. Clinical studies did not reveal any relevant drug-drug interactions with several other drugs commonly prescribed to patients with T2DM, including warfarin. Urinary glucose excretion (UGE) rates were higher with empagliflozin versus placebo and increased with dose, but no relevant impact on 24-h urine volume was observed. Increased UGE resulted in proportional reductions in fasting plasma glucose and mean daily glucose concentrations.

  9. Incidence of tuberculosis and immunological profile of TB/HIV co-infected patients in Nigeria

    Directory of Open Access Journals (Sweden)

    Baba Maiyaki Musa

    2015-01-01

    Full Text Available Background: We obtained estimates of the incidence of tuberculosis (TB among patients receiving HIV Treatment. We also modeled the relationship between incident TB and change in CD4 count over the follow-up period. Methods: We analyzed the incidence of TB over 10 years from initiation of HIV treatment among 345 HIV treatment-naοve persons, who were enrolled in a cohort in Kano, Nigeria. We used Generalized Estimating Equation [GEE] to identify determinants of TB incidence and model the relationship between the occurrences of TB with change in CD4 count over the follow-up period. We created Kaplan-Meier curves stratified by anti-retroviral therapy (ART treatment failure status to examine the effect of first line ART treatment failure on occurrence of TB. Result: During the 10-year period, 47(13.62% had TB [incidence was 7.43 per (1,000 person year]. It is associated with decreasing age (OR = 0.98, female gender (OR = 0.83, being on first line ART other than AZT (OR = 0.87, poor adherence (OR = 1.25, change in ART regimen (OR = 2.3 and ART treatment failure (OR = 1.51. Odds of TB occurrence was also associated with CD4 increment at 10 years (OR = 0.99. Those with TB/HIV co-infection tend to have statistically significant shorter time to failing first line ART regimen compared to those with HIV infection alone. Conclusion: There was high incidence of TB in the studied HIV cohort with a deleterious effect on the outcome of ART treatment. There is need for early TB screening and re-screening among all HIV patients.

  10. Understanding of CO{sub 2} interaction with thermally grown SiO{sub 2} on Si using IBA depth profiling techniques

    Energy Technology Data Exchange (ETDEWEB)

    Deokar, Geetanjali; D’Angelo, Marie; Briand, Emrick [INSP, UPMC, CNRS UMR 7588, 4 Place Jussieu, Paris F-75005 (France); Deville Cavellin, Catherine, E-mail: deville@univ-paris12.fr [INSP, UPMC, CNRS UMR 7588, 4 Place Jussieu, Paris F-75005 (France); Faculté des Sciences et Technologie UPEC, 61 Av., De Gaulle, Créteil F-94010 (France)

    2013-06-01

    Interactions between CO{sub 2} and SiO{sub 2} films thermally grown on Si have been studied using {sup 18}O and {sup 13}C as isotopic tracers associated with ion beam analysis (IBA) depth profiling techniques. From secondary ion mass spectrometry (SIMS) measurements no carbon from CO{sub 2} is detected in the silica while it is found in Si. These results suggest that CO{sub 2} diffuses through the silica. Exchanges of oxygen between CO{sub 2} and silica can be observed from {sup 18}O to {sup 16}O SIMS signals variation. The oxygen concentration depth profiles were determined quantitatively using the narrow resonance near 151 keV in the {sup 18}O(p,α){sup 15}N nuclear reaction (Narrow Resonance Profiling, NRP). We demonstrate that two distinct oxygen exchanges processes co-exist and we determine the diffusion coefficient of the CO{sub 2} molecule in the silica at 1100 °C.

  11. Facile fabrication of hierarchical ZnCo2O4/NiO core/shell nanowire arrays with improved lithium-ion battery performance.

    Science.gov (United States)

    Sun, Zhipeng; Ai, Wei; Liu, Jilei; Qi, Xiaoying; Wang, Yanlong; Zhu, Jianhui; Zhang, Hua; Yu, Ting

    2014-06-21

    We report a facile and controllable strategy for the fabrication of three-dimensional (3D) ZnCo2O4/NiO core/shell nanowire arrays (ZCO/NiO NWs) on nickel (Ni) foam substrates by a simple, cost-effective, two-step, solution-based method. Ultra-thin NiO nanosheets are revealed to grow uniformly on the porous ZnCo2O4 nanowires with many interparticle mesopores, resulting in the formation of 3D core/shell nanowire arrays with hierarchical architecture. In comparison with the pristine ZnCo2O4 nanowire arrays (ZCO NWs), the ZCO/NiO NWs exhibit significantly improved Li storage properties, in terms of higher capacity, enhanced rate capability and improved cycling stability when applied as binders and additive-free anode materials for lithium-ion batteries. The superior Li storage performance of the ZCO/NiO NWs could be attributed to the synergetic effect between the ZnCo2O4 core and the NiO shell, as well as its unique hierarchical architecture, which ensures a large specific surface area and good conductivity. Our results may offer very useful guidelines in scrupulously designing 3D core/shell nanowire-array electrodes using cheap, earth-abundant materials in energy storage applications.

  12. A Facile and Low-Cost Route to Heteroatom Doped Porous Carbon Derived from Broussonetia Papyrifera Bark with Excellent Supercapacitance and CO2 Capture Performance.

    Science.gov (United States)

    Wei, Tongye; Zhang, Qi; Wei, Xiaolin; Gao, Yong; Li, Huaming

    2016-03-03

    In this work, we present a facile and low-cost approach to synthesize heteroatom doped porous carbon via hydrothermal treatment of stem bark of broussonetia papyrifera (BP) as the biomass precursor in diluted sulfuric acid, and following thermal activation by KOH at 800 °C. The morphology, structure and textural property of the prepared porous carbon (PC) are investigated by scanning electron microscopy, transmission electron microscopy, N2 sorption isotherms, and X-ray photoelectron spectroscopy. The porous carbon possesses a high BET surface area of 1759 m(2) g(-1) and an average pore size of 3.11 nm as well as hetero-oxygen (9.09%) and nitrogen (1.7%) doping. Such porous carbon shows outstanding capacitive performances of 416 F g(-1) and 300 F g(-1) in three and two-electrode systems, respectively. As a solid-state adsorbent, the obtained porous carbon has an excellent CO2 adsorption capacity at ambient pressures of up to 6.71 and 4.45 mmol g(-1) at 0 and 25 °C, respectively. The results present one novel precursor-synthesis route for facile large-scale production of high performance porous carbon for a variety of great applications including energy storage and CO2 capture.

  13. Porous NiCo2O4 nanosheets/reduced graphene oxide composite: facile synthesis and excellent capacitive performance for supercapacitors.

    Science.gov (United States)

    Ma, Lianbo; Shen, Xiaoping; Ji, Zhenyuan; Cai, Xiaoqing; Zhu, Guoxing; Chen, Kangmin

    2015-02-15

    A composite with porous NiCo2O4 nanosheets attached on reduced graphene oxide (RGO) sheets is synthesized through a facile solution-based method combined with a simple thermal annealing process. The capacitive performances of the as-prepared NiCo2O4/RGO (NCG) composites as electrode materials are investigated. It is found that the NCG composites exhibit a high specific capacitance up to 1186.3 F g(-1) at the current density of 0.5 A g(-1), and superior cycling stability with about 97% of the initial capacitance after 100 cycles. The greatly enhanced capacitive performance of the NCG electrode can be attributed to the existence of RGO support, which serves as both conductive channels and active interface. The approach used in the synthesis provides a facile route for preparing graphene-binary metal oxide electrode materials. The remarkable capacitive performance of NCG composites will undoubtedly make them be attractive for high performance energy storage applications.

  14. Facile one-pot surfactant-free synthesis of uniform Pd6Co nanocrystals on 3D graphene as an efficient electrocatalyst toward formic acid oxidation

    Science.gov (United States)

    Zhang, Lian Ying; Zhao, Zhi Liang; Yuan, Weiyong; Li, Chang Ming

    2016-01-01

    Ultrasmall and uniform Pd6Co nanocrystals were deposited on 3D graphene by a facile one-pot surfactant-free route for a catalyst toward formic acid oxidation, showing a much higher electrocatalytic activity, larger peak current density and better stability than Pd/3DG, Pd/C as well as commercial Pd-C, and thus offering great potential for an efficient anode catalyst toward high performance direct formic acid fuel cells.Ultrasmall and uniform Pd6Co nanocrystals were deposited on 3D graphene by a facile one-pot surfactant-free route for a catalyst toward formic acid oxidation, showing a much higher electrocatalytic activity, larger peak current density and better stability than Pd/3DG, Pd/C as well as commercial Pd-C, and thus offering great potential for an efficient anode catalyst toward high performance direct formic acid fuel cells. Electronic supplementary information (ESI) available: Experimental section and supplementary figures. See DOI: 10.1039/c5nr08512h

  15. Facile synthesis of triazine-triphenylamine-based microporous covalent polymer adsorbent for flue gas CO2 capture

    KAUST Repository

    Das, Swapan Kumar

    2017-07-17

    The sustainable capture and sequestration of CO2 from flue gas emission is an important and unavoidable challenge to control greenhouse gas release and climate change. In this report, we describe a triazine-triphenylamine-based microporous covalent organic polymer under mild synthetic conditions. 13C and 15N solid-state NMR and FTIR analyses confirm the linkage of the triazine and triphenylamine components in the porous polymer skeleton. The material is composed of spherical particles 1.0 to 2.0 μm in size and possesses a high surface area (1104 m2/g). The material exhibits superb chemical robustness under acidic and basic conditions and high thermal stability. Single-component gas adsorption exhibits an enhanced CO2 uptake of 3.12 mmol/g coupled with high sorption selectivity for CO2/N2 of 64 at 273 K and 1 bar, whereas the binary gas mixture breakthrough study using a model flue gas composition at 298 K shows a high CO2/N2 selectivity of 58. The enhanced performance is attributed to the high Lewis basicity of the framework, as it favors the interaction with CO2.

  16. Regulation of the mRNA-binding protein HuR by posttranslational modification: spotlight on phosphorylation.

    Science.gov (United States)

    Eberhardt, Wolfgang; Doller, Anke; Pfeilschifter, Josef

    2012-06-01

    The ubiquitous mRNA-binding protein human antigen R (HuR) and its neuronal relatives (HuB, HuC, HuD) participate in the post-transcriptional regulation of many AU-rich element-bearing mRNAs. In addition to its originally described role in controlling mRNA decay, the binding of HuR to target mRNAs can affect many aspects of mRNA processing including splicing, polyadenylation, intracellular trafficking, translation and modulation of mRNA repression by miRNAs. In accordance to the growing list of signalling events which are involved in regulating these different HuR functions, recent data implicate that posttranslational modification, namely protein kinase-triggered phosphorylation of HuR plays a crucial role in connecting extracellular signal inputs to a specific post-transcriptional program by HuR. Notably, in addition to directly targeting HuR functions, posttranslational modifications of HuR have a major impact on the sequestration and binding to various HuR ligand proteins as has been demonstrated e.g. for the 14-3-3 chaperones. However, the detailed mechanisms of how a specific modification of HuR coordinates different aspects in HuR regulation are currently poorly understood. Due to the fact that most of the described HuR activities are closely related to its subcellular localization and the binding to cargo mRNA, this review will focus on these aspects of HuR functions and their control by posttranslational modification, particularly by HuR phosphorylations by different protein kinases.

  17. Environmental Management Waste Management Facility Proxy Waste Lot Profile 6.999 for Building K-25 West Wing, East Tennessee Technology Park, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Rigsby V.P.

    2009-02-12

    In 1989, the Oak Ridge Reservation (ORR), which includes the East Tennessee Technology Park (ETTP), was placed on the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) National Priorities List. The Federal Facility Agreement (FFA) (DOE 1992), effective January 1, 1992, now governs environmental restoration activities conducted under CERCLA at the ORR. Following signing of the FFA, U.S. Department of Energy (DOE), U.S. Environmental Protection Agency (EPA), and the state of Tennessee signed the Oak Ridge Accelerated Cleanup Plan Agreement on June 18, 2002. The purpose of this agreement is to define a streamlined decision-making process to facilitate the accelerated implementation of cleanup, resolve ORR milestone issues, and establish future actions necessary to complete the accelerated cleanup plan by the end of fiscal year 2008. While the FFA continues to serve as the overall regulatory framework for remediation, the Accelerated Cleanup Plan Agreement supplements existing requirements to streamline the decision-making process. Decontamination and decommissioning (D&D) activities of Bldg. K-25, the original gaseous diffusion facility, is being conducted by Bechtel Jacobs Company LLC (BJC) on behalf of the DOE. The planned CERCLA action covering disposal of building structure and remaining components from the K-25 building is scheduled as a non-time-critical CERCLA action as part of DOE's continuous risk reduction strategy for ETTP. The K-25 building is proposed for D&D because of its poor physical condition and the expense of surveillance and maintenance activities. The K-25/K-27 D&D Project proposes to dispose of the commingled waste listed below from the K-25 west side building structure and remaining components and process gas equipment and piping at the Environmental Management Waste Management Facility (EMWMF) under waste disposal proxy lot (WPXL) 6.999: (1) Building structure (e.g. concrete floors [excluding basement

  18. Surface-reconstructed Cu Electrode via a Facile Electrochemical Anodization-Reduction Process for Low Overpotential CO 2 reduction

    KAUST Repository

    Min, Shixiong

    2017-03-21

    A high-surface-area Cu electrode, fabricated by a simple electrochemical anodization-reduction method, exhibits high activity and selectivity for CO2 reduction at low overpotential in 0.1 M KHCO3 solution. A faradaic efficiency of 37% for HCOOH and 27% for CO production was achieved with the current density of 1.5 mA cm-2 at −0.64 V vs. RHE, much higher than that of polycrystalline Cu. The enhanced catalytic performance is a result of the formation of the high electrochemical active surface area and high density of preferred low-index facets.

  19. Environmental Management Waste Management Facility Waste Lot Profile 155.5 for K-1015-A Laundry Pit, East Tennessee Technology Park Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Bechtel Jacobs, Raymer J.E.

    2008-06-12

    In 1989, the Oak Ridge Reservation (ORR), which includes the East Tennessee Technology Park (ETTP), was placed on the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) National Priorities List. The Federal Facility Agreement (FFA) (DOE 1992), effective January 1, 1992, now governs environmental restoration activities conducted under CERCLA at the ORR. Following signing of the FFA, U.S. Department of Energy (DOE), U.S. Environmental Protection Agency (EPA), and the state of Tennessee signed the Oak Ridge Accelerated Cleanup Plan Agreement on June 18, 2003. The purpose of this agreement is to define a streamlined decision-making process to facilitate the accelerated implementation of cleanup, to resolve ORR milestone issues, and to establish future actions necessary to complete the accelerated cleanup plan by the end of fiscal year 2008. While the FFA continues to serve as the overall regulatory framework for remediation, the Accelerated Cleanup Plan Agreement supplements existing requirements to streamline the decision-making process. The disposal of the K-1015 Laundry Pit waste will be executed in accordance with the 'Record of Decision for Soil, Buried Waste, and Subsurface Structure Actions in Zone, 2, East Tennessee Technology Park, Oak Ridge, Tennessee' (DOB/ORAH-2161&D2) and the 'Waste Handling Plan for the Consolidated Soil and Waste Sites with Zone 2, East Tennessee Technology Park, Oak Ridge, Tennessee' (DOE/OR/01-2328&D1). This waste lot consists of a total of approximately 50 cubic yards of waste that will be disposed at the Environmental Management Waste Management Facility (EMWMF) as non-containerized waste. This material will be sent to the EMWMF in dump trucks. This profile is for the K-1015-A Laundry Pit and includes debris (e.g., concrete, metal rebar, pipe), incidental soil, plastic and wood, and secondary waste (such as plastic sheeting, hay bales and other erosion control materials, wooden

  20. Comparative transcriptional profiling of Bacillus cereus sensu lato strains during growth in CO2-bicarbonate and aerobic atmospheres.

    Directory of Open Access Journals (Sweden)

    Karla D Passalacqua

    Full Text Available BACKGROUND: Bacillus species are spore-forming bacteria that are ubiquitous in the environment and display a range of virulent and avirulent phenotypes. This range is particularly evident in the Bacillus cereus sensu lato group; where closely related strains cause anthrax, food-borne illnesses, and pneumonia, but can also be non-pathogenic. Although much of this phenotypic range can be attributed to the presence or absence of a few key virulence factors, there are other virulence-associated loci that are conserved throughout the B. cereus group, and we hypothesized that these genes may be regulated differently in pathogenic and non-pathogenic strains. METHODOLOGY/PRINCIPAL FINDINGS: Here we report transcriptional profiles of three closely related but phenotypically unique members of the Bacillus cereus group--a pneumonia-causing B. cereus strain (G9241, an attenuated strain of B. anthracis (Sterne 34F(2, and an avirulent B. cereus strain (10987--during exponential growth in two distinct atmospheric environments: 14% CO(2/bicarbonate and ambient air. We show that the disease-causing Bacillus strains undergo more distinctive transcriptional changes between the two environments, and that the expression of plasmid-encoded virulence genes was increased exclusively in the CO(2 environment. We observed a core of conserved metabolic genes that were differentially expressed in all three strains in both conditions. Additionally, the expression profiles of putative virulence genes in G9241 suggest that this strain, unlike Bacillus anthracis, may regulate gene expression with both PlcR and AtxA transcriptional regulators, each acting in a different environment. CONCLUSIONS/SIGNIFICANCE: We have shown that homologous and even identical genes within the genomes of three closely related members of the B. cereus sensu lato group are in some instances regulated very differently, and that these differences can have important implications for virulence. This study

  1. Structural characterization of the maytansinoid–monoclonal antibody immunoconjugate, huN901–DM1, by mass spectrometry

    National Research Council Canada - National Science Library

    Wang, Lintao; Amphlett, Godfrey; Blättler, Walter A; Lambert, John M; Zhang, Wei

    2005-01-01

    ...‐specific drug delivery. The immunoconjugate, huN901–DM1, composed of the humanized monoclonal IgG 1 antibody, huN901, and the maytansinoid drug, DM1, is being tested in clinical trials to treat small cell lung carcinoma (SCLC). huN901...

  2. Measurement of hard tissue density of head phantom based on the HU by using CBCT

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Moon Sun; Kang, Dong Wan; Kim, Jae Duk [School of Dentistry, Chosun University, Gwangju (Korea, Republic of)

    2009-09-15

    The purpose of this study was to determine a conversion coefficient for Hounsfield Units(HU) to material density (g cm{sup -3}) obtained from cone-beam computed tomography (CBMercuRay{sup TM}) data and to measure the hard tissue density based on the Hounsfield scale on dental head phantom. CT Scanner Phantom (AAPM) equipped with CT Number Insert consists of five cylindrical pins of materials with different densities and teflon ring was scanned by using the CBMercuRay{sup TM} (Hitachi, Tokyo, Japan) volume scanner. The raw data were converted into DICOM format and the HU of different areas of CT number insert measured by using CBWorks{sup TM}. Linear regression analysis and Student t-test were performed statistically. There was no significant difference (P>0.54) between real densities and measured densities. A linear regression was performed using the density, {rho} (g cm{sup -3}), as the dependent variable in terms of the HU (H). The regression equation obtained was {rho}=0.00072 H-0.01588 with an R2 value of 0.9968. Density values based on the Hounsfield scale was 1697.1 {+-} 24.9 HU in cortical bone, 526.5 {+-} 44.4 HU in trabecular bone, 2639.1 {+-} 48.7 HU in enamel, 1246.1 {+-} 39.4 HU in dentin of dental head phantom. CBCT provides an effective option for determination of material density expressed as Hounsfield Units.

  3. Clinical and psychoeducational profile of children with specific learning disability and co-occurring attention-deficit hyperactivity disorder

    Directory of Open Access Journals (Sweden)

    Karande Sunil

    2007-12-01

    Full Text Available Background: Almost 10% of school-going children have specific learning disability (SpLD in the form of dyslexia, dysgraphia and/ or dyscalculia. Attention-deficit hyperactivity disorder (ADHD occurs as a comorbidity in about 20% of these children. Aims: To document the clinical profile and academic history of children with SpLD and co-occurring ADHD. Settings and Design: Prospective observational study conducted in our clinic. Materials and Methods: From August to November 2004, 50 consecutively diagnosed children (34 boys, 16 girls were included in the study. SpLD was diagnosed on the basis of psychoeducational testing. Diagnosis of ADHD was made by DSM-IV-revised criteria. Detailed clinical and academic history and physical and neurological examination findings were noted. Statistical Analysis : Chi-square test or unpaired student′s t-test was applied wherever applicable. Results: The mean age of children was 11.4 years (±SD 2.5, range 7-17.1. Fifteen (30% children had a significant perinatal history, 12 (24% had delayed walking, 11 (22% had delayed talking, 5 (10% had microcephaly, 27 (54% displayed soft neurological signs and 10 (20% had primary nocturnal enuresis. There were no differentiating features between the two gender groups. Their academic problems were difficulties in writing (96%, inattentiveness (96%, difficulties in mathematics (74%, hyperactivity (68% and difficulties in reading (60%. All children had poor school performance, 15 (30% had already experienced class retention and 20 (40% had developed aggressive or withdrawn behavior. Conclusion: Children with SpLD and co-occurring ADHD need to be identified at an early age to prevent poor school performance and behavioral problems.

  4. On the ephemeris of the eclipsing polar HU Aquarii

    CERN Document Server

    Schwope, A D

    2014-01-01

    The magnetic cataclysmic variable HU Aquarii displayed pronounced quasi-periodic modulations of its eclipse timing. These were interpreted in terms of the light-travel time (LTT) effect caused by a circumbinary planet or planetary system. We report new photometric observations that revealed another precise eclipse timing for the October 2013 epoch, the first obtained in a high accretion state after many years in low or intermediate states. The eclipse was observed to occur earlier by 95.3 +- 2.0 s or 62.8 +- 2.0 s than expected for an assumed linear or quadratic ephemeris, respectively. The implied apparent strong evolution of the orbital period calls for a revision of the current planetary model or the planetary parameters. The object deserves further monitoring to uncover the true nature of the observed variability and to constrain the properties of the proposed planet or planetary system. The new observations prove that advanced amateur equipment can successfully be used in the growing field of planet sear...

  5. Facile Co-Assembly of a Dipeptide-Based Organogel toward Efficient Triplet-Triplet Annihilation Photonic Upconversion.

    Science.gov (United States)

    Liu, Xingcen; Fei, Jinbo; Zhu, Pengli; Li, Junbai

    2016-10-06

    By one-step molecular co-assembly, a diphenylalanine-based photonic upconversion organogel was constructed within 20 seconds. Impressively, such an assembled system exhibits green-to-blue triplet-triplet annihilation upconversion with a relative quantum yield of 12 % even under ambient conditions.

  6. HuR contributes to Hepatic Stellate Cell activation and liver fibrosis

    OpenAIRE

    Woodhoo, A.; Iruarrizaga-Lejarreta, M.; Beraza, N.; García-Rodríguez, J.L.; Embade, N.; Fernández-Ramos, D.; Matinez-Lopez, N.; Gutiérrez, Virginia; Arteta, B; Caballeria, J.; Lu, S.C. (Shelly C.); Mato, J.M. (José María); Varela-Rey, M.; Martinez-Chantar, M.L.

    2012-01-01

    RNA-binding proteins (RBPs) play a major role in control of mRNA turnover and translation rates. We examined the role of the RBP human antigen R (HuR) during cholestatic liver injury and hepatic stellate cells (HSC) activation. HuR silencing attenuated fibrosis development in vivo after BDL, reducing liver damage, oxidative stress, inflammation, and collagen and α-SMA (α-smooth muscle actin) expression. HuR expression increased in activated HSC from BDL mice and during HSC activation in vitro...

  7. Facile and Mild Strategy to Construct Mesoporous CeO2-CuO Nanorods with Enhanced Catalytic Activity toward CO Oxidation.

    Science.gov (United States)

    Chen, Guozhu; Xu, Qihui; Yang, Ying; Li, Cuncheng; Huang, Taizhong; Sun, Guoxin; Zhang, Shuxiang; Ma, Dongling; Li, Xu

    2015-10-28

    CeO2-CuO nanorods with mesoporous structure were synthesized by a facile and mild strategy, which involves an interfacial reaction between Ce2(SO4)3 precursor and NaOH ethanol solution at room temperature to obtain mesoporous CeO2 nanorods, followed by a solvothermal treatment of as-prepared CeO2 and Cu(CH3COO)2. Upon solvothermal treatment, CuO species is highly dispersed onto the CeO2 nanorod surface to form CeO2-CuO composites, which still maintain the mesoporous feature. A preliminary CO catalytic oxidation study demonstrated that the CeO2-CuO samples exhibited strikingly high catalytic activity, and a high CO conversion rate was observed without obvious loss in activity even after thermal treatment at a high temperature of 500 °C. Raman spectroscopy, X-ray photoelectron spectroscopy (XPS), and hydrogen temperature-programmed reduction (H2-TPR) analysis revealed that there is a strong interaction between CeO2 and CuO. Moreover, it was found that the introduction of CuO species into CeO2 generates oxygen vacancies, which is highly likely to be responsible for high catalytic activity toward CO oxidation of the mesoporous CeO2-CuO nanorods.

  8. A facile method to control the size and magnetic properties of CoFe{sub 2}O{sub 4} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ayyappan, S. [SMARTS, NDED, Metallurgy and Materials Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102, Tamilnadu (India); Philip, John, E-mail: philip@igcar.gov.in [SMARTS, NDED, Metallurgy and Materials Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102, Tamilnadu (India); Raj, Baldev [SMARTS, NDED, Metallurgy and Materials Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102, Tamilnadu (India)

    2009-06-15

    We discuss a facile approach to control the size and the magnetic properties of CoFe{sub 2}O{sub 4} nanoparticles by varying the solvent dielectric constant. X-ray diffraction (XRD), Transmission Electron Microscopy (TEM), Thermo-Gravimetric Analysis (TGA) and Vibrating Sample Magnetometer (VSM) are used to study the structural, thermal and magnetic properties of CoFe{sub 2}O{sub 4} nanoparticles. XRD analysis confirms the cubic spinel phase of CoFe{sub 2}O{sub 4} nanoparticles. The average particle size increases from 10 {+-} 1 to 16 {+-} 1 nm as the dielectric constant of the solvent is increased from 47 to 80. The room temperature magnetization measurement confirms that the saturation magnetization increases with particle size. The linear dependence of the dielectric constant of the medium on particle size is in good agreement with nucleation theory. Our experimental findings unambiguously confirm that the change in supersaturation has a significant influence on the nucleation rate and the particle size.

  9. The Co-Evolution of Total Density Profiles and Central Dark Matter Fractions in Simulated Early-Type Galaxies

    CERN Document Server

    Remus, Rhea-Silvia; Naab, Thorsten; Burkert, Andreas; Hirschmann, Michaela; Hoffmann, Tadziu L; Johansson, Peter H

    2016-01-01

    We present evidence from cosmological hydrodynamical simulations for a co-evolution of the slope of the total (dark and stellar) mass density profiles, gamma_tot, and the dark matter fractions within the half-mass radius, f_DM, in early-type galaxies. The relation can be described as gamma_tot = A f_DM + B and holds for all systems at all redshifts. We test different feedback models and find that the general trend is independent of the assumed feedback processes and is set by the decreasing importance of dissipative processes towards lower redshifts and for more massive systems. Early-type galaxies are smaller, more concentrated, have lower dark matter fractions and steeper total density slopes at high redshifts and at lower masses for a given redshift. The values for A and B change distinctively with the assumed feedback model, and thus this relation can be used as a test for feedback models. A similar correlation exists between gamma_tot and the stellar mass surface density Sigma_*. The model with weak stel...

  10. Facile synthesis of magnetic metal (Mn, Fe, Co, and Ni) oxides nanocrystals via a cation-exchange reaction.

    Science.gov (United States)

    Ning, Jiajia; Xiao, Guanjun; Wang, Li; Zou, Bo; Liu, Bingbing; Zou, Guangtian

    2011-02-01

    Magnetic metal (Mn, Fe, Co, and Ni) oxides nanocrystals with small size and uniform size distribution are synthesized via a cation-exchange reaction. Two experimental stages are included in the synthesis of metal oxides nanocrystals. Firstly, Cu(OH)2 decomposes to CuO nanocrystals, induced by free metal cations. Compared to CuO nanocrystals produced without any free metal cation, the free metal cation has an important influence on the shape and size of CuO. Secondly, free metal cations exchange with the Cu2+ cation in the CuO nanocrystals to get Mn3O4, Fe2O3, CoO and NiO nanocrystals by cation-exchange reactions. The magnetic properties of these metal oxides nanocrystals have been investigated, all the nanocrystals are superparamagnetic at room temperature.

  11. Boundary Layer Measurements in the Trisonic Gas-dynamics Facility Using Particle Image Velocimetery with CO2 Seeding

    Science.gov (United States)

    2012-03-22

    Type Material Mean diameter in µm Solid Liquid Polystyrene Alumina Al2O3 Titania TiO2 Glass micro-spheres Granules for synthetic...Figure 2.5. When the CO2 expands through the nozzle some of the liquid evaporates and lowers the temperature of the remaining liquid spray to form solid...stainless steel Swagelok® 27 hoses and compression fittings to the top and bottom connection on the manifold. The LCO2 then flows through nozzles

  12. Ms HU Ling-xiang's Experience in Treating Blood Stasis by Acupuncture Balancing Method

    Institute of Scientific and Technical Information of China (English)

    FU Jia; LI Ji; ZHANG Cai-rong

    2005-01-01

    @@ HU Ling-xiang, 60, is a chief doctor and supervisor of postgraduates of master degree. She specializes in the syndrome differentiation and treatment of different kinds of chronic and difficult disorders from the perspective of blood stasis theory.

  13. Facile synthesis of highly active reduced graphene oxide-CuI catalyst through a simple combustion method for photocatalytic reduction of CO2 to methanol

    Science.gov (United States)

    Zhang, Wenjun; Li, Yingjie; Zhang, Xiaoxiong; Li, Cuiluo

    2017-09-01

    We report a facile combustion method synthesis of reduced graphene oxide/CuI composites as a photocatalyst, in which CuI nanoparticles were homogeneously distributed on the surface of reduced graphene oxide (rGO), showing a good visible light response. The rGO-supported and unsupported CuI hybrids were tested over the photocatalytic reduction of CO2 for methanol evolution in visible light. In the current study rGO-CuI composites have shown excellent yields (19.91 μmol g-cat-1). rGO provides a light-weight, charge complementary and two-dimensional material that interacts effectively with the CuI nanoparticles.

  14. Extremely fast dark adsorption rate of carbon and nitrogen co-doped TiO2 prepared by a relatively fast, facile and low-cost microwave method

    Science.gov (United States)

    Du, Chun; Zhou, Jiangshan; Li, Fangzhou; Li, Wei; Wang, Yinzhen; He, Qinyu

    2016-07-01

    A facile and low-cost microwave method was used to prepare C and N co-doped TiO2 in just 8 min. The prepared samples were thoroughly characterized and were found to have favourable features such as surface adsorption of pollutants and photocatalysis. The rapid decomposition of CH5N3HCl under microwave irradiation led to mesopores and surface roughness in the as-prepared particles, resulting in large surface adsorption of pollutant and good photodegradation. The best sample is the one with the ratio of TiO2/CH2N3HCl at 3:1, which adsorbed 86.3 % of a methylene orange (MO) solution (20 mg L-1) in 10 min.

  15. Hierarchical flower-like Co3-xFexO4 ferrite hollow spheres: facile synthesis and catalysis in the degradation of methylene blue

    Science.gov (United States)

    Hao, Jinhui; Yang, Wenshu; Zhang, Zhe; Pan, Shunhao; Lu, Baoping; Ke, Xi; Zhang, Bailin; Tang, Jilin

    2013-03-01

    A facile method is proposed for the synthesis of three-dimensional (3D) flower-like Co3-xFexO4 ferrite (CF) hollow spheres, using SiO2@FeOOH as precursor. The CF hollow spheres are efficient for the catalytic degradation of methylene blue (MB) in the presence of H2O2 at 80 °C. The obtained CF hollow spheres were characterized using transmission electron microscopy, field emission scanning electron microscopy, X-ray diffraction, X-ray photo-electron spectroscopy, and N2 adsorption-desorption isotherm measurements. The formation of 3D hierarchical flower-like superstructure was influenced by the relative amount of urea used. As the mole ratio of CoCl2 and urea decreased, the structure of the products was tailored from yolk-like spheres to hollow spheres with different sized void interiors. Moreover, N2 adsorption-desorption isotherm analysis showed that the CF hollow spheres have a large specific surface area (163 m2 g-1) which provided more activity sites. The CF hollow spheres can catalyze the oxidation of MB efficiently. These results indicate that the designed CF hollow spheres exhibit promising capability for the degradation of dyes.A facile method is proposed for the synthesis of three-dimensional (3D) flower-like Co3-xFexO4 ferrite (CF) hollow spheres, using SiO2@FeOOH as precursor. The CF hollow spheres are efficient for the catalytic degradation of methylene blue (MB) in the presence of H2O2 at 80 °C. The obtained CF hollow spheres were characterized using transmission electron microscopy, field emission scanning electron microscopy, X-ray diffraction, X-ray photo-electron spectroscopy, and N2 adsorption-desorption isotherm measurements. The formation of 3D hierarchical flower-like superstructure was influenced by the relative amount of urea used. As the mole ratio of CoCl2 and urea decreased, the structure of the products was tailored from yolk-like spheres to hollow spheres with different sized void interiors. Moreover, N2 adsorption-desorption isotherm

  16. Clinical Profile, Co-Morbidities and Health Related Quality of Life in Pediatric Patients with Allergic Rhinitis and Asthma

    Directory of Open Access Journals (Sweden)

    Keya R. Lahiri, Milind S. Tullu* and Rachna Kalra

    2010-10-01

    Full Text Available Background: Co-existence of allergic rhinitis (AR and bronchial asthma (BA is well known. We planned to study the clinical profile of patients with AR & BA, the associated co-morbidities and the effect of AR &/ or BA on health related quality of life (HRQOL in Pediatric patients. Methods: Patients attending the Pediatric out-patients department and Pediatric Chest Clinic of tertiary care center were enrolled. The sample size included 100 subjects with BA & AR (Group 1 with control groups of 60 asthmatic children (Group 2 & 40 children suffering from AR (Group 3. The patients were subjected to a questionnaire & a through physical examination and the details were recorded in a pre-designed proforma. General medical, environmental, occupational, personal & family history was procured along with examination of respiratory system. The standard heath related quality of life (HRQOL parameters were studied. Findings: The study was conducted over a period of 13 months (February 2004 to March 2005. 200 patients between ages of 3 to 15 years (mean 7.95 years were enrolled (100 patients with BA and AR- group 1, 60 patients with asthma alone- group 2 and 40 patients with AR alone- group 3. Dust, smoke, outdoor dust, holi festival, winter season, exercise, and smoking by father were important exacerbating factors in all the three groups. Additionally, diwali festival and family history of asthma were important in Group 2 (BA; while pollen, weeds, diwali festival and family history of allergic rhinitis were important causes of exacerbation in group 3 (AR. Cough was commonly seen in all three groups. Wheezing, sneezing, itching throat, rhinorrhea, watering, altered taste, and nasal block was common in patients in group 1 while wheezing was important symptom in patients in group 2 (BA. Sneezing, itching throat, rhinorrhea, watering, altered taste, and nasal block were common symptoms in patients in group 3 (AR. Conjunctivitis, pharyngitis, and post-nasal drip

  17. Zebrafish transgenic line huORFZ is an effective living bioindicator for detecting environmental toxicants.

    Directory of Open Access Journals (Sweden)

    Hung-Chieh Lee

    Full Text Available Reliable animal models are invaluable for monitoring the extent of pollution in the aquatic environment. In this study, we demonstrated the potential of huORFZ, a novel transgenic zebrafish line that harbors a human upstream open reading frame of the chop gene fused with GFP reporter, as an animal model for monitoring environmental pollutants and stress-related cellular processes. When huORFZ embryos were kept under normal condition, no leaked GFP signal could be detected. When treated with hazardous chemicals, including heavy metals and endocrine-disrupting chemicals near their sublethal concentrations (LC50, huORFZ embryos exhibited different tissue-specific GFP expression patterns. For further analysis, copper (Cu2+, cadmium (Cd2+ and Chlorpyrifos were applied. Cu2+ triggered GFP responses in skin and muscle, whereas Cd2+ treatment triggered GFP responses in skin, olfactory epithelium and pronephric ducts. Moreover, fluorescence intensity, as exhibited by huORFZ embryos, was dose-dependent. After surviving treated embryos were returned to normal condition, survival rates, as well as TUNEL signals, returned to pretreatment levels with no significant morphological defects observed. Such results indicated the reversibility of treatment conditions used in this study, as long as embryos survived such conditions. Notably, GFP signals decreased along with recovery, suggesting that GFP signaling of huORFZ embryos likely reflected the overall physiological condition of the individual. To examine the performance of the huORFZ line under real-world conditions, we placed huORFZ embryos in different river water samples. We found that the huORFZ embryos correctly detected the presence of various kinds of pollutants. Based on these findings, we concluded that such uORFchop-based system can be integrated into a first-line water alarm system monitoring the discharge of hazardous pollutants.

  18. Hu'rthle Cell Thyroid Adenoma with an Eggshell Calcification: A Case Report

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Dong Gil; Lee, Sang Kwon; Choe, Mi Sun; Chang, Hyuk Won; Rho, Byung Hak [Dongsan Medical Center, Keimyung University School of Medicine, Daegu (Korea, Republic of)

    2009-09-15

    We report here a case of Hu'rthle cell adenoma with eggshell calcification that presented as a thyroid incidentaloma on ultrasonography (US) in a 58-year-old woman. The mass was hypoechoic with continuous eggshell calcification and intranodular vascularity as seen on gray-scale and power Doppler (PD) US. Hu 'rthle cell adenoma should be considered in the differential diagnosis of a thyroid nodule with eggshell calcification

  19. Constraining CO2 tower measurements in an inhomogeneous area with anthropogenic emissions using a combination of car-mounted instrument campaigns, aircraft profiles, transport modeling and neural networks

    Science.gov (United States)

    Schmidt, A.; Rella, C.; Conley, S. A.; Goeckede, M.; Law, B. E.

    2013-12-01

    The NOAA CO2 observation network in Oregon has been enhanced by 3 new towers in 2012. The tallest tower in the network (270 m), located in Silverton in the Willamette Valley is affected by anthropogenic emissions from Oregon's busiest traffic routes and urban centers. In summer 2012, we conducted a measurement campaign using a car-mounted PICARRO CRDS CO2/CO analyzer. Over 3 days, the instrument was driven over 1000 miles throughout the northwestern portion of Oregon measuring the CO/ CO2 ratios on main highways, back roads in forests, agricultural sites, and Oregon's biggest urban centers. By geospatial analyses we obtained ratios of CO/ CO2 over distinct land cover types divided into 10 classes represented in the study area. Using the coupled WRF-STILT transport model we calculated the footprints of nearby CO/ CO2 observation towers for the corresponding days of mobile road measurements. Spatiotemporally assigned source areas in combination with the land use classification were then used to calculate specific ratios of CO (anthropogenic origins) and CO2 to separate the anthropogenic portion of CO2 from the mixing ratio time series measured at the tower in Silverton. The WRF modeled boundary layer heights used in out study showed some differences compared to the boundary layer heights derived from profile data of wind, temperature, and humidity measured with an airplane in August, September, and November 2012, repeatedly over 5 tower locations. A Bayesian Regularized Artificial Neural Network (BRANN) was used to correct the boundary layer height calculated with WRF with a temporal resolution of 20 minutes and a horizontal resolution of 4 km. For that purpose the BRANN was trained using height profile data from the flight campaigns and spatiotemporally corresponding meteorological data from WRF. Our analyses provide information needed to run inverse modeling of CO2 exchange in an area that is affected by sources that cannot easily be considered by biospheric models

  20. A facile synthesis of poly(aniline-co-o-bromoaniline) copolymer: Characterization and application as semiconducting material

    Science.gov (United States)

    Mahudeswaran, A.; Vivekanandan, J.; Vijayanand, P. S.; Kojima, T.; Kato, S.

    2016-01-01

    Poly(aniline-co-o-bromoaniline) (p(an-co-o-BrAn)) copolymer has been synthesized using chemical oxidation method in the hydrochloric acid medium. Copolymerization of aniline with o-bromoaniline of different compositions, such as 1:1, 1:2, 2:1, 1:3 and 3:1 molar ratios were prepared. The synthesized copolymer is soluble in polar solvents like dimethyl sulphoxide (DMSO), dimethyl formamide (DMF), Tetrahydrofuran (THF) and 1-methyl 2-pyrrolidone (NMP). The copolymer is analyzed by various characterization techniques, such as FTIR, UV-Visible (UV-Vis) spectroscopy, X-ray diffraction (XRD), conductivity, Differential scanning calorimetry (DSC) and scanning electron microscopy (SEM). FTIR spectrum confirms the characteristic peaks of the copolymer containing benzenoid and quinoid ring stretching. UV spectrum reveals the formation of π-π∗ transition and n-π∗ transition between the energy levels. XRD peaks reveal that the copolymer possesses amorphous nature. Morphological study reveals that the agglomerated particles form globular structure and size of the each particle is about 100 nm. The electrical conductivity of the copolymers is found in the range of 10-5Scm-1. These organic semiconductor materials can be used to fabricate thinner and cheaper environmental friendly optoelectronic devices that will replace the conventional inorganic semiconductors.

  1. A facile and versatile approach for controlling electroosmotic flow in capillary electrophoresis via mussel inspired polydopamine/polyethyleneimine co-deposition.

    Science.gov (United States)

    Fu, Qifeng; Li, Xiuju; Zhang, Qihui; Yang, Fengqing; Wei, Weili; Xia, Zhining

    2015-10-16

    Electroosmotic flow (EOF), which reveals the charge property of capillary inner surface, has an important impact on the separation performance and reproducibility of capillary electrophoresis (CE). In this study, a novel, facile and versatile method to achieve diverse and controllable EOF in CE was reported based on the co-deposition of mussel-inspired polydopamine (PDA) and branched polyethyleneimine (PEI) on the capillary inner surface as the hybrid functional coating. After these PDA/PEI co-deposited columns were reinforced by the post-incubation of FeCl3, various magnitude and direction of EOF in CE could be easily achieved by varying a number of preparation parameters, including the mass ratio of DA/PEI and the molecular weight of PEI (including PEI-600, PEI-1800, PEI-10000 and PEI-70000). The separation effectiveness and stability of the hybrid coated columns were verified by the analysis of aromatic acids and aniline derivatives. The results showed that the controllable and diverse EOF was important in enhancing the separation performance of the analytes. The baseline separation of all the five aromatic acids can be achieved in 7 min with high separation efficiency by using the PDA/PEI-600 co-deposited column with the mass ratio of 6:1. On the other hand, with the PDA/PEI-70000 co-deposited column with the mass ratio of 6:1, the aniline compounds were easily baseline separated within 10 min. By contrast, using the bare and PDA coated columns, the migration of the aromatic acids was very slow and the baseline separation of the aniline compounds cannot be obtained. Moreover, the co-deposited columns showed long lifetime and good stability. The relative standard deviations for intra-day, inter-day and capillary-to-capillary repeatability of the PDA/PEI-600 co-deposited column with the mass ratio of 6:1, which was reinforced by the post-incubation of FeCl3, were all lower than 5%. Copyright © 2015 Elsevier B.V. All rights reserved.

  2. Neuroprotective effects of the cannabinoid agonist HU210 on retinal degeneration.

    Science.gov (United States)

    Lax, Pedro; Esquiva, Gema; Altavilla, Cesare; Cuenca, Nicolás

    2014-03-01

    Cannabinoids have been demonstrated to exert neuroprotective effects on different types of neuronal insults. Here we have addressed the therapeutic potential of the synthetic cannabinoid HU210 on photoreceptor degeneration, synaptic connectivity and functional activity of the retina in the transgenic P23H rat, an animal model for autosomal dominant retinitis pigmentosa (RP). In P23H rats administered with HU210 (100 μg/kg, i.p.) from P24 to P90, ERG recordings showed an amelioration of vision loss, as compared to vehicle-administered animals. Under scotopic conditions, the maximum a-wave amplitudes recorded at P60 and P90 were higher in HU210-treated animals, as compared to the values obtained in untreated animals. The scotopic b-waves were significantly higher in treated animals than in untreated rats at P30, P60 and P90. This attenuation of visual deterioration correlated with a delay in photoreceptor degeneration and the preservation of retinal cytoarchitecture. HU210-treated animals had 40% more photoreceptors than untreated animals. Presynaptic and postsynaptic elements, as well as the synaptic contacts between photoreceptors and bipolar or horizontal cells, were also preserved in HU210-treated P23H rats. These results indicate that HU210 preserves cone and rod structure and function, together with their contacts with postsynaptic neurons, in P23H rats. These data suggest that cannabinoids are potentially useful to delay retinal degeneration in RP patients.

  3. Pertussis toxin B-oligomer inhibits HIV infection and replication in hu-PBL-SCID mice.

    Science.gov (United States)

    Lapenta, Caterina; Spada, Massimo; Santini, Stefano M; Racca, Sara; Dorigatti, Fernanda; Poli, Guido; Belardelli, Filippo; Alfano, Massimo

    2005-04-01

    Bordetella pertussis toxin B-oligomer (PTX-B) has been shown to inhibit HIV infection and replication in vitro. The potential anti-viral effect of PTX-B was tested here in an in vivo surrogate model of HIV infection, i.e. SCID mice reconstituted with human peripheral blood leukocytes (PBL) (hu-PBL-SCID) and infected with a CCR5-dependent (R5) HIV-1 strain. SCID mice inoculated intra-peritoneal (i.p.) with PTX-B and then infected with the R5 strain SF-162 were sacrificed 7 days later and analyzed for human PBL (hu-PBL) lymphoid tissue reconstitution, infection of hu-PBL, plasma viremia and viral rescue from ex vivo-cultivated i.p. hu-PBL. Unlike mice treated with 500 ng per animal of PTX-B showing no evidence of viral inhibition, daily administration of PTX-B (50 ng per mouse) strongly inhibited virus infection and replication, as determined by undetectable viremia, absence of infected hu-PBL and lack of rescue of infectious HIV in most animals. Furthermore, PTX-B injection 2 h before and twice after infection prevented HIV-1 infection and replication in all (10/10) tested animals. Thus, PTX-B potently inhibited virus infection and replication in hu-PBL-SCID mice, supporting the hypothesis that it may represent a new pharmacological agent against HIV-1 infection.

  4. Different modes of interaction by TIAR and HuR with target RNA and DNA.

    Science.gov (United States)

    Kim, Henry S; Wilce, Matthew C J; Yoga, Yano M K; Pendini, Nicole R; Gunzburg, Menachem J; Cowieson, Nathan P; Wilson, Gerald M; Williams, Bryan R G; Gorospe, Myriam; Wilce, Jacqueline A

    2011-02-01

    TIAR and HuR are mRNA-binding proteins that play important roles in the regulation of translation. They both possess three RNA recognition motifs (RRMs) and bind to AU-rich elements (AREs), with seemingly overlapping specificity. Here we show using SPR that TIAR and HuR bind to both U-rich and AU-rich RNA in the nanomolar range, with higher overall affinity for U-rich RNA. However, the higher affinity for U-rich sequences is mainly due to faster association with U-rich RNA, which we propose is a reflection of the higher probability of association. Differences between TIAR and HuR are observed in their modes of binding to RNA. TIAR is able to bind deoxy-oligonucleotides with nanomolar affinity, whereas HuR affinity is reduced to a micromolar level. Studies with U-rich DNA reveal that TIAR binding depends less on the 2'-hydroxyl group of RNA than HuR binding. Finally we show that SAXS data, recorded for the first two domains of TIAR in complex with RNA, are more consistent with a flexible, elongated shape and not the compact shape that the first two domains of Hu proteins adopt upon binding to RNA. We thus propose that these triple-RRM proteins, which compete for the same binding sites in cells, interact with their targets in fundamentally different ways.

  5. Stratospheric and mesospheric pressure-temperature profiles from rotational analysis of CO2 lines in atmospheric trace molecule spectroscopy/ATLAS 1 infrared solar occultation spectra

    Science.gov (United States)

    Stiller, G. P.; Gunson, M. R.; Lowes, L. L.; Abrams, M. C.; Raper, O. F.; Farmer, C. B.; Zander, R.; Rinsland, C. P.

    1995-01-01

    A simple, classical, and expedient method for the retrieval of atmospheric pressure-temperature profiles has been applied to the high-resolution infrared solar absorption spectra obtained with the atmospheric trace molecule spectroscopy (ATMOS) instrument. The basis for this method is a rotational analysis of retrieved apparent abundances from CO2 rovibrational absorption lines, employing existing constituent concentration retrieval software used in the analysis of data returned by ATMOS. Pressure-temperature profiles derived from spectra acquired during the ATLAS 1 space shuttle mission of March-April 1992 are quantitatively evaluated and compared with climatological and meteorological data as a means of assessing the validity of this approach.

  6. Pharmacokinetic and pharmacodynamic profiles of recombinant human erythropoietin-loaded poly(lactic-co-glycolic acid) microspheres in rats

    Institute of Scientific and Technical Information of China (English)

    Xiang-lian ZHOU; in-tian HE; Hui-juan DU; Yang-yang FAN; Ying WANG; Hong-xia ZHANG; Yang JIANG

    2012-01-01

    To characterize the pharmacokinetic and pharmacodynamic profiles of the recombinant human erythropoietin (rhEPO)-loaded poly(lactic-co-glycolic acid) (PLGA) microspheres in rats.Methods:The rhEPO-loaded microspheres were prepared using a solid-in-oil-in-water emulsion method.Pharmacokinetics and pharmacodynamics of the rhEPO-loaded microspheres were evaluated in male Sprague-Dawley rats.The serum rhEPO level was determined with ELISA.The level of anti-rhEPO antibody in the serum was measured to assess the immunogenicity of rhEPO released from the microspheres.Results:rhEPO was almost completely released from the PLGA microspheres in vitro,following zero-order release kinetics over approximately 30 d.After intramuscular injection (10 000 or 30 000 IU rhEPO/kg) in the rats,the serum rhEPO concentration reached maximum levels on d 1,then decreased gradually and was maintained at nearly steady levels for approximately 4 weeks.Furthermore,the release of rhEPO from the PLGA microspheres was found to be controlled mainly by a dissolution/diffusion mechanism.A good linear correlation (R2=0.98) was obtained between the in vitro and in vivo release data.A single intramuscular injection of the rhEPO-loaded PLGA microspheres (10 000 or 30 000 IU rhEPO/kg) in the rats resulted in elevated hemoglobin and red blood cell concentrations for more than 28 d.Moreover,the immunogenicity of rhEPO released from the PLGA microspheres was comparable with that of the unencapsulated rhEPO.Conclusion:The results prove the feasibility of using the PLGA-based microspheres to deliver rhEPO for approximately 1 month.

  7. The co-evolution of total density profiles and central dark matter fractions in simulated early-type galaxies

    Science.gov (United States)

    Remus, Rhea-Silvia; Dolag, Klaus; Naab, Thorsten; Burkert, Andreas; Hirschmann, Michaela; Hoffmann, Tadziu L.; Johansson, Peter H.

    2017-01-01

    We present evidence from cosmological hydrodynamical simulations for a co-evolution of the slope of the total (dark and stellar) mass density profile, γtot, and the dark matter fraction within the half-mass radius, fDM, in early-type galaxies. The relation can be described as γtot = A fDM + B for all systems at all redshifts. The trend is set by the decreasing importance of gas dissipation towards lower redshifts and for more massive systems. Early-type galaxies are smaller, more concentrated, have lower fDM and steeper γtot at high redshifts and at lower masses for a given redshift; fDM and γtot are good indicators for growth by `dry' merging. The values for A and B change distinctively for different feedback models, and this relation can be used as a test for such models. A similar correlation exists between γtot and the stellar mass surface density Σ*. A model with weak stellar feedback and feedback from black holes is in best agreement with observations. All simulations, independent of the assumed feedback model, predict steeper γtot and lower fDM at higher redshifts. While the latter is in agreement with the observed trends, the former is in conflict with lensing observations, which indicate constant or decreasing γtot. This discrepancy is shown to be artificial: the observed trends can be reproduced from the simulations using observational methodology to calculate the total density slopes.

  8. Facile preparation of heparinized polysulfone membrane assisted by polydopamine/polyethyleneimine co-deposition for simultaneous LDL selectivity and biocompatibility

    Science.gov (United States)

    Wang, Liwei; Fang, Fei; Liu, Yang; Li, Jing; Huang, Xiaojun

    2016-11-01

    Low-density lipoprotein (LDL) gains worldwide attention for decades as the key risk factor to atherosclerosis that progressively deteriorating into cardiovascular diseases. Until recent years, LDL-apheresis comes to be extensively used as a direct and efficient LDL removal method, with LDL adsorption materials particularly important. In this paper, a new strategy based on the co-deposition of polydopamine (PDA) with polyethylenimine (PEI) onto polysulfone (PSf) membranes, then subsequent heparinization by amino-carbonyl reactions, to achieve LDL selectivity and simultaneous biocompatibility, is proposed. Surface properties of modified PSf membranes are characterized by ATR-FTIR, XPS, FESEM, Zeta potential and WCA measurements. LDL adsorption ability is investigated by ELISA, while blood biocompatibility is evaluated by platelet adhesion experiments. Results suggest that heparin-modified PSf membranes show high selectivity for LDL removal and fine biocompatibility in contact with plasma, as excellent potential materials for LDL-apheresis.

  9. Facile synthesis of Bi2S3 nanoribbons for photocatalytic reduction of CO2 into CH3OH

    Science.gov (United States)

    Jin, Jiarui; He, Tao

    2017-02-01

    The bismuth sulfide (Bi2S3) nanoribbons with different length-to-width ratio are successfully prepared using a simple solvothermal technique. Their crystal structures, morphologies, as well as the optical absorption are characterized by powder X-ray diffraction, transmission electron microscope, UV-vis diffuse-reflection spectroscopy and nitrogen adsorption. The electron microscopy observation shows that the molar ratio of Bi and S source greatly influences the size of the as-prepared Bi2S3 nanoribbons and, thereby, the length-to-width ratio. The Bi2S3 nanocatalysts with the largest length-to-width ratio exhibits the highest activity for photocatalytic reduction of CO2 into methanol because it has the most negative potential of conduction band, the largest BET specific surface area and lowest recombination of photogenerated charge carriers.

  10. Pengukuran Daya Laser CO2 Dan Laser DPSS Serta Pengamatan Beam Profiler Sinar Laser DPSS dan Laser He-Ne Menggunakan CCD

    OpenAIRE

    2015-01-01

    This research has done measuring the power by varying the current of laser CO2 and laser DPSS, observation the beam profiler of laser beam DPSS and laser beam He-Ne and observation the spectrum wavelength of laser DPSS and laser He-Ne. In this case of measuring the power by varying the current of laser CO2 and laser DPSS, the measuring has done more than once in order to concluded how the stability of the power that produced by each of the laser. The result of this measuring is laser DPSS ...

  11. Facile synthesis of radial-like macroporous superparamagnetic chitosan spheres with in-situ co-precipitation and gelation of ferro-gels.

    Directory of Open Access Journals (Sweden)

    Chih-Hui Yang

    Full Text Available Macroporous chitosan spheres encapsulating superparamagnetic iron oxide nanoparticles were synthesized by a facile and effective one-step fabrication process. Ferro-gels containing ferrous cations, ferric cations and chitosan were dropped into a sodium hydroxide solution through a syringe pump. In addition, a sodium hydroxide solution was employed for both gelation (chitosan and co-precipitation (ferrous cations and ferric cations of the ferro-gels. The results showed that the in-situ co-precipitation of ferro-ions gave rise to a radial morphology with non-spheroid macro pores (large cavities inside the chitosan spheres. The particle size of iron oxide can be adjusted from 2.5 nm to 5.4 nm by tuning the concentration of the sodium hydroxide solution. Using Fourier Transform Infrared Spectroscopy and X-ray diffraction spectra, the synthesized nanoparticles were illustrated as Fe(3O(4 nanoparticles. In addition, the prepared macroporous chitosan spheres presented a super-paramagnetic behaviour at room temperature with a saturation magnetization value as high as ca. 18 emu/g. The cytotoxicity was estimated using cell viability by incubating doses (0∼1000 µg/mL of the macroporous chitosan spheres. The result showed good viability (above 80% with alginate chitosan particles below 1000 µg/mL, indicating that macroporous chitosan spheres were potentially useful for biomedical applications in the future.

  12. Oil removal of spent hydrotreating catalyst CoMo/Al2O3 via a facile method with enhanced metal recovery.

    Science.gov (United States)

    Yang, Yue; Xu, Shengming; Li, Zhen; Wang, Jianlong; Zhao, Zhongwei; Xu, Zhenghe

    2016-11-15

    Deoiling process is a key issue for recovering metal values from spent hydrotreating catalysts. The oils can be removed with organic solvents, but the industrialized application of this method is greatly hampered by the high cost and complex processes. Despite the roasting method is simple and low-cost, it generates hardest-to-recycle impurities (CoMoO4 or NiMoO4) and enormous toxic gases. In this study, a novel and facile approach to remove oils from the spent hydrotreating catalysts is developed. Firstly, surface properties of spent catalysts are characterized to reveal the possibility of oil removal. And then, oils are removed with water solution under the conditions of 90°C, 0.1wt% SDS, 2.0wt% NaOH and 10ml/gL/S ratio for 4h. Finally, thermal treatment and leaching tests are carried out to further explore the advantages of oil removal. The results show that no hardest-to-recycle impurity CoMoO4 is found in XPS spectra of thermally treated samples after deoiling and molybdenum is leached completely with sodium carbonate solution. It means that the proposed deoiling method can not only remove oils simply and without enormous harmful gases generating, but also avoid the generation of detrimental impurity and promote recycling of valuable metals from spent hydrotreating catalysts.

  13. Direct C-C Coupling of CO2 and the Methyl Group from CH4 Activation through Facile Insertion of CO2 into Zn-CH3 σ-Bond.

    Science.gov (United States)

    Zhao, Yuntao; Cui, Chaonan; Han, Jinyu; Wang, Hua; Zhu, Xinli; Ge, Qingfeng

    2016-08-17

    Conversion of CO2 and CH4 to value-added products will contribute to alleviating the green-house gas effect but is a challenge both scientifically and practically. Stabilization of the methyl group through CH4 activation and facile CO2 insertion ensure the realization of C-C coupling. In the present study, we demonstrate the ready C-C coupling reaction on a Zn-doped ceria catalyst. The detailed mechanism of this direct C-C coupling reaction was examined based on the results from density functional theory calculations. The results show that the Zn dopant stabilizes the methyl group by forming a Zn-C bond, thus hindering subsequent dehydrogenation of CH4. CO2 can be inserted into the Zn-C bond in an activated bent configuration, with the transition state in the form of a three-centered Zn-C-C moiety and an activation barrier of 0.51 eV. The C-C coupling reaction resulted in the acetate species, which could desorb as acetic acid by combining with a surface proton. The formation of acetic acid from CO2 and CH4 is a reaction with 100% atom economy, and the implementation of the reaction on a heterogeneous catalyst is of great importance to the utilization of the greenhouse gases. We tested other possible dopants including Al, Ga, Cd, In, and Ni and found a positive correlation between the activation barrier of C-C coupling and the electronegativity of the dopant, although C-H bond activation is likely the dominant reaction on the Ni-doped ceria catalyst.

  14. A facile strategy to fabricate plasmonic Cu modified TiO{sub 2} nano-flower films for photocatalytic reduction of CO{sub 2} to methanol

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Enzhou; Qi, Lulu; Bian, Juanjuan; Chen, Yihan [School of Chemical Engineering, Northwest University, No. 229 Taibai North Road, Xi’an 710069 (China); Hu, Xiaoyun [Department of Physics, Northwest University, No. 229 Taibai North Road, Xi' an 710069 (China); Fan, Jun, E-mail: fanjun@nwu.edu.cn [School of Chemical Engineering, Northwest University, No. 229 Taibai North Road, Xi’an 710069 (China); Liu, Hanchen; Zhu, Changjun; Wang, Qiuping [School of Science, Xi' an Polytechnic University, No. 19 Jinhua South Road, Xi’an 710048 (China)

    2015-08-15

    Graphical abstract: Photoreduction of CO{sub 2} to CH{sub 3}OH over plasmonic Cu/TiO{sub 2} film. - Highlights: • Cu nanoparticles modified TiO{sub 2} nano-flower film was prepared by a facile strategy. • Cu nanoparticles can enhance the light absorption and the Raman scattering of TiO{sub 2}. • Cu nanoparticles can effectively restrain the recombination of the charge carriers. • A synergistic mechanism is proposed for photocatalytic reduction of CO{sub 2} on Cu/TiO{sub 2} film. - Abstract: Cu nanoparticles (NPs) deposited TiO{sub 2} nano-flower films were fabricated using a combination of a hydrothermal method and a microwave-assisted reduction process. The investigations indicated that Cu NPs and TiO{sub 2} film both exhibit visible light harvesting properties based on localized surface plasmon resonance (LSPR) of Cu NPs and unique nanostructures of TiO{sub 2} film. Fluorescence quenching was observed because the recombination of charge carriers was effectively suppressed by Cu NPs deposition. The experimental results indicate that Cu/TiO{sub 2} films exhibit better activity for the photocatalytic reduction of CO{sub 2} due to the charge transfer property and LSPR effect of Cu NPs. The CH{sub 3}OH production rate reached 1.8 μmol cm{sup −2} h{sup −1} (energy efficiency was 0.8%) over 0.5 Cu/TiO{sub 2} film under UV and visible light irradiation, which was 6.0 times higher than that observed over pure TiO{sub 2} film. In addition, a tentative photocatalytic mechanism is proposed to understand the experimental results over the Cu modified TiO{sub 2} nano-flower films.

  15. A facile route for the synthesis of Co, Ni and Cu metallic nanoparticles with potential antimicrobial activity using novel metallosurfactants

    Science.gov (United States)

    Kaur, Gurpreet; Singh, Prabjot; Mehta, S. K.; Kumar, Sandeep; Dilbaghi, Neeraj; Chaudhary, Ganga Ram

    2017-05-01

    The work deals with optimizing a methodology for fabrication of monodisperse metallic nanoparticles (active against microbes) using micellar core of amine based metallosurfactant. Novel double chained amine metallosurfactants of the type [M(C12H25NH2)2] (where M is copper, nickel and cobalt) have been synthesized and characterized with elemental analysis, Fourier Transform Infrared spectroscopy (FTIR), Nuclear Magnetic Resonance (NMR) and thermogravimetric analysis (TGA). Further, study of theaggregated structures (i.e. bilayer) of these lipophilic metallosurfactants in various alcohols has been carried out. Thermodynamics parameters of reverse micellization have also been estimated. The process of micellization is spontaneous and entropy driven. Prepared metallosurfactants have been utilized as precursors for the fabrication of metallic nanoparticles (NPs) of Co, Ni and Cu. The method is validated for all the three studied transition metals for the preparation of metallic nanoparticles. This approach offers better results in terms of size, shape, morphology, distribution and stability of NPs. Characterization of NPs is done by UV-vis, X-Ray Diffraction (XRD), Transmission Emission Microscopy (TEM) and Dynamic light scattering (DLS). Prepared metallosurfactants and NPs have been trialled for antimicrobial activity against three pathogenic microbes viz. Bacillus Cereus (gram +ve bacterium), Klebsiella Pneumoniae (gram -ve bacterium) and Curvularia lunata (fungus) and best results are shown by Cu NPs. Furthermore, interaction of metallic NPs with bovine serum albumin (BSA) has been estimated.

  16. A facile and effective immobilization of glucose oxidase on tannic acid modified CoFe2O4 magnetic nanoparticles.

    Science.gov (United States)

    Altun, Seher; Çakıroğlu, Bekir; Özacar, Münteha; Özacar, Mahmut

    2015-12-01

    This article presents a study of glucose oxidase (GOx) immobilization by employing tannic acid (TA) modified-CoFe2O4 (CFO) magnetic nanoparticles which demonstrates novel aspect for enzyme immobilization. By using the strong protein and tannic acid binding, GOx immobilization was carried out via physical adsorption in a simpler way compared with the other immobilization methods which require various chemicals and complicated procedures which is difficult, expensive, time-consuming, and destructive to the enzyme structure. CFO was synthesized by hydrothermal synthesis and modified with TA to immobilize GOx. The immobilized GOx demonstrated maximum catalytic activity at pH 6.5 and 45 °C. The samples were characterized by vibrating sample magnetometer (VSM), thermogravimetric analysis (TGA), zeta potential, and fourier transform infrared spectroscopy (FTIR), all of which confirm the surface modification of CFO and GOx immobilization. Also, field emission scanning electron microscope (FESEM) and X-ray diffraction (XRD) were performed to demonstrate the surface morphology and chemical structure of samples. According to the Lineweaver-Burk plot, GOx possessed lower affinity to glucose after immobilization, and the Michelis-Menten constant (KM) of immobilized and free GOx were found to be 50.05 mM and 28.00 mM, respectively. The immobilized GOx showed excellent reusability, and even after 8 consecutive activity assay runs, the immobilized GOx maintained ca. 60% of its initial activity.

  17. Research Update: Facile synthesis of CoFe2O4 nano-hollow spheres for efficient bilirubin adsorption

    Science.gov (United States)

    Rakshit, Rupali; Pal, Monalisa; Chaudhuri, Arka; Mandal, Madhuri; Mandal, Kalyan

    2015-11-01

    Herein, we report an unprecedented bilirubin (BR) adsorption efficiency of CoFe2O4 (CFO) nanostructures in contrast to the commercially available activated carbon and resin which are generally used for haemoperfusion and haemodialysis. We have synthesized CFO nanoparticles of diameter 100 nm and a series of nano-hollow spheres of diameter 100, 160, 250, and 350 nm using a simple template free solvothermal technique through proper variation of reaction time and capping agent, oleylamine (OLA), respectively, and carried out SiO2 coating by employing Stöber method. The comparative BR adsorption study of CFO and SiO2 coated CFO nanostructures indicates that apart from porosity and hollow configuration of nanostructures, the electrostatic affinity between anionic carboxyl group of BR and cationic amine group of OLA plays a significant role in adsorbing BR. Finally, we demonstrate that the BR adsorption capacity of the nanostructures can be tailored by varying the morphology as well as size of the nanostructures. We believe that our developed magnetic nanostructures could be considered as a potential material towards therapeutic applications against hyperbilirubinemia.

  18. Facile and controllable synthesis of N/P co-doped graphene for high-performance supercapacitors

    Science.gov (United States)

    Xia, Kaisheng; Huang, Zhiyuan; Zheng, Lin; Han, Bo; Gao, Qiang; Zhou, Chenggang; Wang, Hongquan; Wu, Jinping

    2017-10-01

    Improving the energy density of carbon-based supercapacitors is one of the most urgent demands for developing high-power energy supplies, which in general requires delicate engineering of the carbon composition and textures. By pre-functionalization of graphene nanosheets and successive one-step (NH4)3PO4 activation, we prepared a type of nitrogen and phosphorus co-doped graphene (NPG) with high specific surface areas, hierarchical pore structures as well as tunable N and P contents. The as-obtained NPG shows high specific capacitances of 219 F g-1 (123 F cm-3) at 0.25 A g-1 and 175 F g-1 (98 F cm-3) at 10 A g-1, respectively. Accordingly, the NPG-based symmetrical supercapacitor device, working at a potential window of 1.3 V, could deliver an enhanced energy density of 8.2 Wh kg-1 (4.6 Wh L-1) at a power density of 162 W kg-1 (91 W L-1), which still retains 6.7 Wh kg-1 at 6.5 kW kg-1. In particular, under a current density of 5 A g-1, the device endows an 86% capacitance retention of initial after 20,000 cycles, displaying superior cycle stability. Our results imply the feasibility of NPG as a promising candidate for high-performance supercapacitors.

  19. Facile preparation of porous Co3O4 nanosheets for high-performance lithium ion batteries and oxygen evolution reaction

    Science.gov (United States)

    Li, Zhangpeng; Yu, Xin-Yao; Paik, Ungyu

    2016-04-01

    Two dimensional (2D) porous nanostructures are of great interest due to their high surface area and rich edge sites, which are favorable for a wide variety of applications. In this communication, well-defined porous Co3O4 nanosheets (PCNSs) are successfully fabricated using graphene oxide as sacrificial template. The 2D structure and porous nature effectively provide more exposed active sites for electrochemical reaction and facilitate easier ion transportation across the sheets. As a result, the as-prepared PCNSs exhibit remarkable lithium storage performance, showing high reversible capacity of 1380 mAh g-1 even after 240 discharge/charge cycles at a current density of 500 mA g-1 and good rate capability (606 mAh g-1 at 10 A g-1). Moreover, it also shows a good electrocatalytic activity for the electrochemical oxygen evolution reaction with an overpotential of 368 mV for driving the current density of 10 mA cm-2 in 1 M KOH and a small Tafel slope of 59 mV dec-1.

  20. Functional characterization of the HuR:CD83 mRNA interaction.

    Directory of Open Access Journals (Sweden)

    Dorothea Pieper

    Full Text Available Maturation of dendritic cells (DC is characterized by expression of CD83, a surface protein that appears to be necessary for the effective activation of naïve T-cells and T-helper cells by DC. Lately it was shown that CD83 expression is regulated on the posttranscriptional level by interaction of the shuttle protein HuR with a novel posttranscriptional regulatory RNA element (PRE, which is located in the coding region of the CD83 transcript. Interestingly, this interaction commits the CD83 mRNA to efficient nuclear export via the CRM1 pathway. To date, however, the structural basis of this interaction, which potentially involves three distinct RNA recognition motifs (RRM1-3 in HuR and a complex three-pronged RNA stem-loop element in CD83 mRNA, has not been investigated in detail. In the present work we analyzed this interaction in vitro and in vivo using various HuR- and CD83 mRNA mutants. We are able to demonstrate that both, RRM1 and RRM2 are crucial for binding, whereas RRM3 as well as the HuR hinge region contributed only marginally to this protein:RNA interaction. Furthermore, mutation of uridine rich patches within the PRE did not disturb HuR:CD83 mRNA complex formation while, in contrast, the deletion of specific PRE subfragments from the CD83 mRNA prevented HuR binding in vitro and in vivo. Interestingly, the observed inhibition of HuR binding to CD83 mRNA does not lead to a nuclear trapping of the transcript but rather redirected this transcript from the CRM1- towards the NXF1/TAP-specific nuclear export pathway. Thus, the presence of a functional PRE permits nucleocytoplasmic trafficking of the CD83 transcript via the CRM1 pathway.

  1. Ice hydrometeor profile retrieval algorithm for high-frequency microwave radiometers: application to the CoSSIR instrument during TC4

    Science.gov (United States)

    Evans, K. F.; Wang, J. R.; O'C Starr, D.; Heymsfield, G.; Li, L.; Tian, L.; Lawson, R. P.; Heymsfield, A. J.; Bansemer, A.

    2012-09-01

    A Bayesian algorithm to retrieve profiles of cloud ice water content (IWC), ice particle size (Dme), and relative humidity from millimeter-wave/submillimeter-wave radiometers is presented. The first part of the algorithm prepares an a priori file with cumulative distribution functions (CDFs) and empirical orthogonal functions (EOFs) of profiles of temperature, relative humidity, three ice particle parameters (IWC, Dme, distribution width), and two liquid cloud parameters. The a priori CDFs and EOFs are derived from CloudSat radar reflectivity profiles and associated ECMWF temperature and relative humidity profiles combined with three cloud microphysical probability distributions obtained from in situ cloud probes. The second part of the algorithm uses the CDF/EOF file to perform a Bayesian retrieval with a hybrid technique that uses Monte Carlo integration (MCI) or, when too few MCI cases match the observations, uses optimization to maximize the posterior probability function. The very computationally intensive Markov chain Monte Carlo (MCMC) method also may be chosen as a solution method. The radiative transfer model assumes mixtures of several shapes of randomly oriented ice particles, and here random aggregates of spheres, dendrites, and hexagonal plates are used for tropical convection. A new physical model of stochastic dendritic snowflake aggregation is developed. The retrieval algorithm is applied to data from the Compact Scanning Submillimeter-wave Imaging Radiometer (CoSSIR) flown on the ER-2 aircraft during the Tropical Composition, Cloud and Climate Coupling (TC4) experiment in 2007. Example retrievals with error bars are shown for nadir profiles of IWC, Dme, and relative humidity, and nadir and conical scan swath retrievals of ice water path and average Dme. The ice cloud retrievals are evaluated by retrieving integrated 94 GHz backscattering from CoSSIR for comparison with the Cloud Radar System (CRS) flown on the same aircraft. The rms difference in

  2. Ice hydrometeor profile retrieval algorithm for high-frequency microwave radiometers: application to the CoSSIR instrument during TC4

    Directory of Open Access Journals (Sweden)

    K. F. Evans

    2012-09-01

    Full Text Available A Bayesian algorithm to retrieve profiles of cloud ice water content (IWC, ice particle size (Dme, and relative humidity from millimeter-wave/submillimeter-wave radiometers is presented. The first part of the algorithm prepares an a priori file with cumulative distribution functions (CDFs and empirical orthogonal functions (EOFs of profiles of temperature, relative humidity, three ice particle parameters (IWC, Dme, distribution width, and two liquid cloud parameters. The a priori CDFs and EOFs are derived from CloudSat radar reflectivity profiles and associated ECMWF temperature and relative humidity profiles combined with three cloud microphysical probability distributions obtained from in situ cloud probes. The second part of the algorithm uses the CDF/EOF file to perform a Bayesian retrieval with a hybrid technique that uses Monte Carlo integration (MCI or, when too few MCI cases match the observations, uses optimization to maximize the posterior probability function. The very computationally intensive Markov chain Monte Carlo (MCMC method also may be chosen as a solution method. The radiative transfer model assumes mixtures of several shapes of randomly oriented ice particles, and here random aggregates of spheres, dendrites, and hexagonal plates are used for tropical convection. A new physical model of stochastic dendritic snowflake aggregation is developed. The retrieval algorithm is applied to data from the Compact Scanning Submillimeter-wave Imaging Radiometer (CoSSIR flown on the ER-2 aircraft during the Tropical Composition, Cloud and Climate Coupling (TC4 experiment in 2007. Example retrievals with error bars are shown for nadir profiles of IWC, Dme, and relative humidity, and nadir and conical scan swath retrievals of ice water path and average Dme. The ice cloud retrievals are evaluated by retrieving integrated 94 GHz backscattering from CoSSIR for comparison

  3. WRFv3.2-SPAv2: development and validation of a coupled ecosystem–atmosphere model, scaling from surface fluxes of CO2 and energy to atmospheric profiles

    Directory of Open Access Journals (Sweden)

    T. L. Smallman

    2013-07-01

    Full Text Available The Weather Research and Forecasting meteorological (WRF model has been coupled to the Soil–Plant–Atmosphere (SPA terrestrial ecosystem model, to produce WRF-SPA. SPA generates realistic land–atmosphere exchanges through fully coupled hydrological, carbon and energy cycles. The addition of a~land surface model (SPA capable of modelling biospheric CO2 exchange allows WRF-SPA to be used for investigating the feedbacks between biosphere carbon balance, meteorology, and land use and land cover change. We have extensively validated WRF-SPA using multi-annual observations of air temperature, turbulent fluxes, net radiation and net ecosystem exchange of CO2 at three sites, representing the dominant vegetation types in Scotland (forest, managed grassland and arable agriculture. For example air temperature is well simulated across all sites (forest R2 = 0.92, RMSE = 1.7 °C, bias = 0.88 °C; managed grassland R2 = 0.73, RMSE = 2.7 °C, bias = −0.30 °C; arable agriculture R2 = 0.82, RMSE = 2.2 °C, bias = 0.46 °C; RMSE, root mean square error. WRF-SPA generates more realistic seasonal behaviour at the site level compared to an unmodified version of WRF, such as improved simulation of seasonal transitions in latent heat flux in arable systems. WRF-SPA also generates realistic seasonal CO2 exchanges across all sites. WRF-SPA is also able to realistically model atmospheric profiles of CO2 over Scotland, spanning a 3 yr period (2004–2006, capturing both profile structure, indicating realistic transport, and magnitude (model–data residual 2 exchange. WRF-SPA makes use of CO2 tracer pools and can therefore identify and quantify land surface contributions to the modelled atmospheric CO2 signal at a specified location.

  4. Hydroxyurea (HU) for prevention of recurrent stroke in sickle cell anemia (SCA).

    Science.gov (United States)

    Sumoza, Abraham; de Bisotti, Renate; Sumoza, David; Fairbanks, Virgil

    2002-11-01

    Cerebrovascular accident (CVA) is a major cause of morbidity and death in sickle cell anemia (SCA). Transfusion of packed erythrocytes is widely used to prevent this complication. However, chronic transfusion may lead to iron overload, alloimmunization, or infections. Cost and compliance may compromise transfusion therapy. A possible alternative, the prophylactic use of hydroxyurea (HU), has not been tried to determine whether it may prevent recurrent stroke. We used HU in five children with SCA who had suffered stroke, in three of them after a first episode and in the other two after a second CVA. Four had infarctive stroke and one a transient ischemic attack (TIA). Four patients took HU at a dose of 40 mg/kg/d, one patient at 30 mg/kg/d. None of the patients had recurrent stroke during 42-112 months of observation. None experienced pain crises. In all, HbF increased significantly and was maintained above 14.7% during treatment. The total Hb concentration increased 19.5 g/L (median) above the value before treatment. HU was well tolerated. None of the five children had leukopenia or thrombocytopenia during therapy. HU appears to prevent recurrence of stroke in SCA without risk of major toxicity.

  5. dNTP deficiency induced by HU via inhibiting ribonucleotide reductase affects neural tube development.

    Science.gov (United States)

    Guan, Zhen; Wang, Xiuwei; Dong, Yanting; Xu, Lin; Zhu, Zhiqiang; Wang, Jianhua; Zhang, Ting; Niu, Bo

    2015-02-03

    Exposure to environmental toxic chemicals in utero during the neural tube development period can cause developmental disorders. To evaluate the disruption of neural tube development programming, the murine neural tube defects (NTDs) model was induced by interrupting folate metabolism using methotrexate in our previous study. The present study aimed to examine the effects of dNTP deficiency induced by hydroxyurea (HU), a specific ribonucleotide reductase (RNR) inhibitor, during murine neural tube development. Pregnant C57BL/6J mice were intraperitoneally injected with various doses of HU on gestation day (GD) 7.5, and the embryos were checked on GD 11.5. RNR activity and deoxynucleoside triphosphate (dNTP) levels were measured in the optimal dose. Additionally, DNA damage was examined by comet analysis and terminal deoxynucleotidyl transferase mediated dUTP nick end-labeling (TUNEL) assay. Cellular behaviors in NTDs embryos were evaluated with phosphorylation of histone H3 (PH-3) and caspase-3 using immunohistochemistry and western blot analysis. The results showed that NTDs were observed mostly with HU treatment at an optimal dose of 225 mg/kg b/w. RNR activity was inhibited and dNTP levels were decreased in HU-treated embryos with NTDs. Additionally, increased DNA damage, decreased proliferation, and increased caspase-3 were significant in NTDs embryos compared to the controls. Results indicated that HU induced murine NTDs model by disturbing dNTP metabolism and further led to the abnormal cell balance between proliferation and apoptosis.

  6. Gene expression profiling in skeletal muscle of Zucker diabetic fatty rats: implications for a role of stearoyl-CoA desaturase 1 in insulin resistance.

    Science.gov (United States)

    Voss, M D; Beha, A; Tennagels, N; Tschank, G; Herling, A W; Quint, M; Gerl, M; Metz-Weidmann, C; Haun, G; Korn, M

    2005-12-01

    Insulin resistance in skeletal muscle is a hallmark of type 2 diabetes. Therefore, we sought to identify and validate genes involved in the development of insulin resistance in skeletal muscle. Differentially regulated genes in skeletal muscle of male obese insulin-resistant, and lean insulin-sensitive Zucker diabetic fatty (ZDF) rats were determined using Affymetrix microarrays. Based on these data, various aspects of glucose disposal, insulin signalling and fatty acid composition were analysed in a muscle cell line overexpressing stearoyl-CoA desaturase 1 (SCD1). Gene expression profiling in insulin-resistant skeletal muscle revealed the most pronounced changes in gene expression for genes involved in lipid metabolism. Among these, Scd1 showed increased expression in insulin-resistant animals, correlating with increased amounts of palmitoleoyl-CoA. This was further investigated in a muscle cell line that overexpressed SCD1 and accumulated lipids, revealing impairments of glucose uptake and of different steps of the insulin signalling cascade. We also observed differential effects of high-glucose and fatty acid treatment on glucose uptake and long-chain fatty acyl-CoA profiles, and in particular an accumulation of palmitoleoyl-CoA in cells overexpressing SCD1. Insulin-resistant skeletal muscle of ZDF rats is characterised by a specific gene expression profile with increased levels of Scd1. An insulin-resistant phenotype similar to that obtained by treatment with palmitate and high glucose can be induced in vitro by overexpression of SCD1 in muscle cells. This supports the hypothesis that elevated SCD1 expression is a possible cause of insulin resistance and type 2 diabetes.

  7. Multiple Functions of the RNA-Binding Protein HuR in Cancer Progression, Treatment Responses and Prognosis

    Directory of Open Access Journals (Sweden)

    Baocheng Wang

    2013-05-01

    Full Text Available The human embryonic lethal abnormal vision-like protein, HuR, is a member of the Hu family of RNA-binding proteins. Over the past decade, this ubiquitously expressed protein has been extensively investigated in cancer research because it is involved in the regulation of mRNA stability and translation in many cell types. HuR activity and function is associated with its subcellular distribution, transcriptional regulation, translational and post-translational modifications. HuR regulation of target mRNAs is based on the interaction between the three specific domains of HuR protein and one or several U- or AU-rich elements (AREs in the untranslated region of target mRNAs. A number of cancer-related transcripts containing AREs, including mRNAs for proto-oncogenes, cytokines, growth factors, and invasion factors, have been characterized as HuR targets. It has been proposed that HuR has a central tumorigenic activity by enabling multiple cancer phenotypes. In this review, we comprehensively survey the existing evidence with regard to the diverse functions of HuR in caner development and progression. The current data also suggest that HuR might be a novel and promising therapeutic target and a marker for treatment response and prognostic evaluation.

  8. Temporally defined neocortical translation and polysome assembly are determined by the RNA-binding protein Hu antigen R.

    Science.gov (United States)

    Kraushar, Matthew L; Thompson, Kevin; Wijeratne, H R Sagara; Viljetic, Barbara; Sakers, Kristina; Marson, Justin W; Kontoyiannis, Dimitris L; Buyske, Steven; Hart, Ronald P; Rasin, Mladen-Roko

    2014-09-09

    Precise spatiotemporal control of mRNA translation machinery is essential to the development of highly complex systems like the neocortex. However, spatiotemporal regulation of translation machinery in the developing neocortex remains poorly understood. Here, we show that an RNA-binding protein, Hu antigen R (HuR), regulates both neocorticogenesis and specificity of neocortical translation machinery in a developmental stage-dependent manner in mice. Neocortical absence of HuR alters the phosphorylation states of initiation and elongation factors in the core translation machinery. In addition, HuR regulates the temporally specific positioning of functionally related mRNAs into the active translation sites, the polysomes. HuR also determines the specificity of neocortical polysomes by defining their combinatorial composition of ribosomal proteins and initiation and elongation factors. For some HuR-dependent proteins, the association with polysomes likewise depends on the eukaryotic initiation factor 2 alpha kinase 4, which associates with HuR in prenatal developing neocortices. Finally, we found that deletion of HuR before embryonic day 10 disrupts both neocortical lamination and formation of the main neocortical commissure, the corpus callosum. Our study identifies a crucial role for HuR in neocortical development as a translational gatekeeper for functionally related mRNA subgroups and polysomal protein specificity.

  9. Coordination of genomic structure and transcription by the main bacterial nucleoid-associated protein HU.

    Science.gov (United States)

    Berger, Michael; Farcas, Anca; Geertz, Marcel; Zhelyazkova, Petya; Brix, Klaudia; Travers, Andrew; Muskhelishvili, Georgi

    2010-01-01

    The histone-like protein HU is a highly abundant DNA architectural protein that is involved in compacting the DNA of the bacterial nucleoid and in regulating the main DNA transactions, including gene transcription. However, the coordination of the genomic structure and function by HU is poorly understood. Here, we address this question by comparing transcript patterns and spatial distributions of RNA polymerase in Escherichia coli wild-type and hupA/B mutant cells. We demonstrate that, in mutant cells, upregulated genes are preferentially clustered in a large chromosomal domain comprising the ribosomal RNA operons organized on both sides of OriC. Furthermore, we show that, in parallel to this transcription asymmetry, mutant cells are also impaired in forming the transcription foci-spatially confined aggregations of RNA polymerase molecules transcribing strong ribosomal RNA operons. Our data thus implicate HU in coordinating the global genomic structure and function by regulating the spatial distribution of RNA polymerase in the nucleoid.

  10. Selective Regulation of Human Immunodeficiency Virus-Infected CD4+ Lymphocytes by a Synthetic Immunomodulator Leads to Potent Virus Suppression In Vitro and in hu-PBL-SCID Mice

    OpenAIRE

    Bahr, George M.; Darcissac, Edith C. A.; Castéran, Nathalie; Amiel, Corinne; Cocude, Cécile; Truong, Marie-José; Dewulf, Joëlle; Capron, André; Mouton, Yves

    2001-01-01

    We have previously observed that the synthetic immunomodulator Murabutide inhibits human immunodeficiency virus type 1 (HIV-1) replication at multiple levels in macrophages and dendritic cells. The present study was designed to profile the activity of Murabutide on CD8-depleted phytohemagglutinin-activated lymphocytes from HIV-1-infected subjects and on the outcome of HIV-1 infection in severe combined immunodeficiency mice reconstituted with human peripheral blood leukocytes (hu-PBL-SCID mic...

  11. Facile preparation of novel dandelion-like Fe-doped NiCo2O4 microspheres@nanomeshes for excellent capacitive property in asymmetric supercapacitors

    Science.gov (United States)

    Liu, Li; Zhang, Huijuan; Fang, Ling; Mu, Yanping; Wang, Yu

    2016-09-01

    In this work, we successfully synthesized the dandelion-like Fe-doped NiCo2O4 microspheres@nanomeshes (Fe-NCO-M@N-1h) using a facile hydrothermal method, followed by calcinations. In the unique structure, numerous nanoneedles radially grow on the surface of microsphere and some porous nanomeshes orderly develop in the inside of microsphere, therefore dandelion-like Fe-NCO-M@N-1h displays large specific surface area (101.15 m2 g-1) and more active sites. Electrochemical properties of the Fe-NCO-M@N-1h have been tested for symmetric supercapacitors (SCs) and asymmetric supercapacitors (ASCs). Benefiting from the structural advantages, Fe-NCO-M@N-1h electrode exhibits outstanding capacitive behaviors, such as the desirable specific capacitance and eminent rate performance (2237 and 1810 F g-1 at the current densities of 1 and 20 A g-1, respectively) and remarkable cycling performance (95.8% retention after 4500 cycles). Besides, a Fe-NCO-M@N-1h//AC-ASCs device has been constructed successfully, presenting the highest energy density of 46.68 Wh kg-1. The results indicate that the Fe-NCO-M@N-1h is a potential material for SCs.

  12. Probing the mass-loss history of AGB and red supergiant stars from CO rotational line profiles - II. CO line survey of evolved stars: derivation of mass-loss rate formulae

    CERN Document Server

    De Beck, E; de Koter, A; Justtanont, K; Verhoelst, T; Kemper, F; Menten, K M M

    2010-01-01

    We aim to (1) set up simple and general analytical expressions to estimate mass-loss rates of evolved stars, and (2) from those calculate estimates for the mass-loss rates of asymptotic giant branch (AGB), red supergiant (RSG), and yellow hypergiant stars in our galactic sample. Rotationally excited lines of CO are a very robust diagnostic in the study of circumstellar envelopes (CSEs). When sampling different layers of the CSE, observations of these molecular lines lead to detailed profiles of kinetic temperature, expansion velocity, and density. A state-of-the-art, nonlocal thermal equilibrium, and co-moving frame radiative transfer code that predicts CO line intensities in the CSEs of late-type stars is used in deriving relations between stellar and molecular-line parameters, on the one hand, and mass-loss rate, on the other. We present analytical expressions for estimating the mass-loss rates of evolved stellar objects for 8 rotational transitions of the CO molecule, apply them to our extensive CO data se...

  13. Neuroprotective effects of the cannabinoid agonist HU210 on retinal degeneration

    OpenAIRE

    Lax Zapata, Pedro; Esquiva Sobrino, Gema; Altavilla, Cesare; Cuenca Navarro, Nicolás

    2014-01-01

    Cannabinoids have been demonstrated to exert neuroprotective effects on different types of neuronal insults. Here we have addressed the therapeutic potential of the synthetic cannabinoid HU210 on photoreceptor degeneration, synaptic connectivity and functional activity of the retina in the transgenic P23H rat, an animal model for autosomal dominant retinitis pigmentosa (RP). In P23H rats administered with HU210 (100 μg/kg, i.p.) from P24 to P90, ERG recordings showed an amelioration of vision...

  14. The RNA-binding protein HuR regulates DNA methylation through stabilization of DNMT3b mRNA.

    Science.gov (United States)

    López de Silanes, Isabel; Gorospe, Myriam; Taniguchi, Hiroaki; Abdelmohsen, Kotb; Srikantan, Subramanya; Alaminos, Miguel; Berdasco, María; Urdinguio, Rocío G; Fraga, Mario F; Jacinto, Filipe V; Esteller, Manel

    2009-05-01

    The molecular basis underlying the aberrant DNA-methylation patterns in human cancer is largely unknown. Altered DNA methyltransferase (DNMT) activity is believed to contribute, as DNMT expression levels increase during tumorigenesis. Here, we present evidence that the expression of DNMT3b is post-transcriptionally regulated by HuR, an RNA-binding protein that stabilizes and/or modulates the translation of target mRNAs. The presence of a putative HuR-recognition motif in the DNMT3b 3'UTR prompted studies to investigate if this transcript associated with HuR. The interaction between HuR and DNMT3b mRNA was studied by immunoprecipitation of endogenous HuR ribonucleoprotein complexes followed by RT-qPCR detection of DNMT3b mRNA, and by in vitro pulldown of biotinylated DNMT3b RNAs followed by western blotting detection of HuR. These studies revealed that binding of HuR stabilized the DNMT3b mRNA and increased DNMT3b expression. Unexpectedly, cisplatin treatment triggered the dissociation of the [HuR-DNMT3b mRNA] complex, in turn promoting DNMT3b mRNA decay, decreasing DNMT3b abundance, and lowering the methylation of repeated sequences and global DNA methylation. In summary, our data identify DNMT3b mRNA as a novel HuR target, present evidence that HuR affects DNMT3b expression levels post-transcriptionally, and reveal the functional consequences of the HuR-regulated DNMT3b upon DNA methylation patterns.

  15. 可用于探测大气CO2垂直廓线的无线传感系统%Remote sensing system for vertical profiles of atmospheric CO2

    Institute of Scientific and Technical Information of China (English)

    黄见; 胡顺星; 曹开法; 苑克娥; 时东锋

    2016-01-01

    The atmospheric carbon dioxide (CO2) is a greenhouse gas which plays a dominant role in climate changes and also in some other fields. The remote sensing system for vertical profiles of atmospheric CO2 was based on non-dispersive infrared gas detection technology, which can transmit data by wireless. The modulated infrared radiation source and dual-channel detector were employed in the system which take advantage of ultra-low consumption MCU to realize automatic control and acquisition. The method of deducting the fluctuation and background noise of signal was proposed, which made the relative error at 0.29% of the detection. And the time-sharing operation mode was adopted to resolve electromagnetic interference (EMI) from high frequency transmitter of radio sounding to the operational amplifier of the CO2 detection. The digital radio sounding of widely used in meteorology and CO2 detection were integrated highly. The comparison analysis between self-made CO2 remote sensing system and LI-COR LI7500 were carried out, preliminary results show that the variation trends of atmospheric CO2 have good consistency from the two detection systems; the correlation coefficient was 0 . 89 from 24 hours data. It can be indicated that the self-made system has good constancy and accuracy. The self-made system offers another choice to exploit to measure the vertical profiles of atmospheric CO2.%大气CO2是一种温室气体,在气候变化等领域起着关键作用.基于NDIR技术研制了可用于探测大气CO2垂直廓线的无线传感系统.系统采用电调制型的红外辐射光源、双通道探测器并结合超低功耗单片机实现大气CO2信号的采集与控制.提出采用调制信号周期内扣除信号起伏与背景噪声的方法,使得本系统具有0.29%的相对测量误差.通过分时工作的方式解决了数字式无线电探空仪中高频发射机对CO2检测电路运算放大器的电磁辐射干扰,进而实现了气象探空仪与小型化的CO

  16. Hu Shi and the Continuation of the Revolution of1911——Discussing Intellectuals and Social Revolution%Hu Shi and the Continuation of the Revolution of 1911——Discussing Intellectuals and Social Revolution

    Institute of Scientific and Technical Information of China (English)

    Zhu Cheng

    2011-01-01

    Hu Shi is regarded as one of the most important intellectuals after the Revolution of 1911,and he has a far- reaching influence in 20th century.In the perspective of Hu Shi,the contribution and continuation of the Revolution of 1911 has some inspiration for us to analyze the relationship between Chinese intellectuals and social revolution.

  17. Co-modification of F{sup −} and Fe(III) ions as a facile strategy towards effective separation of photogenerated electrons and holes

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xuefei; Yu, Rui; Wang, Ping; Chen, Feng [School of Chemistry, Chemical Engineering and Life Sciences, Wuhan University of Technology, Wuhan 430070 (China); Yu, Huogen, E-mail: yuhuogen@whut.edu.cn [School of Chemistry, Chemical Engineering and Life Sciences, Wuhan University of Technology, Wuhan 430070 (China); State Key Laboratory of Silicate Materials for Architectures, Wuhan University of Technology, Wuhan 430070 (China)

    2015-10-01

    Graphical abstract: - Highlights: • The Fe(III)/F-TiO{sub 2} photocatalyst was prepared by a facile, wet chemical method. • Fe(III)/F-TiO{sub 2} exhibited higher photocatalytic activity than TiO{sub 2}, Fe(III)/TiO{sub 2} and F-TiO{sub 2}. • The synergistic effect of Fe(III) and F ions contributed to the enhanced activity of TiO{sub 2}. - Abstract: The combination of cocatalysts for simultaneously promoting rapid transfer of photogenerated electrons and holes is one of the effective strategies to improve photocatalytic activity of semiconductor photocatalysts. In this study, highly efficient TiO{sub 2} photocatalyst with co-modification of F and Fe(III) ions was prepared by a facile two wet-chemical method including Fe(III) ions impregnation and then F-ion adsorption on the TiO{sub 2} surface. The photocatalytic results demonstrated that the simultaneously modified Fe(III)/F-TiO{sub 2} photocatalyst exhibited obvious enhancement of photocatalytic performance compared with the pure TiO{sub 2} and single-component modified Fe(III)/TiO{sub 2} and F-TiO{sub 2}. Based on the present experimental results, we propose a possible synergistic effect of Fe(III) and F ions to illustrate the enhanced photocatalytic activity of Fe(III)/F-TiO{sub 2} photocatalyst, namely the Fe(III) ions act as effective active sites to rapidly transfer the photogenerated electrons in the CB of TiO{sub 2} and then reduce oxygen, while F ions work as other effective active sites to rapidly transfer the photogenerated holes in the VB of TiO{sub 2} and then form free hydroxide radical to oxidize the organic substances. As a result, the transfer rate and the interfacial catalytic reaction of photogenerated electrons and holes were simultaneously accelerated, which resulted in the enhanced photocatalytic performance of Fe(III)/F-TiO{sub 2} photocatalyst. Due to the low cost and abundant resource of Fe and F, the obtained photocatalyst is promising for practical application. Furthermore, the

  18. Preparation of sustained release co-extrudates by hot-melt extrusion and mathematical modelling of in vitro/in vivo drug release profiles.

    Science.gov (United States)

    Quintavalle, U; Voinovich, D; Perissutti, B; Serdoz, F; Grassi, G; Dal Col, A; Grassi, M

    2008-03-01

    Aim of this work was to develop a cylindrical co-extrudate characterised by an in vivo sustained release profile by means of a hot-melt extrusion process. Co-extrudate was made up of two concentric extruded matrices: an inner one having a hydrophilic character, based on polyethylene glycol, and an outer one with lipophilic character, based on microcrystalline wax. Both segments contained theophylline as a model drug. A screening between several devices differing for dimensions (diameter and length) and relative proportions of the inner and outer part was carried out on the basis of their in vitro drug release and the release mechanism was studied by means of a mathematical model. The co-extrudate exhibiting the desired sustained release was selected for in vivo bioavailability studies. In vivo studies confirmed the achievement of the purpose of the research, demonstrating the desired release of theophylline on four healthy volunteers. Accordingly, hot-melt extrusion process is a viable method to produce in a single step co-extrudates showing a sustained release. In addition, the developed mathematical model proved to be a reliable descriptor of the both in vitro and in vivo experimental data.

  19. Facilities & Leadership

    Data.gov (United States)

    Department of Veterans Affairs — The facilities web service provides VA facility information. The VA facilities locator is a feature that is available across the enterprise, on any webpage, for the...

  20. Epidemiological profile and risk factors of HIV and HBV/HCV co-infection in Fujian Province, southeastern China.

    Science.gov (United States)

    Wu, Shouli; Yan, Pingping; Yang, Tianfei; Wang, Zhenghua; Yan, Yansheng

    2017-03-01

    This study aimed to investigate the epidemiological features of HIV-infected subjects co-infected with HBV/HCV in Fujian Province, southeastern China, and identify the risk factors. Blood samples were collected from 2,028 HIV antibody-positive subjects in Fujian Province. Serum HBsAg and anti-HCV antibody were detected, and CD4(+) T cell count was measured. Of the 2,028 subjects, the prevalence of HIV-HBV, HIV-HCV, and HIV-HBV-HCV co-infections was 16.22%, 3.7%, and 0.79%, respectively. Man (OR = 1.912, 95% CI: 1.371-2.667), key population (OR = 0.756, 95% CI: 0.57-0.976) and detainee (OR = 0.486, 95% CI: 0.259-0.909) were risk factors of HIV-HBV co-infection, and man (OR = 2.227, 95% CI: 1.096-4.525), minority (OR = 5.04, 95% CI: 1.696-14.98), junior high school or lower education (OR = 2.32, 95% CI: 1.071-5.025), intravenous drug use (OR = 38.46, 95% CI: 11.46-129.11) and detainee (OR = 5.687, 95% CI: 2.44-13.25) were risk factors of HIV-HCV co-infection. In addition, a lower mean CD4(+) T cell count was measured in HIV/HBV and HIV/HCV co-infected subjects than in HIV-infected subjects among the untreated individuals, while in the treated populations, a higher mean CD4(+) T cell count was detected in HIV/HBV and HIV/HCV co-infected subjects than in HIV-infected subjects. HIV co-infection with HBV or HCV, notably HIV-HBV co-infection, is widespread in southeastern China. Hepatitis virus screening should be included in monitoring of HIV infection, and HIV and hepatitis virus co-infection should be considered during the development of HIV antiretroviral therapy scheme. J. Med. Virol. 89:443-449, 2017. © 2016 Wiley Periodicals, Inc.

  1. Immunostimulatory effects of natural human interferon-alpha (huIFN-alpha) on carps Cyprinus carpio L.

    Science.gov (United States)

    Watanuki, Hironobu; Chakraborty, Gunimala; Korenaga, Hiroki; Kono, Tomoya; Shivappa, R B; Sakai, Masahiro

    2009-10-15

    Human interferon-alpha (huIFN-alpha) is an important immunomodulatory substance used in the treatment and prevention of numerous infectious and immune-related diseases in animals. However, the immunostimulatory effects of huIFN-alpha in fish remain to be investigated. In the current study, the immune responses of the carp species Cyprinus carpio L. to treatment with huIFN-alpha were analyzed via measurement of superoxide anion production, phagocytic activity and the expression of cytokine genes including interleukin-1beta, tumor necrosis factor-alpha and interleukin 10. Low doses of huIFN-alpha were administered orally once a day for 3 days, and sampling was carried out at 1, 3 and 5 days post-treatment. Our results indicate that a low dose of huIFN-alpha significantly increased phagocytic activity and superoxide anion production in the carp kidney. The huIFN-alpha-treated fish also displayed a significant upregulation in cytokine gene expression. The current study demonstrates the stimulatory effects of huIFN-alpha on the carp immune system and highlights the immunomodulatory role of huIFN-alpha in fish.

  2. First International Workshop on Human Factors in Modeling (HuFaMo 2015)

    DEFF Research Database (Denmark)

    Störrle, Harald; Chaudron, Michel R. V.; Amaral, Vasco

    2015-01-01

    and systematic approaches to assert usability in modeling and confirm the claims of productivity. This workshop creates a space for discussion being a get together of both MDE, Usability, Human Interfaces and the Experimental Software engineering community. HuFaMo expressly focuses on human factors, in order...

  3. Rare Association of Anti-Hu Antibody Positive Paraneoplastic Neurological Syndrome and Transitional Cell Bladder Carcinoma

    Directory of Open Access Journals (Sweden)

    S. Lukacs

    2012-01-01

    Full Text Available Introduction. Paraneoplastic encephalomyelitis (PEM and subacute sensory neuronopathy (SSN are remote effects of cancer, usually associated with small-cell lung carcinoma and positive anti-Hu antibody. We describe the rare association of bladder transitional cell carcinoma (TCC with anti-Hu antibody positivity resulting in this paraneoplastic neurological syndrome. Patient. A 76-year-old female presented with bilateral muscle weakness and paraesthesia of the upper and lower limbs in a length-dependent “glove and stocking” distribution. Central nervous system symptoms included cognitive problems, personality change, and truncal ataxia. Case notes and the literature were reviewed. Result. Autoantibody screening was positive for anti-Hu antibody (recently renamed antineuronal nuclear antibody 1, ANNA-1. The diagnosis of PEM and SSN was supported by MRI and lumbar puncture results. A superficial bladder TCC was demonstrated on CT and subsequently confirmed on histology. No other primary neoplasm was found on full-body imaging. The neurological symptoms were considered to be an antibody-mediated paraneoplastic neurological syndrome and improved after resection of the tumour. Discussion. The association of anti-Hu positive paraneoplastic neurological syndrome and TCC has not been described in the literature previously. We emphasize the need for detailed clinical examination and the importance of a multidisciplinary thought process and encourage further awareness of this rare association.

  4. Facile synthesis of a novel structured Li[Ni0.66Co0.1Mn0.24]O2 cathode material with improved cycle life and thermal stability via ion diffusion

    Science.gov (United States)

    Zhang, Yongheng; Shi, Hua; Song, Dawei; Zhang, Hongzhou; Shi, Xixi; Zhang, Lianqi

    2016-09-01

    In order to combine the advantages of core-shell and concentration-gradient Li[Ni1-xMx]O2 materials, a novel structured Li[Ni0.66Co0.1Mn0.24]O2 (NSsbnd Li[Ni0.66Co0.1Mn0.24]O2) cathode material is facilely synthesized from core-shell precursor [(Ni0.8Co0.1Mn0.1)0.6(Ni0.45Co0.1Mn0.45)0.4](OH)2 via ion diffusion during high temperature calcination. NSsbnd Li[Ni0.66Co0.1Mn0.24]O2 is constructed by core layer, concentration-gradient layer and shell layer. From the detailed comparative investigations, it is found that NSsbnd Li[Ni0.66Co0.1Mn0.24]O2 delivers remarkably improved cycle life and thermal stability compared with normal Li[Ni0.66Co0.1Mn0.24]O2 (Nsbnd Li[Ni0.66Co0.1Mn0.24]O2).

  5. Biochemistry Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Biochemistry Facility provides expert services and consultation in biochemical enzyme assays and protein purification. The facility currently features 1) Liquid...

  6. HuB localizes to polysomes and alters C/EBP-beta expression in 3T3-L1 adipocytes.

    Science.gov (United States)

    Gantt, Kira R; Jain, Renu G; Dudek, Ronald W; Pekala, Phillip H

    2004-01-16

    The RNA binding protein HuB was ectopically expressed in 3T3-L1 preadipocytes and localized primarily to the nucleus, as the cells differentiated HuB redistributed to the cytosol and on analysis localized to the dense polysomes. Electron micrographs confirm association of HuB with the ribosomes in the adipocytes consistent with a proposed role in control of translation and mRNA stability. Examination of the expression of C/EBP-beta in the cells expressing HuB relative to the parental 3T3-L1 adipocytes demonstrated an alteration in the LAP to LIP ratio. The data support a role for endogenous Hu proteins in the differentiation process, potentially affecting the rate of differentiation by controlling the concentration of the dominant negative transcription inhibitor, LIP.

  7. Redox behaviors of the neurotoxic portion in human prion protein, HuPrP(106-126)

    Science.gov (United States)

    Yamamoto, Norifumi; Kuwata, Kazuo

    2010-09-01

    A peptide fragment of human prion protein, HuPrP(106-126), has been reported to mimic the pathological features underlying prion diseases. Although the actual neurotoxic mechanism of HuPrP(106-126) has not been elucidated, several hypotheses has been proposed based on the role for copper. In this study, to understand the toxic function of HuPrP(106-126) from a viewpoint of electrochemical competence, we investigated redox properties of copper ion complexes with four different binding motifs of a model of HuPrP(106-126) based on density functional theory calculations. We found that the HuPrP(106-126)-derived models exhibited diverse redox activities that depended on copper-binding conformations.

  8. Co-Expression and Co-Localization of Cartilage Glycoproteins CHI3L1 and Lubricin in Osteoarthritic Cartilage: Morphological, Immunohistochemical and Gene Expression Profiles.

    Science.gov (United States)

    Szychlinska, Marta Anna; Trovato, Francesca Maria; Di Rosa, Michelino; Malaguarnera, Lucia; Puzzo, Lidia; Leonardi, Rosy; Castrogiovanni, Paola; Musumeci, Giuseppe

    2016-01-01

    Osteoarthritis is the most common human arthritis characterized by degeneration of articular cartilage. Several studies reported that levels of human cartilage glycoprotein chitinase 3-like-1 (CHI3L1) are known as a potential marker for the activation of chondrocytes and the progression of Osteoarthritis (OA), whereas lubricin appears to be chondroprotective. The aim of this study was to investigate the co-expression and co-localization of CHI3L1 and lubricin in normal and osteoarthritic rat articular cartilage to correlate their modified expression to a specific grade of OA. Samples of normal and osteoarthritic rat articular cartilage were analyzed by the Kellgren-Lawrence OA severity scores, the Kraus' modified Mankin score and the Histopathology Osteoarthritis Research Society International (OARSI) system for histomorphometric evaluations, and through CHI3L1 and lubricin gene expression, immunohistochemistry and double immuno-staining analysis. The immunoexpression and the mRNA levels of lubricin increased in normal cartilage and decreased in OA cartilage (normal vs. OA, p < 0.01). By contrast, the immunoexpression and the mRNA levels of CHI3L1 increased in OA cartilage and decreased in normal cartilage (normal vs. OA, p < 0.01). Our findings are consistent with reports suggesting that these two glycoproteins are functionally associated with the development of OA and in particular with grade 2/3 of OA, suggesting that in the future they could be helpful to stage the severity and progression of the disease.

  9. Co-Expression and Co-Localization of Cartilage Glycoproteins CHI3L1 and Lubricin in Osteoarthritic Cartilage: Morphological, Immunohistochemical and Gene Expression Profiles

    Directory of Open Access Journals (Sweden)

    Marta Anna Szychlinska

    2016-03-01

    Full Text Available Osteoarthritis is the most common human arthritis characterized by degeneration of articular cartilage. Several studies reported that levels of human cartilage glycoprotein chitinase 3-like-1 (CHI3L1 are known as a potential marker for the activation of chondrocytes and the progression of Osteoarthritis (OA, whereas lubricin appears to be chondroprotective. The aim of this study was to investigate the co-expression and co-localization of CHI3L1 and lubricin in normal and osteoarthritic rat articular cartilage to correlate their modified expression to a specific grade of OA. Samples of normal and osteoarthritic rat articular cartilage were analyzed by the Kellgren–Lawrence OA severity scores, the Kraus’ modified Mankin score and the Histopathology Osteoarthritis Research Society International (OARSI system for histomorphometric evaluations, and through CHI3L1 and lubricin gene expression, immunohistochemistry and double immuno-staining analysis. The immunoexpression and the mRNA levels of lubricin increased in normal cartilage and decreased in OA cartilage (normal vs. OA, p < 0.01. By contrast, the immunoexpression and the mRNA levels of CHI3L1 increased in OA cartilage and decreased in normal cartilage (normal vs. OA, p < 0.01. Our findings are consistent with reports suggesting that these two glycoproteins are functionally associated with the development of OA and in particular with grade 2/3 of OA, suggesting that in the future they could be helpful to stage the severity and progression of the disease.

  10. Discriminating between HuR and TTP binding sites using the k-spectrum kernel method

    Science.gov (United States)

    Goldberg, Debra S.; Dowell, Robin

    2017-01-01

    Background The RNA binding proteins (RBPs) human antigen R (HuR) and Tristetraprolin (TTP) are known to exhibit competitive binding but have opposing effects on the bound messenger RNA (mRNA). How cells discriminate between the two proteins is an interesting problem. Machine learning approaches, such as support vector machines (SVMs), may be useful in the identification of discriminative features. However, this method has yet to be applied to studies of RNA binding protein motifs. Results Applying the k-spectrum kernel to a support vector machine (SVM), we first verified the published binding sites of both HuR and TTP. Additional feature engineering highlighted the U-rich binding preference of HuR and AU-rich binding preference for TTP. Domain adaptation along with multi-task learning was used to predict the common binding sites. Conclusion The distinction between HuR and TTP binding appears to be subtle content features. HuR prefers strongly U-rich sequences whereas TTP prefers AU-rich as with increasing A content, the sequences are more likely to be bound only by TTP. Our model is consistent with competitive binding of the two proteins, particularly at intermediate AU-balanced sequences. This suggests that fine changes in the A/U balance within a untranslated region (UTR) can alter the binding and subsequent stability of the message. Both feature engineering and domain adaptation emphasized the extent to which these proteins recognize similar general sequence features. This work suggests that the k-spectrum kernel method could be useful when studying RNA binding proteins and domain adaptation techniques such as feature augmentation could be employed particularly when examining RBPs with similar binding preferences. PMID:28333956

  11. Intestinal epithelial HuR modulates distinct pathways of proliferation and apoptosis and attenuates small intestinal and colonic tumor development.

    Science.gov (United States)

    Giammanco, Antonina; Blanc, Valerie; Montenegro, Grace; Klos, Coen; Xie, Yan; Kennedy, Susan; Luo, Jianyang; Chang, Sung-Hee; Hla, Timothy; Nalbantoglu, Ilke; Dharmarajan, Sekhar; Davidson, Nicholas O

    2014-09-15

    HuR is a ubiquitous nucleocytoplasmic RNA-binding protein that exerts pleiotropic effects on cell growth and tumorigenesis. In this study, we explored the impact of conditional, tissue-specific genetic deletion of HuR on intestinal growth and tumorigenesis in mice. Mice lacking intestinal expression of HuR (Hur (IKO) mice) displayed reduced levels of cell proliferation in the small intestine and increased sensitivity to doxorubicin-induced acute intestinal injury, as evidenced by decreased villus height and a compensatory shift in proliferating cells. In the context of Apc(min/+) mice, a transgenic model of intestinal tumorigenesis, intestinal deletion of the HuR gene caused a three-fold decrease in tumor burden characterized by reduced proliferation, increased apoptosis, and decreased expression of transcripts encoding antiapoptotic HuR target RNAs. Similarly, Hur(IKO) mice subjected to an inflammatory colon carcinogenesis protocol [azoxymethane and dextran sodium sulfate (AOM-DSS) administration] exhibited a two-fold decrease in tumor burden. Hur(IKO) mice showed no change in ileal Asbt expression, fecal bile acid excretion, or enterohepatic pool size that might explain the phenotype. Moreover, none of the HuR targets identified in Apc(min/+)Hur(IKO) were altered in AOM-DSS-treated Hur(IKO) mice, the latter of which exhibited increased apoptosis of colonic epithelial cells, where elevation of a unique set of HuR-targeted proapoptotic factors was documented. Taken together, our results promote the concept of epithelial HuR as a contextual modifier of proapoptotic gene expression in intestinal cancers, acting independently of bile acid metabolism to promote cancer. In the small intestine, epithelial HuR promotes expression of prosurvival transcripts that support Wnt-dependent tumorigenesis, whereas in the large intestine epithelial HuR indirectly downregulates certain proapoptotic RNAs to attenuate colitis-associated cancer. Cancer Res; 74(18); 5322-35. ©2014 AACR.

  12. Field study and theoretical evidence for the profiles and underlying mechanisms of PCDD/F formation in cement kilns co-incinerating municipal solid waste and sewage sludge.

    Science.gov (United States)

    Zhao, Yuyang; Zhan, Jiayu; Liu, Guorui; Ren, Zhiyuan; Zheng, Minghui; Jin, Rong; Yang, Lili; Wang, Mei; Jiang, Xiaoxu; Zhang, Xian

    2017-03-01

    A field study and theoretical calculations on the profile and formation mechanism of polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) from two cement kilns co-incinerating municipal solid waste and sewage sludge were performed, and the PCDFs were mainly focused. The back-end areas of the cement kilns were identified to be the major sites of PCDD/F formation according to their distributions in particulate samples from different process stages. The proportions of tetra- to hexa-chlorinated dibenzofurans (∑Cl4-6CDFs) at the kiln back-end areas were in the range of 50-80% of the total PCDD/Fs in mass concentrations and 62-87% in toxic equivalent concentrations. These results indicated that ∑Cl4-6CDFs are the dominant homologs that should be the focus for reducing PCDD/F emissions in cement kilns that co-incinerate municipal solid waste and sewage sludge. It is speculated that the low contents of oxygen and copper compounds, as well as the alkaline conditions, may contribute to the dominance of ∑Cl4-6CDFs in the PCDD/Fs formed. Chlorination was assumed to be the mechanism of formation of PCDFs. The results from model predictions and thermodynamic calculations used to test this assumption were consistent with the PCDF profiles observed from the field study. Copyright © 2016 Elsevier Ltd. All rights reserved.

  13. Fluxes of CO2, CH4 and N2O at two European beech forests: linking soil gas production profiles with soil and stem fluxes

    Science.gov (United States)

    Maier, Martin; Machacova, Katerina; Halaburt, Ellen; Haddad, Sally; Urban, Otmar; Lang, Friederike

    2016-04-01

    Soil and plant surfaces are known to exchange greenhouse gases with the atmosphere. Some gases like nitrous oxide (N2O) and methane (CH4) can be produced and re-consumed in different soil depths and soil compartments, so that elevated concentrations of CH4 or N2O in the soil do not necessarily mean a net efflux from the soil into the atmosphere. Soil aeration, and thus the oxygen status can underlay a large spatial variability within the soil on the plot and profile scale, but also within soil aggregates. Thus, conditions suitable for production and consumption of CH4 and N2O can vary on different scales in the soil. Plant surfaces can also emit or take up CH4 and N2O, and these fluxes can significantly contribute to the net ecosystem exchange. Since roots usually have large intercellular spaces or aerenchyma they may represent preferential transport ways for soil gases, linking possibly elevated soil gas concentrations in the subsoil in a "shortcut" to the atmosphere. We tested the hypothesis that the spatial variability of the soil-atmosphere fluxes of CO2, CH4 and N2O is caused by the heterogeneity in soil properties. Therefore, we measured soil-atmosphere gas fluxes, soil gas concentrations and soil diffusivity profiles and did a small scale field assessment of soil profiles on the measurments plots. We further tried to link vertical profiles of soil gas concentrations and diffusivity to derive the production and consumption profiles, and to link these profiles to the stem-atmosphere flux rates of individual trees. Measurements were conducted in two mountain beech forests with different geographical and climatic conditions (White Carpathians, Czech Republic; Black Forest, Germany). Gas fluxes at stem and soil levels were measured simultaneously using static chamber systems and chromatographic and continuous laser analyses. Monitoring simultaneously vertical soil gas profiles allowed to assess the within-soil gas fluxes, and thus to localize the production and

  14. Risk Profile and Treatment Needs of Women in Jail with Co-Occurring Serious Mental Illness and Substance Use Disorders

    OpenAIRE

    Nowotny, Kathryn M.; Belknap, Joanne; Lynch, Shannon; DeHart, Dana

    2014-01-01

    Recent research has documented the unusually high rates of incarcerated women’s serious mental illness (SMI) and substance use disorders (SUD). Complicating these high rates is the high comorbidity of SMI with SUD and trauma histories. Yet, incarcerated women have significantly less access to treatment and health services while incarcerated than men. We used data from a multi-site, multi-method project funded by the Bureau of Justice Assistance (2011–2012) to determine the risk profile of wom...

  15. Facility Management's Role in Organizational Sustainability

    Science.gov (United States)

    Adams, Gregory K.

    2013-01-01

    Facility managers have questions about sustainability. How do an organization's physical facilities--its built environment--and the management of them, influence the sustainability of the organization or institution as a whole? How important is Facility Management (FM) to the overall sustainability profile of an organization? Facility managers…

  16. Facility Management's Role in Organizational Sustainability

    Science.gov (United States)

    Adams, Gregory K.

    2013-01-01

    Facility managers have questions about sustainability. How do an organization's physical facilities--its built environment--and the management of them, influence the sustainability of the organization or institution as a whole? How important is Facility Management (FM) to the overall sustainability profile of an organization? Facility managers…

  17. 胞质HuR在卵巢上皮性癌的表达及意义%The expression and significance of cytoplasmic HuR in epithelial ovarian carcinoma

    Institute of Scientific and Technical Information of China (English)

    齐玉明; 石彬; 郭皓; 成艳梅

    2011-01-01

    Objective To investigate the correlation between the expression of HuR in epithelial ovarian cancer and clinicopathological parameters in order to explore the factors that affect the prognosis of patients with epithelial ovarian carcinoma. Methods The expressions of cytoplasmic and nuclear HuR in normal ovary tissues,borderline tissue of ovary tumor and epithelial ovarian carcinoma were detected by SP immunohistochemical technique and RT-PCR. The relationship between cytoplasmic HuR expression and prognostic factors was analyzed.Results The expressions of cytoplasmic and nuclear HuR in epithelial ovarian cancer tissue were significantly higher than those in borderline tissue of epithelial ovarian tumor and normal ovarian tissues,however,there was no significant difference between the borderline tissue of epithelial ovarian tumor and normal ovarian tissue ( P >0.05). The statistical analysis showed that the positive expression rate of cytoplasmic HuR in epithelial ovarian carcinoma was closely correlated with histological grade and FIGO stage, but the positive expression rate of nuclear HuR was not correlated with the clinicopathological parameters. Conclusion The over-expression of HuR may play an important role in the growth and progress of epithelial ovarian carcinoma. To detect the expression of cytoplasmic HuR in epithelial ovarian carcinoma may predict the characteristics of oncobiology behaviour. The expression of cytoplasmic HuR may act as an independent prognostic indicator.%目的 检测HuR在卵巢上皮性癌中的表达及与临床病理参数的关系,寻求卵巢癌的预后因素.方法 采用免疫组化链霉菌抗生物素蛋白-过氧化物酶连接(SP)法和逆转录RT-PCR技术,检测胞质和胞核HuR在正常、交界性、恶性卵巢组织中的表达;分析胞质HuR的表达与预后的关系.结果 胞质和胞核HuR在恶性卵巢肿瘤组织的表达明显高于交界性卵巢肿瘤和正常卵巢组织,胞质和胞核HuR在交界性

  18. POWER SYSTEMS DEVELOPMENT FACILITY

    Energy Technology Data Exchange (ETDEWEB)

    Unknown

    2002-11-01

    This report discusses test campaign GCT4 of the Kellogg Brown & Root, Inc. (KBR) transport reactor train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The transport reactor is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using one of two possible particulate control devices (PCDs). The transport reactor was operated as a pressurized gasifier during GCT4. GCT4 was planned as a 250-hour test run to continue characterization of the transport reactor using a blend of several Powder River Basin (PRB) coals and Bucyrus limestone from Ohio. The primary test objectives were: Operational Stability--Characterize reactor loop and PCD operations with short-term tests by varying coal-feed rate, air/coal ratio, riser velocity, solids-circulation rate, system pressure, and air distribution. Secondary objectives included the following: Reactor Operations--Study the devolatilization and tar cracking effects from transient conditions during transition from start-up burner to coal. Evaluate the effect of process operations on heat release, heat transfer, and accelerated fuel particle heat-up rates. Study the effect of changes in reactor conditions on transient temperature profiles, pressure balance, and product gas composition. Effects of Reactor Conditions on Synthesis Gas Composition--Evaluate the effect of air distribution, steam/coal ratio, solids-circulation rate, and reactor temperature on CO/CO{sub 2} ratio, synthesis gas Lower Heating Value (LHV), carbon conversion, and cold and hot gas efficiencies. Research Triangle Institute (RTI) Direct Sulfur Recovery Process (DSRP) Testing--Provide syngas in support of the DSRP commissioning. Loop Seal Operations--Optimize loop seal operations and investigate increases to previously achieved maximum solids-circulation rate.

  19. Comment on "Observation of mutual diffusion of macromolecules in PS/PMMA binary films by confocal Raman microscopy" by C. Hu, X. Chen, J. Chen, W. Zhang and M. Q. Zhang, Soft Matter, 2012, 8, 4780.

    Science.gov (United States)

    Tomba, J Pablo

    2016-05-18

    A paper by Hu et al. (Soft Matter, 2012, 8, 4780) reports on the use of confocal Raman microscopy to resolve mutual diffusion between polystyrene (PS) and poly(methyl methacrylate) (PMMA). In-depth optical sectioning is employed to measure the diffusive broadening of the originally planar PS-PMMA interface, from which tracer and mutual diffusion coefficients and values for the PS-PMMA thermodynamic interaction parameter are extracted. Here, a reinterpretation of Hu's data that leads to a completely different scenario is presented, as apparent diffusive broadening can be mostly attributed to optical distortions inherent to the probe methodology. It also explains the lack of consistency of kinetic and thermodynamic parameters obtained by the authors from their diffusion analysis in comparison with earlier published data on this system. Overall, it highlights the importance of carrying out appropriate data analysis when confocal Raman microscopy is applied in dry depth-profiling investigations.

  20. Advancing forensic RNA typing: On non-target secretions, a nasal mucosa marker, a differential co-extraction protocol and the sensitivity of DNA and RNA profiling.

    Science.gov (United States)

    van den Berge, Margreet; Bhoelai, Bryan; Harteveld, Joyce; Matai, Anuska; Sijen, Titia

    2016-01-01

    The forensic identification of human body fluids and tissues by means of messenger RNA (mRNA) profiling is a long studied methodology that is increasingly applied to casework samples. Previously, we have described an mRNA multiplex system that targets blood, saliva, semen, menstrual secretion, vaginal mucosa and skin (Lindenbergh et al. and van den Berge et al.). In this study we consider various topics to improve this mRNA profiling system or its use and adapt the method accordingly. Bodily secretions that may be encountered at a crime scene whilst not targeted by the multiplex-id est nasal mucosa, sweat, tears, faeces and urine-were examined for false positive signals. The results prompted us to identify a nasal mucosa marker that allows the discrimination of nasal mucosa from saliva or vaginal mucosa and nosebleed blood from peripheral blood. An updated version of the multiplex was prepared to which the nasal mucosa marker was added and in which markers for semen, vaginal mucosa and blood were replaced. Lactobacillus markers were regarded unsuitable as replacement for vaginal mucosa mRNA markers because of background signals on penile swabs that appeared devoid of female DNA. Furthermore, we provide approaches to deal with highly unbalanced mixtures. First, a differential extraction protocol was incorporated into a co-extraction protocol to allow DNA and RNA analysis of separated non-sperm and sperm fractions. In a second approach, besides the standard multiplex, a customized multiplex is used which excludes markers for prevailing cell types. This allows the use of lower cDNA inputs for the prevailing cell types and higher inputs for cell types that appear masked. Additionally, we assessed the relation between the percentage of alleles or markers detected in DNA or RNA profiles when decreasing sample amounts are analysed. While blood, saliva, semen and menstrual secretion show the trend that DNA profiling is more sensitive than RNA profiling, the reverse is seen

  1. Reversible HuR-microRNA binding controls extracellular export of miR-122 and augments stress response.

    Science.gov (United States)

    Mukherjee, Kamalika; Ghoshal, Bartika; Ghosh, Souvik; Chakrabarty, Yogaditya; Shwetha, Shivaprasad; Das, Saumitra; Bhattacharyya, Suvendra N

    2016-08-01

    microRNAs (miRNAs), the tiny but stable regulatory RNAs in metazoan cells, can undergo selective turnover in presence of specific internal and external cues to control cellular response against the changing environment. We have observed reduction in cellular miR-122 content, due to their accelerated extracellular export in human hepatic cells starved for small metabolites including amino acids. In this context, a new role of human ELAV protein HuR has been identified. HuR, a negative regulator of miRNA function, accelerates extracellular vesicle (EV)-mediated export of miRNAs in human cells. In stressed cells, HuR replaces miRNPs from target messages and is both necessary and sufficient for the extracellular export of corresponding miRNAs. HuR could reversibly bind miRNAs to replace them from Ago2 and subsequently itself gets freed from bound miRNAs upon ubiquitination. The ubiquitinated form of HuR is predominantly associated with multivesicular bodies (MVB) where HuR-unbound miRNAs also reside. These MVB-associated pool of miRNAs get exported out via EVs thereby delimiting cellular miR-122 level during starvation. Therefore, by modulating extracellular export of miR-122, HuR could control stress response in starved human hepatic cells.

  2. Versatile high pressure CO2 capture test facility for solvent development: set-up for gaining accurate knowledge of solvent systems

    NARCIS (Netherlands)

    Runstraat, A. van de; Goetheer, E.L.V.; Giling, E.J.M.

    2013-01-01

    Solvent based technology is the state of the art method for the removal of CO2 from natural gas or from shifted syn gas (pre-combustion CO2-capture). In this typical upgrading technology, CO2 is removed from the gas mixture by absorption using physical or reactive solvents. There is an increasing tr

  3. SU-E-T-470: Importance of HU-Mass Density Calibration Technique in Proton Pencil Beam Dose Calculation

    Energy Technology Data Exchange (ETDEWEB)

    Penfold, S; Miller, A [University of Adelaide, Adelaide, SA (Australia)

    2015-06-15

    Purpose: Stoichiometric calibration of Hounsfield Units (HUs) for conversion to proton relative stopping powers (RStPs) is vital for accurate dose calculation in proton therapy. However proton dose distributions are not only dependent on RStP, but also on relative scattering power (RScP) of patient tissues. RScP is approximated from material density but a stoichiometric calibration of HU-density tables is commonly neglected. The purpose of this work was to quantify the difference in calculated dose of a commercial TPS when using HU-density tables based on tissue substitute materials and stoichiometric calibrated ICRU tissues. Methods: Two HU-density calibration tables were generated based on scans of the CIRS electron density phantom. The first table was based directly on measured HU and manufacturer quoted density of tissue substitute materials. The second was based on the same CT scan of the CIRS phantom followed by a stoichiometric calibration of ICRU44 tissue materials. The research version of Pinnacle{sup 3} proton therapy was used to compute dose in a patient CT data set utilizing both HU-density tables. Results: The two HU-density tables showed significant differences for bone tissues; the difference increasing with increasing HU. Differences in density calibration table translated to a difference in calculated RScP of −2.5% for ICRU skeletal muscle and 9.2% for ICRU femur. Dose-volume histogram analysis of a parallel opposed proton therapy prostate plan showed that the difference in calculated dose was negligible when using the two different HU-density calibration tables. Conclusion: The impact of HU-density calibration technique on proton therapy dose calculation was assessed. While differences were found in the calculated RScP of bony tissues, the difference in dose distribution for realistic treatment scenarios was found to be insignificant.

  4. Altered regulation of ELAVL1/HuR in HLA-B27-expressing U937 monocytic cells.

    Directory of Open Access Journals (Sweden)

    Anna S Sahlberg

    Full Text Available OBJECTIVE: To investigate the role of HLA-B27 expression in the regulation of RNA binding protein (RBP Embryonic Lethal Abnormal Vision (ELAV L1/Human antigen R (HuR expression in Salmonella-infected or LPS-stimulated human monocytic cells, since HuR is a critical regulator of the post-transcriptional fate of many genes (e.g. TNFα important in inflammatory response. METHODS: U937 monocytic cells were stably transfected with pSV2neo resistant vector (mock, wild type HLA-B27, or mutated HLA-B27 with amino acid substitutions in the B pocket. Cells were differentiated, infected with Salmonella enteritidis or stimulated with lipopolysaccharide. The expression levels of HuR protein and cleavage products (CP1 and CP2 were detected by Western blotting and flow cytometry. Specific inhibitors were used to study the role of PKR and p38 in HuR expression and generation of CPs. TNFα and IL-10 secretion after p38 and PKR inhibition were measured by ELISA. RESULTS: Full length HuR is overexpressed and HuR cleavage is disturbed in U937 monocytic cells expressing HLA-B27 heavy chains (HC. Increased full length HuR expression, disturbed cleavage and reduced dependence on PKR after infection correlate with the expression of glutamic acid 45 in the B pocket that is linked to the misfolding of HLA-B27. CONCLUSION: Results show that the expression of HLA-B27 HCs modulates the intracellular environment of U937 monocyte/macrophages by altering HuR regulation. This phenomenon is at least partly dependent on the misfolding feature of the B27 molecule. Since HuR is an important regulator of multiple genes involved in inflammatory response observations offer an explanation how HLA-B27 may modulate inflammatory response.

  5. Bacterial Community Profiling of H2/CO2 or Formate-Utilizing Acetogens Enriched from Diverse Ecosystems

    Science.gov (United States)

    Han, R.; Zhang, L.; Fu, B.; Liu, H.

    2014-12-01

    Synthetic gases are usually generated from either cellulosic agricultural waste combustion or industrial release and could be subsequently transformed into acetate, ethanol, and/or butyrate by homoacetogenic bacteria, which commonly possess reductive acetyl-CoA synthesis pathway. Homoacetogen-based syngas fermentation technology provides an alternative solution to link greenhouse gas emission control and cellulosic solid waste treatment with biofuels production. The objective of our current project is to hunt for homoacetogens with capabilities of highly efficiently converting syngases to chemical solvents. In this study, we evaluated homoacetogens population dynamics during enrichments and pinpointed dominant homoacetogens representing diverse ecosystems enriched by different substrates. We enriched homoacetogens from four different samples including waste activate sludge, freshwater sediment, anaerobic methanogenic sludge, and cow manure using H2/CO2 (4:1) or formate as substrate for homoacetogen enrichment. Along with the formyltetrahydrofolate synthetase (FTHFS) gene (fhs gene)-specific real time qPCR assay and Terminal Restriction Fragment Length Polymorphism (T-RFLP) analysis, 16S rRNA based 454 high-throughput pyrosequencing was applied to reveal the population dynamic and community structure during enrichment from different origins. Enrichment of homoacetogenic populations coincided with accumulations of short chain fatty acids such as acetate and butyrate. 454 high-throughput pyrosequencing revealed Firmicutes and Spirochaetes populations became dominant while the overall microbial diversity decreased after enrichment. The most abundant sequences among the four origins belonged to the following phyla: Firmicutes, Spirochaetes, Proteobacteria, and Bacteroidetes, accounting for 62.1%-99.1% of the total reads. The major putative homoacetogenic species enriched on H2/CO2 or formate belonged to Clostridium spp., Acetobacterium spp., Acetoanaerobium spp

  6. Molecular cloning, gene structure and expression profile of two mouse peroxisomal 3-ketoacyl-CoA thiolase genes

    Directory of Open Access Journals (Sweden)

    Latruffe Norbert

    2004-03-01

    Full Text Available Abstract Background In rats, two peroxisomal 3-ketoacyl-CoA thiolase genes (A and B have been cloned, whereas only one thiolase gene is found in humans. The aim of this study was thus to clone the different mouse thiolase genes in order to study both their tissue expression and their associated enzymatic activity. Results In this study, we cloned and characterized two mouse peroxisomal 3-ketoacyl-CoA thiolase genes (termed thiolase A and B. Both thiolase A and B genes contain 12 exons and 11 introns. Using RNA extracted from mouse liver, we cloned the two corresponding cDNAs. Thiolase A and B cDNAs possess an open reading frame of 1272 nucleotides encoding a protein of 424 amino acids. In the coding sequence, the two thiolase genes exhibited ≈97% nucleotide sequence identity and ≈96% identity at the amino acid level. The tissue-specific expression of the two peroxisomal 3-ketoacyl-CoA thiolase genes was studied in mice. Thiolase A mRNA was mainly expressed in liver and intestine, while thiolase B mRNA essentially exhibited hepatic expression and weaker levels in kidney, intestine and white adipose tissue. Thiolase A and B expressions in the other tissues such as brain or muscle were very low though these tissues were chiefly involved in peroxisomal disorders. At the enzymatic level, thiolase activity was detected in liver, kidney, intestine and white adipose tissue but no significant difference was observed between these four tissues. Moreover, thiolase A and B genes were differently induced in liver of mice treated with fenofibrate. Conclusion Two mouse thiolase genes and cDNAs were cloned. Their corresponding transcripts are mostly expressed in the liver of mice and are differently induced by fenofibrate.

  7. Clinical profile, predisposing factors, and associated co-morbidities of children with cerebral palsy in South India

    Directory of Open Access Journals (Sweden)

    Vykuntaraju K Gowda

    2015-01-01

    Full Text Available Introduction: Cerebral palsy (CP is the most common physical disorder of children. Causes like jaundice and birth injury though are decreasing; complications resulting from the survival of low birth weight babies are replacing some of the older etiologies. Hence, this study was planned. Objectives: The objective was to study the clinical patterns, predisposing factors, and co-morbidities in children with CP. Materials and Methods: The present study is a hospital based prospective study conducted from January 2012 to January 2013 in children presenting to neurodevelopmental clinic at a tertiary care teaching hospital in India. Hundred cases with clinical features suggestive of CP were included in the study. Cases were evaluated by history, clinical examination, and necessary investigations. Results: Results of the study showed 81% of spastic, 12% of hypotonic, 5% of dystonic, and 2% of mixed CP cases. The mean age of presentation was 2 year, 2 month, and male to female ratio of 1:2. Pregnancy-induced hypertension (PIH was the most common antenatal complication observed in 6%. Four percent had neonatal sepsis and 19% were born premature. Associated co-morbidities were mental retardation (55%, seizure disorder (46%, visual problems (26%, hearing problems (19%, and failure to thrive (47%. Discussion: Sex distribution observed in our study was male to female ratio of 1.2, which was comparable with a multicenter study in Europe. PIH was observed in 6% of cases, which was comparable with prior studies. Birth asphyxia was observed in 43% of cases. Eighty-one percent of the cases constituted a spastic variety of CP which was comparable to other studies. Conclusion: Perinatal asphyxia was the important etiological factor. We found preventable intranatal causes (60% and antenatal causes (20% forming a significant proportion. Co-morbidities were significantly observed in our study.

  8. One year since enforcement of the energy saving/recycle support act. Energy saving facilities seen in Iwakuni Works, Nippon Paper Co. , Ltd. , No. 1 facilities applied by this act. Shoene-risaikuru shienho shiko kara 1 nen. Tekiyo dai 1 go Nihon Seishi Iwakuni kojo ni miru shoene shisetsu

    Energy Technology Data Exchange (ETDEWEB)

    Owada, T.; Ito, H.

    1994-06-01

    The Iwakuni Work, the Nippon Paper Co., Ltd. had 4 systems of the kraft pulp manufacturing facilities conventionally, however 3 systems out of them were in considerable obsolescence and therefore they were aggregated and integrated, and then a large scale new facility incorporated the highest technology which could be considered at present was installed. This facility is currently the maximum pulp plant domestically, and moreover an yield elevation, labor saving, environmental countermeasure and so forth are sufficiently taken into account. In planning it furthermore, a remarkable curtailment of power and steam consumption is intended, and consequently each kind of facilities with a high energy efficiency is selected and adopted. Its energy saving efficiency is recognized and as a result this plant is authorized by the Energy Saving/Recycle Support Act as a No.1 plant for an application. When a curtailment estimate of the steam and power energy by introducing these facilities is calculated as a trial, based on a conversion of steam to crude oil 75.4 l/T and a conversion of power to crude oil 0.24 l/kWh, an annual curtailment quantity reduced to crude oil in total of 4 systems is 19,547 kl, curtailment ratio 39.6% (equivalent to 8.0% in total work), and therefore this quantity of energy can be estimated to be reduced. 5 figs., 2 tabs.

  9. Central hypoventilation as the presenting symptom in Hu associated paraneoplastic encephalomyelitis.

    Science.gov (United States)

    Gómez-Choco, Manuel J; Zarranz, Juan J; Saiz, Albert; Forcadas, María I; Graus, Francesc

    2007-10-01

    Central hypoventilation is usually caused by ischaemic or neoplastic lesions of the medulla and upper cervical spinal cord. An autoimmune disorder is not usually considered in the differential diagnosis of this syndrome. We retrospectively identified 14 patients from our database of 202 patients with Hu antibodies who presented with brainstem symptoms. Three were admitted to hospital because of central hypoventilation. All underwent intubation and mechanical ventilation. They could breathe properly while they were awake but suffered deep apnoeas during sleep. Two died, but one is still alive requiring ventilatory assistance during sleep. Autopsy was performed in one of the patients which showed severe inflammatory infiltrates and neuronal loss in the medulla. All patients had normal brain imaging studies and the cause of central hypoventilation was an unsolved problem until Hu antibodies were determined.

  10. 2-μm Coherent DIAL for CO2, H2O and Wind Field Profiling in the Lower Atmosphere: Instrumentation and Results

    Directory of Open Access Journals (Sweden)

    Gibert Fabien

    2016-01-01

    Full Text Available We report on 2-μm coherent differential absorption lidar (CDIAL measurements of carbon dioxide (CO2, water vapour (H2O absorption and wind field profiling in the atmospheric boundary layer. The CDIAL uses a Tm:fiber pumped, single longitudinal mode Q-switched seeded Ho:YLF laser and a fibercoupled coherent detection. The laser operates at a pulse repetition frequency of 2 kHz and emits an output energy of 10 mJ with a pulse width of 40 ns (FWHM. Experimental horizontal and vertical range-resolved measurements were made in the atmospheric boundary layer and compared to colocated in-situ sensor data.

  11. Identification of a Calcium Signalling Pathway of S-[6]-Gingerol in HuH-7 Cells

    Directory of Open Access Journals (Sweden)

    Xiao-Hong Li

    2013-01-01

    Full Text Available Calcium signals in hepatocytes control cell growth, proliferation, and death. Members of the transient receptor potential (TRP cation channel superfamily are candidate calcium influx channels. NFκB activation strictly depends on calcium influx and often induces antiapoptotic genes favouring cell survival. Previously, we reported that S-[6]-gingerol is an efficacious agonist of the transient receptor potential cation channel subfamily V member 1 (TRPV1 in neurones. In this study, we tested the effect of S-[6]-gingerol on HuH-7 cells using the Fluo-4 calcium assay, RT-qPCR, transient cell transfection, and luciferase measurements. We found that S-[6]-gingerol induced a transient rise in [Ca2+]i in HuH-7 cells. The increase in [Ca2+]i induced by S-[6]-gingerol was abolished by preincubation with EGTA and was also inhibited by the TRPV1 channel antagonist capsazepine. Expression of TRPV1 in HuH-7 cells was confirmed by mRNA analysis as well as a test for increase of [Ca2+]i by TRPV1 agonist capsaicin and its inhibition by capsazepine. We found that S-[6]-gingerol induced rapid NFκB activation through TRPV1 in HuH-7 cells. Furthermore, S-[6]-gingerol-induced NFκB activation was dependent on the calcium gradient and TRPV1. The rapid NFκB activation by S-[6]-gingerol was associated with an increase in mRNA levels of NFκB-target genes: cIAP-2, XIAP, and Bcl-2 that encode antiapoptotic proteins.

  12. Effects of animal class and genotype on beef muscle nanostructure, pHu, colour and tenderness

    Directory of Open Access Journals (Sweden)

    Amanda Y. Chulayo

    2016-07-01

    Full Text Available The objective of the study was to determine the effects of animal class and genotype of cattle on Muscularis longissimus thoracis et lumborum (LTL nanostructure, ultimate pH (pHu, colour and tenderness of beef. We found significant positive relationships between distance travelled (DT and meat temperature (Tm (p"less than"0.01; lairage duration (LDhr and lightness of colour (L* (p"less than"0.01; ambient temperature (Ta and L* (p"less than"0.05 and LDhr and yellowness (b* (p"less than"0.05 of beef from Bonsmara cattle. Positive linear relationships were observed between DT and Tm (p"less than"0.05 and DT and L* (p"less than"0.01 of the non-descript cattle. There were no significant relationships between pre-slaughter stress and other beef quality parameters (pHu, Warner– Bratzler shear force [WBSF], redness [a*] and b* of Bonsmara, Nguni and non-descript cattle. Muscle fibres differed among class and genotype and had an effect on meat quality. The Bonsmara, non-descript and Nguni cows and heifers had visible skeletal muscle fibres which were thin and long, promising improved tenderness of beef. Genotype and class had significant effects on meat quality parameters (Tm, pHu, L*, a*, b* and WBSF. The first important principal components as they appeared from the analysis were pHu, Tm, L*, a*, b* and WBSF. Therefore, animal class did not affect the nanostructure of beef; instead, meat tenderness was enhanced by the longer and visible muscle fibres. Nguni cattle produced meat of superior quality to that of the Bonsmara and the non-descript cattle.

  13. The outcome of PIE *#Hi- and *#Hu- in Germanic

    DEFF Research Database (Denmark)

    Hansen, Bjarne Simmelkjær Sandgaard

    2015-01-01

    It has been established with a great amount of certainty that PIE *#Hu- > Gr. #Vὐ- and that PIE *#Hi- > Gr. #ἰ-. It still remains to be demonstrated what happens in other Western Indo-European branches, including Germanic. In this article , I reject the statement by Ringe (1988: 433) that PIE *#H...... tentatively propose that PG *#au- > PG *#u- when followed by a labial consonant; a development partially paralleled in Greek and in English....

  14. Sustainable groundwater development and management in the Quaternary Hang-Jia-Hu Plain, China

    Institute of Scientific and Technical Information of China (English)

    朱琰

    2002-01-01

    Based on the results of study on regional water supply system, water quality assessments, Quaternary aquifers investigation, and correlation analysis of groundwater depression resulting from land subsidence in the Hang-Jia-Hu Quaternary Plain, this paper presents the groundwater resources policy and sustainable management methods suitable for this area. Suggestions for controlling land subsidence by implementation of wise groundwater policy and management measures are also given.

  15. The outcome of PIE *#Hi- and *#Hu- in Germanic

    DEFF Research Database (Denmark)

    Hansen, Bjarne Simmelkjær Sandgaard

    2015-01-01

    It has been established with a great amount of certainty that PIE *#Hu- > Gr. #Vὐ- and that PIE *#Hi- > Gr. #ἰ-. It still remains to be demonstrated what happens in other Western Indo-European branches, including Germanic. In this article , I reject the statement by Ringe (1988: 433) that PIE *#H...... tentatively propose that PG *#au- > PG *#u- when followed by a labial consonant; a development partially paralleled in Greek and in English....

  16. Screening candidate microRNAs (miRNAs) in different lambskin hair follicles in Hu sheep.

    Science.gov (United States)

    Gao, Wen; Sun, Wei; Yin, Jinfeng; Lv, Xiaoyang; Bao, Jianjun; Yu, Jiarui; Wang, Lihong; Jin, Chengyan; Hu, Liang

    2017-01-01

    Hu sheep lambskin is a unique white lambskin from China that exhibits three types of flower patterns, including small waves, medium waves, and large waves, with small waves considered the best quality. However, our understanding of the molecular mechanism underlying flower pattern formation in Hu sheep lambskin is limited. The aim of the present study was to further explore the relevance between candidate microRNAs (miRNAs) and developmental characteristics of hair follicles and screen miRNAs for later functional validation. Herein, we employed Illumina Hiseq 2500 to identify differentially expressed miRNAs in hair follicles of different flower patterns with small, medium, and large waves to construct a comprehensive sequence database on the mechanism of hair follicle development. Paraffin sections of lambskin tissue were prepared to assess the structure of different hair follicles. Expression levels of candidate miRNAs in different flower patterns were analyzed by relative quantitation using real-time PCR, combined with histological observation and micro-observation technologies, and the correlation between expression levels of candidate miRNAs and histological properties of hair follicles was analyzed by using SPSS 17.0. A total of 522 differentially expressed miRNAs were identified, and RNA-seq analysis detected 7,266 target genes in different groups of flower patterns. Gene ontological analysis indicated these target genes were mainly involved in cell proliferation, differentiation, growth, apoptosis, and ion transport, and 14 miRNAs, including miR-143, miR-10a, and let-7 were screened as candidate miRNAs in Hu sheep hair follicle growth and development. In the same field of vision, variance analysis showed that the number of secondary follicles in small waves was significantly larger than that in large and medium waves (Phair follicles, highly significant differences in miRNA-143 expression levels between large and small waves were observed (Phair follicle

  17. Facile hydrothermal synthesis and characterization of Co2GeO4/r-GO@C ternary nanocomposite as negative electrode for Li-ion batteries.

    Science.gov (United States)

    Subramanian, Yuvaraj; Kaliyappan, Karthikeyan; Ramakrishnan, Kalai Selvan

    2017-07-15

    Ternary nanocomposite of Co2GeO4/r-GO@C is synthesized by single step hydrothermal method followed by calcination. The XRD analysis reveals the formation of cubic structured Co2GeO4 and their corresponding functional groups identified through Raman analysis. The TEM analysis assures that uniform distribution of Co2GeO4 nanoparticles on the r-GO layers. The Galvanostatic charge-discharge (GCD) curve demonstrates that the initial discharge capacity of pristine Co2GeO4, Co2GeO4/r-GO and Co2GeO4/r-GO@C composite is 1400, 1284 and 1594mAhg(-1) at 50mAg(-1), respectively. The cycling stability curve shows the specific capacity of 609, 970 and 1180mAhg(-1) for pristine, Co2GeO4/r-GO and Co2GeO4/r-GO@C composite, respectively over 15 cycles. The ternary composite of Co2GeO4/r-GO@C delivers the discharge capacity of 323mAhg(-1) at high current density of 1Ag(-1) over 500 cycles with capacity retention of 71%. The rate capability curve indicates that Co2GeO4/r-GO@C composite shows the better rate capability. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. Downregulation of β-Adrenoceptors in Isoproterenol-Induced Cardiac Remodeling through HuR.

    Directory of Open Access Journals (Sweden)

    Qian Yin

    Full Text Available β-adrenergic receptors (β-ARs play an important role in cardiac remodeling, which is the key pathological process in various heart diseases and leads to heart failure. However, the regulation of β-AR expression in remodeling hearts is still unclear. This study aims to clarify the possible mechanisms underlying the regulation of β1- and β2-AR expression in cardiac remodeling. The rat model of cardiac remodeling was established by subcutaneous injection of isoproterenol(ISO at the dose of 0.25 mg·kg(-1·d(-1 for 7 days. We found that the expression of β1- and β2-ARs decreased in the remodeling heart. The mechanisms may include the inhibition of DNA transcription and the increase of mRNA degradation. cAMP-response element binding protein(CREB is a well-known transcription factor of β-AR. However, the expression and activation of CREB was not changed in the remodeling heart. Further, human Antigen-R (HuR, a RNA binding protein, which binds to the 3'-untranslated region of the β-AR mRNA and promotes RNA degradation, was increased in the remodeling model. And in vitro, HuR deficiency reversed the reduction of β-AR mRNA induced by ISO. Therefore, the present findings indicate that HuR, but not CREB, is responsible for the reduction of β-AR expression in ISO induced cardiac remodeling.

  19. Intraperirhinal cortex administration of the synthetic cannabinoid, HU210, disrupts object recognition memory in rats.

    Science.gov (United States)

    Sticht, Martin A; Jacklin, Derek L; Mechoulam, Raphael; Parker, Linda A; Winters, Boyer D

    2015-03-25

    Cannabinoids disrupt learning and memory in human and nonhuman participants. Object recognition memory, which is particularly susceptible to the impairing effects of cannabinoids, relies critically on the perirhinal cortex (PRh); however, to date, the effects of cannabinoids within PRh have not been assessed. In the present study, we evaluated the effects of localized administration of the synthetic cannabinoid, HU210 (0.01, 1.0 μg/hemisphere), into PRh on spontaneous object recognition in Long-Evans rats. Animals received intra-PRh infusions of HU210 before the sample phase, and object recognition memory was assessed at various delays in a subsequent retention test. We found that presample intra-PRh HU210 dose dependently (1.0 μg but not 0.01 μg) interfered with spontaneous object recognition performance, exerting an apparently more pronounced effect when memory demands were increased. These novel findings show that cannabinoid agonists in PRh disrupt object recognition memory.

  20. 论胡锦涛的人才观%On HuJintao' s View of Talent

    Institute of Scientific and Technical Information of China (English)

    于伟峰; 黄静

    2012-01-01

    胡锦涛的人才观主要体现在:树立人才资源为第一资源、人人皆可成才和以人为本的观念。胡锦涛的人才观的核心内容与前三代领导集体人才观的核心内容既一眯相承又有其独特的创新点,他首次提出了党管人才的原则和将人才观与以人为本的发展观相结合的原则。%Hu Jintao' s view of talents is embodied in 1 ) his view that human resources are paramount to all other resources; 2) his belief that everyone can develop into a man of caliber; and 3) his people-oriented approach to development. The kernel of Hu Jintao' s view of talent is imbued with the same spirit reflected in the general out- look on talent of previous three generations of central collective leadership of the CPC, while boasting unique inno- vations. Hu first puts forward the principle of managing talents by the party and the principle of combining the sci- entific view of talent with the people-oriented approach to development.

  1. CTXφ Replication Depends on the Histone-Like HU Protein and the UvrD Helicase.

    Directory of Open Access Journals (Sweden)

    Eriel Martínez

    2015-05-01

    Full Text Available The Vibrio cholerae bacterium is the agent of cholera. The capacity to produce the cholera toxin, which is responsible for the deadly diarrhea associated with cholera epidemics, is encoded in the genome of a filamentous phage, CTXφ. Rolling-circle replication (RCR is central to the life cycle of CTXφ because amplification of the phage genome permits its efficient integration into the genome and its packaging into new viral particles. A single phage-encoded HUH endonuclease initiates RCR of the proto-typical filamentous phages of enterobacteriaceae by introducing a nick at a specific position of the double stranded DNA form of the phage genome. The rest of the process is driven by host factors that are either essential or crucial for the replication of the host genome, such as the Rep SF1 helicase. In contrast, we show here that the histone-like HU protein of V. cholerae is necessary for the introduction of a nick by the HUH endonuclease of CTXφ. We further show that CTXφ RCR depends on a SF1 helicase normally implicated in DNA repair, UvrD, rather than Rep. In addition to CTXφ, we show that VGJφ, a representative member of a second family of vibrio integrative filamentous phages, requires UvrD and HU for RCR while TLCφ, a satellite phage, depends on Rep and is independent from HU.

  2. Clinical study on intravitreal injection of cannabinoid HU-211 for optic nerve damage in glaucoma rats

    Directory of Open Access Journals (Sweden)

    Hui-Feng Liu

    2014-09-01

    Full Text Available AIM: To evaluate the protective effects of intravitreal injection of cannabinoid HU-211 for optic nerve in glaucoma rats, providing the experimental evidence in the treatment of glaucoma optic nerve injury.METHODS: Glaucoma rats(18 eyeswere modeled by electric coagulation sclera surface vein and randomized into 3 groups, group A received intravitreal injection of 1mg/0.1mL cannabinoid HU-211 every other day respectively; group B was given intravitreal injection of 0.1mL water every other day, group C was high intraocular pressure(IOPgroup, 6 eyes were randomly selected for blank control group(group D. IOP was observed every day. The rats were sacrificed after treatment 4wk, froze retina section, HE stain. The density fluctuation of retinal ganglion cell(RGCneurons assessment the optic nerve of rat model with chronic high IOP glaucoma were measured.RESULTS: The apoptosis and damage degree of RGC in group B was obviously higher than that in group A, with statistically significant difference(PP >0.05.CONCLUSION: Intravitreal injection of cannabinoid HU-211 shows obvious protective effect on optic nerve in glaucom rat models.

  3. The cytoskeletal inhibitors latrunculin A and blebbistatin exert antitumorigenic properties in human hepatocellular carcinoma cells by interfering with intracellular HuR trafficking

    Energy Technology Data Exchange (ETDEWEB)

    Doller, Anke; Badawi, Amel [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Schmid, Tobias; Brauß, Thilo [Institut für Biochemie I (Pathobiochemie), Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Pleli, Thomas [Medizinische Klinik 1, Schwerpunkt Gastroenterologie und Hepatologie, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Meyer zu Heringdorf, Dagmar [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Piiper, Albrecht [Medizinische Klinik 1, Schwerpunkt Gastroenterologie und Hepatologie, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Pfeilschifter, Josef [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Eberhardt, Wolfgang, E-mail: w.eberhardt@em.uni-frankfurt.de [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany)

    2015-01-01

    The impact of the RNA-binding protein HuR for the post-transcriptional deregulation of tumor-relevant genes is well established. Despite of elevations in HuR expression levels, an increase in cytoplasmic HuR abundance in many cases correlates with a high grade of malignancy. Here, we demonstrated that administration of the actin-depolymerizing macrolide latrunculin A, or blebbistatin, an inhibitor of myosin II ATPase activity, caused a dose- and time-dependent reduction in the high cytoplasmic HuR content of HepG2 and Huh7 hepatocellular carcinoma (HCC) cells. Subcellular fractionation revealed that in addition, both inhibitors strongly attenuated cytoskeletal and membrane-bound HuR abundance and conversely increased the HuR amount in nuclear cell fractions. Concomitant with changes in intracellular HuR localization, both cytoskeletal inhibitors markedly decreased the half-lives of cyclooxygenase-2 (COX-2), cyclin A and cyclin D{sub 1} encoding mRNAs resulting in a significant reduction in their expression levels in HepG2 cells. Importantly, a similar reduction in the expression of these HuR targets was achieved by a RNA interference (RNAi)-mediated knockdown of either HuR or nonmuscle myoin IIA. Using polysomal fractionation, we further demonstrate that the decrease in cytoplasmic HuR by latrunculin A or blebbistatin is accompanied by a marked change in the allocation of HuR and its mRNA cargo from polysomes to ribonucleoprotein (RNP) particles. Functionally, the basal migration and prostaglandin E{sub 2} synthesis are similarly impaired in inhibitor-treated and stable HuR-knockdown HepG2 cells. Our data demonstrate that interfering with the actomyosin-dependent HuR trafficking may comprise a valid therapeutic option for antagonizing pathologic posttranscriptional gene expression by HuR and furthermore emphasize the potential benefit of HuR inhibitory strategies for treatment of HCC. - Highlights: • We tested the effects of latrunculin A and blebbistatin on

  4. High-level Expression and Purification of Human Zona Pellucida huZP3a22-176 and huZP3b177-348 Peptides in Escherichia coli

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Objective To try making huZP3a22-176 and huZP3b177-348 polypeptides (representing an intact huZP322-348 protein without its N-terminal signal peptide and C-terminal transmembrane domain ) express in E. coli at a higher levelMethods The cDNAs encoding huZP3a and huZP3b were obtained with PCR method.The pB V221 plasmid was used to construct thermo-inducible recombinant expression vector. Purification of two target expression products employed an improved method of preparative gel polyacrylamide gel electrophoresis.Results Two polypeptides of recombinant huZP3a (rhuZP3a) and recombinant huZP3b(rhuZP3b) were all expressed respectively in an E. coli BL21(DE3)pLysS strain at a higher level, which were recognized by two specific polyclonal antisera in Western blotting test which recognize a linear B cell epitope present in rhuZP3a or rhuZP3b respectively. Using the shake-flask method, approximately 5 mg of rhuZP3a and rhuZP3b with more than 95% relative homogeneity were harvested from 1 L culture respectively.Conclusion The availability of two rhuZP3 polypeptides will help in detecting the immunogenicities of rhuZP3a and rhuZP3b through animal experiments and confirming the function domain of non-glycosylated huZP3 to induce acrosome reaction in vitro.

  5. Fabrication Facilities

    Data.gov (United States)

    Federal Laboratory Consortium — The Fabrication Facilities are a direct result of years of testing support. Through years of experience, the three fabrication facilities (Fort Hood, Fort Lewis, and...

  6. Exercise Training and Grape Seed Extract Co-Administration Improves Lipid Profile, Weight Loss, Bradycardia, and Hypotension of STZ-Induced Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Mohammad Badavi

    2013-12-01

    Full Text Available Background:: Exercise Training (ET and Grape Seed Extract (GSE as an antioxidant have many positive effects on controlling diabetes mellitus and its complications. Objectives:: This study aimed to determine the effects of GSE alone or combined with ET on body weight, plasma lipid profile, blood pressure, and heart rate in STZ-induced diabetic rats. Methods:: In this study, male Wistar rats were randomly assigned to five groups: sedentary control, sedentary diabetic, trained diabetic, GSE treated sedentary diabetic, and GSE treated trained diabetic. ET was conducted on the treadmill daily for 8 weeks. One way ANOVA followed by LSD test was used for statistical analysis. Results:: Reduction of body weight, high density lipoproteins, heart rate, and systolic blood pressure and increment of total cholesterol, triglyceride, low density lipoprotein, and very low density lipoproteins were observed after STZ injection. Co-administration of GSE and ET had more positive effects on lipid profile compared to each method alone. In addition, GSE and ET modified heart rate partially, while their combination was more effective in improvement of heart rat in conscious rats. On the other hand, administration of ET or GSE alone did not affect systolic blood pressure and body weight, while their combination restored systolic blood pressure completely and improved body weight partially. Conclusions:: The study findings indicated that ET combined with GSE had more beneficial effects compared to each one alone on the complications of STZ induced diabetes. This may constitute a convenient and inexpensive therapeutic approach to diabetic complications.

  7. GenCLiP: a software program for clustering gene lists by literature profiling and constructing gene co-occurrence networks related to custom keywords

    Directory of Open Access Journals (Sweden)

    Zhou Yi-Bo

    2008-07-01

    Full Text Available Abstract Background Biomedical researchers often want to explore pathogenesis and pathways regulated by abnormally expressed genes, such as those identified by microarray analyses. Literature mining is an important way to assist in this task. Many literature mining tools are now available. However, few of them allows the user to make manual adjustments to zero in on what he/she wants to know in particular. Results We present our software program, GenCLiP (Gene Cluster with Literature Profiles, which is based on the methods presented by Chaussabel and Sher (Genome Biol 2002, 3(10:RESEARCH0055 that search gene lists to identify functional clusters of genes based on up-to-date literature profiling. Four features were added to this previously described method: the ability to 1 manually curate keywords extracted from the literature, 2 search genes and gene co-occurrence networks related to custom keywords, 3 compare analyzed gene results with negative and positive controls generated by GenCLiP, and 4 calculate probabilities that the resulting genes and gene networks are randomly related. In this paper, we show with a set of differentially expressed genes between keloids and normal control, how implementation of functions in GenCLiP successfully identified keywords related to the pathogenesis of keloids and unknown gene pathways involved in the pathogenesis of keloids. Conclusion With regard to the identification of disease-susceptibility genes, GenCLiP allows one to quickly acquire a primary pathogenesis profile and identify pathways involving abnormally expressed genes not previously associated with the disease.

  8. Facility Microgrids

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Z.; Walling, R.; Miller, N.; Du, P.; Nelson, K.

    2005-05-01

    Microgrids are receiving a considerable interest from the power industry, partly because their business and technical structure shows promise as a means of taking full advantage of distributed generation. This report investigates three issues associated with facility microgrids: (1) Multiple-distributed generation facility microgrids' unintentional islanding protection, (2) Facility microgrids' response to bulk grid disturbances, and (3) Facility microgrids' intentional islanding.

  9. Potentiation of the bioavailability of blueberry phenolic compounds by co-ingested grape phenolic compounds in mice, revealed by targeted metabolomic profiling in plasma and feces.

    Science.gov (United States)

    Dudonné, Stéphanie; Dal-Pan, Alexandre; Dubé, Pascal; Varin, Thibault V; Calon, Frédéric; Desjardins, Yves

    2016-08-10

    The low bioavailability of dietary phenolic compounds, resulting from poor absorption and high rates of metabolism and excretion, is a concern as it can limit their potential beneficial effects on health. Targeted metabolomic profiling in plasma and feces of mice supplemented for 15 days with a blueberry extract, a grape extract or their combination revealed significantly increased plasma concentrations (3-5 fold) of blueberry phenolic metabolites in the presence of a co-ingested grape extract, associated with an equivalent decrease in their appearance in feces. Additionally, the repeated daily administration of the blueberry-grape combination significantly increased plasma phenolic concentrations (2-3-fold) compared to animals receiving only a single acute dose, with no such increase being observed with individual extracts. These findings highlight a positive interaction between blueberry and grape constituents, in which the grape extract enhanced the absorption of blueberry phenolic compounds. This study provides for the first time in vivo evidence of such an interaction occurring between co-ingested phenolic compounds from fruit extracts leading to their improved bioavailability.

  10. CYTOKINE PROFILE FEATURES IN THE PATIENTS WITH NONALLERGIC BRONCHIAL ASTHMA WITH CO-EXISTING TYPE 2 DIABETES MELLITUS

    Directory of Open Access Journals (Sweden)

    L. N. Sorokina

    2017-01-01

    Full Text Available Thirty-five patients with non-allergic bronchial asthma (NABA, 22 patients with NABA and diabetes mellitus type 2 (DT2, 23 subjects with DT2, and 31 healthy controls were enrolled into the study. ELISA assays for IL-4, IL-10, IL-6, IFNγ were performed by means of a standardized protocol using immunoassay kits purchased from VectorBest, and Cytokine. In asthma patients complicated by DT2, the pattern of bronchial asthma was ascribed to NABA. This finding may be consistent with a theory of specific insulin-receptor interactions in asthma. The NABA patients with type 2 diabetes mellitus exhibited a significant increase in IL-6, IFNγ, and decrease of IL-4, as compared with healthy controls and NABA. Moreover, we have revealed an increase of IL-4, IL-6, IFNγ, when compared with DT2. Hence, the patients with coexistence of non-allergic bronchial asthma and DT2 were characterized by a specific cytokine profile of pro- and anti-inflammatory cytokines, which may correlate with increased glycation and deterioration of lung function. 

  11. Improvement of a block co-polymer (PS-b-PMMA)-masked silicon etch profile using a neutral beam

    Science.gov (United States)

    Yun, Deokhyun; Park, Jinwoo; Kim, Hwasung; Mun, Jeongho; Kim, Sangouk; Kim, Kyongnam; Yeom, Geunyoung

    2016-09-01

    Bottom-up block copolymer (BCP) lithography mediated by self-assembly of polystyrene (PS)/poly-methyl methacrylate (PMMA) is widely used as an alternative patterning method for various deep nanoscale devices, such as optical devices and transistors, replacing conventional top-down photolithography. However, the nanoscale BCP mask features formed on the substrates after direct self-assembly of BCP tend to be easily damaged during exposure to the following plasma processing. In this study, silicon masked with a nanoscale BCP mask (PS) was etched by irradiating with a Cl2/Ar neutral beam in addition to a Cl2/Ar ion beam, and the effect of a Cl2/Ar neutral beam instead of a Cl2/Ar ion beam on damage to the PS mask and the silicon etch characteristics of nanodevices was investigated. The results show that the use of a neutral beam instead of an ion beam decreased degradation of the BCP mask during etching; therefore, a more anisotropic silicon etch profile in addition to improved etch selectivity of silicon compared to the BCP mask was observed. Moreover, by using the neutral beam, the sidewall roughness and sidewall angle also improved due to the decreased surface charge and reduced damage to the nanoscale PS mask resulting from use of a highly directional radical beam instead of a conventional ion-based beam.

  12. Isolation, purification, crystallization, and preliminary X-ray diffraction study of the crystals of HU protein from M. gallisepticum

    Science.gov (United States)

    Nikolaeva, A. Yu.; Timofeev, V. I.; Boiko, K. M.; Korzhenevskii, D. A.; Rakitina, T. V.; Dorovatovskii, P. V.; Lipkin, A. V.

    2015-11-01

    HU proteins are involved in bacterial DNA and RNA repair. Since these proteins are absent in cells of higher organisms, inhibitors of HU proteins can be used as effective and safe antibiotics. The crystallization conditions for the M. gallisepticum HU protein were found and optimized by the vapor-diffusion method. The X-ray diffraction data set was collected to 2.91 Å resolution from the crystals grown by the vapor-diffusion method on a synchrotron source. The crystals of the HU protein belong to sp. gr. P41212 and have the following unit-cell parameters: a = b = 97.94 Å, c = 77.92 Å, α = β = γ = 90°.

  13. Facile synthesis and electrochemical performance of Co{sub 2}SnO{sub 4}/Co{sub 3}O{sub 4} nanocomposite for lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    An, Bonan [School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Engineering Research Center of Materials and Technology for Electrochemical Energy Storage (Ministry of Education), Guangzhou 510006 (China); Ru, Qiang, E-mail: ruqiang@scnu.edu.cn [School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Engineering Research Center of Materials and Technology for Electrochemical Energy Storage (Ministry of Education), Guangzhou 510006 (China); Laboratory of Quantum Engineering and Quantum Materials, School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Hu, Shejun; Song, Xiong; Li, Juan [School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Engineering Research Center of Materials and Technology for Electrochemical Energy Storage (Ministry of Education), Guangzhou 510006 (China)

    2014-12-15

    Graphical abstract: TEM of Co{sub 2}SnO{sub 4}/Co{sub 3}O{sub 4} composite and the discharge curves of pure Co{sub 3}O{sub 4}, pure Co{sub 2}SnO{sub 4} and Co{sub 2}SnO{sub 4}/Co{sub 3}O{sub 4} composite. - Highlights: • Novel Co{sub 2}SnO{sub 4}/Co{sub 3}O{sub 4} composite has been prepared by simple co-precipitation method. • Small spherical nanocrystals adhering to the surface of large polyhedral particles. • Formation mechanism is relate to solubility of Sn(OH){sub 6}{sup 2−} in high concentration OH{sup −} . • The composite shows better electrochemical performance than Co{sub 2}SnO{sub 4} and Co{sub 3}O{sub 4} - Abstract: A novel dispersed structure Co{sub 2}SnO{sub 4}/Co{sub 3}O{sub 4} composite has been successfully synthesized by a conventional co-precipitation method with certain amount of NaOH concentration. The obtained composite exhibits dispersed structure with small spherical nanocrystals adhering to the surface of large polyhedral particles, which has been studied as an anode material in lithium-ion battery. Galvanostatic charge–discharge and cyclic voltammetry has been conducted to measure the electrochemical properties of the material. The results show that Co{sub 2}SnO{sub 4}/Co{sub 3}O{sub 4} composite demonstrates good reversible capacity of 702.5 mA h g{sup −1} after 50 cycles at a current density of 100 mA h g{sup −1}, much better than that of pure Co{sub 3}O{sub 4} (375.1 mA h g{sup −1}) and pure Co{sub 2}SnO{sub 4} (194.1 mA h g{sup −1}). This material also presents improved rate performance with capacity retention of 71.1% when the current ranges from 100 mA g{sup −1} to 1000 mA g{sup −1}. The excellent electrochemical performance of the as-prepared dispersed structure Co{sub 2}SnO{sub 4}/Co{sub 3}O{sub 4} composite could be attributed to the good dispersibility of nanoparticles which can effectively alleviate the volume expansion and improve the conductivity, thus enhance the cycling stability.

  14. Global gene expression profiles of canine macrophages and canine mammary cancer cells grown as a co-culture in vitro

    Directory of Open Access Journals (Sweden)

    Król Magdalena

    2012-02-01

    Full Text Available Abstract Background Solid tumours comprise various cells, including cancer cells, resident stromal cells, migratory haemopoietic cells and other. These cells regulate tumour growth and metastasis. Macrophages constitute probably the most important element of all interactions within the tumour microenvironment. However, the molecular mechanism, that guides tumour environment, still remains unknown. Exploring the underlying molecular mechanisms that orchestrate these phenomena has been the aim of our study. A co-culture of canine mammary cancer cells and macrophages was established and maintained for 72 hrs. Having sorted the cells, gene expression in cancer cells and macrophages, using DNA microarrays, was examined. The results were confirmed using real-time qPCR and confocal microscopy. Moreover, their ability for migration and invasion has been assessed. Results Microarray analysis showed that the up-regulated genes in the cancer cell lines are involved in 15 highly over-manifested pathways. The pathways that drew our diligent attention included: the inflammation pathway mediated by chemokine and cytokine, the Toll receptor signalling pathway and the B cell activation. The up-regulated genes in the macrophages were involved in only 18 significantly over-manifested pathways: the angiogenesis, the p53 pathway feedback loops2 and the Wnt signalling pathway. The microarray analysis revealed that co-culturing of cancer cells with macrophages initiated the myeloid-specific antigen expression in cancer cells, as well as cytokine/chemokine genes expression. This finding was confirmed at mRNA and protein level. Moreover, we showed that macrophages increase cancer migration and invasion. Conclusions The presence of macrophages in the cancer environment induces acquisition of the macrophage phenotype (specific antigens and chemokines/cytokines expression in cancer cells. We presumed that cancer cells also acquire other myeloid features, such as

  15. Facile one-pot synthesis of CoS{sub 2}-MoS{sub 2}/CNTs as efficient electrocatalyst for hydrogen evolution reaction

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yan-Ru; Hu, Wen-Hui; Li, Xiao [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Dong, Bin, E-mail: dongbin@upc.edu.cn [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Shang, Xiao [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Han, Guan-Qun [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Chai, Yong-Ming [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Liu, Yun-Qi, E-mail: liuyq@upc.edu.cn [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Liu, Chen-Guang [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China)

    2016-10-30

    Highlights: • Ternary hybrid CoS{sub 2}-MoS{sub 2}/CNTs electrocatalysts have been prepared. • CNTs as support may provide good conductivity and low the agglomeration of MoS{sub 2}. • CoS{sub 2} with intrinsic metallic conductivity may enhance the activity for HER. • Ternary CoS{sub 2}-MoS{sub 2}/CNTs have the better activity and stability for HER. - Abstract: Ternary hybrid cobalt disulfide-molybdenum disulfides supported on carbon nanotubes (CoS{sub 2}-MoS{sub 2}/CNTs) electrocatalysts have been prepared via a simple hydrothermal method. CNTs as support may provide good conductivity and low the agglomeration of layered MoS{sub 2} structure. CoS{sub 2} with intrinsic metallic conductivity may enhance the activity of the ternary hybrid electrocatalysts for hydrogen evolution reaction (HER). X-ray diffraction (XRD) data confirm the formation of ternary hybrid nanocomposites composed of CNTs, CoS{sub 2} and amorphous MoS{sub 2}. Scanning electron microscopy (SEM) images show that strong combination between MoS{sub 2}, CNTs and regular orthohexagonal CoS{sub 2} has been obtained. The dispersion of each component is good and no obvious agglomeration can be observed. It is found that compared with CoS{sub 2}/CNTs and MoS{sub 2}/CNTs, the ternary CoS{sub 2}-MoS{sub 2}/CNTs have the better activity for HER with a low onset potential of 70 mV (vs. RHE) and a small Talel slope of 67 mV dec{sup −1}, and are extremely stable after 1000 cycles. In addition, the optimal doping ratio of Co to Mo is 2:1, which have better HER activity. It is proved that the introduction of carbon materials and Co atoms could improve the performances of MoS{sub 2}-based electrocatalysts for HER.

  16. HuR interacts with human immunodeficiency virus type 1 reverse transcriptase, and modulates reverse transcription in infected cells

    Directory of Open Access Journals (Sweden)

    Ennifar Eric

    2008-06-01

    Full Text Available Abstract Reverse transcription of the genetic material of human immunodeficiency virus type 1 (HIV-1 is a critical step in the replication cycle of this virus. This process, catalyzed by reverse transcriptase (RT, is well characterized at the biochemical level. However, in infected cells, reverse transcription occurs in a multiprotein complex – the reverse transcription complex (RTC – consisting of viral genomic RNA associated with viral proteins (including RT and, presumably, as yet uncharacterized cellular proteins. Very little is known about the cellular proteins interacting with the RTC, and with reverse transcriptase in particular. We report here that HIV-1 reverse transcription is affected by the levels of a nucleocytoplasmic shuttling protein – the RNA-binding protein HuR. A direct protein-protein interaction between RT and HuR was observed in a yeast two-hybrid screen and confirmed in vitro by homogenous time-resolved fluorescence (HTRF. We mapped the domain interacting with HuR to the RNAse H domain of RT, and the binding domain for RT to the C-terminus of HuR, partially overlapping the third RRM RNA-binding domain of HuR. HuR silencing with specific siRNAs greatly impaired early and late steps of reverse transcription, significantly inhibiting HIV-1 infection. Moreover, by mutagenesis and immunoprecipitation studies, we could not detect the binding of HuR to the viral RNA. These results suggest that HuR may be involved in and may modulate the reverse transcription reaction of HIV-1, by an as yet unknown mechanism involving a protein-protein interaction with HIV-1 RT.

  17. Facile synthesis of yellow-emitting CaAlSiN3:Ce3+ phosphors and the enhancement of red-component by co-doping Eu2+ ions

    Science.gov (United States)

    Chen, Jingjing; Zhao, Yang; Li, Guanghao; Mao, Zhiyong; Wang, Dajian; Bie, Lijian

    2017-04-01

    In this paper, facile synthesis of CaAlSiN3:Ce3+ yellow-emitting phosphors under atmospheric pressure at a moderate temperature and their photoluminescent properties are reported. The prepared CaAlSiN3:Ce3+ phosphors exhibit a broad yellow emission band positioned at 580 nm and covering a bandwidth of 150 nm. The thermal stability of CaAlSiN3:Ce3+ phosphors shows obvious superiority than the commercial YAG: Ce3+ phosphor, indicating its promising application prospect in power LEDs. In addition, the enhancement of red-light component for CaAlSiN3:Ce3+ phosphor is demonstrated by co-doping Eu2+ ions. This study offers a facile route to prepare CaAlSiN3:Ce3+ yellow-emitting phosphors, which may be used as a promising candidate for high performance white LEDs.

  18. Facile one-pot synthesis of CoS2-MoS2/CNTs as efficient electrocatalyst for hydrogen evolution reaction

    Science.gov (United States)

    Liu, Yan-Ru; Hu, Wen-Hui; Li, Xiao; Dong, Bin; Shang, Xiao; Han, Guan-Qun; Chai, Yong-Ming; Liu, Yun-Qi; Liu, Chen-Guang

    2016-10-01

    Ternary hybrid cobalt disulfide-molybdenum disulfides supported on carbon nanotubes (CoS2-MoS2/CNTs) electrocatalysts have been prepared via a simple hydrothermal method. CNTs as support may provide good conductivity and low the agglomeration of layered MoS2 structure. CoS2 with intrinsic metallic conductivity may enhance the activity of the ternary hybrid electrocatalysts for hydrogen evolution reaction (HER). X-ray diffraction (XRD) data confirm the formation of ternary hybrid nanocomposites composed of CNTs, CoS2 and amorphous MoS2. Scanning electron microscopy (SEM) images show that strong combination between MoS2, CNTs and regular orthohexagonal CoS2 has been obtained. The dispersion of each component is good and no obvious agglomeration can be observed. It is found that compared with CoS2/CNTs and MoS2/CNTs, the ternary CoS2-MoS2/CNTs have the better activity for HER with a low onset potential of 70 mV (vs. RHE) and a small Talel slope of 67 mV dec-1, and are extremely stable after 1000 cycles. In addition, the optimal doping ratio of Co to Mo is 2:1, which have better HER activity. It is proved that the introduction of carbon materials and Co atoms could improve the performances of MoS2-based electrocatalysts for HER.

  19. Domain-specific phosphomimetic mutation allows dissection of different protein kinase C (PKC) isotype-triggered activities of the RNA binding protein HuR.

    Science.gov (United States)

    Schulz, Sebastian; Doller, Anke; Pendini, Nicole R; Wilce, Jacqueline A; Pfeilschifter, Josef; Eberhardt, Wolfgang

    2013-12-01

    The ubiquitous mRNA binding protein human antigen R (HuR) participates in the post-transcriptional regulation of many AU-rich element (ARE)-bearing mRNAs. Previously, by using in vitro kinase assay, we have identified serines (Ser) 158, 221 and 318 as targets of protein kinase C (PKC)-triggered phosphorylation. In this study, we tested whether GFP- or GST-tagged HuR constructs bearing a phosphomimetic Ser (S)-to-Asp (D) substitution at the different PKC target sites, would affect different HuR functions including HuR nucleo-cytoplasmic redistribution and binding to different types of ARE-containing mRNAs. The phosphomimetic GFP-tagged HuR protein bearing a phosphomimetic substitution in the hinge region of HuR (HuR-S221D) showed an increased cytoplasmic abundance when compared to wild-type HuR. Conversely, data from in vitro kinase assay and electrophoretic mobility shift assay (EMSA), implicates that phosphorylation at Ser 221 is not relevant for mRNA binding of HuR. Quantification of in vitro binding affinities of GST-tagged wild-type HuR and corresponding HuR proteins bearing a phosphomimetic substitution in either RRM2 (HuR-S158D) or in RRM3 (HuR-S318D) by microscale thermophoresis (MST) indicates a specific binding of wild-type HuR to type I, II or type III-ARE-oligonucleotides in the high nanomolar range. Interestingly, phosphomimetic mutation at position 158 or 318 had a negative influence on HuR binding to type I- and type II-ARE-mRNAs whereas it significantly enhanced HuR affinity to a type III-ARE substrate. Our data suggest that differential phosphorylation of HuR by PKCs at different HuR domains coordinates subcellular HuR distribution and leads to a preferential binding to U-rich bearing target mRNA.

  20. A Review of the Pharmacological Effects of the Dried Root of Polygonum cuspidatum (Hu Zhang and Its Constituents

    Directory of Open Access Journals (Sweden)

    Huan Zhang

    2013-01-01

    Full Text Available Traditional Chinese medicine (TCM has been widely used in China for thousands of years to treat and prevent diseases. TCM has been proven safe and effective, and it is being considered as one of the important types of complementary and alternative medicine and receives increasing attention worldwide. The dried root of Polygonum cuspidatum Sieb. et Zucc. (also known as “Hu Zhang” in Chinese is one of the medicinal herbs listed in the Pharmacopoeia of the People's Republic of China. Hu Zhang is widely distributed in the world. It can be found in Asia and North America and is used as folk medicine in countries such as Japan and Korea. In China, Hu Zhang is usually used in combination with other TCM herbs. The therapeutic uses of those Hu Zhang-containing TCM prescriptions or formulations are for treating cough, hepatitis, jaundice, amenorrhea, leucorrhea, arthralgia, burns and snake bites. Recent pharmacological and clinical studies have indicated that Hu Zhang has antiviral, antimicrobial, anti-inflammatory, neuroprotective, and cardioprotective functions. This review gives a summary of the reported therapeutic effects of the active compounds and the different extracts of Hu Zhang.

  1. Effect of CO{sub 2} air mixtures on the pH of air-stripped water at Treatment Facility D

    Energy Technology Data Exchange (ETDEWEB)

    Krauter, P.W.; Harrar, J.E.; Orloff, S.P.

    1998-01-01

    A small-scale model of the air stripping tanks at TFD was constructed and tested to determine the effect of carbon dioxide additions, to the stripper air, on system water pH. The objective was to determine whether this technique could be used to control and minimize CaCO{sub 3} scale formation. It was found that a concentration of 0.7 vol. % CO{sub 2} is required to maintain the water at its original, influent pH value of 7.4, but lower concentrations may be effective in controlling scale. There is also a possibility of reducing CO{sub 2} consumption by recycling the CO{sub 2}-rich air. The use of CO{sub 2} injection at Site 300 water treatment is reviewed.

  2. A shallow subsurface controlled release facility in Bozeman, Montana, USA, for testing near surface CO2 detection techniques and transport models

    Energy Technology Data Exchange (ETDEWEB)

    Spangler, L.H.; Dobeck, L.M.; Nehrir, A.; Humphries, S.; Barr, J.; Keith, C.; Shaw, J.; Rouse, J.; Cunningham, A.; Benson, S.; Repasky, K.S.; Lewicki, J.; Wells, A.; Diehl, R.; Strazisar, B.; Fessenden, J.; Rahn, T.; Amonette, J.; Barr, J.; Pickles, W.; Jacobson, J.; Silver, E.; Male, E.; Rauch, H.; Gullickson, K.; Trautz, R.; Kharaka, Y.; Birkholzer, J.T.; Wielopolski, L.; Oldenburg, C.M.

    2009-10-20

    A controlled field pilot has been developed in Bozeman, Montana, USA, to study near surface CO2 transport and detection technologies. A slotted horizontal well divided into six zones was installed in the shallow subsurface. The scale and CO2 release rates were chosen to be relevant to developing monitoring strategies for geological carbon storage. The field site was characterized before injection, and CO2 transport and concentrations in saturated soil and the vadose zone were modeled. Controlled releases of CO2 from the horizontal well were performed in the summers of 2007 and 2008, and collaborators from six national labs, three universities, and the U.S. Geological Survey investigated movement of CO2 through the soil, water, plants, and air with a wide range of near surface detection techniques. An overview of these results will be presented.

  3. A shallow subsurface controlled release facility in Bozeman, Montana, USA, for testing near surface CO2 detection techniques and transport models

    Science.gov (United States)

    Spangler, L.H.; Dobeck, L.M.; Repasky, K.S.; Nehrir, A.R.; Humphries, S.D.; Keith, C.J.; Shaw, J.A.; Rouse, J.H.; Cunningham, A.B.; Benson, S.M.; Oldenburg, C.M.; Lewicki, J.L.; Wells, A.W.; Diehl, J.R.; Strazisar, B.R.; Fessenden, J.E.; Rahn, T.A.; Amonette, J.E.; Barr, J.L.; Pickles, W.L.; Jacobson, J.D.; Silver, E.A.; Male, E.J.; Rauch, H.W.; Gullickson, K.S.; Trautz, R.; Kharaka, Y.; Birkholzer, J.; Wielopolski, L.

    2010-01-01

    A controlled field pilot has been developed in Bozeman, Montana, USA, to study near surface CO2 transport and detection technologies. A slotted horizontal well divided into six zones was installed in the shallow subsurface. The scale and CO2 release rates were chosen to be relevant to developing monitoring strategies for geological carbon storage. The field site was characterized before injection, and CO2 transport and concentrations in saturated soil and the vadose zone were modeled. Controlled releases of CO2 from the horizontal well were performed in the summers of 2007 and 2008, and collaborators from six national labs, three universities, and the U.S. Geological Survey investigated movement of CO2 through the soil, water, plants, and air with a wide range of near surface detection techniques. An overview of these results will be presented. ?? 2009 The Author(s).

  4. A shallow subsurface controlled release facility in Bozeman, Montana, USA, for testing near surface CO2 detection techniques and transport models

    Energy Technology Data Exchange (ETDEWEB)

    Spangler, L.H.; Wielopolski, L.; Dobeck, L. M.; Repasky, K. S.; Nehrir, A. R.; Humphries, S. D.; Barr, J. L.; Keith, C. J.; Shaw, J. A.; Rouse, J. H.; Cunningham, A. B.; Benson, S. M.; Oldenburg, C. M.; Lewicki, J. L.; Wells, A. W.; Diehl, J. R.; Strazisar, B. R.; Fessenden, J. E.; Rahn, T. A.; Amonette, J. E.; Barr, J. L.; Pickles, W. L.; Jacobson, J. D.; Silver, E. A.; Male, E. J.; Rauch, H. W.; Gullickson, K. S.; Trautz, R.; Kharaka, Y.; Birkholzer, J.

    2010-03-01

    A controlled field pilot has been developed in Bozeman, Montana, USA, to study near surface CO{sub 2} transport and detection technologies. A slotted horizontal well divided into six zones was installed in the shallow subsurface. The scale and CO{sub 2} release rates were chosen to be relevant to developing monitoring strategies for geological carbon storage. The field site was characterized before injection, and CO{sub 2} transport and concentrations in saturated soil and the vadose zone were modeled. Controlled releases of CO{sub 2} from the horizontal well were performed in the summers of 2007 and 2008, and collaborators from six national labs, three universities, and the U.S. Geological Survey investigated movement of CO{sub 2} through the soil, water, plants, and air with a wide range of near surface detection techniques. An overview of these results will be presented.

  5. A shallow subsurface controlled release facility in Bozeman, Montana, USA, for testing near surface CO2 detection techniques and transport models

    Energy Technology Data Exchange (ETDEWEB)

    Spangler, Lee H. [Montana State Univ., Bozeman, MT (United States). Dept. of Chemistry and Biochemistry; Dobeck, Laura M. [Montana State Univ., Bozeman, MT (United States). Dept. of Chemistry and Biochemistry; Repasky, Kevin S. [Montana State Univ., Bozeman, MT (United States). Dept. of Electrical and Computer Engineering; Nehrir, Amin R. [Montana State Univ., Bozeman, MT (United States). Dept. of Electrical and Computer Engineering; Humphries, Seth D. [Montana State Univ., Bozeman, MT (United States). Dept. of Electrical and Computer Engineering; Barr, Jamie L. [Montana State Univ., Bozeman, MT (United States). Dept. of Electrical and Computer Engineering; Keith, Charlie J. [Montana State Univ., Bozeman, MT (United States). Dept. of Electrical and Computer Engineering; Shaw, Joseph A. [Montana State Univ., Bozeman, MT (United States). Dept. of Electrical and Computer Engineering; Rouse, Joshua H. [Montana State Univ., Bozeman, MT (United States). Dept. of Electrical and Computer Engineering; Cunningham, Alfred B. [Montana State Univ., Bozeman, MT (United States). Dept. of Civil Engineering; Benson, Sally M. [Stanford Univ., CA (United States). Global Climate and Energy Project; Oldenburg, Curtis M. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Earth Sciences Div.; Lewicki, Jennifer L. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Earth Sciences Div.; Wells, Arthur W. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Earth Sciences Div.; Diehl, J. Rodney [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Earth Sciences Div.; Strazisar, Brian R. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Earth Sciences Div.; Fessenden, Julianna E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Div. of Earth and Environmental Sciences; Rahn, Thom A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Div. of Earth and Environmental Sciences; Amonette, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Barr, Jon L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Pickles, William L. [Univ. of California, Santa Cruz, CA (United States). Earth and Planetary Sciences; Jacobson, James D. [Univ. of California, Santa Cruz, CA (United States). Earth and Planetary Sciences; Silver, Eli A. [Univ. of California, Santa Cruz, CA (United States). Earth and Planetary Sciences; Male, Erin J. [Univ. of California, Santa Cruz, CA (United States). Earth and Planetary Sciences; Rauch, Henry W. [Univ. of West Virginia, Morgantown, WV (United States). Dept. of Geology and Geography; Gullickson, Kadie S. [Montana State Univ., Bozeman, MT (United States). Dept. of Chemistry and Biochemistry; Trautz, Robert [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Kharaka, Yousif [U.S. Geological Survey, Menlo Park, CA (United States); Birkholzer, Jens [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Earth Sciences Div.; Wielopolski, Lucien [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2010-03-01

    A controlled field pilot has been developed in Bozeman, Montana, USA, to study near surface CO2 transport and detection technologies. A slotted horizontal well divided into six zones was installed in the shallow subsurface. The scale and CO2 release rates were chosen to be relevant to developing monitoring strategies for geological carbon storage. The field site was characterized before injection, and CO2 transport and concentrations in saturated soil and the vadose zone were modeled. Controlled releases of CO2 from the horizontal well were performed in the summers of 2007 and 2008, and collaborators from six national labs, three universities, and the U. S. Geological Survey investigated movement of CO2 through the soil, water, plants, and air with a wide range of near surface detection techniques. An overview of these results will be presented.

  6. 不同加工方式对浙江红花油茶茶油品质的影响%Effects of Different Processing Methods on the Quality of Oil- Tea of Camellia Cheklangoleosa Hu

    Institute of Scientific and Technical Information of China (English)

    沈建福; 陈中海; 肖仁显; 陈秋平

    2012-01-01

    First, the main economic charactere of four kinds of camellia plants (Camellia oleifera Abel, Camellia meiocarpa,Camellia vietnamensis Huang ex Hu,Camellia cheklangoleosa Hu)were analyzed. The results show as follows: oil rate of dry seed and oil rate of the kernel yield of Camellia cheklangoleosa Hu are highest (60.7% and 37.2% respectively). The oil rate of fresh fruit of Camellia cheklangoleosa Hu is just less than Camellia meiocarpa. Analyzing from the perspective of Economics,Camellia cheklangoleosa Hu is more hopeful. Then,Camellia cheklangoleosa Hu is used for material. Three process methods (supercritical CO2 extraction, cold pressing, and solvent extraction) were applied to prepare oil - tea camellia seed oil. The physicochemical property and nutritional materials of the oil,such as extraction rate of oil acid value,peroxide value,iodine value,colour value,saponification value,transparency, the content of vitamin E,oxidative stability of oil and fatty acid,were investigated. The results show as follows; for three process methods,extraction rate of oil of supercritical C02 extraction is highest(92.09% ),extraction rate of oil old pressing is 74.1% which is significant less than that of the oil extracted by the other methods. The supercritical CO2 extraction oil has the highest acid value and peroxide value which are significant higher than that of the oil extracted by the other methods. At the same time, the oxidative stability of oil of supercritical CO2 extraction oil is the worst. The contents of vitamin E: supercritical CO2 extracted oil > Solvent Extraction > cold pressing.%首先分析了山荼属中普通油茶、小果油茶、越南油茶和浙江红花油茶果实主要经济性状.结果表明,4种油茶中,浙江红花油茶的种仁含油率(60.7%)和干籽含油率(37.2%)最高,鲜果含油率仅次于小果油荼.从经济角度考虑,浙江红花油茶最具发展前景.然后以浙江红花油茶为材料,研究了CO2超临界萃取

  7. Canonical discrimination of the effect of a new broiler production facility on soil chemical profiles as related to current management practices.

    Directory of Open Access Journals (Sweden)

    Cynthia L Sheffield

    Full Text Available The effect dirt-floored broiler houses have on the underlying native soil, and the potential for contamination of the ground water by leaching under the foundation, is an understudied area. This study examines alterations in fifteen quantitative soil parameters (Ca, Cu, electrical conductivity, Fe, K, Mg, Mn, Na, NO3, organic matter, P, pH, S, soil moisture and Zn in the underlayment of a newly constructed dirt-floored broiler house over the first two years of production (Native through Flock 11. The experiment was conducted near NW Robertson County, Texas, where the native soil is a fine, smectitic thermic Udertic Paleustalfs and the slopes range from zero to three percent. Multiple samples were collected from under each of three water and three feed lines the length of the house, in a longitudinal study during February 2008 through August 2010. To better define the relationship between the soil parameters and sampling times, a canonical discriminant analysis approach was used. The soil profiles assembled into five distinctive clusters corresponding to time and management practices. Results of this work revealed that the majority of parameters increased over time. The management practices of partial and total house clean-outs markedly altered soil profiles the house underlayment, thus reducing the risk of infiltration into the ground water near the farm. This is important as most broiler farms consist of several houses within a small area, so the cumulative ecological impact could be substantial if not properly managed.

  8. Canonical discrimination of the effect of a new broiler production facility on soil chemical profiles as related to current management practices.

    Science.gov (United States)

    Sheffield, Cynthia L; Crippen, Tawni L; Byrd, J Allen; Beier, Ross C; Yeater, Kathleen

    2015-01-01

    The effect dirt-floored broiler houses have on the underlying native soil, and the potential for contamination of the ground water by leaching under the foundation, is an understudied area. This study examines alterations in fifteen quantitative soil parameters (Ca, Cu, electrical conductivity, Fe, K, Mg, Mn, Na, NO3, organic matter, P, pH, S, soil moisture and Zn) in the underlayment of a newly constructed dirt-floored broiler house over the first two years of production (Native through Flock 11). The experiment was conducted near NW Robertson County, Texas, where the native soil is a fine, smectitic thermic Udertic Paleustalfs and the slopes range from zero to three percent. Multiple samples were collected from under each of three water and three feed lines the length of the house, in a longitudinal study during February 2008 through August 2010. To better define the relationship between the soil parameters and sampling times, a canonical discriminant analysis approach was used. The soil profiles assembled into five distinctive clusters corresponding to time and management practices. Results of this work revealed that the majority of parameters increased over time. The management practices of partial and total house clean-outs markedly altered soil profiles the house underlayment, thus reducing the risk of infiltration into the ground water near the farm. This is important as most broiler farms consist of several houses within a small area, so the cumulative ecological impact could be substantial if not properly managed.

  9. Facile electrochemical co-deposition of a graphene-cobalt nanocomposite for highly efficient water oxidation in alkaline media: direct detection of underlying electron transfer reactions under catalytic turnover conditions.

    Science.gov (United States)

    Guo, Si-Xuan; Liu, Yuping; Bond, Alan M; Zhang, Jie; Esakki Karthik, P; Maheshwaran, I; Senthil Kumar, S; Phani, K L N

    2014-09-21

    A facile electrochemical co-deposition method has been developed for the fabrication of graphene-cobalt nanocomposite modified electrodes that achieve exceptionally efficient water oxidation in highly alkaline media. In the method reported, a graphene-cobalt nanocomposite film was deposited electrochemically from a medium containing 1 mg ml(-1) graphene oxide, 0.8 mM cobalt nitrate and 0.05 M phytic acid (pH 7). The formation of the nanocomposite film was confirmed using electrochemical, Raman spectroscopic and scanning electron microscopic techniques. The nanocomposite film exhibits excellent activity and stability towards water oxidation to generate oxygen in 1 M NaOH aqueous electrolyte media. A turn over frequency of 34 s(-1) at an overpotential of 0.59 V and a faradaic efficiency of 97.7% were deduced from analysis of data obtained by rotating ring disk electrode voltammetry. Controlled potential electrolysis data suggests that the graphene supported catalyst exhibits excellent stability under these harsh conditions. Phytate anion acts as stabilizer for the electrochemical formation of cobalt nanoparticles. Fourier transformed ac voltammetry allowed the redox chemistry associated with catalysis to be detected directly under catalytic turnover conditions. Estimates of formal reversible potentials obtained from this method and derived from the overall reactions 3Co(OH)2 + 2OH(-) ⇌ Co3O4 + 4H2O + 2e(-), Co3O4 + OH(-) ⇌ 3CoOOH + e(-) and CoOOH + OH(-) ⇌ CoO2 + H2O + e(-) are 0.10, 0.44 and 0.59 V vs. Ag/AgCl, respectively.

  10. Future technological and economic performance of IGCC and FT production facilities with and without CO2 capture: Combining component based learning curve and bottom-up analysis

    NARCIS (Netherlands)

    Knoope, M.M.J.; Meerman, J.C.; Ramirez, C.A.; Faaij, A.P.C.

    2013-01-01

    This study aims to investigate the technological and economic prospects of integrated gasification facilities for power (IGCC) and Fischer–Tropsch (FT) liquid production with and without CCS over time. For this purpose, a component based experience curve was constructed and applied to identify the p

  11. Facile and single step synthesis of three dimensional reduced graphene oxide-NiCoO2 composite using microwave for enhanced electron field emission properties

    Science.gov (United States)

    Kumar, Rajesh; Singh, Rajesh K.; Singh, Ashwani K.; Vaz, Alfredo R.; Rout, Chandra S.; Moshkalev, Stanislav A.

    2017-09-01

    We report the enhanced field emission properties of three-dimensional (3D) mixed transition metal oxide with reduced graphene oxide nanosheets (rGO-NSs) using a simple and fast synthesis route. The rGO-NSs with different/mixed transition metal oxide (rGO-MxOy) (MxOy = CoO, NiO and NiCoO2) composite has been synthesized for comparative studies for the electron field emission properties. The various rGO-MxOy composite materials were synthesized by microwave irradiation using soild precursor powder. The electron field emission properties were studied for all the samples as rGO-NSs, rGO-CoO, rGO-NiO and 3D rGO-NiCoO2 composite. It was found that specially, rGO-NiCoO2 composite shows the enhanced field emission performance due to synergic effect of mixed transition metal oxide as NiCoO2 nanoparticles with rGO-NSs and also the proper anchoring of NiCoO2 nanoparticles on rGO-NSs. The attachment of NiCoO2 mixed transition metal oxide with rGO-NSs exhibited lower turn-on field, lower threshold field, larger field enhancement factor and stable emission current stability as compared with those of the rGO-NSs, rGO-CoO and rGO-NiO composite. The surface microstructural analysis and morphology were probed by XRD, scanning and Raman. We suggest that anchoring of binary metal oxide nanoparticles on rGO-NSs could be exploited for the development of efficient field emitters.

  12. Peak Discharge, Flood Profile, Flood Inundation, and Debris Movement Accompanying the Failure of the Upper Reservoir at the Taum Sauk Pump Storage Facility near Lesterville, Missouri

    Science.gov (United States)

    Rydlund, Jr., Paul H.

    2006-01-01

    The Taum Sauk pump-storage hydroelectric power plant located in Reynolds County, Missouri, uses turbines that operate as pumps and hydraulic head generated by discharging water from an upper to a lower reservoir to produce electricity. A 55-acre upper reservoir with a 1.5- billion gallon capacity was built on top of Proffit Mountain, approximately 760 feet above the floodplain of the East Fork Black River. At approximately 5:16 am on December 14, 2005, a 680-foot wide section of the upper reservoir embankment failed suddenly, sending water rushing down the western side of Proffit Mountain and emptying into the floodplain of East Fork Black River. Flood waters from the upper reservoir flowed downstream through Johnson's Shut-Ins State Park and into the lower reservoir of the East Fork Black River. Floods such as this present unique challenges and opportunities to analyze and document peak-flow characteristics, flood profiles, inundation extents, and debris movement. On December 16, 2005, Light Detection and Ranging (LiDAR) data were collected and used to support hydraulic analyses, forensic failure analyses, damage extent, and mitigation of future disasters. To evaluate the impact of sedimentation in the lower reservoir, a bathymetric survey conducted on December 22 and 23, 2005, was compared to a previous bathymetric survey conducted in April, 2005. Survey results indicated the maximum reservoir capacity difference of 147 acre-feet existed at a pool elevation of 730 feet. Peak discharge estimates of 289,000 cubic feet per second along Proffit Mountain and 95,000 cubic feet per second along the East Fork Black River were determined through indirect measurement techniques. The magnitude of the embankment failure flood along the East Fork Black River was approximately 4 times greater than the 100-year flood frequency estimate of 21,900 cubic feet per second, and approximately 3 times greater than the 500-year flood frequency estimate of 30,500 cubic feet per second

  13. Prevalence of enterobacteriaceae in Tupinambis merianae (Squamata: Teiidae from a captive facility in Central Brazil, with a profile of antimicrobial drug resistance in Salmonella enterica

    Directory of Open Access Journals (Sweden)

    Andréa de Moraes Carvalho

    2013-06-01

    Full Text Available The present study reports the presence of enterobacteriaceae in Tegu Lizards (Tupinambis merianaefrom a captive facility in central Brazil. From a total of 30 animals, 10 juveniles and 20 adults (10 males, 10 females, 60 samples were collected, in two periods separated by 15 days. The samples were cultivated in Xylose-lysine-deoxycholate agar (XLT4 and MacConkey agar. The Salmonella enterica were tested for antimicrobial susceptibility. A total of 78 bacteria was isolated, of wich 27 were from juveniles of T. merianae, 30 from adult males and 21 from adult females. Salmonella enterica was the most frequent bacteria followed by Citrobacter freundii, Escherichia coli, Enterobacter sakasakii, Kluivera sp., Citrobacter amalonaticus, Serratia marcescens, Citrobacter diversus, Yersinia frederiksenii, Serratia odorifera, and Serratia liquefaciens. Salmonella enterica subsp. diarizonae and houtenae showed resistance to cotrimoxazole, and serum Salmonella enterica Worthington showed resistance to tetracycline and gentamicin. Salmonella enterica Panama and S. enterica subsp. diarizonae showed intermediate sensitivity to cotrimoxazole. In addition to Enterobacteriaceae in the Tegu lizard, pathogenic serotypes of S. enterica also occur, and their antimicrobial resistance was confirmed.

  14. Using phenotype microarrays in the assessment of the antibiotic susceptibility profile of bacteria isolated from wastewater in on-site treatment facilities.

    Science.gov (United States)

    Jałowiecki, Łukasz; Chojniak, Joanna; Dorgeloh, Elmar; Hegedusova, Berta; Ejhed, Helene; Magnér, Jörgen; Płaza, Grażyna

    2017-04-27

    The scope of the study was to apply Phenotype Biolog MicroArray (PM) technology to test the antibiotic sensitivity of the bacterial strains isolated from on-site wastewater treatment facilities. In the first step of the study, the percentage values of resistant bacteria from total heterotrophic bacteria growing on solid media supplemented with various antibiotics were determined. In the untreated wastewater, the average shares of kanamycin-, streptomycin-, and tetracycline-resistant bacteria were 53, 56, and 42%, respectively. Meanwhile, the shares of kanamycin-, streptomycin-, and tetracycline-resistant bacteria in the treated wastewater were 39, 33, and 29%, respectively. To evaluate the antibiotic susceptibility of the bacteria present in the wastewater, using the phenotype microarrays (PMs), the most common isolates from the treated wastewater were chosen: Serratia marcescens ss marcescens, Pseudomonas fluorescens, Stenotrophomonas maltophilia, Stenotrophomonas rhizophila, Microbacterium flavescens, Alcaligenes faecalis ss faecalis, Flavobacterium hydatis, Variovorax paradoxus, Acinetobacter johnsonii, and Aeromonas bestiarum. The strains were classified as multi-antibiotic-resistant bacteria. Most of them were resistant to more than 30 antibiotics from various chemical classes. Phenotype microarrays could be successfully used as an additional tool for evaluation of the multi-antibiotic resistance of environmental bacteria and in preliminary determination of the range of inhibition concentration.

  15. Partially reduced iridium oxide clusters dispersed on titania as efficient catalysts for facile synthesis of dimethylformamide from CO2, H2 and dimethylamine.

    Science.gov (United States)

    Bi, Qing-Yuan; Lin, Jian-Dong; Liu, Yong-Mei; Xie, Song-Hai; He, He-Yong; Cao, Yong

    2014-08-21

    A novel bifunctional catalyst based on partially reduced iridium oxide supported on TiO2 was found to be exceedingly efficient for the organic-solvent-free synthesis of dimethylformamide from CO2, H2 and dimethylamine.

  16. Facile synthesis of organic-inorganic layered nanojunctions of g-C3N4/(BiO)2CO3 as efficient visible light photocatalyst.

    Science.gov (United States)

    Zhang, Wendong; Sun, Yanjuan; Dong, Fan; Zhang, Wei; Duan, Shuo; Zhang, Qin

    2014-08-21

    Novel g-C3N4/(BiO)2CO3 organic-inorganic nanojunctioned photocatalysts were synthesized by in situ depositing (BiO)2CO3 nanoflakes onto the surface of g-C3N4 nanosheets through a one-pot efficient capture of atmospheric CO2 method at room temperature. The as-synthesized samples were characterized by X-ray diffraction (XRD), Fourier transform infrared (FT-IR) spectroscopy, X-ray photoelectron spectroscopy (XPS), transmission electron microscopy (TEM), high-resolution transmission electron microscopy (HRTEM), UV-vis diffuse reflectance spectroscopy (DRS), N2 adsorption-desorption analysis and electron spin resonance (ESR). The photocatalytic activity of as-synthesized samples was evaluated by degrading Rhodamine B (RhB) and phenol in aqueous solution under visible-light irradiation. The g-C3N4/(BiO)2CO3 nanojunctions showed much higher visible-light photocatalytic activity than those of pure g-C3N4 and (BiO)2CO3 for the degradation of RhB and phenol. The enhanced photocatalytic activity can be mainly ascribed to the well-matched band structures, dye photosensitization and efficient crystal facets coupling interaction between g-C3N4 {002} and (BiO)2CO3 {002}. The ˙O2(-) radicals were identified as the main active species. Furthermore, the pure (BiO)2CO3 with highly exposed {002} crystal facets also exhibited excellent visible-light photoactivity for the degradation of RhB, which can be originated from the indirect dye photosensitization. The present work could provide a new strategy for the efficient utilization of atmospheric CO2 in green synthetic chemistry.

  17. A facile solvent-free Synthesis Route for the Assembly of Highly CO2 Selective and H2S tolerant NiSIFSIX Metal-Organic Framework

    KAUST Repository

    Eddaoudi, Mohamed

    2015-07-06

    The development of materials for CO2 capture with high selectivity and high tolerance to H2S is of prime importance for various industrially relevant gas streams (e.g. natural gas and biogas upgrading as well as pre-combustion capture). Here, we report the successful fabrication of a MOF with combined exceptional CO2 capture properties and H2S tolerance, namely Ni SIFSIX based-MOF using both solvothermal and solvent-free methodologies.

  18. CONSTRUCTION OF HU-PBL/SCID CHIMERAS AND DEVELOPMENT OF EBV-RELATED LYMPHOMAS

    Institute of Scientific and Technical Information of China (English)

    Run-liang Gan; Ke Lan; Zhi-hua Yin; Li-jiang Wang; Ying Song; Kai-tai Yao

    2005-01-01

    Objective To construct hu-PBL/SCID chimeras and to investigate the development of lymphoma and oncogenicity of the Epstein-Barr virus (EBV).Mtehods Human peripheral blood lymphocytes (PBLs) were isolated from healthy adult donors and transplanted intraperitoneally into severe combined immunodeficient (SCID) mice. Mice with hu-PBL engraftment from healthy EBV seronegative donors were injected intraperitoneally with EBV-containing supematant from suspension culture of B95-8 cell line (active infection), whereas mice receiving lymphocytes from healthy EBV seropositive donors were not re-infected with B95-8 derived EBV (latent infection). Pathological examination and molecular analysis were performed on experimental animals and induced neoplasms.Results In the early stage of this experiment, 12 mice died of acute graft-versus-host disease, mortality was 34.3%(12/35 mice) with an average life span of 17.5 days. In 19 survival hu-PBL/SCID chimeric recipients from 12 healthy donors,tumor incidence was 84.2% (16/19 mice). The average survival time of tumor-bearing mice was 65.5 days. EBV-related neoplasms in SCID mice were nodular tumors with aggressive and fatal features. Histological morphology of tumors exhibited diffuse large cell lymphomas. Immunohistochemistry revealed that LCA (CD45) and L26 (CD20) were positive, but both PS1 (CD3) and UCHL-1 (CD45RO) were negative, and EBV products ZEBRA, LMP1, and EBNA2 were expressed in a small number of tumor cells. EB virus particles were seen in the nuclei of some tumor cells by electron microscopy, and EBV DNA could be amplified in the tumor tissues by PCR. In situ hybridization indicated that the nuclei of tumor cells contained human-specific Alu sequence.Conclusions EBV-induced tumors were human B-cell malignant lymphomas. We obtained direct causative evidence dealing with EBV-associated tumor deriving from normal human cells.

  19. 'Hu Hong' (bad thing): parental perceptions of teenagers' sexuality in urban Vietnam.

    Science.gov (United States)

    Do, Lan Anh Thi; Boonmongkon, Pimpawun; Paek, Seung Chun; Guadamuz, Thomas E

    2017-02-28

    Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers' sexuality, particularly the social and cultural forces, that may hinder access to sexuality information. Guided by a Community Advisory Board (CAB), this qualitative study uses four focus group discussions (FGDs) consisting of 12 mothers and 12 fathers, as well as twelve individual in-depth interviews (IDIs) with a diverse sample of parents of teens in Ho Chi Minh City (HCMC), Vietnam. Content and discourse analysis were conducted, based on Foucauldian concepts. Four themes emerged: 1) Meanings of sexuality and sexuality education, 2) Early sexual intercourse destroys teenagers' future, 3) Teenagers are not hu hong (spoil/bad thing), are innocent and virgin, and 4) Policing and controlling of sexual intercourse among teens. Parents did not view their teenage children as sexual beings; those who are sexual are considered hu hong. Parents believed that teens need to be policed and controlled to prevent them from becoming hu hong, particularly girls. Controlling of sexuality information by parents was therefore common in HCMC, but differed by gender and educational levels of parents. For example, fathers more than mothers were not comfortable teaching their teenage children about sex and sexuality. Parents with higher education police their teenage children's usage of the Internet and social media, while parents with lower education control who can be friends with their teenage children. Vietnamese parents in general have negative views of sex and sexuality education for their teenage children. Recognizing that many Vietnamese teenagers have unsafe sex before marriage, parents need to

  20. Effects of weaning age on growth, nutrient digestibility and metabolism, and serum parameters in Hu lambs

    Directory of Open Access Journals (Sweden)

    Jianmin Chai

    2015-12-01

    Full Text Available This study was conducted to investigate the effect of weaning age on growth performance, nutrient digestion and metabolism, and serological indicators, and to obtain an optimal weaning age in Hu lambs. Forty-eight newborn Hu lambs (birth weight, 2.53 ± 0.14 kg were randomly divided into 4 groups. The lambs in control group (ER suckled their dams. The lambs in other three experimental groups were weaned on milk replacer at 10, 20, and 30 days of age (EW10, EW20, and EW30 groups, respectively. The results were as follows: 1 lambs in EW10 and EW30 groups had a lower (P  0.05 among groups; however, the apparent digestibility and deposition of calcium in early weaned lambs were lower (P < 0.05 than those in ewe-reared lambs. 4 The albumin content in EW30 group was lower (P < 0.05 than that in ER group; the globulin content in EW30 group was higher (P < 0.05 than that in other groups; the content of serum insulin-like growth factor-Ⅰ in weaned lambs tended to increase compared with lambs in ER group. Finally, the growth rate of lambs decreased within 10 days post-weaning, but early weaning boosted creep feed intake, leading to better growth and health later in life. The Hu lambs can be weaned on milk replacer and creep feed at 10 days of age.

  1. Microarray profiling and co-expression network analysis of circulating lncRNAs and mRNAs associated with major depressive disorder.

    Directory of Open Access Journals (Sweden)

    Zhifen Liu

    Full Text Available LncRNAs, which represent one of the most highly expressed classes of ncRNAs in the brain, are becoming increasingly interesting with regard to brain functions and disorders. However, changes in the expression of regulatory lncRNAs in Major Depressive Disorder (MDD have not yet been reported. Using microarrays, we profiled the expression of 34834 lncRNAs and 39224 mRNAs in peripheral blood sampled from MDD patients as well as demographically-matched controls. Among these, we found that 2007 lncRNAs and 1667 mRNAs were differentially expressed, 17 of which were documented as depression-related gene in previous studies. Gene Ontology (GO and pathway analyses indicated that the biological functions of differentially expressed mRNAs were related to fundamental metabolic processes and neurodevelopment diseases. To investigate the potential regulatory roles of the differentially expressed lncRNAs on the mRNAs, we also constructed co-expression networks composed of the lncRNAs and mRNAs, which shows significant correlated patterns of expression. In the MDD-derived network, there were a greater number of nodes and connections than that in the control-derived network. The lncRNAs located at chr10:874695-874794, chr10:75873456-75873642, and chr3:47048304-47048512 may be important factors regulating the expression of mRNAs as they have previously been reported associations with MDD. This study is the first to explore genome-wide lncRNA expression and co-expression with mRNA patterns in MDD using microarray technology. We identified circulating lncRNAs that are aberrantly expressed in MDD and the results suggest that lncRNAs may contribute to the molecular pathogenesis of MDD.

  2. The dynamic ocean biological pump: Insights from a global compilation of particulate organic carbon, CaCO3, and opal concentration profiles from the mesopelagic

    Science.gov (United States)

    Lam, Phoebe J.; Doney, Scott C.; Bishop, James K. B.

    2011-09-01

    We have compiled a global data set of 62 open ocean profiles of particulate organic carbon (POC), CaCO3, and opal concentrations collected by large volume in situ filtration in the upper 1000 m over the last 30 years. We define concentration-based metrics for the strength (POC concentration at depth) and efficiency (attenuation of POC with depth in the mesopelagic) of the biological pump. We show that the strength and efficiency of the biological pump are dynamic and are characterized by a regime of constant and high transfer efficiency at low to moderate surface POC and a bloom regime where the height of the bloom is characterized by a weak deep biological pump and low transfer efficiency. The variability in POC attenuation length scale manifests in a clear decoupling between the strength of the shallow biological pump (e.g., POC at the export depth) and the strength of the deep biological pump (POC at 500 m). We suggest that the paradigm of diatom-driven export production is driven by a too restrictive perspective on upper mesopelagic dynamics. Indeed, our full mesopelagic analysis suggests that large, blooming diatoms have low transfer efficiency and thus may not export substantially to depth; rather, our analysis suggests that ecosystems characterized by smaller cells and moderately high %CaCO3 have a high mesopelagic transfer efficiency and can have higher POC concentrations in the deep mesopelagic even with relatively low surface or near-surface POC. This has negative implications for the carbon sequestration prospects of deliberate iron fertilization.

  3. Chemical Constituents from the Seeds of Ziziphus jujuba var. Spinosa (Bunge) Hu

    Institute of Scientific and Technical Information of China (English)

    Li-Mei LI; Xun LIAO; Shu-Lin PENG; Li-Sheng DING

    2005-01-01

    To search for new and bioactive minor components from traditional Chinese medicines, a new compound, named jujuphenoside (1), was isolated from the seeds of Ziziphusjujuba var. spinosa (Bunge)Hu. The structure of jujuphenoside was elucidated by spectral and chemical methods, particularly twodimensional nuclear magnetic resonance analysis. Together with the new compound, 22 known compounds were also isolated and identified from the seeds of Z. jujuba var. spinosa, among which, epiceanothic acid (2) was first obtained from natural resources, whereas compounds 7-16 were first obtained from this plant.

  4. Opsoclonus-myoclonus and anti-Hu positive limbic encephalitis in a patient with neuroblastoma.

    Science.gov (United States)

    Morales La Madrid, Andres; Rubin, Charles M; Kohrman, Michael; Pytel, Peter; Cohn, Susan L

    2012-03-01

    Opsoclonus-myoclonus syndrome (OMS) is seen in 2-3% of children with neuroblastoma and is believed to be caused by an autoimmune process elicited by the tumor. Although long-term neurologic sequelae are common in children with OMS, limbic encephalitis has not previously been reported. We report a child who developed limbic encephalitis associated with anti-Hu antibodies, 6 years after her initial diagnosis of neuroblastoma and OMS. This case demonstrates that patients with neuroblastoma and OMS are at risk for developing new paraneoplastic symptoms years after their original diagnosis and emphasizes the need for careful long-term follow-up.

  5. Micología Lista de Huéspedes Colombianos

    Directory of Open Access Journals (Sweden)

    Obregon Botero Rafael

    1964-12-01

    Full Text Available El presente trabajo es una lista de hongos encontrados en Colombia. Está ordenada por Familias del huésped y cada nombre científico del hongo va seguido por la mención de los lugares donde fue encontrado así como la altura de tales localidades. Luego precede un número que corresponde a la colección existente en el Ministerio de Agricultura de Colombia. No pretendo sino iniciar la labor que han de completar especialistas mejor informados y espero que sea de alguna utilidad para los que se dedican a esta rama de las Ciencias Naturales.

  6. Hybrid Semiloof elements for plates and shells based upon a modified Hu-Washizu principle

    Science.gov (United States)

    Pian, T. H. H.; Sumihara, K.

    1984-01-01

    Hybrid SemiLoof elements for plates and shells are developed based upon modified Hu-Washizu principle. In the new version of the assumed stress hybrid formulation the equilibrium equations are satisfied through the introduction of internal displacement parameters as Lagrange multipliers. The inversion of the resulting H-matrices is simplified particularly when the stresses are expressed in terms of natural coordinates. A 24-DOF triangular element and a 32-DOF quadrilateral element based on shallow shell theory are derived and evaluated.

  7. HuLiS, a program to teach mesomerism and more

    Science.gov (United States)

    Carissan, Yannick; Goudard, Nicolas; Hagebaum-Reignier, Denis; Humbel, Stéphane

    2016-08-01

    The HuLiS program is presented as a tool to decompose a delocalized wave function as a linear combination of localized electronic structures. The principles of the energy based HL-CI and the overlap based schemes HL-P are developed. The results obtained for a set of 10 relevant organic molecules are shown to compare very well with high level quantum chemistry calculations. A trust factort is introduced and its use is shown on the allyl radical case where symmetry must be taken into account.

  8. MicroRNA-16 Modulates HuR Regulation of Cyclin E1 in Breast Cancer Cells

    Directory of Open Access Journals (Sweden)

    Xun Guo

    2015-03-01

    Full Text Available RNA binding protein (RBPs and microRNAs (miRNAs or miRs are post-transcriptional regulators of gene expression that are implicated in development of cancers. Although their individual roles have been studied, the crosstalk between RBPs and miRNAs is under intense investigation. Here, we show that in breast cancer cells, cyclin E1 upregulation by the RBP HuR is through specific binding to regions in the cyclin E1 mRNA 3' untranslated region (3'UTR containing U-rich elements. Similarly, miR-16 represses cyclin E1, dependent on its cognate binding sites in the cyclin E1 3'UTR. Evidence in the literature indicates that HuR can regulate miRNA expression and recruit or dissociate RNA-induced silencing complexes (RISC. Despite this, miR-16 and HuR do not affect the other’s expression level or binding to the cyclin E1 3'UTR. While HuR overexpression partially blocks miR-16 repression of a reporter mRNA containing the cyclin E1 3'UTR, it does not block miR-16 repression of endogenous cyclin E1 mRNA. In contrast, miR-16 blocks HuR-mediated upregulation of cyclin E1. Overall our results suggest that miR-16 can override HuR upregulation of cyclin E1 without affecting HuR expression or association with the cyclin E1 mRNA.

  9. Sustaining fermentation in high-gravity ethanol production by feeding yeast to a temperature-profiled multifeed simultaneous saccharification and co-fermentation of wheat straw.

    Science.gov (United States)

    Westman, Johan O; Wang, Ruifei; Novy, Vera; Franzén, Carl Johan

    2017-01-01

    Considerable progress is being made in ethanol production from lignocellulosic feedstocks by fermentation, but negative effects of inhibitors on fermenting microorganisms are still challenging. Feeding preadapted cells has shown positive effects by sustaining fermentation in high-gravity simultaneous saccharification and co-fermentation (SSCF). Loss of cell viability has been reported in several SSCF studies on different substrates and seems to be the main reason for the declining ethanol production toward the end of the process. Here, we investigate how the combination of yeast preadaptation and feeding, cell flocculation, and temperature reduction improves the cell viability in SSCF of steam pretreated wheat straw. More than 50% cell viability was lost during the first 24 h of high-gravity SSCF. No beneficial effects of adding selected nutrients were observed in shake flask SSCF. Ethanol concentrations greater than 50 g L(-1) led to significant loss of viability and prevented further fermentation in SSCF. The benefits of feeding preadapted yeast cells were marginal at later stages of SSCF. Yeast flocculation did not improve the viability but simplified cell harvest and improved the feasibility of the cell feeding strategy in demo scale. Cultivation at 30 °C instead of 35 °C increased cell survival significantly on solid media containing ethanol and inhibitors. Similarly, in multifeed SSCF, cells maintained the viability and fermentation capacity when the temperature was reduced from 35 to 30 °C during the process, but hydrolysis yields were compromised. By combining the yeast feeding and temperature change, an ethanol concentration of 65 g L(-1), equivalent to 70% of the theoretical yield, was obtained in multifeed SSCF on pretreated wheat straw. In demo scale, the process with flocculating yeast and temperature profile resulted in 5% (w/w) ethanol, equivalent to 53% of the theoretical yield. Multifeed SSCF was further developed by means of a

  10. 可在鱼体内表达hu-IFN-α的基因重组构建及转化%Construction of a Fish Expression hu-IFN-α Recombinant Gene

    Institute of Scientific and Technical Information of China (English)

    张学文; 章怀云; 符少辉; 陈韬; 陈立祥; 肖调义

    2001-01-01

    通过分子重组,将人α-干扰素(hu-IFN-α)基因编码序列克隆到鲤鱼β-肌动蛋白基因启动子下游,构建成能在鱼体内组成型表达hu-IFN-α的基因重组分子。经限制性酶切分析、Southern杂交和序列测定,证明重组分子构建的正确性。采用显微注射法将这一重组基因转化草鱼受精卵,获得了表达人α-干扰素的转基因草鱼。%The coding sequence of hu-IFN-α gene is cloned under the control of Carp β-actin gene promoter. Thus a fish constantly expression of hu-IFN-α gene recombinant is constructed. Southern blot and sequencing results show that the recombinant molecule is correctly constructed. The recombinant gene is transferred into fertilized zygotes of grass carp via microinjection. And hu-IFN-α is detected out in 20% of transgenic fish by ELISA.

  11. Facile synthesis of ternary Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids with enhanced photocatalytic removal of elemental mercury driven by visible light

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Anchao, E-mail: anchaozhang@126.com [School of Mechanical and Power Engineering, Henan Polytechnic University, Jiaozuo, 454000 (China); Zhang, Lixiang; Lu, Hao; Chen, Guoyan; Liu, Zhichao [School of Mechanical and Power Engineering, Henan Polytechnic University, Jiaozuo, 454000 (China); Xiang, Jun; Sun, Lushi [State Key Laboratory of Coal Combustion, Huazhong University of Science and Technology, Wuhan, 430074 (China)

    2016-08-15

    Graphical abstract: Schematic illustration for the charge transfer in the Ag/AgBr(0.7)-Ag{sub 2}CO{sub 3} system. - Highlights: • A novel technique on Hg{sup 0} removal using visible-light-driven Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids was proposed. • Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids were synthesized by a simple modified co-precipitation method. • Hg{sup 0} was mainly removed by the photogenerated holes (h{sup +}). • The possible reaction mechanism for superior Hg{sup 0} removal was proposed. - Abstract: A novel technique for photocatalytic removal of elemental mercury (Hg{sup 0}) using visible-light-driven Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids was proposed. The ternary Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids were synthesized by a simple modified co-precipitation method and characterized by N{sub 2} adsorption-desorption, scanning electron microscope (SEM), X-ray diffraction (XRD), UV–vis diffused reflectance spectroscopy (DRS), X-ray photoelectron spectroscopy (XPS) and electron spin resonance (ESR) techniques. The effects of AgBr content, fluorescent lamp (FSL) irradiation, solution temperature, SO{sub 2} and NO on Hg{sup 0} removal were investigated in detail. Furthermore, a possible reaction mechanism for higher Hg{sup 0} removal was proposed, and the simultaneous removal of Hg{sup 0}, SO{sub 2} and NO was studied. The results showed that a high efficiency of Hg{sup 0} removal was obtained by using Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids under fluorescent lamp irradiation. The AgBr content, FSL irradiation, solution temperature, and SO{sub 2} all exhibited significant effects on Hg{sup 0} removal, while NO had slight effect on Hg{sup 0} removal. The addition of Ca(OH){sub 2} demonstrated a little impact on Hg{sup 0} removal and could significantly improve the SO{sub 2}-resistance performance of Ag/AgBr(0.7)-Ag{sub 2}CO{sub 3} hybrid. The characterization results exhibited that hydroxyl radical (·OH), superoxide radical (·O{sub 2}{sup −}), hole (h{sup +}), and Br

  12. Plasma profile of pro-inflammatory cytokines and chemokines in cocaine users under outpatient treatment: influence of cocaine symptom severity and psychiatric co-morbidity.

    Science.gov (United States)

    Araos, Pedro; Pedraz, María; Serrano, Antonia; Lucena, Miguel; Barrios, Vicente; García-Marchena, Nuria; Campos-Cloute, Rafael; Ruiz, Juan J; Romero, Pablo; Suárez, Juan; Baixeras, Elena; de la Torre, Rafael; Montesinos, Jorge; Guerri, Consuelo; Rodríguez-Arias, Marta; Miñarro, José; Martínez-Riera, Roser; Torrens, Marta; Chowen, Julie A; Argente, Jesús; Mason, Barbara J; Pavón, Francisco J; Rodríguez de Fonseca, Fernando

    2015-07-01

    The treatment for cocaine use constitutes a clinical challenge because of the lack of appropriate therapies and the high rate of relapse. Recent evidence indicates that the immune system might be involved in the pathogenesis of cocaine addiction and its co-morbid psychiatric disorders. This work examined the plasma pro-inflammatory cytokine and chemokine profile in abstinent cocaine users (n = 82) who sought outpatient cocaine treatment and age/sex/body mass-matched controls (n = 65). Participants were assessed with the diagnostic interview Psychiatric Research Interview for Substance and Mental Diseases according to the Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition, Text Revision (DSM-IV-TR). Tumor necrosis factor-alpha, chemokine (C-C motif) ligand 2/monocyte chemotactic protein-1 and chemokine (C-X-C motif) ligand 12 (CXCL12)/stromal cell-derived factor-1 (SDF-1) were decreased in cocaine users, although all cytokines were identified as predictors of a lifetime pathological use of cocaine. Interleukin-1 beta (IL-1β), chemokine (C-X3-C motif) ligand 1 (CX3CL1)/fractalkine and CXCL12/SDF-1 positively correlated with the cocaine symptom severity when using the DSM-IV-TR criteria for cocaine abuse/dependence. These cytokines allowed the categorization of the outpatients into subgroups according to severity, identifying a subgroup of severe cocaine users (9-11 criteria) with increased prevalence of co-morbid psychiatric disorders [mood (54%), anxiety (32%), psychotic (30%) and personality (60%) disorders]. IL-1β was observed to be increased in users with such psychiatric disorders relative to those users with no diagnosis. In addition to these clinical data, studies in mice demonstrated that plasma IL-1β, CX3CL1 and CXCL12 were also affected after acute and chronic cocaine administration, providing a preclinical model for further research. In conclusion, cocaine exposure modifies the circulating levels of pro-inflammatory mediators. Plasma

  13. Probing the mass-loss history of AGB and red supergiant stars from CO rotational line profiles I. Theoretical model -- Mass-loss history unravelled in VY CMa

    CERN Document Server

    Decin, L; De Koter, A; Justtanont, K; Tielens, A G G M; Waters, L B F M

    2006-01-01

    Context: Mass loss plays a dominant role in the evolution of low mass stars while they are on the Asymptotic Giant Branch (AGB). The gas and dust ejected during this phase are a major source in the mass budget of the interstellar medium. Recent studies have pointed towards the importance of variations in the mass-loss history of such objects. Aims: By modelling the full line profile of low excitation CO lines emitted in the circumstellar envelope, we can study the mass-loss history of AGB stars. Methods: We have developed a non-LTE radiative transfer code, which calculates the velocity structure and gas kinetic temperature of the envelope in a self-consistent way. The resulting structure of the envelope provides the input for the molecular line radiative calculations which are evaluated in the comoving frame. The code allows for the implementation of modulations in the mass-loss rate. This code has been benchmarked against other radiative transfer codes and is shown to perform well and efficiently. Results: W...

  14. Comparative Global Gene Expression Profiles of Wild-Type Yersinia pestis CO92 and Its Braun Lipoprotein Mutant at Flea and Human Body Temperatures

    Directory of Open Access Journals (Sweden)

    Cristi L. Galindo

    2010-01-01

    Full Text Available Braun/murein lipoprotein (Lpp is involved in inflammatory responses and septic shock. We previously characterized a Δlpp mutant of Yersinia pestis CO92 and found that this mutant was defective in surviving in macrophages and was attenuated in a mouse inhalation model of plague when compared to the highly virulent wild-type (WT bacterium. We performed global transcriptional profiling of WT Y. pestis and its Δlpp mutant using microarrays. The organisms were cultured at 26 and 37 degrees Celsius to simulate the flea vector and mammalian host environments, respectively. Our data revealed vastly different effects of lpp mutation on the transcriptomes of Y. pestis grown at 37 versus 26C. While the absence of Lpp resulted mainly in the downregulation of metabolic genes at 26C, the Y. pestis Δlpp mutant cultured at 37C exhibited profound alterations in stress response and virulence genes, compared to WT bacteria. We investigated one of the stress-related genes (htrA downregulated in the Δlpp mutant relative to WT Y. pestis. Indeed, complementation of the Δlpp mutant with the htrA gene restored intracellular survival of the Y. pestis Δlpp mutant. Our results support a role for Lpp in Y. pestis adaptation to the host environment, possibly via transcriptional activation of htrA.

  15. Comparative Analyses of Transcriptional Profiles in Mouse Organs Using a Pneumonic Plague Model after Infection with Wild-Type Yersinia pestis CO92 and Its Braun Lipoprotein Mutant

    Directory of Open Access Journals (Sweden)

    Cristi L. Galindo

    2009-01-01

    Full Text Available We employed Murine GeneChips to delineate the global transcriptional profiles of the livers, lungs, and spleens in a mouse pneumonic plague infection model with wild-type (WT Y. pestis CO92 and its Braun lipoprotein (Δlpp mutant with reduced virulence. These organs showed differential transcriptional responses to infection with WT Y. pestis, but the overall host functional processes affected were similar across all three tissues. Gene expression alterations were found in inflammation, cytokine signaling, and apoptotic cell death-associated genes. Comparison of WT and Δlpp mutant-infected mice indicated significant overlap in lipopolysaccharide- (LPS- associated gene expression, but the absence of Lpp perturbed host cell signaling at critical regulatory junctions resulting in altered immune response and possibly host cell apoptosis. We generated a putative signaling pathway including major inflammatory components that could account for the synergistic action of LPS and Lpp and provided the mechanistic basis of attenuation caused by deletion of the lpp gene from Y. pestis in a mouse model of pneumonic plague.

  16. Hierarchical hollow urchin-like NiCo2O4 nanomaterial as electrocatalyst for oxygen evolution reaction in alkaline medium

    Science.gov (United States)

    Wang, Juan; Qiu, Tian; Chen, Xu; Lu, Yanluo; Yang, Wensheng

    2014-12-01

    Hierarchical hollow urchins of NiCo2O4 (HU-NiCo2O4) were synthesized by a hard templating method followed by thermal decomposition. The structure consists of three levels of hierarchy i.e., zero-dimensional nanoparticle with a diameter of about 6 nm, one-dimensional chain, and three-dimensional hollow urchin, respectively. Nanoparticle aggregates of NiCo2O4 (NA-NiCo2O4) were also synthesized by the same procedure in the absence of the hard template. Relative to NA-NiCo2O4, HU-NiCo2O4 features a well-connected three-dimensional porous structure, which is beneficial for diffusion of oxygen. Consequently, HU-NiCo2O4 displayed superior electrocatalytic activity towards oxygen evolution processes with lower overpotential, higher current density, and higher stability than NA-NiCo2O4.

  17. Facile preparation of ordered mesoporous MnCo2O4 for low-temperature selective catalytic reduction of NO with NH3

    Science.gov (United States)

    Qiu, Mingying; Zhan, Sihui; Yu, Hongbing; Zhu, Dandan; Wang, Shengqiang

    2015-01-01

    Ordered mesoporous MnCo2O4 nanomaterials were successfully prepared through the nanocasting route using SBA-15 and KIT-6 as hard templates. These mesoporous nanomaterials were characterized using XRD, BET, TEM, NH3-TPD, H2-TPR, NO-TPD, XPS and DRIFT. The low temperature selective catalytic reduction (SCR) activity of NO with NH3 was investigated, which revealed that 3D-MnCo2O4 using KIT-6 as a template can totally clean all NO over a wide temperature range of 100-250 °C with a gas hourly space velocity (GHSV) of 32 000 h-1, while 2D-MnCo2O4 with SBA-15 as a template had 95% conversion rate at the same condition. 3D-MnCo2O4 showed the best performance to clean NO due to its typical three-dimensional porous structure, large specific surface area, abundant active surface oxygen species and Lewis acid sites. All the results indicate that a novel, cheap catalyst for catalytic removal of NO can be designed by controlling the morphology at the nanoscale.Ordered mesoporous MnCo2O4 nanomaterials were successfully prepared through the nanocasting route using SBA-15 and KIT-6 as hard templates. These mesoporous nanomaterials were characterized using XRD, BET, TEM, NH3-TPD, H2-TPR, NO-TPD, XPS and DRIFT. The low temperature selective catalytic reduction (SCR) activity of NO with NH3 was investigated, which revealed that 3D-MnCo2O4 using KIT-6 as a template can totally clean all NO over a wide temperature range of 100-250 °C with a gas hourly space velocity (GHSV) of 32 000 h-1, while 2D-MnCo2O4 with SBA-15 as a template had 95% conversion rate at the same condition. 3D-MnCo2O4 showed the best performance to clean NO due to its typical three-dimensional porous structure, large specific surface area, abundant active surface oxygen species and Lewis acid sites. All the results indicate that a novel, cheap catalyst for catalytic removal of NO can be designed by controlling the morphology at the nanoscale. Electronic supplementary information (ESI) available: Low-angle XRD

  18. Evaluation of the Kerma at the entrance of the labyrin thin in facilities with Co-60 HDR brachytherapy; Evaluacion del Kerma en la entrada del laberinto en instalaciones de braquiterapia de HDR con Co-60

    Energy Technology Data Exchange (ETDEWEB)

    Pujades, M. C.; Granero, D.; Ballester, F.; Perez-Calatayud, J.; Vijande, J.

    2013-07-01

    The purpose of this study is to evaluate the kerma's collision at the entrance of the labyrinth adapting the methodology of the NCRP-151 to a bunker of brachytherapy with Co-60, similar to the one carried out in a previous work with HDR Ir-192. To validate the result is simulated using techniques Monte Carlo (MC) two typical designs of HDR with Co-60 bunker. (Author)

  19. Genetic determination of the enhanced drought resistance of rice maintainer HuHan2B by pedigree breeding.

    Science.gov (United States)

    Wei, Haibin; Feng, Fangjun; Lou, Qiaojun; Xia, Hui; Ma, Xiaosong; Liu, Yunhua; Xu, Kai; Yu, Xinqiao; Mei, Hanwei; Luo, Lijun

    2016-11-17

    The ongoing deficit of fresh water resource in rice growing regions has made the selection of water-saving and drought-resistance rice (WDR) a crucial factor in developing sustainable cultivation. HuHan2B, a new japonica maintainer for WDR breeding, had the same yield potential as recurrent parent HanFengB but showed improved drought resistance in fields. We investigated the genomic content accumulation and candidate genes passed from parent to offspring using the genomic and transcriptomic approaches. The genomic constitution indicated that the genetic similarity was 84% between HuHan2B and HanFengB; additionally, 7,256 genes with specific alleles were inherited by HuHan2B from parents other than HanFengB. The differentially expressed genes (DEGs) under drought stress showed that biological function was significantly enriched for transcript regulation in HuHan2B, while the oxidation-reduction process was primarily enriched in HanFengB. Furthermore, 36 DEGs with specific inherited alleles in HuHan2B were almost involved in the regulatory network of TFs and target genes. These findings suggested that major-effect genes were congregated and transformed into offspring in manner of interacting network by breeding. Thus, exploiting the potential biological function of allelic-influencing DEGs would be of great importance for improving selection efficiency and the overall genetic gain of multiple complex traits.

  20. HuR-Regulated mRNAs Associated with Nuclear hnRNP A1-RNP Complexes

    Directory of Open Access Journals (Sweden)

    Apostolia Guialis

    2013-10-01

    Full Text Available Post-transcriptional regulatory networks are dependent on the interplay of many RNA-binding proteins having a major role in mRNA processing events in mammals. We have been interested in the concerted action of the two RNA-binding proteins hnRNP A1 and HuR, both stable components of immunoselected hnRNP complexes and having a major nuclear localization. Specifically, we present here the application of the RNA-immunoprecipitation (RIP-Chip technology to identify a population of nuclear transcripts associated with hnRNP A1-RNPs as isolated from the nuclear extract of either HuR WT or HuR-depleted (KO mouse embryonic fibroblast (MEF cells. The outcome of this analysis was a list of target genes regulated via HuR for their association (either increased or reduced with the nuclear hnRNP A1-RNP complexes. Real time PCR analysis was applied to validate a selected number of nuclear mRNA transcripts, as well as to identify pre-spliced transcripts (in addition to their mature mRNA counterpart within the isolated nuclear hnRNP A1-RNPs. The differentially enriched mRNAs were found to belong to GO categories relevant to biological processes anticipated for hnRNP A1 and HuR (such as transport, transcription, translation, apoptosis and cell cycle indicating their concerted function in mRNA metabolism.

  1. Effects of rHu-EPO on Myocyte Apoptosis and Cardiac Function Follow-ing Acute Myocardial Infarction in Rats

    Institute of Scientific and Technical Information of China (English)

    YE Liang; DU Xinling; XIA Jiahong; JIANG Ping

    2005-01-01

    The mechanisms of rHu-EPO attenuating the apoptosis after myocardial infarction in rats were studied. Thirty-two rats were divided into three groups: sham operation group (Sham), acute myocardial infarction group (MI) and rHu-EPO-treated group (MI+ EPO). Acute myocardial infarction model was made by ligating the anterior descending coronary artery. rHu-EPO was administered i. p. in MI+EPO group at the dose of 5 000 IU/kg body weight immediately after the ligation. Each rat in MI+EPO group received the same dose of rHu-EPO daily the next 6 days. On the 14th day all rats underwent hemodynamic measurements and then killed. The samples were examined with HE stain, immunohistochemistry technique (bcl-2, bax) and TUNEL dyeing. The results showed that hemodynamic function in MI+ EPO group was much better than in MI group.The number of the cells positive for bax and TUNEL in MI+EPO group was less than that in MI group. The number of the cells positive for bcl-2 in MI+EPO group was more than that in MI group. These findings suggested that rHu-EPO could treat myocardial infarction by preventing apoptosis and attenuating post-infarction deterioration in hemodynamic function.

  2. The Use of Soluble Transferrin Receptor in the Detection of rHuEPO Abuse in Sports

    Directory of Open Access Journals (Sweden)

    Lorenzo Gordon

    2010-02-01

    Full Text Available Erythropoietin (EPO increases the number of circulating erythrocytes and muscle oxygenation. The recombinant forms of EPO have indiscriminately been used by athletes, mainly in endurance sports to increase their erythrocytes concentration, thus generating a better delivery of oxygen to the muscle tissue. The administration of recombinant human erythropoietin (rHuEPO except for therapeutic use was prohibited by the International Olympic Committee (IOC and its unauthorized use considered as doping. In the last few years, a number of studies using parameters indicative of accelerated erythropoiesis have investigated a number of indirect methods for the detection of rHuEPO abuse. No single indirect marker has been found that can satisfactorily demonstrated rHuEPO misuse. Soluble transferrin receptor (sTfR is a new marker of iron status and erythropoietic activity. It has been included in multivariable blood testing models for the detection of performance enhancing EPO abuse in sports. Indirect markers of altered erythropoiesis give reliable evidence of current or discontinued rHuEPO usage. This review describes the physical, biological and pharmacokinetic properties of endogenous EPO and its recombinant form. It also discusses the available strategies for the detection of rHuEPO abuse in sports, involving the use of sTfR concentration directly or in mathematical multivariate models.

  3. Combining wavelets transform and Hu moments with self-organizing maps for medical image categorization

    Science.gov (United States)

    Silva, Leandro A.; Del-Moral-Hernandez, Emilio; Moreno, Ramon A.; Furuie, Sérgio S.

    2011-10-01

    Images are fundamental sources of information in modern medicine. The images stored in a database and divided in categories are an important step for image retrieval. For an automatic categorization process, detailed analysis is done regarding image representation and generalization method. The baseline method for this process, in the medical image context, is using thumbnails and K-nearest neighbor (KNN), which is easily implemented and has had satisfactory results in literature. This work addresses an alternative method for automatic categorization, which jointly uses discrete wavelet transform with Hu's moments for image representation and self-organizing maps (SOM) neural networks combined with the KNN classifier (SOM-KNN), for medical image categorization. Furthermore, extensive experiments are conducted, to define the best wavelet family and to select the best coefficients set, to consider the remaining wavelet coefficients set (not selected as the best ones) through their Hu's moments, and to carry out a contrastive study with other successful approaches for categorization. The categorization result from a database with 10,000 images in 116 categories yielded 81.8% of correct rate, which is much better than the 67.9% obtained by the baseline method; and the time consumed in classification processing with SOM-KNN is 100 times shorter than KNN.

  4. Hu1-2: a metal-poor bipolar planetary nebula with fast collimated outflows

    CERN Document Server

    Fang, Xuan; Miranda, Luis F; Riera, Angels; Velazquez, Pablo F; Raga, Alejandro C

    2015-01-01

    We present narrow-band optical and near-IR imaging and optical long-slit spectroscopic observations of Hu1-2, a Galactic planetary nebula (PN) with a pair of [N II]-bright, fast-moving (> 340 km/s) bipolar knots. Intermediate-dispersion spectra are used to derive physical conditions and abundances across the nebula, and high-dispersion spectra to study the spatio-kinematical structure. Generally Hu1-2 has high He/H (~0.14) and N/O ratios (~0.9), typical of Type I PNe. On the other hand, its abundances of O, Ne, S, and Ar are low as compared with the average abundances of Galactic bulge and disc PNe. The position-velocity maps can be generally described as an hour-glass shaped nebula with bipolar expansion, although the morphology and kinematics of the innermost regions cannot be satisfactorily explained with a simple, tilted equatorial torus. The spatio-kinematical study confines the inclination angle of its major axis to be within 10 degrees of the plane of sky. As in the irradiated bow-shocks of IC4634 and ...

  5. Revisiting the proposed planetary system orbiting the eclipsing polar HU Aquarii

    CERN Document Server

    Wittenmyer, Robert A; Marshall, J P; Butters, O W; Tinney, C G

    2011-01-01

    It has recently been proposed, on the basis of eclipse-timing data, that the eclipsing polar cataclysmic variable HU Aquarii is host to at least two giant planets. However, that result has been called into question based upon the dynamical stability of the proposed planets. In this work, we present a detailed re-analysis of all eclipse timing data available for the HU Aquarii system, making use of standard techniques used to fit orbits to radial-velocity data. We find that the eclipse timings can be used to obtain a two-planet solution that does not require the presence of additional bodies within the system. We then perform a highly detailed dynamical analysis of the proposed planetary system. We show that the improved orbital parameters we have derived correspond to planets that are dynamically unstable on unfeasibly short timescales (of order 10^4 years or less). Given these results, we discuss briefly how the observed signal might in fact be the result of the intrinsic properties of the eclipsing polar, r...

  6. ReHuNa- La Red por la Humanización del Parto y Nacimiento

    Directory of Open Access Journals (Sweden)

    Daphne RATTNER

    2010-12-01

    Full Text Available La ReHuNa - Red por la Humanización del Parto y Nacimiento - es una organización de la sociedad civil que actúa desde 1993 en forma de red de asociados en el Brasil. Su principal objetivo es la divulgación de la asistencia y cuidados perinatales con base en evidencias científicas y de acuerdo a las recomendaciones de la Organización Mundial de la Salud. Esta red tuvo un papel fundamental en la estructura de un movimiento que hoy se denomina “humanización de la asistencia al parto y nacimiento”, que pretende disminuir las intervenciones innecesarias y promover cuidados al proceso del embarazo-parto-nacimiento-lactancia comprendido como un proceso natural y fisiológico basado en conocimientos científicos. Este artículo relata la historia de la ReHuNa y sus principales realizaciones y señala sus caminos futuros.

  7. The impact of the vaccination program for hemorrhagic fever with renal syndrome in Hu County, China.

    Science.gov (United States)

    Xiao, Dan; Wu, Kejian; Tan, Xin; Yan, Tiecheng; Li, Haitao; Yan, Yongping

    2014-02-03

    The incidence of hemorrhagic fever with renal syndrome (HFRS) in Hu County ranked third of all counties in China in 2010. Although this county has provided a HFRS vaccination program freely since 1994, the impact of HFRS remains quite substantial. In order to continue the vaccination program effectively and control HFRS, a detailed understanding of the effect of the vaccination program should be undertaken. The Cochran-Armitage trend test was employed to examine the temporal trends of HFRS incidences, mortality rate and vaccination compliance. Temporal cluster analysis was performed to detect time periods of high HFRS risk. Cross correlation analysis was conducted to detect the correlation between HFRS incidence and vaccination compliance. Wavelet analysis was employed to detect the shift of the periodicity of HFRS. Between 1971 and 2011, the HFRS incidence and mortality rate ranged from 9.53/100,000 to 300.57/100,000 and 0 to 24.91/100,000, respectively, with a fluctuating but distinctly declining trend (incidence: Z=-34.38, P1994. In conclusion, the increase in vaccination compliance may play an important role in HFRS control and prevention in Hu County, China.

  8. The SCID-hu mouse as a model for HIV-1 infection.

    Science.gov (United States)

    Aldrovandi, G M; Feuer, G; Gao, L; Jamieson, B; Kristeva, M; Chen, I S; Zack, J A

    1993-06-24

    During normal fetal ontogeny, one of the first organs to harbour CD4-positive cells is the thymus. This organ could therefore be one of the earliest targets infected by human immunodeficiency virus type 1 (HIV-1) in utero. HIV-1-infected cells and pathological abnormalities of the thymus have been seen in HIV-1-infected adults and children, and in some fetuses aborted from infected women. Studies of HIV-1 pathogenesis have been hampered by lack of a suitable animal model system. Here we use the SCID-hu mouse as a model to investigate the effect of virus infection on human tissue. The mouse is homozygous for the severe combined immunodeficiency (SCID) defect. The model is constructed by implanting human fetal liver and thymus under the mouse kidney capsule. A conjoint human organ develops, which allows normal maturation of human thymocytes. After direct inoculation of HIV-1 into these implants, we observed severe depletion of human CD4-bearing cells within a few weeks of infection. This correlated with increasing virus load in the implants. Thus the SCID-hu mouse may be a useful in vivo system for the study of HIV-1-induced pathology.

  9. Avaliação dos óbitos ocorridos no Hospital Universitário da Universidade Federal de Santa Catarina (HU/UFSC Evaluation of deaths occurred at the University Hospital (HU/UFSC

    Directory of Open Access Journals (Sweden)

    Rachel Duarte Moritz

    2008-10-01

    Full Text Available OBJETIVO: Avaliar os óbitos ocorridos no HU/UFSC. Comparar o perfil dos pacientes que morreram nas enfermarias com o daqueles que morreram na UTI. Verificar se os óbitos foram considerados esperados (E e não evitáveis (NE. Constatar se houve recusa/suspensão de terapêutica (RST precedendo a morte. MÉTODOS: Obtivemos dados por meio de ficha elaborada pela Comissão de Óbito Hospitalar (COH, na qual constavam os aspectos demográficos, clínicos e terapêuticos dos pacientes e a avaliação da COH sobre a expectativa/evitabilidade dos óbitos. RESULTADOS: Analisamos os dados dos 326 pacientes com mais de 14 anos, que morreram entre julho/2004 e dezembro/2005. Desses, 128 morreram na UTI (G1 e 198 nas enfermarias (G2. A RST precedeu 38,2% dos óbitos no G1 e 2% no G2 (pOBJECTIVE: To evaluate the deaths which occurred at the HU/UFSC. To compare the profile of patients who died in the wards with that of patients who died in the ICU. To classify deaths which were expected or not, and avoidable or not. To verify how often withholding or withdrawing (WW therapy preceded death. METHODS: Archives of the Hospital Death Commission (HDC were analyzed. The clinical and demographic records were retrieved from the HDC data bank. Deaths were classified by the HDC as expected or not and avoidable or not. RESULTS: Data from 326 dead persons over 14 years of age were analyzed. One hundred and twenty eight deaths occurred in the ICU (G1 and 198 in the wards (G2. WW therapy preceded 38.2% of deaths in G1 and 2% in G2 (p<0.001. The main WW therapies were vasoactive drugs and antibiotics. Almost 20% of deaths were unexpected/avoidable in G1. In G2 6.5% were considered unexpected and 5% avoidable (p<0.005. Patients in G1 were younger and mostly male (p<0.005. Do-not-resuscitate orders were registered in 48.4% of patients' medical charts in G2 and 6.3% in G1 (p<0.001. Cardiopulmonary resuscitation was performed in 23.4% of patients in G1 and in 5.5% in G2 (p<0

  10. Facile preparation of NiCo2O4@rGO composites for the removal of uranium ions from aqueous solutions.

    Science.gov (United States)

    Song, Xiumei; Tan, Lichao; Sun, Xiaojun; Ma, Huiyuan; Zhu, Lin; Yi, Xiaoqing; Dong, Qiang; Gao, Junyu

    2016-11-14

    A hierarchical structure of NiCo2O4@rGO composite has been fabricated, with its structure and morphology well characterized by XRD, TEM, XPS and BET. The results proved that the NiCo2O4 nanosheets grow uniformly on both sides of the graphene sheets. In batch adsorption experiments, the effects of equilibrium time, pH and temperature on uranium(vi) adsorption were investigated. The main results show that the NiCo2O4@rGO composite has a higher affinity towards the uptake of uranium(vi) from aqueous solutions. The highest adsorption capacity reached 342.4 mg U g(-1) at pH 5.0. Kinetic analysis shows that the adsorption process is described best by a pseudo-second-order kinetic model. The uranium(vi) sorption equilibrium data correlates well with the Langmuir sorption isotherm model in the thermodynamic analysis. Thus, NiCo2O4@rGO composite is an excellent adsorbent for removing uranium(vi) ions.

  11. A facile approach for the synthesis of monolithic hierarchical porous carbons – high performance materials for amine based CO2 capture and supercapacitor electrode

    KAUST Repository

    Estevez, Luis

    2013-05-03

    An ice templating coupled with hard templating and physical activation approach is reported for the synthesis of hierarchically porous carbon monoliths with tunable porosities across all three length scales (macro- meso- and micro), with ultrahigh specific pore volumes [similar]11.4 cm3 g−1. The materials function well as amine impregnated supports for CO2 capture and as supercapacitor electrodes.

  12. RNA-binding protein HuD reduces triglyceride production in pancreatic β cells by enhancing the expression of insulin-induced gene 1.

    Science.gov (United States)

    Kim, Chongtae; Lee, Heejin; Kang, Hoin; Shin, Jung Jae; Tak, Hyosun; Kim, Wook; Gorospe, Myriam; Lee, Eun Kyung

    2016-04-01

    Although triglyceride (TG) accumulation in the pancreas leads to β-cell dysfunction and raises the chance to develop metabolic disorders such as type 2 diabetes (T2DM), the molecular mechanisms whereby intracellular TG levels are regulated in pancreatic β cells have not been fully elucidated. Here, we present evidence that the RNA-binding protein HuD regulates TG production in pancreatic β cells. Mouse insulinoma βTC6 cells stably expressing a small hairpin RNA targeting HuD (shHuD) (βTC6-shHuD) contained higher TG levels compared to control cells. Moreover, downregulation of HuD resulted in a decrease in insulin-induced gene 1 (INSIG1) levels but not in the levels of sterol regulatory element-binding protein 1c (SREBP1c), a key transcription factor for lipid production. We identified Insig1 mRNA as a direct target of HuD by using ribonucleoprotein immunoprecipitation (RIP) and biotin pulldown analyses. By associating with the 3'-untranslated region (3'UTR) of Insig1 mRNA, HuD promoted INSIG1 translation; accordingly, HuD downregulation reduced while ectopic HuD expression increased INSIG1 levels. We further observed that HuD downregulation facilitated the nuclear localization of SREBP1c, thereby increasing the transcriptional activity of SREBP1c and the expression of target genes involved in lipogenesis; likewise, we observed lower INSIG1 levels in the pancreatic islets of HuD-null mice. Taken together, our results indicate that HuD functions as a novel repressor of lipid synthesis in pancreatic β cells.

  13. Analysis of the kinetic of expression of tristetraprolin and HuR by rheumatoid arthritis patients pheripheral blood mononuclear cells stimulated with lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    G. Ferraccioli

    2011-09-01

    Full Text Available Objective. Given the role of TNF-α in Rheumatoid Arthritis (RA we decided to define the characteristics of the TNF- α synthesis by peripheral blood mononuclear cells (PBMNCs obtained from active-aggressive RA patients giving a particular attention to the modulation of the expression of two fundamental proteins in TNF-α mRNA stability regulation, Tristetraprolin (TTP and HuR. Methods. 11 RA patients with active disease were enrolled in the study before their entry in 2 double blind protocols: Infliximab versus MTX and Etanercept versus MTX. 9 healthy blood donors were taken as controls. PBMNCs obtained by Ficoll centrifugation and plastic adherence were stimulated with lipopolysaccharide (LPS and TNF-α was measured in the supernatant during 8 hours by ELISA. At each time point the cells were harvested and analysed for TNF- α, TTP and HuR mRNA expression by semi-quantitative PCR. Results. MNCs TNF-α secretion after LPS stimulation did not differ significantly between RA and control subjects, even if a tendency towards a more prompt response was observed in the patients. More importantly only the DMARDs responsive patients (DAS <3.7 at the 6th month, with a minimal reduction of 1.2 points disclosed precociously (at the first month a significant change in the profile of TNF-α secretion and maintained it until the 6th month. The “normalization” of the synthetic behaviour was accompanied by the resetting in the regulation of the expression of the TTP, that appeared significantly different in the patients before and after therapy. Conclusions. Independently from the type of therapy, responsive patients demonstrate a rapid change in the cellular biology at the systemic level that might drive the resolution of the phlogistic process at the synovial level.

  14. HuR-targeted nanotherapy in combination with AMD3100 suppresses CXCR4 expression, cell growth, migration, and invasion in lung cancer

    Science.gov (United States)

    Muralidharan, Ranganayaki; Panneerselvam, Janani; Chen, Allshine; Zhao, Yan Daniel; Munshi, Anupama; Ramesh, Rajagopal

    2015-01-01

    The CXCR4 chemokine receptor plays an important role in cancer cell metastasis. The CXCR4 antagonist, AMD3100, has limited efficacy in controlling metastasis. HuR, an RNA-binding protein, regulates CXCR4 in cancer cells. We therefore investigated whether targeting HuR using a siRNA-based nanoparticle plus AMD3100 would suppress CXCR4 and inhibit lung cancer metastasis. We treated human H1299 lung cancer cell with HuR-specific siRNA contained in a folate-targeted lipid nanoparticle (HuR-FNP) plus AMD3100, and compared this with AMD3100 alone, HuR-FNP alone and no treatment. HuR-FNP plus AMD3100 treatment produced a G1 phase cell-cycle arrest and reduced cell viability above and beyond the effects of AMD3100 alone. HuR and CXCR4 mRNA and protein expression levels were markedly reduced in all treatment groups. Phosphorylated (p) AKTS473 protein was also reduced. P27 protein expression increased with HuR-FNP and combination treatment. Promoter-based reporter studies showed that the combination inhibited CXCR4 promoter activity more than did either treatment alone. Cell migration and invasion was significantly reduced with all treatment; the combination provided the most inhibition. Reduced matrix metalloprotease (MMP) -2 and -9 expression was associated with reduced invasion in all treatment groups. Thus, we found that combined HuR and CXCR4 targeting effectively controlled lung cancer metastasis. PMID:26494555

  15. HuR-targeted nanotherapy in combination with AMD3100 suppresses CXCR4 expression, cell growth, migration and invasion in lung cancer.

    Science.gov (United States)

    Muralidharan, R; Panneerselvam, J; Chen, A; Zhao, Y D; Munshi, A; Ramesh, R

    2015-12-01

    The CXCR4 chemokine receptor has an important role in cancer cell metastasis. The CXCR4 antagonist, AMD3100, has limited efficacy in controlling metastasis. HuR, an RNA-binding protein, regulates CXCR4 in cancer cells. We therefore investigated whether targeting HuR using a siRNA-based nanoparticle plus AMD3100 would suppress CXCR4 and inhibit lung cancer metastasis. We treated human H1299 lung cancer cells with HuR-specific siRNA contained in a folate-targeted lipid nanoparticle (HuR-FNP) plus AMD3100, and compared this with AMD3100 alone, HuR-FNP alone and no treatment. HuR-FNP plus AMD3100 treatment produced a G1 phase cell cycle arrest and reduced cell viability above and beyond the effects of AMD3100 alone. HuR and CXCR4 mRNA and protein expression levels were markedly reduced in all treatment groups. Phosphorylated (p) AKT(S473) protein was also reduced. P27 protein expression increased with HuR-FNP and combination treatment. Promoter-based reporter studies showed that the combination inhibited CXCR4 promoter activity more than did either treatment alone. Cell migration and invasion was significantly reduced with all treatments; the combination provided the most inhibition. Reduced matrix metalloprotease (MMP)-2 and -9 expression was associated with reduced invasion in all treatment groups. Thus, we found that combined HuR and CXCR4 targeting effectively controlled lung cancer metastasis.

  16. Facile synthesis of surface N-doped Bi{sub 2}O{sub 2}CO{sub 3}: Origin of visible light photocatalytic activity and in situ DRIFTS studies

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Ying, E-mail: yzhou@swpu.edu.cn [State Key Laboratory of Oil and Gas Reservoir Geology and Exploitation, Southwest Petroleum University, Xindu Rd. 8, Chengdu 610500 (China); The Center of New Energy Materials and Technology, School of Materials Science and Engineering, Southwest Petroleum University, Xindu Rd. 8, Chengdu 610500 (China); Insititute for Chemical Technology and Polymer Chemistry, Karlsruhe Institute of Technology (KIT), 76131 Karlsruhe (Germany); Zhao, Ziyan [State Key Laboratory of Oil and Gas Reservoir Geology and Exploitation, Southwest Petroleum University, Xindu Rd. 8, Chengdu 610500 (China); The Center of New Energy Materials and Technology, School of Materials Science and Engineering, Southwest Petroleum University, Xindu Rd. 8, Chengdu 610500 (China); Wang, Fang; Cao, Kun [The Center of New Energy Materials and Technology, School of Materials Science and Engineering, Southwest Petroleum University, Xindu Rd. 8, Chengdu 610500 (China); Doronkin, Dmitry E. [Insititute for Chemical Technology and Polymer Chemistry, Karlsruhe Institute of Technology (KIT), 76131 Karlsruhe (Germany); Dong, Fan [College of Environmental and Biological Engineering, Chonqing Technology and Business University, Chongqing 400067 (China); Grunwaldt, Jan-Dierk, E-mail: grunwaldt@kit.edu [Insititute for Chemical Technology and Polymer Chemistry, Karlsruhe Institute of Technology (KIT), 76131 Karlsruhe (Germany)

    2016-04-15

    Graphical abstract: Surfactant (CTAB) can induce nitrogen interstitially doping in the Bi{sub 2}O{sub 2}CO{sub 3} surface, leading to the formation of localized states from N−O bond, which probably account for the origin of the visible light activity. Moreover, the photocatalytic NO oxidation processes over Bi{sub 2}O{sub 2}CO{sub 3} were successfully monitored for the first time by in situ DRIFTS. - Highlights: • Interstitially doping N in the Bi{sub 2}O{sub 2}CO{sub 3} surface was achieved at room temperature. • N-doped Bi{sub 2}O{sub 2}CO{sub 3} exhibited significantly enhanced visible light photocatalytic activity compared to the pristine Bi{sub 2}O{sub 2}CO{sub 3}. • The formation of localized states from N−O bond could account for the visible light activity of Bi{sub 2}O{sub 2}CO{sub 3}. • The photocatalytic NO oxidation process was monitored by in situ DRIFTS. - Abstract: Bi{sub 2}O{sub 2}CO{sub 3} nanosheets with exposed {001} facets were prepared by a facile room temperature chemical method. Due to the high oxygen atom density in {001} facets of Bi{sub 2}O{sub 2}CO{sub 3}, the addition of cetyltrimethylammonium bromide (CTAB) does not only influence the growth of crystalline Bi{sub 2}O{sub 2}CO{sub 3}, but also modifies the surface properties of Bi{sub 2}O{sub 2}CO{sub 3} through the interaction between CTAB and Bi{sub 2}O{sub 2}CO{sub 3}. Nitrogen from CTAB as dopant interstitially incorporates in the Bi{sub 2}O{sub 2}CO{sub 3} surface evidenced by both experimental and theoretical investigations. Hence, the formation of localized states from N−O bond improves the visible light absorption and charge separation efficiency, which leads to an enhancement of visible light photocatalytic activity toward to the degradation of Rhodamine B (RhB) and oxidation of NO. In addition, the photocatalytic NO oxidation over Bi{sub 2}O{sub 2}CO{sub 3} nanosheets was successfully monitored for the first time using in situ diffuse reflectance infrared Fourier

  17. Wildlife Protection, Mitigation, and Enhancement Plans, Anderson Ranch and Black Canyon Facilities: Final Report.

    Energy Technology Data Exchange (ETDEWEB)

    Meuleman, G. Allyn

    1987-06-01

    Under direction of the Pacific Northwest Electric Power Planning and Conservation Act of 1980, and the subsequent Northwest Power Planning Council's Columbia River Basin Fish and Wildlife Program, projects have been developed in Idaho to mitigate the impacts to wildlife habitat and production due to the development and operation of the Anderson Ranch and Black Canyon Facilities (i.e., dam, power plant, and reservoir areas). The Anderson Ranch Facility covered about 4812 acres of wildlife habitat while the Black Canyon Facility covered about 1115 acres. These acreages include dam and power plant staging areas. A separate mitigation plan has been developed for each facility. A modified Habitat Evaluation Procedure (HEP) was used to assess the benefits of the mitigation plans to wildlife. The interagency work group used the target species Habitat Units (HU's) lost at each facility as a guideline during the mitigation planning process, while considering the needs of wildlife in the areas. Totals of 9619 and 2238 target species HU's were estimated to be lost in the Anderson Ranch and Black Canyon Facility areas, respectively. Through a series of projects, the mitigation plans will provide benefits of 9620 target species HU's to replace Anderson Ranch wildlife impacts and benefits of 2195 target species HU's to replace Black Canyon wildlife impacts. Target species to be benefited by the Anderson Ranch and/or Black Canyon mitigation plans include the mallard, Canada goose, mink, yellow warbler, black-capped chickadee, ruffed grouse, mule deer, blue grouse, sharp-tailed grouse, ring-necked pheasant, and peregrine falcon.

  18. Hypertensive crisis: clinical-epidemiological profile.

    Science.gov (United States)

    Vilela-Martin, José Fernando; Vaz-de-Melo, Renan Oliveira; Kuniyoshi, Cristina Hiromi; Abdo, André Neder Ramires; Yugar-Toledo, Juan Carlos

    2011-03-01

    Hypertensive crisis (HC) stands out as one type of acute elevation in blood pressure (BP) and can manifest as hypertensive emergency (HE-with target-organ damage (TOD)) or hypertensive urgency (HU-without TOD), usually accompanied by levels of diastolic BP ≥120 mmHg. The aim of this study was to characterize the clinical-epidemiological profile of HC over the course of 1 year in a university reference hospital and perform a review of the literature. The study was a cross-sectional study, conducted over a period of 1 year (2006) in 362 patients who presented for treatment at the emergency hospital with HC, as described above. Among all patients examined, 231 individuals met the criteria for HE and 131 met the criteria for HU. Patients with HE were older (Phypertension.

  19. Facile synthesis of graphene-like Co{sub 3}S{sub 4} nanosheet/Ag{sub 2}S nanocomposite with enhanced performance in visible-light photocatalysis

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Mingyang [Anhui Province Key Laboratory of Environment-friendly Polymer Materials, School of Chemistry and Chemical Engineering, Anhui University, Hefei 230039 (China); Niu, Helin, E-mail: niuhelin@ahu.edu.cn [Anhui Province Key Laboratory of Environment-friendly Polymer Materials, School of Chemistry and Chemical Engineering, Anhui University, Hefei 230039 (China); Huang, Jinjing; Song, Jiming; Mao, Changjie; Zhang, Shengyi [Anhui Province Key Laboratory of Environment-friendly Polymer Materials, School of Chemistry and Chemical Engineering, Anhui University, Hefei 230039 (China); Zhu, Chengfeng [School of Chemical Engineering Hefei University of Technology, Hefei 230009 (China); Chen, Changle [CAS Key Laboratory of Soft Matter Chemistry, Department of Polymer Science and Engineering, University of Science and Technology of China, Hefei 230026 (China)

    2015-10-01

    Highlights: • Graphene-like Co{sub 3}S{sub 4} nanosheet/Ag{sub 2}S nanocomposites was prepared by a facile method. • Good photocatalytic activity for dye degradation under visible light irradiation. • Promising candidates as photocatalyst for dye degradation. - Abstract: Visible light photocatalysts have stimulated great research efforts. In this contribution, graphene-like Co{sub 3}S{sub 4} nanosheet/Ag{sub 2}S nanocomposite was prepared using a simple method, and characterized by transmission electron microscopy, X-ray diffraction, and UV–Vis DRS, etc. The photocatalytic properties of the nanocomposite was evaluated by the photocatalytic degradation of Methylene blue (MB) and Methyl orange (MO) under visible light irradiation. The nanocomposite photocatalyst displays excellent stability and photocatalytic activity compared with pure Co{sub 3}S{sub 4} nanosheet or Ag{sub 2}S nanoparticles. The superior photocatalytic properties were attributed to its unique structures, which could promote efficiently electron/hole separation and transportation.

  20. Expression of ARE-binding proteins AUF1 and HuR in follicular adenoma and carcinoma of thyroid gland.

    Science.gov (United States)

    Trojanowicz, B; Sekulla, C; Dralle, H; Hoang-Vu, C

    2016-01-01

    Both adenylate-uridylate rich elements binding proteins AUF1 and HuR may participate in thyroid carcinoma progression. In this study we investigated the expression of both factors on a protein level with a special focus on follicular adenoma and follicular thyroid carcinoma. By employment of immunofluorescence and western blot on 68 thyroid tissues including 7 goiter, 16 follicular adenoma (4 adenomatous hyperplasia), 19 follicular thyroid carcinomas, 13 papillary thyroid carcinomas and 14 undifferentiated thyroid carcinomas we investigated protein expression of AUF1 and HuR. In addition to previous results we demonstrated that AUF1 and HuR are significantly up-regulated in carcinoma tissues as compared with follicular adenoma or goiter tissues. Furthermore, by evaluation of AUF1 or HuR expression, or combination of both proteins on total tissue lysates, we were able to demonstrate a significant difference between follicular adenoma and follicular thyroid carcinoma. Overexpression of AUF1 and HuR is a common finding observed in thyroid malignancy. Analysis of the tissues obtained by surgical resection as demonstrated in this study is comparable to a fine needle aspiration and in combination with AUF1/HuR immuno-analysis may support the conventional immunohistological investigations. The promising results of this study were performed on relatively small collective, but justify future development of a quick thyroid diagnostic test on larger cohort of the patients, especially for thyroid samples which are inadequate for histological examinations.

  1. Facile Synthesis of Carbon Nanosphere/NiCo2O4 Core-shell Sub-microspheres for High Performance Supercapacitor

    Science.gov (United States)

    Li, Delong; Gong, Youning; Zhang, Yupeng; Luo, Chengzhi; Li, Weiping; Fu, Qiang; Pan, Chunxu

    2015-08-01

    This paper introduced a process to prepare the carbon nanosphere (CNS)/NiCo2O4 core-shell sub-microspheres. That is: 1) CNSs were firstly prepared via a simple hydrothermal method; 2) a layer of NiCo2O4 precursor was coated on the CNS surface; 3) finally the composite was annealed at 350 °C for 2 hours in the air, and the CNS/NiCo2O4 core-shell sub-microspheres were obtained. This core-shell sub-microsphere was prepared with a simple, economical and environmental-friendly hydrothermal method, and was suitable for large-scale production, which expects a promising electrode candidate for high performance energy storage applications. Electrochemical experiments revealed that the composite exhibited remarkable electrochemical performances with high capacitance and desirable cycle life at high rates, such as: 1) the maximum specific capacitance was up to 1420 F/g at 1 A/g 2) about 98.5% of the capacitance retained after 3000 charge-discharge cycles; 3) the capacitance retention was about 72% as the current density increase from 1 A/g to 10 A/g.

  2. Solid phase extraction of Cu2+, Ni2+, and Co2+ ions by a new magnetic nano-composite: excellent reactivity combined with facile extraction and determination.

    Science.gov (United States)

    Azizi, Parastou; Golshekan, Mostafa; Shariati, Shahab; Rahchamani, Jalal

    2015-04-01

    In the present study, silica magnetite mesoporous nanoparticles functionalized with a new chelating agent were synthesized and introduced as a magnetic solid phase for preconcentration of trace amounts of Cu2+, Ni2+, and Co2+ ions from aqueous solutions. Briefly, MCM-41 mesoporous-coated magnetite nano-particles (MMNPs) with particle size lower than 15 nm were synthesized via chemical co-precipitation methods. Then, N-(4-methoxysalicylidene)-4,5-dinitro-1,2-phenylenediamine (HL) as a new chelating agent was synthesized and used for surface modification of mesoporous magnetic solid phase by dispersive liquid-liquid functionalization (DLLF) as a new rapid method to form HL functionalized mesoporous magnetite nanoparticles (MMNPs─HL). The structure and morphology of prepared sorbent were characterized by FT-IR, XRD, VSM, and TEM. Finally, the prepared nanoparticles were utilized for preconcentration of Cu2+, Ni2+, and Co2+ ions prior to determination by atomic absorption spectrophotometery. The calibration graph was obtained under the optimized conditions with linear dynamic range of 1.0-300 μg L(-1) and correlation coefficient (r2) of 0.998. The detection limits of this method for cobalt, nickel, and copper ions were 0.03, 0.03, and 0.04 ng/mL, respectively. Finally, the method was successfully applied to the extraction and determination of the analyte ions in natural waters and reference plant samples.

  3. Mammography Facilities

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Mammography Facility Database is updated periodically based on information received from the four FDA-approved accreditation bodies: the American College of...

  4. Health Facilities

    Science.gov (United States)

    Health facilities are places that provide health care. They include hospitals, clinics, outpatient care centers, and specialized care centers, such as birthing centers and psychiatric care centers. When you ...

  5. Canyon Facilities

    Data.gov (United States)

    Federal Laboratory Consortium — B Plant, T Plant, U Plant, PUREX, and REDOX (see their links) are the five facilities at Hanford where the original objective was plutonium removal from the uranium...

  6. Antonio Rodríguez Huéscar y José Ortega y Gasset: Tres cartas

    OpenAIRE

    Esteban Enguita, José Emilio; Lasaga Medina, José

    2015-01-01

    El objetivo principal de este artículo es comentar las cartas que se enviaron Antonio Rodríguez Huéscar y José Ortega y Gasset entre 1942 y 1943. Dichas cartas se incluyen en el artículo. The principal aim of this paper is to comment on the letters which Antonio Rodríguez Huéscar and José Ortega y Gasset sent each other between 1942 and 1943. The above said letters are included in the paper

  7. The RNA-binding protein HuR regulates DNA methylation through stabilization of DNMT3b mRNA

    OpenAIRE

    Lopez de Silanes, I.; Gorospe, M.; Taniguchi, H; Abdelmohsen, K; Srikantan, S.; Alaminos, M.; Berdasco, M.; Urdinguio, R. G.; Fraga, M. F.; Jacinto, F. V.; Esteller, M.

    2009-01-01

    The molecular basis underlying the aberrant DNA-methylation patterns in human cancer is largely unknown. Altered DNA methyltransferase (DNMT) activity is believed to contribute, as DNMT expression levels increase during tumorigenesis. Here, we present evidence that the expression of DNMT3b is post-transcriptionally regulated by HuR, an RNA-binding protein that stabilizes and/or modulates the translation of target mRNAs. The presence of a putative HuR-recognition motif in the DNMT3b 3???UTR pr...

  8. Comparison of the Debye–Hückel and the Mean Spherical Approximation Theories for Electrolyte Solutions

    DEFF Research Database (Denmark)

    Maribo-Mogensen, Bjørn; Kontogeorgis, Georgios M.; Thomsen, Kaj

    2012-01-01

    The thermodynamics of electrolyte solutions has been investigated by many scientists throughout the last century. While several theories have been presented, the most popular models for the electrostatic interactions are based on the Debye–Hückel and mean spherical approximation (MSA) theories....... In this paper we investigate the differences between the Debye–Hückel and the MSA theories, and comparisons of the numerical results for the Helmholtz energy and its derivatives with respect to temperature, volume and composition are presented. The investigation shows that the nonrestricted primitive MSA...

  9. Characterisation of a novel, multifunctional, co-processed excipient and its effect on release profile of paracetamol from tablets prepared by direct compression

    Institute of Scientific and Technical Information of China (English)

    Eraga Sylvester Okhuelegbe; Arhewoh Matthew Ikhuoria; Uhumwangho Michael Uwumagbe; Iwuagwu Magnus Amara

    2015-01-01

    To characterise a novel multifunctional pharmaceutical excipient and investigate its effect on paracetamol release from tablets prepared by direct compression. Methods: The excipient was prepared by co-processing gelatinized maize starch with sodium carboxymethyl cellulose and microcrystalline cellulose in a ratio of 2:1:1, dried and pulverized into powder. The excipient formulated was characterized using Fourier transform infrared spectroscopy and differential scanning calorimetry. The excipient was used to prepare batches of tablets by direct compression with drug-excipient ratios of 1:1, 1:2, 1:3 and 1:4. Parameters evaluated on tablets include crushing strength, friability and in vitro dissolution studies. Results: Differential scanning calorimetry analysis revealed a crystalline excipient while Fourier transform infrared spectroscopy showed no interaction between the excipient and paracetamol. Tablets from all the batches gave average crushing strength values between 3.47 and 4.88 kp. The 1:1 and 1:2 tablet batches were comparable to each other while 1:3 and 1:4 were also comparable to one another in their dissolution profiles. The dissolution parameters of the 1:4 batch was faster with - m∞(90.5%), t50% (3.5 min), t70% (11.6 min) while that of ratio 1:1 was the least with - m∞ (48.6%), m5min (23.8%). Their release kinetics followed a Korsmeyer-Peppas model with a super case-II transport mechanism. Conclusions: The drug-excipient ratios of 1:3 and 1:4 gave pharmaceutically acceptable tablets that met the British Pharmacopoeia specifications. The t50% value of the 1:4 batch of tablets may find its usefulness in formulating drugs for which a fast onset of action is desired.

  10. Neurobehavioural, neuropathological and biochemical profiles in a novel mouse model of co-morbid posttraumatic stress disorder and mild traumatic brain injury.

    Directory of Open Access Journals (Sweden)

    Joseph Olubunmi Ojo

    2014-06-01

    Full Text Available Co-morbid mild traumatic brain injury (mTBI and post-traumatic stress disorder (PTSD has become the signature disorder for returning combat veterans. The clinical heterogeneity and overlapping symptomatology of mTBI and PTSD underscore the need to develop a preclinical model that will enable the characterization of unique and overlapping features and allow discrimination between both disorders. This study details the development and implementation of a novel experimental paradigm for PTSD and combined PTSD-mTBI. The PTSD paradigm involved exposure to a danger-related predator odor under repeated restraint over a 21day period and a physical trauma (inescapable footshock. We administered this paradigm alone, or in combination with a previously established mTBI model. We report outcomes of behavioral, pathological and biochemical profiles at an acute timepoint. PTSD animals demonstrated recall of traumatic memories, anxiety and an impaired social behavior. In both mTBI and combination groups there was a pattern of disinhibitory like behavior. mTBI abrogated both contextual fear and impairments in social behavior seen in PTSD animals. No major impairment in spatial memory was observed in any group. Examination of neuroendocrine and neuroimmune responses in plasma revealed a trend towards increase in corticosterone in PTSD and combination groups, and an apparent increase in Th1 and Th17 proinflamatory cytokine(s in the PTSD only and mTBI only groups respectively. In the brain there were no gross neuropathological changes in any groups. We observed that mTBI on a background of repeated trauma exposure resulted in an augmentation of axonal injury and inflammatory markers neurofilament L and ICAM-1. Our observations thus far suggest that this novel stress-trauma-related paradigm may be a useful model for investigating further the overlapping and distinct spatio-temporal and behavioral/biochemical relationship between mTBI and PTSD experienced by combat

  11. Preliminary Sweep Width Determination for HU-25A Airborne Radars: Life Raft and Recreational Boat Targets

    Science.gov (United States)

    1987-12-01

    East Vivant (Facility No. 9216) Jade East (Facility No. 6117) Skippers II (Facility No. 6104) Lady Irene (Facility No. 9204) Pete’s Pride (Facility No...fiberglass 25 x 8.2 x 6 Vivant Albin 27 trawler fiberglass 27 x 10 x 9 R/V Oceaneer Long Line trawler fiberglass 34 x 13 x 7.5 Jade East Sail Cutter...Too III 5:1 = CG 252501 6 = Vivant 7 = Oceaneer 8 = Jade East 9 = Skippers U 10 = Lady Irene 11 = Pete’s Pride 12 =CG 41341 2. AN/APS-131 Side Looking

  12. Serum metabonomics study of anti-depressive effect of Xiao-Chai-Hu-Tang on rat model of chronic unpredictable mild stress.

    Science.gov (United States)

    Xiong, Zhili; Yang, Jie; Huang, Yue; Zhang, Kuo; Bo, Yunhai; Lu, Xiumei; Su, Guangyue; Ma, Jie; Yang, Jingyu; Zhao, Longshan; Wu, Chunfu

    2016-09-01

    Xiao-Chai-Hu-Tang (XCHT) has been proven to be effective for the clinical treatment of depression. However, the mechanisms of definite antidepressant-like effects and detailed metabolic biomarkers were still unclear in this prior study. Here, we have investigated the metabolic profiles and potential biomarkers in a chronic unpredictable mild stress model after treatment with XCHT. Metabonomics based on ultra-high performance liquid chromatography coupled with mass spectrometry was used to profile the metabolic fingerprints of serum obtained from a rat model with chronic unpredictable mild stress with and without XCHT treatment. The model rats showed a significant decrease in sucrose preference and food consumption, and these depression-like symptoms were significantly improved by XCHT. Through principal component analysis (PCA), nine potential biomarkers of tryptophan, uric acid, phenylalanine, cholic acid and lysophosphatidylcholine (C18:0 LPC, C16:0 LPC, C16:1 LPC, C18:1 LPC, C20:4 LPC) were characterized as potential biomarkers involved the pathogenesis of depression. The therapeutic effect of XCHT on depression may involve in amino acid metabolism, lipid metabolism, oxidative stress and inflammation response. The present investigation highlights that metabonomics is a valuable tool for studying the essence of depression as well as evaluating the efficacy of the corresponding drug treatment.

  13. Facile Enhancement in CO-Tolerance of a Polymer-Coated Pt Electrocatalyst Supported on Carbon Black: Comparison between Vulcan and Ketjenblack.

    Science.gov (United States)

    Yang, Zehui; Kim, ChaeRin; Hirata, Shinsuke; Fujigaya, Tsuyohiko; Nakashima, Naotoshi

    2015-07-29

    The CO poisoning and low durability of the anode platinum electrocatalyst in the direct methanol fuel cell (DMFC) are the two crucial obstacles of the wide commercialization of the DMFC. In this study, we synthesized two different electrocatalysts using VulcanXC-72R (VC) and Ketjenblack (KB) as the carbon supporting material for the methanol oxidation reaction (MOR) and long-term durability test, in which the carbon supporting materials were wrapped by poly[2,2'-(2,6-pyridine)-5,5'-bibenzimidazole] (PyPBI) before the platinum deposition and the fabricated electrocatalysts were coated by the poly(vinylphosphonic acid) (PVPA) via the base-acid reaction. We have found that the as-prepared KB/PyPBI/Pt/PVPA shows a higher durability (7% loss in ECSA) under the potential cycling from 1.0 to 1.5 V vs. RHE compared to that of the VC/PyPBI/Pt/PVPA, which showed a 20% loss in ECSA after 10 000 cycle-durability test. Meanwhile, the KB/PyPBI/Pt/PVPA shows a higher CO tolerance before and after the durability test compared to that of the VC/PyPBI/Pt/PVPA, especially under very high methanol concentration (4 M and 8 M), which is close to the practical application of the DMFC. The observed higher CO tolerance is due to the higher amount of the PVPA (14.6 wt %) in the KB/PyPBI/Pt/PVPA caused by the higher specific surface area of the KB (1232 m(2)/g) compared to the VC (235 m(2)/g).

  14. Energy restriction affect liver development in Hu sheep ram lambs through Hippo signaling pathway.

    Science.gov (United States)

    Zhang, Ting-Ting; Zhang, Guo-Min; Jin, Yu-Hang; Guo, Yi-Xuan; Wang, Zhen; Fan, Yi-Xuan; El-Samahy, M A; Wang, Feng

    2017-09-02

    This study aimed to evaluate the effects of dietary energy restriction on postnatal liver development in Hu sheep ram lambs. A total of 16 ram lambs were randomly divided into two groups: 100% energy requirements diet and 55% energy requirements diet, which were fed for 75 d. Results showed that the final body and liver weights decreased with energy restriction (p Energy restriction caused a significant decrease in the levels of circulating insulin-like growth factor 1 (IGF1) and an increase in growth hormone secretion (p energy restriction, respectively (p energy restriction group (p energy restriction group (p energy restriction in ram lambs impairs liver development by increasing apoptosis, which may occur via the Hippo signaling pathway. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Flight Testing Surfaces Engineered for Mitigating Insect Adhesion on a Falcon HU-25C

    Science.gov (United States)

    Shanahan, Michelle; Wohl, Chris J.; Smith, Joseph G., Jr.; Connell, John W.; Siochi, Emilie J.; Doss, Jereme R.; Penner, Ronald K.

    2015-01-01

    Insect residue contamination on aircraft wings can decrease fuel efficiency in aircraft designed for natural laminar flow. Insect residues can cause a premature transition to turbulent flow, increasing fuel burn and making the aircraft less environmentally friendly. Surfaces, designed to minimize insect residue adhesion, were evaluated through flight testing on a Falcon HU-25C aircraft flown along the coast of Virginia and North Carolina. The surfaces were affixed to the wing leading edge and the aircraft remained at altitudes lower than 1000 feet throughout the flight to assure high insect density. The number of strikes on the engineered surfaces was compared to, and found to be lower than, untreated aluminum control surfaces flown concurrently. Optical profilometry was used to determine insect residue height and areal coverage. Differences in results between flight and laboratory tests suggest the importance of testing in realistic use environments to evaluate the effectiveness of engineered surface designs.

  16. The Curious Case of HU Aquarii - Dynamically Testing Proposed Planetary Systems

    CERN Document Server

    Horner, Jonathan; Marshall, Jonathan P; Tinney, Chris G; Butters, Oliver W

    2012-01-01

    In early 2011, the discovery of two planets moving on surprisingly extreme orbits around the eclipsing polar cataclysmic variable system HU Aquraii was announced based on variations in the timing of mutual eclipses between the two central stars. We perform a detailed dynamical analysis of the stability of the exoplanet system as proposed in that work, revealing that it is simply dynamically unfeasible. We then apply the latest rigorous methods used by the Anglo-Australian Planet Search to analyse radial velocity data to re-examine the data used to make the initial claim. Using that data, we arrive at a significantly different orbital solution for the proposed planets, which we then show through dynamical analysis to be equally unfeasible. Finally, we discuss the need for caution in linking eclipse-timing data for cataclysmic variables to the presence of planets, and suggest a more likely explanation for the observed signal.

  17. Congenital Pelger-Huët anomaly in a Danish/Swedish Farmdog: Case Report

    Directory of Open Access Journals (Sweden)

    Allison Robin W

    2011-03-01

    Full Text Available Abstract A 13 year old Danish/Swedish Farmdog from Denmark was evaluated in a veterinary clinic in Warsaw, Poland for evaluation of an orthopedic problem. Radiographs revealed spondylosis and degenerative vertebral disease, which responded to treatment with anti-inflammatory medications. A predominance of hyposegmented neutrophils and eosinophils containing condensed chromatin and normal cytoplasm were identified on a routine CBC. Follow-up blood film evaluations over the course of 12 months confirmed that the hyposegmented granulocytes persisted. The majority of neutrophils contained Grade 2 nuclei (slightly indented, and the mean nuclear score varied from 1.9 to 2.3. Pelger-Huët anomaly (PHA, presumably congenital, was diagnosed based on persistent hyposegmented granulocytes in the absence of an underlying cause for acquired PHA; genetically related dogs were unavailable for testing to confirm vertical transmission. To the authors' knowledge this is the first report of PHA in a Danish/Swedish Farmdog.

  18. Potential therapeutic use of antibodies directed towards HuIFN-gamma.

    Science.gov (United States)

    Froyen, G; Billiau, A

    1997-01-01

    IFN-gamma is an important regulator of immune responses and inflammation. Studies in animal models of inflammation, autoimmunity, cancer, transplant rejection and delayed-type hypersensitivity have indicated that administration of antibodies against IFN-gamma can prevent the occurrence of diseases or alleviate disease manifestations. Therefore, it is speculated that such antibodies may have therapeutical efficacy in human diseases. Since animal-derived antibodies are immunogenic in patients several strategies are being developed in order to reduce or abolish this human anti-mouse antibody (HAMA) response. In our laboratory, we have constructed a single-chain variable fragment (scFv) derived from a mouse antibody with neutralizing potential for human IFN-gamma. A scFv consists of only variable domains tethered together by a flexible linker. The scFv was demonstrated to neutralize the antiviral activity of HuIFN-gamma in vitro and therefore might be considered as a candidate for human therapy.

  19. La voz y la letra en "Un huésped", de Yoko Tawada

    Directory of Open Access Journals (Sweden)

    María Lucía Correa

    2009-05-01

    Full Text Available Los textos de Yoko Tawada, escritorajaponesa residente en Alemania,hacen presente el desgarramientode quien vive fuera de la lenguamaterna. Es una obra que se balanceasobre el límite entre loscódigos, donde nada hay evidente,donde la palabra parece tener vidapropia. Entre los textos que tomanesta extrañeza del lenguaje comosustrato, se encuentra el relato"Un huésped", cuya particular referenciaa la voz y a la letra comodos registros que se entrelazan yse repelen alternativamente, loconvierte en una valiosa fuente dereflexiones sobre lo oral, la voz, laletra, la lectura y la escritura.Palabras clave: Yoko Tawada, literaturajaponesa contemporánea, voz,letra, escritura.

  20. The SCID-hu mouse as a tool in immunotoxicological risk assessment: Effects of 2-acetyl-4(5)-tetrahydroxybutyl-imidazole (THI) and di-n-butyltin dichloride (DBTC) on the human thymus in SCID-hu mice

    NARCIS (Netherlands)

    Heer, C. de; Schuurman, H.J.; Houben, G.F.; Pieters, R.H.H.; Penninks, A.H.; Loveren, H. van

    1995-01-01

    SCID mice engrafted with human fetal thymus and liver tissue fragments (SCID-hu mice) are currently considered as a new tool in human immunotoxicological risk assessment. Testing of various immunotoxicants exerting thymotoxicity via different intrathymic target cell types is necessary for validation

  1. The complete chloroplast genome sequence of the relict woody plant Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Chen, Jinhui; Hao, Zhaodong; Xu, Haibin; Yang, Liming; Liu, Guangxin; Sheng, Yu; Zheng, Chen; Zheng, Weiwei; Cheng, Tielong; Shi, Jisen

    2015-01-01

    Metasequoia glyptostroboides Hu et Cheng is the only species in the genus Metasequoia Miki ex Hu et Cheng, which belongs to the Cupressaceae family. There were around 10 species in the Metasequoia genus, which were widely spread across the Northern Hemisphere during the Cretaceous of the Mesozoic and in the Cenozoic. M. glyptostroboides is the only remaining representative of this genus. Here, we report the complete chloroplast (cp) genome sequence and the cp genomic features of M. glyptostroboides. The M. glyptostroboides cp genome is 131,887 bp in length, with a total of 117 genes comprised of 82 protein-coding genes, 31 tRNA genes and four rRNA genes. In this genome, 11 forward repeats, nine palindromic repeats, and 15 tandem repeats were detected. A total of 188 perfect microsatellites were detected through simple sequence repeat (SSR) analysis and these were distributed unevenly within the cp genome. Comparison of the cp genome structure and gene order to those of several other land plants indicated that a copy of the inverted repeat (IR) region, which was found to be IR region A (IRA), was lost in the M. glyptostroboides cp genome. The five most divergent and five most conserved genes were determined and further phylogenetic analysis was performed among plant species, especially for related species in conifers. Finally, phylogenetic analysis demonstrated that M. glyptostroboides is a sister species to Cryptomeria japonica (L. F.) D. Don and to Taiwania cryptomerioides Hayata. The complete cp genome sequence information of M. glyptostroboides will be great helpful for further investigations of this endemic relict woody plant and for in-depth understanding of the evolutionary history of the coniferous cp genomes, especially for the position of M. glyptostroboides in plant systematics and evolution.

  2. Facile preparation of well-dispersed CeO2-ZnO composite hollow microspheres with enhanced catalytic activity for CO oxidation.

    Science.gov (United States)

    Xie, Qingshui; Zhao, Yue; Guo, Huizhang; Lu, Aolin; Zhang, Xiangxin; Wang, Laisen; Chen, Ming-Shu; Peng, Dong-Liang

    2014-01-08

    In this article, well-dispersed CeO2-ZnO composite hollow microspheres have been fabricated through a simple chemical reaction followed by annealing treatment. Amorphous zinc-cerium citrate hollow microspheres were first synthesized by dispersing zinc citrate hollow microspheres into cerium nitrate solution and then aging at room temperature for 1 h. By calcining the as-produced zinc-cerium citrate hollow microspheres at 500 °C for 2 h, CeO2-ZnO composite hollow microspheres with homogeneous composition distribution could be harvested for the first time. The resulting CeO2-ZnO composite hollow microspheres exhibit enhanced activity for CO oxidation compared with CeO2 and ZnO, which is due to well-dispersed small CeO2 particles on the surface of ZnO hollow microspheres and strong interaction between CeO2 and ZnO. Moreover, when Au nanoparticles are deposited on the surface of the CeO2-ZnO composite hollow microspheres, the full CO conversion temperature of the as-produced 1.0 wt % Au-CeO2-ZnO composites reduces from 300 to 60 °C in comparison with CeO2-ZnO composites. The significantly improved catalytic activity may be ascribed to the strong synergistic interplay between Au nanoparticles and CeO2-ZnO composites.

  3. Facile synthesis of multi-shell structured binary metal oxide powders with a Ni/Co mole ratio of 1:2 for Li-Ion batteries

    Science.gov (United States)

    Choi, Seung Ho; Park, Sun Kyu; Lee, Jung-Kul; Kang, Yun Chan

    2015-06-01

    Multi-shell structured binary transition metal oxide powders with a Ni/Co mole ratio of 1:2 are prepared by a simple spray drying process. Precursor powder particles prepared by spray drying from a spray solution of citric acid and ethylene glycol have completely spherical shape, fine size, and a narrow size distribution. The precursor powders turn into multi-shell powders after a post heat-treatment at temperatures between 250 and 800 °C. The multi-shell structured powders are formed by repeated combustion and contraction processes. The multi-shell powders have mixed crystal structures of Ni1-xCo2O4-x and NiO phases regardless of the post-treatment temperature. The reversible capacities of the powders post-treated at 250, 400, 600, and 800 °C after 100 cycles are 584, 913, 808, and 481 mA h g-1, respectively. The low charge transfer resistance and high lithium ion diffusion rate of the multi-shell powders post-treated at 400 °C with optimum grain size result in superior electrochemical properties even at high current densities.

  4. A facile in situ synthesis route for CuInS(2) quantum-dots/In(2)S(3) co-sensitized photoanodes with high photoelectric performance.

    Science.gov (United States)

    Wang, Yuan-Qiang; Rui, Yi-Chuan; Zhang, Qing-Hong; Li, Yao-Gang; Wang, Hong-Zhi

    2013-11-27

    CuInS2 quantum-dot sensitized TiO2 photoanodes with In2S3 buffer layer were in situ prepared via chemical bath deposition of In2S3, where the Cd-free In2S3 layer then reacted with TiO2/CuxS which employed a facile SILAR process to deposit CuxS quantum dots on TiO2 film, followed by a covering process with ZnS layer. Polysulfide electrolyte and Cu2S on FTO glass counter electrode were used to provide higher photovoltaic performance of the constructed devices. The characteristics of the quantum dots sensitized solar cells were studied in more detail by optical measurements, photocurrent-voltage performance measurements, and impedance spectroscopy. On the basis of optimal CuxS SILAR cycles, the best photovoltaic performance with power conversion efficiency (η) of 1.62% (Jsc = 6.49 mA cm(-2), Voc = 0.50 V, FF = 0.50) under full one-sun illumination was achieved by using Cu2S counter electrode. Cu2S-FTO electrode exhibits superior electrocatalytic ability for the polysulfide redox reactions relative to that of Pt-FTO electrode.

  5. The photosynthetic acclimation response of Lolium perenne to four years growth in a free-air CO{sub 2} enrichment (FACE) facility

    Energy Technology Data Exchange (ETDEWEB)

    Creasey, R. [Univ. of Essex (United Kingdom)

    1996-11-01

    In this study, the photosynthetic responses of field grown Lolium perenne to ambient (354 {mu}mol mol{sup -1}) and elevated (600 {mu}mol mol{sup -1}) C{sub a} were measured. The experiment utilized the FACE facility at Eschikon, Switzerland; here the L. Perenne swards had been grown at two nitrogen treatments, with six cuts per year, for 4 years. The study revealed a significant decrease in Rubisco activity (Vcmax) in the low nitrogen FACE plots; this is consistent with the theories of source-sink imbalance resulting in feedback inhibition and down-regulation. Such negative acclimation was not wholly supported by diurnal investigations which revealed an average stimulation of 53.38% and 52.78% in the low and high nitrogen, respectively. However, light response curves and AI investigations also suggested down-regulation, especially in the low nitrogen. SI is expected to decrease in response to elevated C{sub a}, if any change is seen. This was indeed observed in the high nitrogen plots but for the low nitrogen a significant increase was found. Conclusions drawn from this project center around the implications of negative acclimation to future crop productivity. For instance, inter-specific differences in response to elevated C{sub a} may result in ecosystem changes and new management techniques may be necessary. However, real predictions cannot be made from leaf level studies alone as these may not represent the overall changes at the whole plant level.

  6. Antidepressant effects of curcumin and HU-211 coencapsulated solid lipid nanoparticles against corticosterone-induced cellular and animal models of major depression

    Science.gov (United States)

    He, Xiaolie; Zhu, Yanjing; Wang, Mei; Jing, Guoxin; Zhu, Rongrong; Wang, Shilong

    2016-01-01

    Major depression is a complex neuropsychiatric disorder with few treatment approaches. The use of nontargeted antidepressants induced many side effects with their low efficacy. A more precise targeting strategy is to develop nanotechnology-based drug delivery systems; hence, we employed solid lipid nanoparticles (SLNs) to encapsulate HU-211 and curcumin (Cur). The antidepressant effects of the dual-drug nanoparticles (Cur/SLNs-HU-211) for major depression treatment were investigated in corticosterone-induced cellular and animal models of major depression. Cur/SLNs-HU-211 can effectively protect PC12 cells from corticosterone-induced apoptosis and can release more dopamine, which may be associated with the higher uptake of Cur/SLNs-HU-211 shown by cellular uptake behavior analysis. Additionally, Cur/SLNs-HU-211 significantly reduced the immobility time in forced swim test, enhanced fall latency in rotarod test, and improved the level of dopamine in mice blood. Cur/SLNs-HU-211 can deliver more Cur to the brain and thus produce a significant increase in neurotransmitters level in brain tissue, especially in the hippocampus and striatum. The results of Western blot and immunofluorescence revealed that Cur/SLNs-HU-211 can significantly enhance the expression of CB1, p-MEK1, and p-ERK1/2. Our study suggests that Cur/SLNs-HU-211 may have great potential for major depression treatment. PMID:27757031

  7. Facile fabrication of all-solid-state SnO2/NiCo2O4 biosensor for self-powered glucose detection

    Science.gov (United States)

    Cai, Bin; Mao, Weiwei; Ye, Zhizhen; Huang, Jingyun

    2016-09-01

    With increasing attention on daily diabetes management, we develop an all-solid-state self-powered glucose biosensor, with simultaneous solar energy conversion, electrochemical energy storage and glucose sensing. The SnO2 nanosheet arrays are used to obtain photogenerated electron-hole pairs, and rhombus-shaped NiCo2O4 nanorod arrays are developed for solar energy storage. A stable open circuit voltage ~0.58 V is obtained after being fully charged, which is a suitable voltage for the oxidation of glucose. The biosensor can work under two different modes without any external bias voltage, and both show large linear range and excellent selectivity. Under the sunlight, photocurrent shows a sensitive decrease upon different glucose additions. Meanwhile, in the dark condition, the open circuit voltage of the charged biosensor also exhibits a corresponding response to glucose.

  8. Genetic diversity and population structure in the narrow endemic Chinese walnut Juglans hopeiensis Hu: implications for conservation

    Science.gov (United States)

    Yiheng Hu; Meng Dang; Xiaojia Feng; Keith Woeste; Peng Zhao

    2017-01-01

    The conservation of narrow endemic species relies on accurate information regarding their population structure. Juglans hopeiensis Hu (Ma walnut), found only in Hebei province, Beijing, and Tianjin, China, is a threatened tree species valued commercially for its nut and wood. Sequences of two maternally inherited mitochondrial markers and two...

  9. Budget estimates: Fiscal year 1994. Volume 2: Construction of facilities

    Science.gov (United States)

    1994-01-01

    The Construction of Facilities (CoF) appropriation provides contractual services for the repair, rehabilitation, and modification of existing facilities; the construction of new facilities and the acquisition of related collateral equipment; the acquisition or condemnation of real property; environmental compliance and restoration activities; the design of facilities projects; and advanced planning related to future facilities needs. Fiscal year 1994 budget estimates are broken down according to facility location of project and by purpose.

  10. Preparation of AgInS₂ quantum dot/In₂S₃ co-sensitized photoelectrodes by a facile aqueous-phase synthesis route and their photovoltaic performance.

    Science.gov (United States)

    Wang, Yuanqiang; Zhang, Qinghong; Li, Yaogang; Wang, Hongzhi

    2015-04-14

    In an aqueous-phase system, AgInS2 quantum dot (QD) sensitized TiO2 photoanodes were prepared in situ by the reaction of β-In2S3 nanocrystals and as-prepared TiO2/Ag2S-QD electrodes, followed by a covering process with a ZnS passivation layer. A facile successive ionic layer adsorption and reaction (SILAR) method was adopted to obtain TiO2/Ag2S-QD electrodes. β-In2S3 nanocrystals synthesized by the chemical bath deposition (CBD) process serve as the reactant of AgInS2 as well as a buffer layer between the interfaces of TiO2 and AgInS2-QDs. A polysulfide electrolyte and a Pt-coated FTO glass count electrode were used to test the photovoltaic performance of the constructed devices. The characteristics of the sensitized photoelectrodes were studied in more detail by electron microscopy, X-ray techniques, and optical and photoelectric performance measurements. AgInS2 is the main photo-sensitizer for TiO2/AgInS2-QD/In2S3 electrodes and excess In2S3 appears on the surface of the electrodes. Based on the optimal Ag2S SILAR cycle, the best photovoltaic performance of the prepared TiO2/AgInS2-QD/In2S3 electrode with the short-circuit photocurrent density (Jsc) of 7.87 mA cm(-2) and power conversion efficiency (η) of 0.70% under full one-sun illumination was achieved.

  11. The Preliminary Research on Rupture and Factors Affecting Rupturing of the Hoh Sai Hu Segment in Eastern Kunlun

    Institute of Scientific and Technical Information of China (English)

    Bai Yuzhu; Xu Jie; Zhou Qing; Zhou Bengang

    2012-01-01

    On November 14, 2001, an extraordinarily large earthquake (Ms8. 1) occurred on the Hoh Sai Hu segment of the Eastern Kunlun Fault, in the northern Qinghai-Tibetan Plateau. The seismogenic fault, the Hoh Sai Hu segment, is a left-lateral fault with a high slip rate in geological history, with the average slip rate reaching( 14. 8± 2. 8)mm/a since the late Pleistocene. Different slip rates of the Hoh Sai Hu segment can affect fault motion in the future. Therefore, this paper analyzes the effect of different slip rates and different initial friction coefficients on the fault plane of the Hoh Sai Hu segment of the eastern Kunlun Fault on the rupture behaviors of the fault. In this research, we apply the single degree of spring block model controlled by the rate- and state-dependent frictional constitutive laws. Using the fault dislocation model and based on ancient earthquake research, historical earthquakes data and the achievements of previous researchers, we obtained the parameters of this model. Through numerical simulation of the rupturing motion of the Hoh Sai Hu segment in the next 6500 years under different slip rates, we find that a faster annual slip rate will shorten the recurrence interval of the earthquake. For example, the earthquake recurrence interval is 2100a at a slip rate of 0. 014m/a, which agrees with previous research, but, the recurrence interval will be 1000 - 1500a and 2100 - 2500a, corresponding to the slip rates of 0. 018m/a and 0. 008m/a, respectively. The fault slip rate has no regular effect on the coseismic slip rate and fault displacement in an earthquake. The initial friction coefficient on the fault surface has an effect on the earthquake recurrence interval. A smaller initial friction coefficient will lengthen the earthquake recurrence interval. At the same time, the smaller initial friction coefficient will lead to larger slip rates and fault displacement when earthquakes occur.

  12. Striatal synaptic dysfunction and hippocampal plasticity deficits in the Hu97/18 mouse model of Huntington disease.

    Directory of Open Access Journals (Sweden)

    Karolina Kolodziejczyk

    Full Text Available Huntington disease (HD is a fatal neurodegenerative disorder caused by a CAG repeat expansion in the gene (HTT encoding the huntingtin protein (HTT. This mutation leads to multiple cellular and synaptic alterations that are mimicked in many current HD animal models. However, the most commonly used, well-characterized HD models do not accurately reproduce the genetics of human disease. Recently, a new 'humanized' mouse model, termed Hu97/18, has been developed that genetically recapitulates human HD, including two human HTT alleles, no mouse Hdh alleles and heterozygosity of the HD mutation. Previously, behavioral and neuropathological testing in Hu97/18 mice revealed many features of HD, yet no electrophysiological measures were employed to investigate possible synaptic alterations. Here, we describe electrophysiological changes in the striatum and hippocampus of the Hu97/18 mice. At 9 months of age, a stage when cognitive deficits are fully developed and motor dysfunction is also evident, Hu97/18 striatal spiny projection neurons (SPNs exhibited small changes in membrane properties and lower amplitude and frequency of spontaneous excitatory postsynaptic currents (sEPSCs; however, release probability from presynaptic terminals was unaltered. Strikingly, these mice also exhibited a profound deficiency in long-term potentiation (LTP at CA3-to-CA1 synapses. In contrast, at 6 months of age we found only subtle alterations in SPN synaptic transmission, while 3-month old animals did not display any electrophysiologically detectable changes in the striatum and CA1 LTP was intact. Together, these data reveal robust, progressive deficits in synaptic function and plasticity in Hu97/18 mice, consistent with previously reported behavioral abnormalities, and suggest an optimal age (9 months for future electrophysiological assessment in preclinical studies of HD.

  13. Alternativa terapeutica en la isquemia cerebral empleando la Eritropoyetina humana recombinante (rHu-EPO CIM como neuroprotector.

    Directory of Open Access Journals (Sweden)

    Iliana Sosa Testé

    2005-01-01

    Full Text Available Las enfermedades vasculares constituyen las terceras causas de muerte en Cuba. Su variante isquémica es causa de invalidez y perdida de la calidad de la vida. La búsqueda de agentes neuroprotectores es muy importante sí tenemos en cuenta que nuestra población está envejecida. Muchos son las razones por la que una molécula con propiedades neuroprotectoras en los modelos animales no tenga los resultados en ensayos clínicos en humanos. Este trabajo analiza y discute como mejorar estos aspectos. La Eritropoyetina humana recombinante (rHu EPO, conocido por su papel en la diferenciación del eritrocito, ha mostrado ser neuroprotector durante la isquemia cerebral en los modelos de animales adultos. De esta molécula se exponen los mecanismos de acción, que son las bases de los resultados positivos alcanzaron en las investigaciones preclínicas y los ensayos clínicos, que lo proponen como el neuroprotector ideal. Finalmente se comparan los resultados alcanzados por los autores en las investigaciones con la rHu EPO producida por el Centro Molecular de Inmunología de Cuba (CIM. El efecto de la aplicación de rHu EPO se evidenció por la disminución del edema cerebral, preservación de la conducta exploratoria y la disminución de la incidencia de señales clínicas de infarto cerebral y alteraciones patológicas. El grupo de resultados demostró las diferencias significantes entre los animales controles y tratados con el rHu EPO con los no tratados que sugieren que el rHu EPO debe ser considerado como una alternativa terapéutica contra el infarto cerebral en su fase aguda.

  14. A novel high throughput biochemical assay to evaluate the HuR protein-RNA complex formation.

    Directory of Open Access Journals (Sweden)

    Vito G D'Agostino

    Full Text Available The RNA binding protein HuR/ELAVL1 binds to AU-rich elements (AREs promoting the stabilization and translation of a number of mRNAs into the cytoplasm, dictating their fate. We applied the AlphaScreen technology using purified human HuR protein, expressed in a mammalian cell-based system, to characterize in vitro its binding performance towards a ssRNA probe whose sequence corresponds to the are present in TNFα 3' untranslated region. We optimized the method to titrate ligands and analyzed the kinetic in saturation binding and time course experiments, including competition assays. The method revealed to be a successful tool for determination of HuR binding kinetic parameters in the nanomolar range, with calculated Kd of 2.5±0.60 nM, k on of 2.76±0.56*10(6 M(-1 min(-1, and k off of 0.007±0.005 min(-1. We also tested the HuR-RNA complex formation by fluorescent probe-based RNA-EMSA. Moreover, in a 384-well plate format we obtained a Z-factor of 0.84 and an averaged coefficient of variation between controls of 8%, indicating that this biochemical assay fulfills criteria of robustness for a targeted screening approach. After a screening with 2000 small molecules and secondary verification with RNA-EMSA we identified mitoxantrone as an interfering compound with rHuR and TNFα probe complex formation. Notably, this tool has a large versatility and could be applied to other RNA Binding Proteins recognizing different RNA, DNA, or protein species. In addition, it opens new perspectives in the identification of small-molecule modulators of RNA binding proteins activity.

  15. Asian Facilities

    Science.gov (United States)

    Nakahata, M.

    2011-04-01

    Asian underground facilities are reviewed. The YangYang underground Laboratory in Korea and the Kamioka observatory in Japan are operational and several astrophysical experiments are running. Indian Neutrino Observatory(INO) and China JinPing Underground Laboratory (CJPL) are under construction and underground experiments are being prepared. Current activities and future prospects at those underground sites are described.

  16. Immunoblot profiles of sera from laboratory rats naturally infected with Mycoplasma pulmonis and technicians exposed to infected animal facilities Imunoeletroforese do soro de ratos naturalmente infectados com Mycoplasma pulmonis e bioteristas expostos a biotérios infectados

    Directory of Open Access Journals (Sweden)

    Márcio Oliveira Delgado

    2001-12-01

    Full Text Available Mycoplasma pulmonis have been isolated in about 10(5 CFU/mL from tracheal aspirates of rats from conventional animal facilities in São Paulo. The mycoplasma transmission by aerosol may happen from an infected rat to a healthy one at distances up to 120 cm. This condition also favors the technicians contamination. As this infection is unknown in humans, in this study the immunoblot profiles to M. pulmonis of sera from rats were compared to those presented by animal facility technicians. About 32 proteins from 11 to 230 kDa (kilodaltons were recognized by the sera from rats naturally infected with M. pulmonis. Sera from technicians responsible for the cleaning and sanitation of cages of infected animals for more than seven years recognized about 10 proteins of this bacteria. Sera from individuals with shorter working time or that had never been exposed to such environment recognized few proteins. Proteins about 117 and 95 kDa were recognized by human and rat sera and by the negative controls. Although a positive human serum against M. pulmonis is unknown, this study established a temporary profile of protein recognition of human serum against such mycoplasma.Mycoplasma pulmonis foi isolado em aproximadamente 10(5 UFC/mL do lavado traqueal de ratos mantidos em biotérios convencionais da cidade de São Paulo. A transmissão do micoplasma por aerossol pode ocorrer entre os animais em até 120 cm. Esta condição favorece a sua transmissão para os bioteristas que também são expostos a este microrganismo. Como esta colonização é desconhecida em humanos, as imunoeletroforeses dos soros destes indivíduos foram comparados à com os dos ratos. Aproximadamente 32 proteínas de 11 a 230 kDa foram reconhecidas pelo soros dos ratos naturalmente infectados com M. pulmonis. Os soros dos bioteristas que estão envolvidos por mais de 7 anos na higenização das caixas com animais infectados reconheceram cerca de 10 proteínas deste microrganismo. O soro

  17. Facile Synthesis of Magnetic Copolymer Microspheres Based on Poly(glycidyl methacrylate-co-N-isopropylacrylamide/Fe3O4 by Suspension Photopolymerization

    Directory of Open Access Journals (Sweden)

    Siti Zulaikha Mazlan

    2014-01-01

    Full Text Available Magnetic copolymer based on poly(glycidyl methacrylate-co-N-isopropylacrylamide microspheres was prepared by 2,2-dimethoxy-2-phenylacetophenone- (DMPP- photo initiated and poly(vinyl alcohol- (PVA- stabilized single step suspension photopolymerization. The effect of chemical interaction, morphology, and thermal properties by adding 0.1% w/v Fe3O4 in the copolymer was investigated. Infrared analysis (FTIR showed that (C=C band disappeared after copolymerization, indicating that the magnetic copolymer microspheres were successfully synthesized and two important bands at 908 cm−1 and 1550 cm−1 appear. These are associated with the epoxy group stretching of GMA and secondary amide (N–H/C–H deformation vibration of NIPAAm in magnetic microspheres. The X-ray diffraction (XRD result proved the incorporation of Fe3O4 nanoparticles with copolymer microspheres as peak of Fe3O4 was observed. Morphology study revealed that magnetic copolymer exhibited uniform spheres and smoother appearance when entrapped with Fe3O4 nanoparticles. The lowest percentage of Fe3O4 nanoparticles leached from the copolymer microspheres was obtained at pH 7. Finally, thermal property of the copolymer microspheres was improved by adding a small amount of Fe3O4 nanoparticles that has been shown from the thermogram.

  18. Facile synthesis of Co(II) and Cu(II) complexes of 2-hydroxybenzophenone: An efficient catalyst for oxidation of olefins and DFT study

    Science.gov (United States)

    Lashanizadegan, Maryam; Alavijeh, Roya Karimi; Anafcheh, Maryam

    2017-10-01

    Two diketone complexes of Cu(II) and Co(II) were easily synthesized in reaction of M(CH3COO)2 with 2-Hydroxybenzophenone (bpoH). The complexes of M(bpo)2 were characterized by UV-vis, IR spectroscopy, and elemental analysis. The complexes are active catalysts for the oxidation of styrene using TBHP as an oxidant. Under the optimized reaction conditions, 100% conversion of styrene with 63.5% selectivity for Benzaldehyde and 36.5% for Styrene oxide were obtained by Cu(bpo)2. Also, the effect of imidazole was investigated. Results confirmed that the addition of imidazole accelerates the oxidation of styrene. Our DFT results confirmed the necessity of diffuse functions in the basis set and including an accurate treatment of the dispersion energy for obtaining the most stable structure in these systems. Therefore, the geometry optimization and the vibrational frequencies were calculated at the M06-2X/6-311++G(d,p) level. The scaled theoretical frequencies and the structural parameters are in excellent agreement with the experimental data. The natural charge analysis indicated that an electron is transferred from Cu(bpo)2 back to the TBHP to break the Osbnd O bond and formation of tert-butoxyl radicals. Coordination of imidazole in the axial position of the Cu(bpo)2 significantly assists in moving back of electron and increases the activity of the complex in oxidation.

  19. Ultrasound-assisted facile synthesis of a new tantalum(V) metal-organic framework nanostructure: Design, characterization, systematic study, and CO2 adsorption performance

    Science.gov (United States)

    Sargazi, Ghasem; Afzali, Daryoush; Mostafavi, Ali; Ebrahimipour, S. Yousef

    2017-06-01

    This work presents a fast route for the preparation of a new Ta(V) metal-organic framework nanostructure with high surface area, significant porosity, and small size distribution. X-ray diffraction (XRD), scanning electron microscopy (SEM), Transition electron microscopy (TEM), energy dispersive spectrometer (EDS), thermo-gravimetric analysis (TGA), differential scanning calorimetry (DSC), fourier transform infrared spectroscopy (FTIR), CHNS/O elemental analyser, and Brunauer-Emmett-Teller (BET) surface area analysis were applied to characterize the synthesized product. Moreover, the influences of ultrasonic irradiation including temperature, time, and power on different features of the final products were systematically studied using 2k-1 factorial design experiments, and the response surface optimization was used for determining the best welding parameter combination. The results obtained from analyses of variances showed that ultrasonic parameters affected the size distribution, thermal behaviour, and surface area of Ta-MOF samples. Based on response surface methodology, Ta-MOF could be obtained with mean diameter of 55 nm, thermal stability of 228 °C, and high surface area of 2100 m2/g. The results revealed that the synthesized products could be utilized in various applications such as a novel candidate for CO2 adsorption.

  20. Facile synthesis of three-dimensional structured carbon fiber-NiCo2O4-Ni(OH)2 high-performance electrode for pseudocapacitors

    Science.gov (United States)

    Li, Wei; Xin, Lipeng; Xu, Xin; Liu, Qida; Zhang, Ming; Ding, Shujiang; Zhao, Mingshu; Lou, Xiaojie

    2015-03-01

    Two-dimensional textured carbon fiber is an excellent electrode material and/or supporting substrate for active materials in fuel cells, batteries, and pseudocapacitors owing to its large surface area, high porosity, ultra-lightness, good electric conductivity, and excellent chemical stability in various liquid electrolytes. And Nickel hydroxide is one of the most promising active materials that have been studied in practical pseudocapacitor applications. Here we report a high-capacitance, flexible and ultra-light composite electrode that combines the advantages of these two materials for pseudocapacitor applications. Electrochemical measurements demonstrate that the 3D hybrid nanostructured carbon fiber-NiCo2O4-Ni(OH)2 composite electrode shows high capacitance, excellent rate capability. To the best of our knowledge, the electrode developed in this work possesses the highest areal capacitance of 6.04 F cm-2 at the current density of 5 mA cm-2 among those employing carbon fiber as the conductor. It still remains 64.23% at 40 mA cm-2. As for the cycling stability, the initial specific capacitance decreases only from 4.56 F cm-2 to 3.35 F cm-2 after 1000 cycles under a current density of 30 mA cm-2.

  1. Nano cube of CaSnO3: Facile and green co-precipitation synthesis, characterization and photocatalytic degradation of dye

    Science.gov (United States)

    Moshtaghi, Saeed; Gholamrezaei, Sousan; Salavati Niasari, Masoud

    2017-04-01

    In this work, nanocubes of CaSnO3 have been prepared by a simple and green co-precipitation method. In this technique, for preparation of calcium stannate, we have used from a complex structure of calcium as a new precursor and the synthesis of CaSnO3 have been done in water as a green solvent. Using of complexing precursors were created a congestion in reaction medium. Different conditions have been studied in synthetic approaches and optimized the effect of different parameters on the morphology of product such as precipitation agent (alkaline), pH, temperature, the rate of stirrer, surfactants and the mole ratio of surfactants for preparation product and obtain the best product in terms of quality and morphology. By using of this CaSnO3, two types of azo dyes (acid blue 92 and acid brown 14) have been degraded at presence of ultraviolet light from aqueous solution. Results display that the powder shows appropriate catalytic behavior for degradation of dyes (77% acid brown 14 and 67% acid black 92). Therefore these nano-cube structures have been used as photocatalysts in presence of UV light for degradation of azo dyes.

  2. Environmental Management Waste Management Facility Waste Lot Profile for the K-770 Scrap Yard Soils and Miscellaneous Debris, East Tennessee Technology Park, Oak Ridge, Tennessee - EMWMF Waste Lot 4.12

    Energy Technology Data Exchange (ETDEWEB)

    Davenport M.

    2009-04-15

    Waste Lot 4.12 consists of approximately 17,500 yd{sup 3} of low-level, radioactively contaminated soil, concrete, and incidental metal and debris generated from remedial actions at the K-770 Scrap Metal Yard and Contaminated Debris Site (the K-770 Scrap Yard) at the East Tennessee Technology Park (ETTP). The excavated soil will be transported by dump truck to the Environmental Management Waste Management Facility (EMWMF). This profile provides project-specific information to demonstrate compliance with Attainment Plan for Risk/Toxicity-based Waste Acceptance Criteria at the Oak Ridge Reservation, Oak Ridge, Tennessee (DOE 2001). The K-770 Scrap Yard is an approximately 36-acre storage area located southwest of the main portion of ETTP, outside the security perimeter fence in the Powerhouse Area adjacent to the Clinch River. The K-770 area was used to store radioactively contaminated or suspected contaminated materials during and previous to the K-25 Site cascade upgrading program. The waste storage facility began operation in the 1960s and is estimated to at one time contain in excess of 40,000 tons of low-level, radioactively contaminated scrap metal. Scrap metal was taken to the site when it was found to contain alpha or beta/gamma activity on the surface or if the scrap metal originated from a process building. The segregated metal debris was removed from the site as part of the K-770 Scrap Removal Action (RA) Project that was completed in fiscal year (FY) 2007 by Bechtel Jacobs Company LLC (BJC). An area of approximately 10 acres is located in EUs 29 and 31 where the scrap was originally located in the 100-year floodplain. In the process of moving the materials around and establishing segregated waste piles above the 100-year floodplain, the footprint of the site was expanded by 10-15 acres in EUs 30 and 32. The area in EUs 29 and 31 that was cleared of metallic debris in the floodplain was sown with grass. The areas in EUs 30 and 32 have some scattered

  3. Site Characterization for CO{sub 2} Storage from Coal-fired Power Facilities in the Black Warrior Basin of Alabama

    Energy Technology Data Exchange (ETDEWEB)

    Clark, Peter; Pashin, Jack; Carlson, Eric; Goodliffe, Andrew; McIntyre-Redden, Marcella; Mann, Steven; Thompson, Mason

    2012-08-31

    Coal-fired power plants produce large quantities of carbon dioxide. In order to mitigate the greenhouse gas emissions from these power plants, it is necessary to separate and store the carbon dioxide. Saline formations provide a potential sink for carbon dioxide and delineating the capacity of the various known saline formations is a key part of building a storage inventory. As part of this effort, a project was undertaken to access the storage capacity of saline reservoirs in the Black Warrior Basin of Alabama. This basin has been a productive oil and gas reservoir that is well characterized to the west of the two major coal-fired power plants that are north of Birmingham. The saline zones were thought to extend as far east as the Sequatchie Anticline which is just east of the power plants. There is no oil or gas production in the area surrounding the power plants so little is known about the formations in that area. A geologic characterization well was drilled on the Gorgas Power Plant site, which is the farthest west of two power plants in the area. The well was planned to be drilled to approximately 8,000 feet, but drilling was halted at approximately 5,000 feet when a prolific freshwater zone was penetrated. During drilling, a complete set of cores through all of the potential injection zones and the seals above these zones were acquired. A complete set of openhole logs were run along with a vertical seismic profile (VSP). Before drilling started two approximately perpendicular seismic lines were run and later correlated with the VSP. While the zones that were expected were found at approximately the predicted depths, the zones that are typically saline through the reservoir were found to be saturated with a light crude oil. Unfortunately, both the porosity and permeability of these zones were small enough that no meaningful hydrocarbon production would be expected even with carbon dioxide flooding. iv While this part of the basin was found to be unsuitable

  4. POWER SYSTEMS DEVELOPMENT FACILITY

    Energy Technology Data Exchange (ETDEWEB)

    Unknown

    2002-05-01

    This report discusses test campaign GCT3 of the Halliburton KBR transport reactor train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The transport reactor is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using one of two possible particulate control devices (PCDs). The transport reactor was operated as a pressurized gasifier during GCT3. GCT3 was planned as a 250-hour test run to commission the loop seal and continue the characterization of the limits of operational parameter variations using a blend of several Powder River Basin coals and Bucyrus limestone from Ohio. The primary test objectives were: (1) Loop Seal Commissioning--Evaluate the operational stability of the loop seal with sand and limestone as a bed material at different solids circulation rates and establish a maximum solids circulation rate through the loop seal with the inert bed. (2) Loop Seal Operations--Evaluate the loop seal operational stability during coal feed operations and establish maximum solids circulation rate. Secondary objectives included the continuation of reactor characterization, including: (1) Operational Stability--Characterize the reactor loop and PCD operations with short-term tests by varying coal feed, air/coal ratio, riser velocity, solids circulation rate, system pressure, and air distribution. (2) Reactor Operations--Study the devolatilization and tar cracking effects from transient conditions during transition from start-up burner to coal. Evaluate the effect of process operations on heat release, heat transfer, and accelerated fuel particle heat-up rates. Study the effect of changes in reactor conditions on transient temperature profiles, pressure balance, and product gas composition. (3) Effects of Reactor Conditions on Syngas Composition--Evaluate the effect of air distribution, steam

  5. A new phantom for image quality, geometric destortion, and HU calibration in MSCT and CBCT

    Science.gov (United States)

    Voigt, Johannes M.; Blendl, Christian; Selbach, Markus; Uphoff, Clemens; Fiebich, Martin

    2012-03-01

    Flat panel cone-beam computed tomography (CBCT) is developing to the state-of-the-art technique in several medical disciplines such as dental and otorhinolaryngological imaging. Dental and otorhinolaryngological CBCT systems offer a variety of different field-of-view sizes from 6.0 to 17.0 cm. Standard phantoms are only designed for the use in multi-slices CT (MSCT) and there is no phantom which provides detail structures for all common characteristic values and Hounsfield calibration. In this study we present a new phantom specially designed for use with MSCT and CBCT systems providing detail structures for MTF, 3D MTF, NPS, SNR, geometric distortion and HU calibration. With this phantom you'll only need one acquisition for image quality investigation and assurance. Materials and methods: The phantom design is shown in figure 1. To investigate the practicability, the phantom was scanned using dedicated MSCT-scanners, 3D C-arms und digital volume tomographs. The acquired axial image stacks were analyzed using a dedicated computer program, which is provided as an ImageJ plugin. The MTF was compared to other methodologies such as a thin wire, a sphere or noise response [10, 13, 14]. The HU values were also computed using other common methods. Results: These results are similar to the results of others studies [10, 13, 14]. The method has proven to be stable and delivers comparable results to other methodologies such as using a thin wire. The NPS was calculated for all materials. Furthermore, CT numbers for all materials were computed and compared to the desired values. The measurement of geometric deformation has proven to be accurate. Conclusion: A unique feature of this phantom is to compute the geometric deformation of the 3D-volume image. This offers the chance to improve accuracy, e.g. in dental implant planning. Another convenient feature is that the phantom needs to be scanned only once with otorhinolaryngological volume tomographs to be fully displayed. It is

  6. {sup 89}Zr-huJ591 immuno-PET imaging in patients with advanced metastatic prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Pandit-Taskar, Neeta; Solomon, Stephen B.; Durack, Jeremy C.; Carrasquillo, Jorge A.; Lefkowitz, Robert A.; Osborne, Joseph R. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); O' Donoghue, Joseph A. [Memorial Sloan Kettering Cancer Center, Department of Medical Physics, New York, NY (United States); Beylergil, Volkan; Ruan, Shutian; Cheal, Sarah M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Lyashchenko, Serge [Memorial Sloan Kettering Cancer Center, Department of Radiochemistry and Molecular Imaging Probes Core, New York, NY (United States); Gonen, Mithat [Memorial Sloan Kettering Cancer Center, Department of Epidemiology and Biostatistics, New York, NY (United States); Lewis, Jason S. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Department of Radiochemistry and Molecular Imaging Probes Core, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Holland, Jason P. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Harvard Medical School, Department of Radiology of Massachusetts General Hospital, Boston, MA (United States); Reuter, Victor E. [Memorial Sloan Kettering Cancer Center, Department of Pathology, New York, NY (United States); Weill Cornell Medical College, Department of Pathology, New York, NY (United States); Loda, Massimo F. [Dana-Farber Cancer Institute, Boston, MA (United States); Broad Institute of Harvard and MIT, Cambridge, MA (United States); Smith-Jones, Peter M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Department of Psychiatry and Behavioral Science of Stony Brook University, Stony Brook, NY (United States); Weber, Wolfgang A.; Larson, Steven M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Bander, Neil H. [Memorial Sloan Kettering Cancer Center, Department of Surgery, New York, NY (United States); Weill Cornell Medical College, Department of Urology, New York, NY (United States); Scher, Howard I.; Morris, Michael J. [Memorial Sloan Kettering Cancer Center, Department of Medicine, New York, NY (United States); Weill Cornell Medical College, Department of Medicine, New York, NY (United States)

    2014-11-15

    Given the bone tropism of prostate cancer, conventional imaging modalities poorly identify or quantify metastatic disease. {sup 89}Zr-huJ591 positron emission tomography (PET) imaging was performed in patients with metastatic prostate cancer to analyze and validate this as an imaging biomarker for metastatic disease. The purpose of this initial study was to assess safety, biodistribution, normal organ dosimetry, and optimal imaging time post-injection for lesion detection. Ten patients with metastatic prostate cancer received 5 mCi of {sup 89}Zr-huJ591. Four whole-body scans with multiple whole-body count rate measurements and serum activity concentration measurements were obtained in all patients. Biodistribution, clearance, and lesion uptake by {sup 89}Zr-huJ591 immuno-PET imaging was analyzed and dosimetry was estimated using MIRD techniques. Initial assessment of lesion targeting of {sup 89}Zr-huJ591 was done. Optimal time for imaging post-injection was determined. The dose was well tolerated with mild chills and rigors seen in two patients. The clearance of {sup 89}Zr-huJ591 from serum was bi-exponential with biological half-lives of 7 ± 4.5 h (range 1.1-14 h) and 62 ± 13 h (range 51-89 h) for initial rapid and later slow phase. Whole-body biological clearance was 219 ± 48 h (range 153-317 h). The mean whole-body and liver residence time was 78.7 and 25.6 h, respectively. Dosimetric estimates to critical organs included liver 7.7 ± 1.5 cGy/mCi, renal cortex 3.5 ± 0.4 cGy/mCi, and bone marrow 1.2 ± 0.2 cGy/mCi. Optimal time for patient imaging after injection was 7 ± 1 days. Lesion targeting of bone or soft tissue was seen in all patients. Biopsies were performed in 8 patients for a total 12 lesions, all of which were histologically confirmed as metastatic prostate cancer. One biopsy-proven lesion was not positive on {sup 89}Zr-huJ591, while the remaining 11 lesions were {sup 89}Zr-huJ591 positive. Two biopsy-positive nodal lesions were noted only on

  7. Phytochemical profile, antioxidant and antimicrobial activity of extracts obtained from erva-mate (Ilex paraguariensis) fruit using compressed propane and supercritical CO2.

    Science.gov (United States)

    Fernandes, Ciro E F; Scapinello, Jaqueline; Bohn, Aline; Boligon, Aline A; Athayde, Margareth L; Magro, Jacir Dall; Palliga, Marshall; Oliveira, J Vladimir; Tres, Marcus V

    2017-01-01

    Traditionally, Ilex paraguariensis leaves are consumed in tea form or as typical drinks like mate and terere, while the fruits are discarded processing and has no commercial value. The aim of this work to evaluate phytochemical properties, total phenolic compounds, antioxidant and antimicrobial activity of extracts of Ilex paraguariensis fruits obtained from supercritical CO2 and compressed propane extraction. The extraction with compressed propane yielded 2.72 wt%, whereas with supercritical CO2 1.51 wt% was obtained. The compound extracted in larger amount by the two extraction solvents was caffeine, 163.28 and 54.17 mg/g by supercritical CO2 and pressurized propane, respectively. The antioxidant activity was more pronounced for the supercritical CO2 extract, with no difference found in terms of minimum inhibitory concentration for Staphylococcus aureus for the two extracts and better results observed for Escherichia coli when using supercritical CO2.

  8. 纳米碳酸钙在PVC型材中应用研究%Application of Nano-Calcium Carbonate (CaCO3) to PVC Profile

    Institute of Scientific and Technical Information of China (English)

    王道俊

    2007-01-01

    研究纳米碳酸钙(CaCO3)在PVC/CPE体系中的应用,讨论了改进前后纳米CaCO3对PVC体系流变行为的影响,并测试了纳米CaCO3对型材性能的影响.结果表明,改进后纳米CaCO3 P100流变性接近生产试样,可用于挤出生产;改进后的纳米CaCO3显著提高了型材的性能,可增韧增强PVC复合体系.

  9. Selective Regulation of Human Immunodeficiency Virus-Infected CD4+ Lymphocytes by a Synthetic Immunomodulator Leads to Potent Virus Suppression In Vitro and in hu-PBL-SCID Mice

    Science.gov (United States)

    Bahr, George M.; Darcissac, Edith C. A.; Castéran, Nathalie; Amiel, Corinne; Cocude, Cécile; Truong, Marie-José; Dewulf, Joëlle; Capron, André; Mouton, Yves

    2001-01-01

    We have previously observed that the synthetic immunomodulator Murabutide inhibits human immunodeficiency virus type 1 (HIV-1) replication at multiple levels in macrophages and dendritic cells. The present study was designed to profile the activity of Murabutide on CD8-depleted phytohemagglutinin-activated lymphocytes from HIV-1-infected subjects and on the outcome of HIV-1 infection in severe combined immunodeficiency mice reconstituted with human peripheral blood leukocytes (hu-PBL-SCID mice). Maintaining cultures of CD8-depleted blasts from 36 patients in the presence of Murabutide produced dramatically reduced levels of viral p24 protein in the supernatants. This activity correlated with reduced viral transcripts and proviral DNA, was evident in cultures harboring R5, X4-R5, or X4 HIV-1 isolates, was not linked to inhibition of cellular DNA synthesis, and did not correlate with β-chemokine release. Moreover, c-myc mRNA expression was down-regulated in Murabutide-treated cells, suggesting potential interference of the immunomodulator with the nuclear transport of viral preintegration complexes. On the other hand, daily treatment of HIV-1-infected hu-PBL-SCID mice with Murabutide significantly reduced the viral loads in plasma and the proviral DNA content in human peritoneal cells. These results are the first to demonstrate that a clinically acceptable synthetic immunomodulator with an ability to enhance the host's nonspecific immune defense mechanisms against infections can directly regulate cellular factors in infected lymphocytes, leading to controlled HIV-1 replication. PMID:11435574

  10. Detection of neutralizing antibodies to erythropoietin by inhibition of rHuEPO-stimulated EGR1 gene expression in the UT-7/EPO cell line.

    Science.gov (United States)

    Ferguson, Jackie; Bird, Chris; Wadhwa, Meenu; Burns, Chris

    2013-01-31