48 CFR 301.603-72 - FAC-C and HHS SAC certification requirements.
2010-10-01
... HUMAN SERVICES GENERAL HHS ACQUISITION REGULATION SYSTEM Career Development, Contracting Authority, and... retention of certification, including the requirement to earn continuous learning points (CLPs). FAC-C... to employees for the first time at a department or agency.) (c) The FAC-C certification is based on...
Gougoulias, Christos; Meade, Andrew; Shaw, Liz J
2018-02-19
An unresolved need in microbial ecology is methodology to enable quantitative analysis of in situ microbial substrate carbon use at the population level. Here, we evaluated if a novel combination of radiocarbon-labelled substrate tracing, fluorescence in situ hybridisation (FISH) and fluorescence-activated cell sorting (FACS) to sort the FISH-targeted population for quantification of incorporated radioactivity ( 14 C-FISH-FACS) can address this need. Our test scenario used FISH probe PSE1284 targeting Pseudomonas spp. (and some Burkholderia spp.) and salicylic acid added to rhizosphere soil. We examined salicylic acid- 14 C fate (mineralized, cell-incorporated, extractable and non-extractable) and mass balance (0-24 h) and show that the PSE1284 population captured ∼ 50% of the Nycodenz extracted biomass 14 C. Analysis of the taxonomic distribution of the salicylic acid biodegradation trait suggested that PSE1284 population success was not due to conservation of this trait but due to competitiveness for the added carbon. Adding 50KBq of 14 C sample -1 enabled detection of 14 C in the sorted population at ∼ 60-600 times background; a sensitivity which demonstrates potential extension to analysis of rarer/less active populations. Given its sensitivity and compatibility with obtaining a C mass balance, 14 C-FISH-FACS allows quantitative dissection of C flow within the microbial biomass that has hitherto not been achieved. © 2018 Society for Applied Microbiology and John Wiley & Sons Ltd.
Effect of Cr content on the FAC of pipe material at 150 .deg. C
International Nuclear Information System (INIS)
Park, Tae Jun; Kim, Hong Pyo
2013-01-01
Flow accelerated corrosion (FAC) of the carbon steel piping in nuclear power plants (NPPs) has been major issue in nuclear industry. During the FAC, a protective oxide layer on carbon steel dissolves into flowing water leading to a thinning of the oxide layer and accelerating corrosion of base material. As a result, severe failures may occur in the piping and equipment of NPPs. Effect of alloying elements on FAC of pipe materials was studied with rotating cylinder FAC test facility at 150 .deg. C and at flow velocity of 4m/s. The facility is equipped with on line monitoring of pH, conductivity, dissolved oxygen(DO) and temperature. Test solution was the demineralized water, and DO concentration was less than 1 ppb. Surface appearance of A 106 Gr. B which is used widely in secondary pipe in NPPs showed orange peel appearance, typical appearance of FAC. The materials with Cr content higher than 0.17wt.% showed pit. The pit is thought to early degradation mode of FAC. The corrosion product within the pit was enriched with Cr, Mo, Cu, Ni and S. But S was not detected in SA336 F22V with 2.25wt.% Cr. The enrichment of Cr and Mo seemed to be related with low, solubility of Cr and Mo compared to Fe. Measured FAC rate was compared with Ducreaux's relationship and showed slightly lower FAC rate than Ducreaux's relationship
Sandwich iridium complexes with the monoanionic carborane ligand [9-SMe2-7,8-C2B9H10]-
International Nuclear Information System (INIS)
Loginov, D.A.; Vinogradov, M.M.; Perekalin, D.S.; Starikova, Z.A.; Lysenko, K.A.; Petrovskij, P.V.; Kudinov, A.R.
2006-01-01
The reaction of the [(η-9-SMe 2 -7,8-C 2 B 9 H 10 )IrBr 2 ] 2 complex with Tl[Tl(η-7,8-C 2 B 9 H 11 )] afforded the iridacarborane compound (η-9-SMe 2 -7,8-C 2 B 9 H 10 )Ir(η-7,8-C 2 B 9 H 11 ). The cationic complex [Cp*Ir(η-9-SMe 2 -7,8-C 2 B 9 H 10 )] + PF 6 - (Cp* is pentamethylcyclopentadienyl) was synthesized by the reaction of [Cp*IrCl 2 ] 2 with Na[9-SMe 2 -7,8-C 2 B 9 H 10 ]. The structures of (η-9-SMe 2 -7,8-C 2 B 9 H 10 )Ir(η-cod) (cod is 1,5-cyclooctadiene) and [Cp*Ir(η-9-SMe 2 -7,8-C 2 B 9 H 10 ]PF 6 were established by X-ray diffraction [ru
Ui, Mihoko; Tanaka, Yoshikazu; Tsumuraya, Takeshi; Fujii, Ikuo; Inoue, Masayuki; Hirama, Masahiro; Tsumoto, Kouhei
2008-07-11
Ciguatoxins are a family of marine toxins composed of transfused polycyclic ethers. It has not yet been clarified at the atomic level on the pathogenic mechanism of these toxins or the interaction between a polycyclic ether compounds and a protein. Using the crystal structures of anti-ciguatoxin antibody 10C9 Fab in ligand-free form and in complexes with ABCD-ring (CTX3C-ABCD) and ABCDE-ring (CTX3C-ABCDE) fragments of the antigen CTX3C at resolutions of 2.6, 2.4, and 2.3 angstroms, respectively, we elucidated the mechanism of the interaction between the polycyclic ethers and the antibody. 10C9 Fab has an extraordinarily large and deep binding pocket at the center of the variable region, where CTX3C-ABCD or CTX3C-ABCDE binds longitudinally in the pocket via hydrogen bonds and van der Waals interactions. Upon antigen-antibody complexation, 10C9 Fab adjusts to the antigen fragments by means of rotational motion in the variable region. In addition, the antigen fragment lacking the E-ring induces a large motion in the constant region. Consequently, the thermostability of 10C9 Fab is enhanced by 10 degrees C upon complexation with CTX3C-ABCDE but not with CTX3C-ABCD. The crystal structures presented in this study also show that 10C9 Fab recoginition of CTX3C antigens requires molecular rearrangements over the entire antibody structure. These results further expand the fundamental understanding of the mechanism by which ladder-like polycyclic ethers are recognized and may be useful for the design of novel therapeutic agents by antibodies, marine toxins, or new diagnostic reagents for the detection and targeting of members of the polycyclic ether family.
46 CFR 151.50-86 - Alkyl (C7-C9) nitrates.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Alkyl (C7-C9) nitrates. 151.50-86 Section 151.50-86... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-86 Alkyl (C7-C9) nitrates. (a) The carriage temperature of octyl nitrates must be maintained below 100 °C (212 °F) in order to...
46 CFR 153.560 - Special requirements for Alkyl (C7-C9) nitrates.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Special requirements for Alkyl (C7-C9) nitrates. 153.560... Equipment Special Requirements § 153.560 Special requirements for Alkyl (C7-C9) nitrates. (a) The carriage temperature of octyl nitrates must be maintained below 100 °C (212 °F) in order to prevent the occurrence of a...
International Nuclear Information System (INIS)
Polyanskaya, T.M.
2006-01-01
A monocrystal X-ray diffraction study of a new iodine-containing cluster compound 9-(pyridine)-11-iodo-decahydro-7,8-dicarba-nido-undecaborane [9-C 5 H 5 N-11-I-7,8-C 2 B 9 H 10 ] has been performed. Crystal data: C 7 H 15 B 9 NI, M = 337.39, monoclinic, space group P2 1 /c, unit cell parameters: a=9.348(1) A, b=11.159(1) A, c=13.442(2) A, β=98.13(1) deg, V=1388.1(5) A 3 , Z=4, d calc = 1.614 g/cm 3 , T = 295 K, F(000)=648, μ=2.276 mm -1 . The structure was solved by a direct method and refined in the full-matrix anisotropic approximation (isotropic for hydrogen atoms) to final agreement factors R 1 = 0.0254, wR 2 = 0.0454 for 2437 I hkl >2σ I from 3590 measured I hkl (an Enraf-Nonius CAD-4 diffractometer, λMoK α , graphite monochromator, θ/2θ-scanning). The molecules are joined into a supramolecular assembly by hydrogen bonds X-H...I (X = B, C) [ru
Synthesis of iridacarborane halide complexes [(η-9-SMe2-7,8-C2B9H10)IrX2]2 (X=Cl, Br, I)
International Nuclear Information System (INIS)
Kudinov, A.R.; Perekalin, D.S.; Petrovskij, P.V.
2001-01-01
By interaction between Na[9-SMe 2 -7,8-C 2 B 9 H 10 ] and [(Cod)IrCl] 2 (Cod - cycloocta-1,5-diene) iridium complex (η-9-SMe 2 -7,8-C 2 B 9 H 10 )Ir(Cod), which under the action of anhydrous hydrohalogenic acids HX (X=Cl, Br, I) yields iridacarborane halide complexes [(η-9-SMe 2 -7,8-C 2 B 9 H 10 )IrX 2 ] 2 , being analogs of cyclopentadienyl complexes [(C 5 Me 5 )IrX 2 ] 2 . The complexes prepared were characterized on the basis of data of elementary analysis and 1 H, 11 B NMR spectra [ru
Viguri, Maialen Espinal; Pérez, Julio; Riera, Lucía
2014-05-05
A new family of cationic rhenium tricarbonyl complexes with either two N-alkylimidazole (N-RIm) and one pyridine (Py) ligand, or two pyridine and one N-RIm ligand, [Re(CO)3 (N-RIm)(3-x) (Py)x ](+) , has been prepared. The reaction of these complexes with a strong base, followed by an oxidant, selectively afforded 2,2'-pyridylimidazole complexes as the result of intramolecular dehydrogenative CC coupling reactions. For tris(pyridine) complexes [Re(CO)3 (Py)3 ](+) the reaction pattern upon a deprotonation/oxidation sequence is maintained, which allows the generation of complexes with 2,2'-bipyridine ligands. In the particular combination of two different types of pyridine ligand in the cationic fac-Re(CO)3 complexes only the cross-coupling products with asymmetric 2,2'-bipyridine ligands were obtained; the homocoupling products were not observed. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Ye, Y; Duke, C C; Holder, G M
1995-03-01
The hepatic microsomal metabolites of the highly carcinogenic dimethylbenzacridines, 7,9-dimethylbenz[c]acridine (7,9-DMBAC), and 7,10-dimethylbenz[c]acridine (7,10-DMBAC) were obtained with preparations from 3-methylcholanthrene-pretreated rats. Metabolites were separated by reversed-phase HPLC and characterized using UV spectral data and chemical ionization-mass spectrometry after trimethylsilylation and GC. Comparisons with products formed in the presence of the epoxide hydrolase inhibitor, 1,1,1-trichloropropane 2,3-oxide and with those formed from the three synthetic alcohol derivatives of each parent compound, aided the assignment of firm or tentative structures to 16 products from 7,9-DMBAC found in 22 reversed-phase chromatographic peaks, and for 17 products of 7,10-DMBAC found in 19 chromatographic peaks. The more abundant metabolites were derived from oxidation of the methyl groups. Other metabolites were dihydrodiols, epoxides, phenols and secondary metabolites. The 9-methyl group prevented dihydrodiol formation at the 8,9-position from 7,9-DMBAC, and for each carcinogen, the 3,4-dihydrodiol was formed. As well, 3,4-dihydrodiols of methyl oxidized compounds were found.
International Nuclear Information System (INIS)
Adams, R.D.; Golembski, N.M.
1979-01-01
The structures of the compounds (μ-H)(H)Os 3 (CO) 10 (CN-t-C 4 H 9 ) and (μ-H) 2 Os 3 (CO) 9 (CN-t-C 4 H 9 ) have been revealed by x-ray crystallographic techniques. For (μ-H)(H)Os 3 (CO) 10 (CN-t-C 4 H 9 ): a = 9.064 (3), b = 12.225 (3), c = 20.364 (4) A; β = 98.73 (3) 0 ; space group P2 1 /c[C/sub 2h/ 5 ], No. 14; Z = 4; d/sub calcd/ = 2.79 g cm -3 . This compound contains a triangular cluster of three osmium atoms; Os(1)--Os(2) = 2.930 (1) A, Os(1)--Os(3) = 2.876 (1) A, and Os(2)--Os(3) = 3.000 (1) A. There are ten linear terminal carbonyl groups and one linear terminal isocyanide ligand which occupies an axial coordination site. The hydrogen atoms were not observed crystallographically, but their positions are strongly inferred from considerations of molecular geometry. For (μ-H) 2 Os 3 (CO) 9 (CN-t-C 4 H 9 ): a = 15.220 (8), b = 12.093 (6), c = 23.454 (5) A; space group Pbcn [D/sub 2h/ 14 ], No. 60; Z = 8; d/sub calcd/ = 2.79 g cm -3 . The compound is analogous to the parent carbonyl (μ-H) 2 Os 3 (CO) 10 and has two normal and one short osmium--osmium bonds: Os(1)--Os(2) = 2.827 (1) A, Os(1)--Os(3) = 2.828 (1) A, Os(2)--Os(3) = 2.691 (1) A. The isocyanide ligand resides in an equatorial coordination site on osmium Os(2). The hydrogen atoms were not observed but are believed to occupy bridging positions as in the parent carbonyl complex. 2 figures, 7 tables
Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18
Directory of Open Access Journals (Sweden)
R. F. Weiss
2012-05-01
Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.
International Nuclear Information System (INIS)
Adams, R.D.; Golembeski, N.M.
1979-01-01
The crystal and molecular structure of the compound (μ-H)(μ-eta 1 -C==N(H)(t-C 4 H 9 ))Os 3 (CO) 10 has been determined by X-ray crystallographic methods. The compound crystallizes in the centrosymmetric monoclinic space group P2 1 /n[C/sub 2h/ 5 ]:a = 13.651 (4) A, b = 9.156 (4) A, c = 18.275 (5) A, β = 111.42 (2) 0 , V = 2126.3 (25) A 3 , Z = 4, rho/sub calcd/ = 2.92 g cm -3 . A uniform triangular cluster of three osmium atoms contains ten linear carbonyl groups and a μ-eta 1 -C==N(H)(t-C 4 H 9 ) iminyl ligand. The carbon atom of the iminyl ligand symmetrically bridges one osmium-osmium bond, as is shown by the internuclear separations Os(2)-C(11) = 2.066 (8) A and Os(3)-C(11) = 2.043 (8) A. The iminyl bond, C(11)-N, is double with the C-N distance being 1.298 (10) A
J/sub 1c/ fracture toughness transition behavior of HT-9
International Nuclear Information System (INIS)
Huang, F.H.
1984-01-01
Small compact tension specimens of two heats of HT-9 were tested at temperatures ranging from room temperature to -192 0 C. The ductile-brittle transition toughness of HT-9 was evaluated using the J-integral approach. There were two loading rates of 2.1 x 10 -5 m/s and 3.2 x 10 -2 m/s. The ductile-brittle transition temperatures of HT-9 (number 1 heat) tested at 2.1 x 10 -5 m/s and HT-9 (number 2 heat) tested at 3.2 x 10 -2 m/s were found to be -60 and -10 0 C, respectively. Results showed the fracture toughness of the former was not sensitive to loading rate and the lower shelf toughness decreased with temperature to a J/sub 1c/ value of 5 kJ/m 2 at -190 0 C. Furthermore, the values of J/sub 1c/ were valid since the thickness of the test specimens was well above the thickness criterion
Gopalappa, Ramu; Song, Myungjae; Chandrasekaran, Arun Pandian; Das, Soumyadip; Haq, Saba; Koh, Hyun Chul; Ramakrishna, Suresh
2018-05-31
Targeted genome editing by clustered regularly interspaced short palindromic repeats (CRISPR-Cas9) raised concerns over off-target effects. The use of double-nicking strategy using paired Cas9 nickase has been developed to minimize off-target effects. However, it was reported that the efficiency of paired nickases were comparable or lower than that of either corresponding nuclease alone. Recently, we conducted a systematic comparison of the efficiencies of several paired Cas9 with their corresponding Cas9 nucleases and showed that paired D10A Cas9 nickases are sometimes more efficient than individual nucleases for gene disruption. However, sometimes the designed paired Cas9 nickases exhibited significantly lower mutation frequencies than nucleases, hampering the generation of cells containing paired Cas9 nickase-induced mutations. Here we implemented IRES peptide-conjugation of fluorescent protein to Cas9 nickase and subjected for fluorescence-activated cell sorting. The sorted cell populations are highly enriched with cells containing paired Cas9 nickase-induced mutations, by a factor of up to 40-fold as compared with the unsorted population. Furthermore, gene-disrupted single cell clones using paired nickases followed by FACS sorting strategy were generated highly efficiently, without compromising with its low off-target effects. We envision that our fluorescent protein coupled paired nickase-mediated gene disruption, facilitating efficient and highly specific genome editing in medical research.
Synthesis of C-9-14C-1,8-dihydroxy-3-carboxyanthraquinone
International Nuclear Information System (INIS)
De Witte, P.; Lemli, J.
1988-01-01
The synthesis of C-9- 14 C-rhein is reported using 14 CO 2 as a 14 C-source. After preparing 14 C-1, 8-dimethoxy-3-methylanthraquinone by a condensation reaction, the product is demethylated and the 3-methyl group converted to the corresponding 3-carboxy group. The radio-active yield of the total synthesis, starting with 1 Ci 14 CO 2 is 6,9% (6, 9 mCi); 352 mg 14 rhein is produced with a specific activity of 55,7 mCi/mmol. (author)
Is insulin the preferred treatment for HbA1c >9%?
Bloomgarden, Zachary
2017-09-01
The algorithms and guidelines of the American Association of Clinical Endocrinologists and the American Diabetes Association recommend that insulin administration be strongly considered for people with type 2 diabetes (T2D) with HbA1c levels exceeding 9.0% and 10%, respectively. Although the caveat is given in both sets of recommendations that this is particularly appropriate when patients are "symptomatic," referring to urinary frequency with increased thirst and appetite, weight loss, and ketosis, the clinical definition of such presentations may be ill-defined, and it is noteworthy that both documents consider insulin to offer particular benefit under such circumstances. However, with multiple options for glycemic treatment, it is of interest to reconsider this argument for insulin use. It should be recalled that in the UK Prospective Diabetes Study, diet alone was associated with a reduction in HbA1c from 9% to 7%. Drug-naïve people with T2D do often show surprisingly strong reductions in HbA1c with metformin-based dual-agent oral treatment approaches; a recent report showed that even with baseline HbA1c >11%, the combination of metformin with a sulfonylurea, pioglitazone, or sitagliptin was associated with reduction in HbA1c from 11.6% to 6.0%. A 32-week study of the combination of rosiglitazone with metformin in patients with mean baseline HbA1c 8.9% showed a mean HbA1c reduction of 2.3%, and an open-label cohort with baseline HbA1c 11.8% had a reduction in HbA1c to 7.8%. With metformin plus sitagliptin, a mean placebo-adjusted HbA1c reduction of 2.1% from a baseline of 8.8% was reported, with those patients with baseline HbA1c >9% having a 2.6% reduction in HbA1c, and an open-label cohort with baseline HbA1c 11.2% having a 2.9% reduction in HbA1c. Similar 2% HbA1c reductions from baseline levels of 9.1% were seen with metformin in initial combination with the sodium-glucose cotransporter 2 (SGLT2) inhibitor dapagliflozin. Although such dual oral agent
Molecular resonances in sub-Coulomb energy region (12C-12C, 12C-24Mg, 12C-9Be systems)
International Nuclear Information System (INIS)
Takimoto, Kiyohiko; Shimomura, Susumu; Tanaka, Makoto; Murakami, Tetsuya; Fukada, Mamoru; Sakaguchi, Atsushi
1982-01-01
Molecular resonance in sub-Coulomb energy region was studied on 12 C- 12 C, 12 C- 24 Mg and 12 C- 9 Be systems. The excitation functions and the angular distributions were measured on the reactions 12 C( 12 C, 8 Besub(g,s,)) 16 Osub(g,s,), 24 Mg( 12 C, α) 32 S and 9 Be ( 12 C, 8 Besub(g,s,)) 13 Csub(g,s,). Sub-Coulomb resonances were observed in all systems and the contribution of the 12 Csub(2nd)*(0 + , 7.65 MeV) state is proposed. (author)
Elastic scattering of lithium by 9Be, 10B, 12C, 13C, 16O, and 28Si from 4 to 63 MeV
International Nuclear Information System (INIS)
Poling, J.E.; Norbeck, E.; Carlson, R.R.
1976-01-01
Elastic scattering angular distributions have been measured at energies between 4.0 and 13.0 MeV for 6 Li and 7 Li beams and targets of 10 B, 12 C, 13 C, 16 O, and 28 Si. Yield curves have been measured for energies from 3.0 to 13.0 MeV for 6 Li beams and targets of 9 Be, 12 C, 13 C, 16 O, and 28 Si, and for 7 Li and 12 C. The angular distributions, supplemented by published angular distributions, have been fitted with optical-model potentials. For 6 Li+ 12 C, angular distributions were available at energies from 4.5 to 63.0 MeV. Potentials which gave fits to the data across the entire available energy range were obtained for each elastic scattering reaction. The usual ambiguities were observed in the optical-model potentials. In certain cases the back angles were not well fitted by parameter sets which were useful for all energies. The quality of the fits did not seem to be limited by experimental errors, which were generally better than 10% for our data; compound nucleus effects are presumed to be the cause of rapid energy variations in the angular distributions
Neutron flux measurements in C-9 capsule pressure tube
International Nuclear Information System (INIS)
Barbos, D.; Roth, C. S.; Gugiu, D.; Preda, M.
2001-01-01
C-9 capsule is a fuel testing facility in which the testing consists of a daily cycle ranging between the limits 100% power to 50% power. C-9 in-pile section with sample holder an instrumentation are introduced in G-9 and G-10 experimental channels. The experimental fuel channel has a maximum value when the in-pile section (pressure tube) is in G-9 channel and minimum value in G-10 channel. In this paper the main goals are determination or measurements of: - axial thermal neutron flux distribution in C-9 pressure tube both in G-9 and G-10 channel; - ratio of maximum neutron flux value in G-9 and the same value in G-9 channel and the same value in G-10 channel; - neutron flux-spectrum. On the basis of axial neutron flux distribution measurements, the experimental fuel element in sample holder position in set. Both axial neutron flux distribution of thermal neutrons and neutron flux-spectrum were performed using multi- foil activation technique. Activation rates were obtained by absolute measurements of the induced activity using gamma spectroscopy methods. To determine the axial thermal neutron flux distribution in G-9 and G-10, Cu 100% wire was irradiated at the reactor power of 2 MW. Ratio between the two maximum values, in G-9 and G-10 channels, is 2.55. Multi-foil activation method was used for neutron flux spectrum measurements. The neutron spectra and flux were obtained from reaction rate measurements by means of SAND 2 code. To obtain gamma-ray spectra, a HPGe detector connected to a multichannel analyzer was used. The spectrometer is absolute efficiency calibrated. The foils were irradiated at 2 MW reactor power in previously determined maximum flux position resulted from wire measurements. This reaction rates were normalized for 10 MW reactor power. Neutron self shielding corrections for the activation foils were applied. The self-shielding corrections are computed using Monte Carlo simulation methods. The measured integral flux is 1.1·10 14 n/cm 2 s
Unraveling the Role of RNA Mediated Toxicity of C9orf72 Repeats in C9-FTD/ALS
Directory of Open Access Journals (Sweden)
Vijay Kumar
2017-12-01
Full Text Available The most frequent genetic cause of amyotrophic lateral sclerosis (ALS and frontotemporal dementia (FTD is intronic hexanucleotide (G4C2 repeat expansions (HRE in the C9orf72 gene. The non-exclusive pathogenic mechanisms by which C9orf72 repeat expansions contribute to these neurological disorders include loss of C9orf72 function and gain-of-function determined by toxic RNA molecules and dipeptides repeats protein toxicity. The expanded repeats are transcribed bidirectionally and forms RNA foci in the central nervous system, and sequester key RNA-binding proteins (RBPs leading to impairment in RNA processing events. Many studies report widespread transcriptome changes in ALS carrying a C9orf72 repeat expansion. Here we review the contribution of RNA foci interaction with RBPs as well as transcriptome changes involved in the pathogenesis of C9orf72- associated FTD/ALS. These informations are essential to elucidate the pathology and therapeutic intervention of ALS and/or FTD.
40 CFR 721.2088 - Carboxylic acids, (C6-C9) branched and linear.
2010-07-01
... linear. 721.2088 Section 721.2088 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Specific Chemical Substances § 721.2088 Carboxylic acids, (C6-C9) branched and linear. (a) Chemical... as carboxylic acids, (C6-C9) branched and linear (PMNs P-93-313, 314, 315, and 316) are subject to...
International Nuclear Information System (INIS)
Booysen, I.; Gerber, T. I. A.; Hosten, E.; Mayer, P.
2008-01-01
The rhenium(I) compound fac-[Re(CO) 3 (daa)]. Hpab.H 2 O (Hpab N,N'-(l,2-phenylene)bis(2'-aminobenzamide); Hdaa 2-amino-N-(2-aminophenyl)benzamide) was synthesized from the reaction of [Re(CO) 5 ,Br] with two equivalent of Hpab in toluene. The monoanionic tridentate ligand daa was formed by the rhenium-mediated cleavage of an amido N-C bond of the potentially tetradentate ligand Hpab. The compound was characterized by IR spectroscopy and X-ray crystallography, and daa is coordinated as a diamino amide via three nitrogen-donor atoms
DEFF Research Database (Denmark)
Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter
1997-01-01
This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R)-hydroxymethyl-butyrolac......This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...
Metabolism of 7-ethoxycoumarin, flavanone and steroids by cytochrome P450 2C9 variants.
Uno, Tomohide; Nakano, Ryosuke; Kanamaru, Kengo; Takenaka, Shinji; Uno, Yuichi; Imaishi, Hiromasa
2017-11-01
CYP2C9 is a human microsomal cytochrome P450c (CYP). Much of the variation in CYP2C9 levels and activity can be attributed to polymorphisms of this gene. Wild-type CYP2C9 and mutants were coexpressed with NADPH-cytochrome P450 reductase in Escherichia coli. The hydroxylase activities toward 7-ethoxycoumarin, flavanone and steroids were examined. Six CYP2C9 variants showed Soret peaks (450 nm) typical of P450 in reduced CO-difference spectra. CYP2C9.38 had the highest 7-ethoxycoumarin de-ethylase activity. All the CYP2C9 variants showed lower flavanone 6-hydroxylation activities than CYP2C9.1 (the wild-type). CYP2C9.38 showed higher activities in testosterone 6β-hydroxylation, progesterone 6β-/16α-hydroxylation, estrone 11α-hydroxylation and estradiol 6α-hydroxylation than CYP2C9.1. CYP2C9.40 showed higher testosterone 17-oxidase activity than CYP2C9.1; CYP2C9.8 showed higher estrone 16α-hydroxylase activity and CYP2C9.12 showed higher estrone 11α-hydroxylase activity. CYP2C9.9 and CYP2C9.10 showed similar activities to CYP2C9.1. These results indicate that the substrate specificity of CYP2C9.9 and CYP2C9.10 was not changed, but CYP2C9.8, CYP2C9.12 and CYP2C9.40 showed different substrate specificity toward steroids compared with CYP2C9.1; and especially CYP2C9.38 displayed diverse substrate specificities towards 7-ethoxycoumarin and steroids. Copyright © 2017 John Wiley & Sons, Ltd.
Bi, Qi-Rui; Hou, Jin-Jun; Yang, Min; Shen, Yao; Qi, Peng; Feng, Rui-Hong; Dai, Zhuo; Yan, Bing-Peng; Wang, Jian-Wei; Shi, Xiao-Jian; Wu, Wan-Ying; Guo, De-An
2017-03-01
Fatty acids conjugates (FACs) are ubiquitous but found in trace amounts in the natural world. They are composed of multiple unknown substructures and side chains. Thus, FACs are difficult to be analyzed by traditional mass spectrometric methods. In this study, an integrated strategy was developed to global profiling and targeted structure annotation of FACs in complex matrix by LTQ Orbitrap. Dicarboxylic acid conjugated bufotoxins (DACBs) in Venenum bufonis (VB) were used as model compounds. The new strategy (abbreviated as HPNA) combined higher-energy C-trap dissociation (HCD) with product ion- (PI), neutral loss- (NL) based MS n (n ≥ 3) acquisition in both positive-ion mode and negative-ion mode. Several advantages are presented. First, various side chains were found under HCD in negative-ion mode, which included both known and unknown side chains. Second, DACBs with multiple side chains were simultaneously detected in one run. Compared with traditional quadrupole-based mass method, it greatly increased analysis throughput. Third, the fragment ions of side chain and steroids substructure could be obtained by PI- and NL-based MS n acquisition, respectively, which greatly increased the accuracy of the structure annotation of DACBs. In all, 78 DACBs have been discovered, of which 68 were new compounds; 25 types of substructure formulas and seven dicarboxylic acid side chains were found, especially five new side chains, including two saturated dicarboxylic acids [(azelaic acid (C 9 ) and sebacic acid (C 10 )] and three unsaturated dicarboxylic acids (u-C 8 , u-C 9 , and u-C 10 ). All these results greatly enriched the structures of DACBs in VB. Graphical Abstract ᅟ.
Values of Kp Indices, Ap Indices, Cp Indices, C9 Indices, Sunspot Number, and 10.7 cm Flux
National Oceanic and Atmospheric Administration, Department of Commerce — This data file consists of Kp indices, Ap indices, Cp indices, C9 indices, sunspot number, and 10.7 cm flux. The most often requested parameter of this file are the...
Short Intramolecular N–H⋯C(carbonyl Interactions in Mixed-Ligand Molybdenum Hexacarbonyl Derivatives
Directory of Open Access Journals (Sweden)
Matthew G. Budge
2011-06-01
Full Text Available The syntheses and single-crystal structures of Mo(CO3(phen(dipy (1, Mo(CO3(biquin(dipy (2 and Mo(CO3(dpme(dipy (3, (phen = 1,10-phenanthroline, C12H8N2; dipy = 2,2'-dipyridylamine, C10H9N3; biquin = 2,2'-biquinoline, C18H12N2; dpme = 2,2'-dipyridylmethane, C11H10N2 are described. In each case, distorted fac-MoC3N3 octahedral coordination geometries arise for the metal atoms. Short intramolecular N–H…C interactions from the dipy N–H group to a carbonyl carbon atom occur in each structure. Crystal data: 1 (C25H17MoN5O3, Mr = 531.38, monoclinic, P21/n (No. 14, Z = 4, a = 11.0965 (5 Å, b = 13.0586 (6 Å, c = 16.6138 (8 Å, b = 108.324 (1°, V = 2285.31 (18 Å3, R(F = 0.035, wR(F2 = 0.070. 2 (C31H21MoN5O3, Mr = 607.47, monoclinic, P21/n (No. 14, Z = 4, a = 11.4788 (6 Å, b = 19.073 (1 Å, c = 11.9881 (6 Å, b = 95.179 (1°, V = 2613.9 (2 Å3, R(F = 0.030, wR(F2 = 0.076. 3 (C24H19MoN5O3, Mr = 521.38, monoclinic, P21/n (No. 14, Z = 4, a = 8.4222 (3 Å, b = 21.5966 (9 Å, c = 12.5011 (5 Å, b = 94.065 (1°, V = 2268.12 (15 Å3, R(F = 0.025, wR(F2 = 0.065.
Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets
International Nuclear Information System (INIS)
Swamy, K.S.K.
1987-01-01
The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)
West, Brandi; Useli-Bacchitta, Francesca; Sabbah, Hassan; Blanchet, Valérie; Bodi, Andras; Mayer, Paul M; Joblin, Christine
2014-09-11
The unimolecular dissociation of the pyrene radical cation, C16H10(+•), has been explored using a combination of computational techniques and experimental approaches, such as multiple photon absorption in the cold ion trap Piège à Ions pour la Recherche et l'Etude de Nouvelles Espèces Astrochimiques (PIRENEA) and imaging photoelectron photoion coincidence spectrometry (iPEPICO). In total, 22 reactions, involving the fragmentation cascade (H, C2H2, and C4H2 loss) from the pyrene radical cation down to the C14(+•) fragment ion, have been studied using PIRENEA. Branching ratios have been measured for reactions from C16H10(+•), C16H8(+•), and C16H5(+). Density functional theory calculations of the fragmentation pathways observed experimentally and postulated theoretically lead to 17 unique structures. One important prediction is the opening of the pyrene ring system starting from the C16H4(+•) radical. In the iPEPICO experiments, only two reactions could be studied, namely, R1 C16H10(+•) → C16H9(+) + H (m/z = 201) and R2 C16H9(+) → C16H8(+•) + H (m/z = 200). The activation energies for these reactions were determined to be 5.4 ± 1.2 and 3.3 ± 1.1 eV, respectively.
DEFF Research Database (Denmark)
Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter
1997-01-01
This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...
Ui, Mihoko; Tanaka, Yoshikazu; Tsumuraya, Takeshi; Fujii, Ikuo; Inoue, Masayuki; Hirama, Masahiro; Tsumoto, Kouhei
2011-03-01
The mechanism by which anti-ciguatoxin antibody 10C9Fab recognizes a fragment of ciguatoxin CTX3C (CTX3C-ABCDE) was investigated by mutational analysis based on structural data. 10C9Fab has an extraordinarily large and deep antigen-binding pocket at the center of its variable region. We mutated several residues located at the antigen-binding pocket to Ala, and kinetic analysis of the interactions between the mutant proteins and the antigen fragment was performed. The results indicate that some residues associated with the rigid antigen-binding pocket are structural hot-spots and that L-N94 is an energetic hot-spot for association of the antibody with the antigen fragment CTX3C-ABCDE, suggesting the importance of structural complementarity and energetic hot-spot interactions for specific recognition of polycyclic ethers.
International Nuclear Information System (INIS)
Lim, Dong Seok; Ku, Hee Kwon; Cho, Jae Seon
2015-01-01
NPPs produces electric energy through phase transition of water. According to this, a piping, which is flow path, integrity is essential for safety functions. Erosion, FAC and fittings are corrosion failure mechanism by increasing service life. Especially, there are 10-kilometers of piping in secondary systems. It needs to estimate FAC and apply periodic management. Iron oxides produced by FAC cause power reduction and Loss Of Coolant Accident (LOCA) will be occurred through the continued piping wall thinning. In this study, corrosion rate of pipe materials with carbon steel(SA106.Gr.B) and low-alloy steel (SA335.P22) was evaluated for pipe configuration and dissolved oxygen concentration on 150 °C, pH 9.5∼10.0 and flow velocity of 5m/s. Temperature of 150°C is well known that causes high FAC rate and pH consider a NPPs in-service condition. Further corrosion rate test was performed to develop FAC reduction technology through Pt-nanoparticle injection. In this study, corrosion rate is evaluated by weight depletion method. The results of material impact assessment show that corrosion rate of carbon steel is more higher than that of low-alloy steel because of Cr content. And also, the results of pipe configuration test show that case with 90° elbow had maximum wall thinning than with 180° horizontal pipe. The dissolved oxygen concentration test shows that low oxygen condition, ≤5 ppb, had high corrosion rate compared to normal condition and the corrosion rate decreased 50% at Pt-nanoparticle injection test on maximum corrosion rate condition compared to maximum wall thinning condition without Pt-nanoparticle injection. In this study, samples provided by each test case had analyzed through SEM-EDX (Scanning Electron Microscopy-Energy Dispersive X-ray Spectroscopy). Behavior evaluation for oxide film was performed and Electrochemical corrosion potential (ECP) was measured for electrochemistry evaluation. To apply Pt-nanoparticle injection technology on nuclear
Giesbrecht, Gordon G; Jamieson, Christopher; Cahill, Farrell
2007-06-01
Firefighters experience significant heat stress while working with heavy gear in a hot, humid environment. This study compared the cooling effectiveness of immersing the forearms and hands in 10 and 20 degrees C water. Six men (33 +/- 10 yr; 180 +/- 4 cm; 78 +/- 9 kg; 19 +/- 5% body fat) wore firefighter 'turn-out gear' (heavy clothing and breathing apparatus weighing 27 kg) in a protocol including three 20-min exercise bouts (step test, 78 W, 40 degrees C air, 40% RH) each followed by a 20-min rest/cooling (21 degrees C air); i.e., 60 min of exercise, 60 min of cooling. Turn-out gear was removed during rest/cooling periods and subjects either rested (Control), immersed their hands in 10 or 20 degrees C water (H-10, H-20), or immersed their hands and forearms in 10 or 20 degrees C water (HF-10, HF-20). In 20 degrees C water, hand immersion did not reduce core temperature compared with Control; however, including forearm immersion decreased core temperature below Control values after both the second and final exercise periods (p hand immersion produced a lower core temperature (0.8 degrees C above baseline) than all other conditions (1.1 to 1.4 degrees C above baseline) after the final exercise period (p Hand and forearm immersion in cool water is simple, reduces heat strain, and may increase work performance in a hot, humid environment. With 20 degrees C water, forearms should be immersed with the hands to be effective. At lower water temperatures, forearm and/or hand immersion will be effective, although forearm immersion will decrease core temperature further.
International Nuclear Information System (INIS)
Zakharkin, L.I.; Zhigareva, G.G.
1996-01-01
Dianions 1,4 and 1,3-C 6 H 4 (CH 2 -9-C 2 H 2 B 9 H 9 -7,8-nido) 2 2- obtained from nido 7,8-dicarbollide-ion and 1,4-bis(bromomethyl) and 1,3-bis(bromomethyl)benzenes react with (Ph 3 P) 3 RhCl to give binuclear rhodacarboranes, 1,4- and 1,3-[3,3-(Ph 3 P) 2 -3-H-3,1,2-RhC 2 B 9 H 10 -4-CH 2 ] 2 C 6 H 6 with chemical reaction yield 85% and 87% respectively. 7 refs., 1 fig., 1 tab
Energy Technology Data Exchange (ETDEWEB)
Rabideau, P.W.; Mooney, J.L.; Lipkowitz, K.B.
1986-12-24
The conformational analyses of 9, 10-dihydroanthracene and several of its methylated and ethylated derivatives are studied by empirical force field calculations (MM2 and MMPI). The computational results are considered in light of previous and current carbon NMR data. Model compounds are examined which involve fixed, planar, and boat-shaped conformations about the central ring, and these /sup 13/C NMR data are then compared with flexible systems. It is concluded that carbon chemical shifts and carbon-hydrogen coupling constants are consistent with the results of molecular mechanics calculations which indicate a greater tendency for planarity around the central ring than previously considered.
Youssoufian, H; Kruyt, FAE; Li, XT
1999-01-01
Current methods for direct gene transfer into hematopoietic cells are inefficient. Here we show that functional complementation of Fanconi anemia (FA) group C cells by protein replacement can be as efficacious as by transfection with wild-type FAC cDNA, We expressed a chimeric protein (called
International Nuclear Information System (INIS)
Timofeev, S.V.; Lobanova, I.A.; Petrovskij, P.V.; Starikova, Z.A.; Bregadze, V.I.
2001-01-01
Interaction between exo-nido-ruthenacarborane [Cl(Ph 3 P) 2 Ru]-5,6,10-(μ-H) 3 -10-H-7,8-C 2 B 9 H 8 with bromine in CH 2 Cl 2 solutions at 0 deg C studied using the methods of elementary analysis, NMR, IR spectroscopy and X-ray diffraction analysis. It was ascertained that the reaction gives rise to bromine atom substitution for chlorine atom in octahedral surrounding of ruthenium atom with formation of complex [Br(Ph 3 P) 2 Ru]-5,6,10-(μ-H) 3 -10-H-7,8-C 2 B 9 H 8 . The complex is crystallized in monoclinic crystal system with the following unit cell parameters a = 12.592 (1), b = 20.687 (2), c = 16.628 (2) A, β = 94.372 (3) deg, sp. gr. P2 1 /n, Z = 4. Coordination octahedron of ruthenium atom is formed by three hydrogen atoms bound with boron atoms in one triangular face of carborane, two phosphorus atoms and one bromine atom [ru
Berkei, Michael; Bickley, Jamie F; Heaton, Brian T; Steiner, Alexander
2002-09-21
The reaction of M[PtX3(CO)] (M+ = [(C4H9)4N]+, X = Br, Cl) with an excess of Br2 gives the new platinum(IV) salts, [(C4H9)4N]2[Pt2Br10].(Br2)7, 1, and [(C4H9)4N]2[PtBr4Cl2].(Br2)6, 2, which, in the solid state, contain strong Br Br interactions resulting in the formation of polymeric networks; they could provide useful solid storage reservoirs for elemental bromine.
2010-07-23
... balance-cuts can negatively affect the low-cycle fatigue life capability of the shaft. This condition, if... Company (GE) CT7-9C and -9C3 Turboprop Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... nonconforming GGT shaft land balance-cuts, which could result in the shaft failing before its published life...
Spectroscopic Characterization of Aqua [ fac-Tc(CO)3]+ Complexes at High Ionic Strength.
Chatterjee, Sayandev; Hall, Gabriel B; Engelhard, Mark H; Du, Yingge; Washton, Nancy M; Lukens, Wayne W; Lee, Sungsik; Pearce, Carolyn I; Levitskaia, Tatiana G
2018-06-05
Understanding fundamental Tc chemistry is important to both the remediation of nuclear waste and the reprocessing of nuclear fuel; however, current knowledge of the electronic structure and spectral signatures of low-valent Tc compounds significantly lags behind the remainder of the d-block elements. In particular, identification and treatment of Tc speciation in legacy nuclear waste is challenging due to the lack of reference data especially for Tc compounds in the less common oxidation states (I-VI). In an effort to establish a spectroscopic library corresponding to the relevant conditions of extremely high ionic strength typical for the legacy nuclear waste, compounds with the general formula of [ fac-Tc(CO) 3 (OH 2 ) 3- n (OH) n ] 1- n (where n = 0-3) were examined by a range of spectroscopic techniques including 99 Tc/ 13 C NMR, IR, XPS, and XAS. In the series of monomeric aqua species, stepwise hydrolysis results in the increase of the Tc metal center electron density and corresponding progressive decrease of the Tc-C bond distances, Tc electron binding energies, and carbonyl stretching frequencies in the order [ fac-Tc(CO) 3 (OH 2 ) 3 ] + > [ fac-Tc(CO) 3 (OH 2 ) 2 (OH)] > [ fac-Tc(CO) 3 (OH 2 )(OH) 2 ] - . These results correlate with established trends of the 99 Tc upfield chemical shift and carbonyl 13 C downfield chemical shift. The lone exception is [ fac-Tc(CO) 3 (OH)] 4 which exhibits a comparatively low electron density at the metal center attributed to the μ 3 -bridging nature of the - OH ligands causing less σ-donation and no π-donation. This work also reports the first observations of these compounds by XPS and [ fac-Tc(CO) 3 Cl 3 ] 2- by XAS. The unique and distinguishable spectral features of the aqua [ fac-Tc(CO) 3 ] + complexes lay the foundation for their identification in the complex aqueous matrixes.
International Nuclear Information System (INIS)
Lysenko, K.A.; Golovanov, D.G.; Meshcheryakov, V.I.; Kudinov, A.R.; Antipin, M.Yu.
2005-01-01
The character of electron density distribution in the C 2 B 3 open face, the influence of the SMe 2 group on the character of electron density distribution, and the nature of the sodium-anion interaction were studied based on the data of high-resolution X-ray diffraction study of crystals of the sodium salt of charge-compensated nido-carborane [9-SMe 2 -7,8- C 2 B 9 H 10 ] - and quantum-chemical calculations for the Na...H-B-bonded dimer, the isolated [9-SMe 2 -7,8-C 2 B 9 H 10 ] - anion, and the [7,8-C 2 B 9 H 10 ] 2- dianion. The character of electron density distribution in the C 2 B 3 open face is analogous to the electron distribution in the cyclopentadienyl ligand. In nido-carborane, a substantial charge redistribution takes place compared to that observed in the closo analogs. The topological analysis of the electron density distribution function demonstrated that the cation-anion interactions are determined predominantly by Na...H-B contacts. The total energy of these contacts in the {[9-SMe 2 -7,8-C 2 B 9 H 10 ]Na(thf) 2 } 2 dimer estimated from X-ray diffraction data is 11.74 kcal mol -1 [ru
Kan, Dongxiao; Zhang, Xilin; Zhang, Yanxing; Yang, Zongxian
2018-02-01
The supported catalysts have received great attentions due to their high catalytic activity, low cost and good stability. Here we report the stability, wetting ability, corrosion resistance and catalytic activity of the supported catalysts with group 9, 10 and 11 metals (M = Co, Rh, Ir, Ni, Pd, Pt, Cu, Ag, Au) monolayers (ML) deposited on NbC(001), denoted as MML/NbC(001). The PdML/NbC(001) and PtML/NbC(001) are testified as the most stable and active ones with the former even better on the whole. The catalytic activities toward oxygen reduction reactions (ORR) are clarified by the dissociation and the change in Gibbs free energies for the elementary reaction steps of O2 on PdML/NbC(001).
Park, Jin-Ju; Park, Eun-Kwang; Lee, Gyoung-Ja; Rhee, Chang-Kyu; Lee, Min-Ku
2017-09-01
Carbon steel with dispersed nano-sized TiC ceramic particles was fabricated by the ex-situ introduction of the particles into the melt, with the flow-assisted corrosion (FAC) resistance then investigated in the presence and absence of TiC nanoparticles using a once-through type of FAC loop test. From the potentiodynamic polarization curves, the current density at any given anodic potential was decreased and the open-circuit potential was increased by the addition of TiC nanoparticles. In addition, when the nano-sized TiC particles were added, the FAC rate was 1.38 times lower than that of carbon steel without TiC nanoparticles, indicating an improvement of the FAC resistance due to the homogeneous distribution of the TiC reinforcing nanoparticles.
International Nuclear Information System (INIS)
Manzotti, G; Mariani, S A; Corradini, F; Bussolari, R; Cesi, V; Vergalli, J; Ferrari-Amorotti, G; Fragliasso, V; Soliera, A R; Cattelani, S; Raschellà, G; Holyoake, T L; Calabretta, B
2012-01-01
The c-Myb gene encodes the p75 c-Myb isoform and less-abundant proteins generated by alternatively spliced transcripts. Among these, the best known is p c-Mybex9b , which contains 121 additional amino acids between exon 9 and 10, in a domain involved in protein–protein interactions and negative regulation. In hematopoietic cells, expression of p c-Mybex9b accounts for 10–15% of total c-Myb; these levels may be biologically relevant because modest changes in c-Myb expression affects proliferation and survival of leukemic cells and lineage choice and frequency of normal hematopoietic progenitors. In this study, we assessed biochemical activities of p c-Mybex9b and the consequences of perturbing its expression in K562 and primary chronic myeloid leukemia (CML) progenitor cells. Compared with p75 c-Myb , p c-Mybex9b is more stable and more effective in transactivating Myb-regulated promoters. Ectopic expression of p c-Mybex9b enhanced proliferation and colony formation and reduced imatinib (IM) sensitivity of K562 cells; conversely, specific downregulation of p c-Mybex9b reduced proliferation and colony formation, enhanced IM sensitivity of K562 cells and markedly suppressed colony formation of CML CD34 + cells, without affecting the levels of p75 c-Myb . Together, these studies indicate that expression of the low-abundance p c-Mybex9b isoform has an important role for the overall biological effects of c-Myb in BCR/ABL-transformed cells
Environmental Chambers (-10°C to 50°C)
Federal Laboratory Consortium — USARIEM has environmental and biophysical evaluation chambers of various sizes that can be controlled for temperature (-10°C to 50°C), relative humidity, and wind...
Effects of HFIR irradiation at 550C on the microstructure and toughness of HT-9 and 9Cr-1Mo
International Nuclear Information System (INIS)
Gelles, D.S.; Hu, W.L.; Huang, F.H.; Johnson, G.D.
1984-01-01
Results are reported for base metal and weld metal specimens of HT-9 and Modified 9Cr-1Mo following irradiation in HFIR at 55 0 C to 5 dpa. The DBTT shifts in irradiated base metal specimens were 30 0 C for HT-9 and 90 0 C for 9Cr-1Mo with further shifts of 20 0 C for weld metal. Concurrently, strength as measured by hardness increased 15 percent for HT-9 and 25 percent for 9Cr-1Mo. The hardness increases can be attributed in part to defect clusters 1.5 to 3.0 nm in diameter at densities approaching 10 17 cm -3 and also to lower rates of cavity nucleation ahead of the propagating crack
Hughes, Michael J; Gerken, Michael; Mercier, Hélène P A; Schrobilgen, Gary J
2010-06-07
Dissolution of the infinite chain polymer, (OsO(3)F(2))(infinity), in CH(3)CN solvent at -40 degrees C followed by solvent removal under vacuum at -40 degrees C yielded fac-OsO(3)F(2)(NCCH(3)).nCH(3)CN (n >/= 2). Continued pumping at -40 degrees C with removal of uncoordinated CH(3)CN yielded fac-OsO(3)F(2)(NCCH(3)). Both fac-OsO(3)F(2)(NCCH(3)).nCH(3)CN and fac-OsO(3)F(2)(NCCH(3)) are yellow-brown solids and were characterized by low-temperature (-150 degrees C) Raman spectroscopy. The crystal structure (-173 degrees C) of fac-OsO(3)F(2)(NCCH(3)).2CH(3)CN consists of two co-crystallized CH(3)CN molecules and a pseudo-octahedral OsO(3)F(2).NCCH(3) molecule in which three oxygen atoms are in a facial arrangement and CH(3)CN is coordinated trans to an oxygen atom in an end-on fashion. The Os---N bond length (2.205(3) A) is among the shortest M---N adduct bonds observed for a d(0) transition metal oxide fluoride. The (19)F NMR spectrum of (OsO(3)F(2))(infinity) in CH(3)CN solvent (-40 degrees C) is a singlet (-99.6 ppm) corresponding to fac-OsO(3)F(2)(NCCH(3)). The (1)H, (15)N, (13)C, and (19)F NMR spectra of (15)N-enriched OsO(3)F(2)(NCCH(3)) were recorded in SO(2)ClF solvent (-84 degrees C). Nitrogen-15 enrichment resulted in splitting of the (19)F resonance of fac-OsO(3)F(2)((15)NCCH(3)) into a doublet ((2)J((15)N-(19)F), 21 Hz). In addition, a doublet of doublets ((2)J((19)F(ax)-(19)F(eq)), 134 Hz; (2)J((15)N-(19)F(eq)), 18 Hz) and a doublet ((2)J((19)F(ax)-(19)F(eq)), 134 Hz) were observed in the (19)F NMR spectrum that have been assigned to mer-OsO(3)F(2)((15)NCCH(3)); however, coupling of (15)N to the axial fluorine-on-osmium environment could not be resolved. The nitrogen atom of CH(3)CN is coordinated trans to a fluorine ligand in the mer-isomer. Quantum-chemical calculations at the SVWN and B3LYP levels of theory were used to calculate the energy-minimized gas-phase geometries, vibrational frequencies of fac- and mer-OsO(3)F(2)(NCCH(3)) and of CH(3)CN. The
Institute of Scientific and Technical Information of China (English)
纵艳艳; 裴冬生; 孙亚峰; 张光毅
2005-01-01
目的研究TAT-GluR6-9c-dansyl荧光小肽是否可以进入细胞内部.方法在培养的海马神经元中加入TAT-GluR6-9c-dansyl荧光小肽和对照肽TAT38-48-dansyl.结果用10 μmol/L TAT-GluR6-9c-dansyl处理的海马神经元在荧光显微镜下可以观到绿色荧光的出现,而对照肽TAT38-48-dansyl无荧光出现.结论 TAT-GluR6-9c-dansyl荧光小肽可以进入细胞.
Linear C32H66 hydrocarbon in the mixed state with C10H22 ...
Indian Academy of Sciences (India)
Unknown
S R Research Laboratory for Studies in Crystallization Phenomena, 10-1-96, ... mixed state with certain shorter chain length homologues (SMOLLENCs), estimated ... Methods. Five hydrocarbons of even carbon numbers, C10, C12, C14, C16 ...
Verma, Anand Mohan; Kishore, Nanda
2017-02-01
The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.
International Nuclear Information System (INIS)
Trache, L.; Mukhamedzhanov, A.M.; Tribble, R.E.; Carstoiu, F.
2002-06-01
We have used existing data on the one-proton-removal cross section of 9 C at 285 MeV/u and Glauber model calculations to extract the asymptotic normalization coefficient for the wave function of the last proton in the ground state of 9 C. The calculations are done first using folded potentials starting from two different effective nucleon-nucleon interactions and second in the optical limit using three nucleon-nucleon interactions, and the results are found to be consistent, with no new parameters adjusted. We find C 2 (p 3/2 ) + C 2 (p 1/2 ) = 1.22±0.13 fm -1 . From this result we obtain the astrophysical factor for the proton radiative capture reaction 8 B(p,γ) 9 C as S 18 (0) = 46 ± 6 eV.b. The calculated energy dependence of the astrophysical S-factor for the energy region E cm = 0 - 0.8 MeV and the reaction rates for T 9 = 0 - 1 are included. (authors)
Directory of Open Access Journals (Sweden)
Selma Djender
2014-04-01
Full Text Available We designed a vector for the bacterial expression of recombinant antibodies fused to a double tag composed of 6xHis and the EPEA amino acid sequence. EPEA sequence (C tag is tightly bound by a commercial antibody when expressed at the C-term end of a polypeptide. The antigen is released in the presence of 2 M MgCl2. Consequently, constructs fused to the 6xHis-C tags can be purified by two successive and orthogonal affinity steps. Single-domain antibodies were produced either in the periplasmic or in the cytoplasmic space of E. coli. Surprisingly, the first affinity purification step performed using the EPEA-binding resin already yielded homogeneous proteins. The presence of the C tag did not interfere with the binding activity of the antibodies, as assessed by FACS and SPR analyses, and the C tag was extremely effective for immunoprecipitating HER2 receptor. Finally, the Alexa488-coupled anti-C tag allowed for simplification of FACS and IF analyses. These results show that a tag of minimal dimensions can be effectively used to improve the applicability of recombinant antibodies as reagents. In our hands, C tag was superior to His-tag in affinity purification and pull-down experiments, and practical in any other standard immune technique.
Energy Technology Data Exchange (ETDEWEB)
Dominguez, E.; Carretero, J.C. [Departamento de Quimica Organica, Universidad Autonoma, Madrid (Spain)
1994-12-31
A stereo controlled synthesis of the enantiomerically pure C{sub 9}-C{sub 1}3 fragment of erythromycin B is described. The process takes place in 15 steps from (R)-phenylsulfonyl p-tolylsulfinyl methane and butyraldehyde (16% overall yield). The key steps, corresponding to the formation of the chiral centers, are based on the iterative synthesis of gamma-hydroxivinylsulfones and further syb-sterereoselective addition of MeLi to their protected derivatives. 8 refs.
Energy Technology Data Exchange (ETDEWEB)
Bandyopadhyay, S. [Department of Physics, The University of Burdwan, Golapbag, Burdwan, 713104, West Bengal (India); Dutta, H. [Department of Physics, Vivekananda College, Burdwan, 713103, West Bengal (India); Kar, T. [Department of Materials Science, Indian Association for the Cultivation of Science, Jadavpur, Kolkata, 700032, West Bengal (India); Pradhan, S.K., E-mail: skp_bu@yahoo.com [Department of Physics, The University of Burdwan, Golapbag, Burdwan, 713104, West Bengal (India)
2016-02-01
This article reports the synthesis and microstructure characterization of nanocrystalline Si{sub 0.9}Al{sub 0.1}C powder obtained by mechanical milling the mixture of Si, Al and graphite powders at room temperature under inert atmosphere. XRD patterns of ball-milled powders clearly reveal the nucleation of Si{sub 0.9}Al{sub 0.1}C phase after 5 h of milling and the stoichiometric cubic Si{sub 0.9}Al{sub 0.1}C is formed after 10 h of milling with crystallite size of ∼3 nm. Microstructure of ball-milled powders in terms of different lattice imperfections is characterized by employing both Rietveld's method of structure refinement using XRD data and high resolution transmission electron microscope (HRTEM). HRTEM micrographs of 10 h milled powder substantiate the formation of nanocrystalline Si{sub 0.9}Al{sub 0.1}C compound without any contamination and confirm the findings of Rietveld analysis using XRD data. - Highlights: • Cubic Si{sub 0.9}Al{sub 0.1}C is formed after 5 h of milling of Si, Al and graphite powders. • Nanocrystalline Si{sub 0.9}Al{sub 0.1}C with particle size ∼3 nm is obtained after 10 h milling. • Average particle size of Si{sub 0.9}Al{sub 0.1}C from XRD analysis and HRTEM is very close.
Anoctamin 9/TMEM16J is a cation channel activated by cAMP/PKA signal.
Kim, Hyungsup; Kim, Hyesu; Lee, Jesun; Lee, Byeongjun; Kim, Hee-Ryang; Jung, Jooyoung; Lee, Mi-Ock; Oh, Uhtaek
2018-05-01
Anoctamins (ANOs) are multifunctional membrane proteins that consist of 10 homologs. ANO1 (TMEM16A) and ANO2 (TMEM16B) are anion channels activated by intracellular calcium that meditate numerous physiological functions. ANO6 is a scramblase that redistributes phospholipids across the cell membrane. The other homologs are not well characterized. We found ANO9/TMEM16J is a cation channel activated by a cAMP-dependent protein kinase A (PKA). Intracellular cAMP-activated robust currents in whole cells expressing ANO9, which were inhibited by a PKA blocker. A cholera toxin that persistently stimulated adenylate cyclase activated ANO9 as did the application of PKA. The cAMP-induced ANO9 currents were permeable to cations. The cAMP-dependent ANO9 currents were augmented by intracellular Ca 2+ . Ano9 transcripts were predominant in the intestines. Human intestinal SW480 cells expressed high levels of Ano9 transcripts and showed PKA inhibitor-reversible cAMP-dependent currents. We conclude that ANO9 is a cation channel activated by a cAMP/PKA pathway and could play a role in intestine function. Copyright © 2017. Published by Elsevier Ltd.
Observation of Ξc(2930)0 and updated measurement of B- → K-Λc+ anti Λc- at Belle
International Nuclear Information System (INIS)
Li, Y.B.; Ban, Y.; Shen, C.P.; Jia, S.; Adachi, I.; Haba, J.; Hara, T.; Itoh, R.; Nakao, M.; Nishida, S.; Sakai, Y.; Uno, S.; Ahn, J.K.; Kim, J.B.; Kim, K.T.; Moon, H.K.; Won, E.; Aihara, H.; Jin, Y.; Al Said, S.; Asner, D.M.; Bansal, V.; Cunliffe, S.; Fast, J.E.; Fulsom, B.G.; Strube, J.F.; Aushev, T.; Popov, V.; Ayad, R.; Babu, V.; Mohanty, G.B.; Badhrees, I.; Bakich, A.M.; Behera, P.; Libby, J.; Berger, M.; Widmann, E.; Bhardwaj, V.; Bhuyan, B.; Nath, K.J.; Biswal, J.; Lubej, M.; Mrvar, M.; Nanut, T.; Pestotnik, R.; Staric, M.; Bonvicini, G.; Cinabro, D.; Di Carlo, S.; Bozek, A.; Natkaniec, Z.; Bracko, M.; Korpar, S.; Browder, T.E.; Hedges, M.T.; Kotchetkov, D.; Varner, G.; Cervenkov, D.; Dolezal, Z.; Drasal, Z.; Kodys, P.; Chekelian, V.; Kiesling, C.; Li Gioi, L.; Chen, A.; Cheon, B.G.; Kim, S.H.; Lee, I.S.; Unno, Y.; Chilikin, K.; Pakhlov, P.; Zhukova, V.; Cho, K.; Choi, S.K.; Choi, Y.; Park, C.W.; Dash, N.; Eidelman, S.; Epifanov, D.; Gabyshev, N.; Garmash, A.; Krokovny, P.; Kuzmin, A.; Shebalin, V.; Shwartz, B.; Vorobyev, V.; Zhilich, V.; Zhulanov, V.; Ferber, T.; Inguglia, G.; Karyan, G.; Rostomyan, A.; Ye, H.; Garg, R.; Gaur, V.; Piilonen, L.E.; Gelb, M.; Goldenzweig, P.; Giri, A.; Guido, E.; Mussa, R.; Hayasaka, K.; Kawasaki, T.; Miyata, H.; Seino, Y.; Watanabe, M.; Yusa, Y.; Hayashii, H.; Miyabayashi, K.; Hou, W.S.; Shiu, J.G.; Wang, M.Z.; Iijima, T.; Inami, K.; Kato, Y.; Mori, T.; Ishikawa, A.; Sanuki, T.; Iwasaki, M.; Nakano, E.; Iwasaki, Y.; Kichimi, H.; MacNaughton, J.; Santelj, L.; Jacobs, W.W.; Vossen, A.; Joo, K.K.; Julius, T.; Tenchini, F.; Waheed, E.; Kim, D.Y.; Kinoshita, K.; Pal, B.; Sandilya, S.; Wang, B.; Krizan, P.; Kroeger, R.; Kulasiri, R.; Kumita, T.; Sumiyoshi, T.; Kwon, Y.J.; Lee, S.C.; Park, H.; Li, L.K.; Wang, P.; Yuan, C.Z.; Liventsev, D.; Luo, T.; Wang, X.L.; Masuda, M.; Matsuda, T.; Merola, M.; Pardi, S.; Russo, G.; Mizuk, R.; Nayak, M.; Niiyama, M.; Ogawa, S.; Pakhlova, G.; Solovieva, E.; Uglov, T.; Zakharov, S.; Paul, S.; Pedlar, T.K.; Salehi, M.; Schneider, O.; Schnell, G.; Schwanda, C.; Shibata, T.A.; Uchida, M.; Sokolov, A.; Sumihama, M.; Takizawa, M.; Tamponi, U.; Tanida, K.; Hulse, C. van; Wang, C.H.; Watanabe, Y.; Yelton, J.; Zhang, Z.P.
2018-01-01
We report the first observation of the Ξ c (2930) 0 charmed-strange baryon with a significance greater than 5σ. The Ξ c (2930) 0 is found in its decay to K - Λ c + in decays. The measured mass and width are [2928.9 ± 3.0(stat.) +0.9 -12.0 (syst.)] MeV/c 2 and [19.5 ± 8.4(stat.) +5.9 -7.9 (syst.)] MeV, respectively, and the product branching fraction is B(B - → Ξ c (2930) 0 anti Λ c - ) B(Ξ c (2930) 0 → K - Λ c + ) = [1.73 ± 0.45(stat.) ± 0.21(syst.)] x 10 -4 . We also measure B(B - → K - Λ c + anti Λ c - ) = [4.80 ± 0.43(stat.) ± 0.60(syst.)] x 10 -4 with improved precision, and search for the charmonium-like state Y(4660) and its spin partner, Y η , in the Λ c + anti Λ c - invariant mass spectrum. No clear signals of the Y(4660) nor its spin partner are observed and the 90% credibility level (C.L.) upper limits on their production rates are determined. These measurements are obtained from a sample of (772� ± 11) � x 10 6 B anti B pairs collected at the Υ(4S) resonance by the Belle detector at the KEKB asymmetric energy electron.positron collider. (orig.)
Wang, Xin; Gu, Wenpeng; Qiu, Haiyan; Xia, Shengli; Zheng, Han; Xiao, Yuchun; Liang, Junrong; Jing, Huaiqi
2013-10-01
We investigated the lethality of pathogenic Yersinia enterocolitica bioserotypes 1B/O:8 and 2/O:9 in susceptible BALB/C and resistant C57BL/6 mice; the cytokine alterations and histopathological changes were observed comparing the two strains in BALB/C mice. The data showed the 50% lethal dose (LD50) for the pathogenic Y. enterocolitica bioserotype 1B/O:8 was 10³ cfu in both BALB/C and C57BL/6 mice; while the LD50 for the 2/O:9 was 10⁸ cfu in BALB/C mice and 10⁹ cfu in C57BL/6 mice, a large difference. After infection with the two strains in BALB/C mice, GM-CSF (granulocyte-macrophage colony stimulating factor), IFN-γ (interferon-γ), IL-1β (interleukin-1β), IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, and TNF-α (tumor necrosis factor-α) appeared as a cytokine storm in a short period, reached peak values, and then quickly decreased. This appeared important for the immune response and cytokine immunopathogenesis in pathogenic Y. enterocolitica infections. In the initial infection stage, GM-CSF, IL-6, and TNF-α of 2/O:9 were higher than 1B/O:8; and subsequently the status was reversed. However, levels of IFN-γ, IL-1β, IL-2, IL-4, IL-5, IL-10, IL-12 following infection with 1B/O:8 were always higher than with 2/O:9. The histopathological changes in the liver and spleen in BALB/C mice infected with the two strains were similar at different times and doses. These observations show the different immunological effects and changes for pathogenic Y. enterocolitica 1B/O:8 and 2/O:9 infections using the mouse model. Copyright © 2013 Elsevier Ltd. All rights reserved.
Genetic Polymorphism of CYP2C9 Among Sistani Ethnic Group in Gorgan.
Marjani, Abdoljalal; Gharanjik, Aman Mohammad
2018-04-01
Cytochrome P450 2C9 (CYP2C9) is involved in metabolism of many important drugs and its genotype variations is thought to affect drug efficacy and the treatment process. The aim of this study was to assess the distribution of CYP2C9 allele and genotypic variants in Sistani ethnic group, living in Gorgan, South East of Caspian Sea and North East of Iran. This study included 140 Sistani, referred to the health center of Gorgan. CYP2C9 genotyping was carried out by polymerase chain reaction-restriction fragment length polymorphism technique. The allele frequency of CYP2C9*1, CYP2C9*2 and CYP2C9*3 was 76.1, 16.1 and 7.8%, respectively. The frequency of CYP2C9*1/*1, CYP2C9*1/*2, CYP2C9*1/*3, CYP2C9*2/*2, CYP2C9*2/*3 and CYP2C9*3/*3 genotypes was 53.9, 22.1, 11.4, 2.9, 4.3% and nil, respectively. In this study the genotypic variations of the CYP2C9 allele among the Sistani ethnic group was investigated and great differences were observed in comparison to other populations. Our findings suggest that different genotypes of CYP2C9 may influence the pharmacokinetics of some drugs. More studies on the pharmacokinetic effects of CYP2C9 genotypes may help physicians choose optimal dosage of some drugs for treatment and prevention of their side effects. Since different ethnic groups from all over the world use medications, it suggests to investigate the pharmacokinetic effects of CYP2C9 genotypes in different populations.
International Nuclear Information System (INIS)
Naghi Saadatjoo; Mohsen Javaheri; Nuclear Science and Technology Research Institute, Tehran; Nader Saemian; Mohsen Amini
2016-01-01
Quetiapine is one of the most widely used antipsychotic drug which acts as an antagonist for multiple neurotransmitter receptor sites. 2-[2-(4-(Dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl)ethoxy]ethanol (quetiapine) labeled with carbon-14 in 11-position has been synthesized as part of a 5-step sequence from anthranilic acid-[carboxy- 14 C]. We have presented a convenient synthetic pathway for labeling of quetiapine with carbon-14 by using one-pot procedures from a key thiazepin-11(10H)-one-[11- 14 C] by good radiochemical yield. And also isoclotiapine[11- 14 C], and 10-(4-methylpiperazin-1-yl)pyrido[4,3-b][1,4]benzothiazepine[10- 14 C], synthesized according to this route. (author)
Investigation of the 9Be(a,n)12C reaction. Pt. 2
International Nuclear Information System (INIS)
Schmidt, D.; Boettger, R.; Klein, H.; Nolte, R.
1992-04-01
Differential cross sections of the 9 Be(α,n) 12 C reaction have been measured at 19 alpha energies between 7 MeV and 16 MeV. Besides the differential cross sections from the 9 Be(α,n) 12 C(g.s.) reaction, also those of the 9 Be(α,n) 12 C(E ex ) reactions were derived for excitation energies E ex = 4.439, 7.654, 9.641, 10.84, 11.83 and 12.71 MeV. Possible sources of uncertainties have been extensively investigated and the corresponding results have been published in part 1. All partial and integrated cross sections from the 9 Be(α,n) 12 C(g.s.) reaction were determined with uncertainties of less than 5%. The angular distributions were fitted to Legendre polynomial expansions by the least-squares method. A comparison of the measured cross sections with data from other authors and with an evaluation shows considerable deviations in some cases. Tests were also carried out to ascertain how well an interpolation of the Legendre coefficients reproduces the magnitude and shape of the experimentally determined angular distributions. All angular distributions are presented in figures, together with their Legendre polynomial expansions and data from the literature if available. The a l coefficients of the Legendre polynomial expansions are given in the Appendix. (orig.) [de
Linear ketenimines. Variable structures of C,C-dicyanoketenimines and C,C-bis-sulfonylketenimines.
Finnerty, Justin; Mitschke, Ullrich; Wentrup, Curt
2002-02-22
C,C-dicyanoketenimines 10a-c were generated by flash vacuum thermolysis of ketene N,S-acetals 9a-c or by thermal or photochemical decomposition of alpha-azido-beta-cyanocinnamonitrile 11. In the latter reaction, 3,3-dicyano-2-phenyl-1-azirine 12 is also formed. IR spectroscopy of the keteniminines isolated in Ar matrixes or as neat films, NMR spectroscopy of 10c, and theoretical calculations (B3LYP/6-31G) demonstrate that these ketenimines have variable geometry, being essentially linear along the CCN-R framework in polar media (neat films and solution), but in the gas phase or Ar matrix they are bent, as is usual for ketenimines. Experiments and calculations agree that a single CN substituent as in 13 is not enough to enforce linearity, and sulfonyl groups are less effective that cyano groups in causing linearity. C,C-bis(methylsulfonyl)ketenimines 4-5 and a C-cyano-C-(methylsulfonyl)ketenimine 15 are not linear. The compound p-O2NC6H4N=C=C(COOMe)2 previously reported in the literature is probably somewhat linearized along the CCNR moiety. A computational survey (B3LYP/6-31G) of the inversion barrier at nitrogen indicates that electronegative C-substituents dramatically lower the barrier; this is also true of N-acyl substituents. Increasing polarity causes lower barriers. Although N-alkylbis(methylsulfonyl)ketenimines are not calculated to be linear, the barriers are so low that crystal lattice forces can induce planarity in N-methylbis(methylsulfonyl)ketenimine 3.
Directory of Open Access Journals (Sweden)
Carlos Alexandre Twardowschy
2011-04-01
Full Text Available OBJECTIVE: CYP2C9 is a major enzyme in human drug metabolism and the polymorphism observed in the corresponding gene may affect therapeutic outcome during treatment. The distribution of variant CYP2C9 alleles and prevalence of phenytoin adverse reactions were hereby investigated in a population of patients diagnosed with epilepsy. METHOD: Allele-specific PCR analysis was carried out in order to determine frequencies of the two most common variant alleles, CYP2C9*2 and CYP2C9*3 in genomic DNA isolated from 100 epileptic patients. We also analyzed the frequency of phenytoin adverse reactions among those different genotypes groups. The data was presented as mean±standard deviation. RESULTS: The mean age at enrollment was 39.6±10.3 years (range, 17-72 years and duration of epilepsy was 26.5±11.9 years (range 3-48 years. The mean age at epilepsy onset was 13.1±12.4 years (range, 1 month-62 years. Frequencies of CYP2C9*1 (84%, CYP2C9*2 (9% and CYP2C9*3 (7% were similar to other published reports. Phenytoin adverse reactions were usually mild and occurred in 15% patients, without correlation with the CYP2C9 polymorphism (p=0.34. CONCLUSION: Our findings indicate an overall similar distribution of the CYP2C9 alleles in a population of patients diagnosed with epilepsy in the South of Brazil, compared to other samples. This sample of phenytoin users showed no drug related adverse reactions and CYP2C9 allele type correlation. The role of CYP2C9 polymorphism influence on phenytoin adverse reaction remains to be determined since some literature evidence and our data found negative results.
The C9orf72 repeat expansion disrupts nucleocytoplasmic transport.
Zhang, Ke; Donnelly, Christopher J; Haeusler, Aaron R; Grima, Jonathan C; Machamer, James B; Steinwald, Peter; Daley, Elizabeth L; Miller, Sean J; Cunningham, Kathleen M; Vidensky, Svetlana; Gupta, Saksham; Thomas, Michael A; Hong, Ingie; Chiu, Shu-Ling; Huganir, Richard L; Ostrow, Lyle W; Matunis, Michael J; Wang, Jiou; Sattler, Rita; Lloyd, Thomas E; Rothstein, Jeffrey D
2015-09-03
The hexanucleotide repeat expansion (HRE) GGGGCC (G4C2) in C9orf72 is the most common cause of amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD). Recent studies support an HRE RNA gain-of-function mechanism of neurotoxicity, and we previously identified protein interactors for the G4C2 RNA including RanGAP1. A candidate-based genetic screen in Drosophila expressing 30 G4C2 repeats identified RanGAP (Drosophila orthologue of human RanGAP1), a key regulator of nucleocytoplasmic transport, as a potent suppressor of neurodegeneration. Enhancing nuclear import or suppressing nuclear export of proteins also suppresses neurodegeneration. RanGAP physically interacts with HRE RNA and is mislocalized in HRE-expressing flies, neurons from C9orf72 ALS patient-derived induced pluripotent stem cells (iPSC-derived neurons), and in C9orf72 ALS patient brain tissue. Nuclear import is impaired as a result of HRE expression in the fly model and in C9orf72 iPSC-derived neurons, and these deficits are rescued by small molecules and antisense oligonucleotides targeting the HRE G-quadruplexes. Nucleocytoplasmic transport defects may be a fundamental pathway for ALS and FTD that is amenable to pharmacotherapeutic intervention.
Directory of Open Access Journals (Sweden)
Renata Pereira Limberger
2002-09-01
Full Text Available Essential oils from Calyptranthes concinna, C. lucida and C. rubella, collected in Southern Brazil, were analyzed by GC and GC/MS. Sixty-two compounds were identified representing about 98% of the oil contents. All samples were rich in cyclic sesquiterpenes (more than 90 %, mainly those from cadinane, bisabolane and germacrane cyclization pathway. The mainly components characterized were bicyclogermacrene (22.1% in C. concinna;11.7% in C. rubella, cis-calamenene (10.3% in C. concinna, beta-caryophyllene (16.5% in C. rubella; 9.4% in C. lucida, beta-bisabolene (25.5% in C. lucida, spathulenol (15.4% in C. rubella and caryophyllene oxide (7.6% in C. concinna.Os óleos essenciais de Calyptranthes concinna, C. lucida e C. rubella, coletadas no sul do Brasil, foram analisados por GC/FID e GC/MS. Sessenta e dois constituintes foram identificados representando cerca de 98% do óleo. Todas as amostras mostraram-se ricas em sesquiterpenos cíclicos (mais de 90%, principalmente aquelas da via de ciclização dos cadinanos, bisabolanos e germacranos. Os principais constituintes caracterizados foram biciclogermacreno (22,1% em C. concinna; 11,7% em C. rubella, cis-calameneno (10,3% em C. concinna, betacariofileno (16,5% em C. rubella; 9,4% em C. lucida, beta-bisaboleno (25,5% em C. lucida, espatulenol (15,4% em C. rubella e óxido de cariofileno (7,6% em C. concinna.
FACS-Assisted CRISPR-Cas9 Genome Editing Facilitates Parkinson's Disease Modeling
Directory of Open Access Journals (Sweden)
Jonathan Arias-Fuenzalida
2017-11-01
Full Text Available Genome editing and human induced pluripotent stem cells hold great promise for the development of isogenic disease models and the correction of disease-associated mutations for isogenic tissue therapy. CRISPR-Cas9 has emerged as a versatile and simple tool for engineering human cells for such purposes. However, the current protocols to derive genome-edited lines require the screening of a great number of clones to obtain one free of random integration or on-locus non-homologous end joining (NHEJ-containing alleles. Here, we describe an efficient method to derive biallelic genome-edited populations by the use of fluorescent markers. We call this technique FACS-assisted CRISPR-Cas9 editing (FACE. FACE allows the derivation of correctly edited polyclones carrying a positive selection fluorescent module and the exclusion of non-edited, random integrations and on-target allele NHEJ-containing cells. We derived a set of isogenic lines containing Parkinson's-disease-associated mutations in α-synuclein and present their comparative phenotypes.
Yeang, Calvin; Witztum, Joseph L; Tsimikas, Sotirios
2015-06-01
The measurement that is termed 'LDL-cholesterol' (LDL-C) includes the cholesterol content of lipoprotein(a) [Lp(a)-C], which can contribute approximately 30-45% to measured LDL-C levels as a percentage of its mass. We review the implications of achieved very low LDL-C levels in patients treated with potent LDL-C-lowering agents in the context of varying Lp(a) levels. Combination therapy with statins, ezetimibe, and proprotein convertase subtilisin/kexin type 9 (PCSK9) inhibitors can lower LDL-C to unprecedentedly low levels. Recent PCSK9 trials have shown that routine achievement of mean LDL-C less than 50 mg/dl is feasible, along with the modest reductions in Lp(a). Many patients will achieve LDL-C less than 25 mg/dl with concomitantly elevated Lp(a) levels that contribute substantially to the measured 'LDL-C'. Therefore, it is possible that some of these patients may have little to no circulating LDL-C. As the new era of ultralow LDL-C levels ensues, it is imperative to understand the contribution of Lp(a)-C to measured LDL-C and the consequences of achieving ultralow or potentially absent LDL-C in the setting of elevated Lp(a) levels and possibly free apo(a). We review this concept and suggest avenues of research, including analyses of existing datasets in current clinical trials and new research studies, to understand its pathophysiological and clinical significance.
Aslanyan, P Zh; Rikhvitskaya, G G
2004-01-01
Experimental data from a 2 m propane bubble chamber have been analyzed to search for an exotic baryon state, the $\\Theta^+$ baryon, in the $pK^0_s$ decay mode for the reaction $p+{\\rm C_3H_8}$ at 10 GeV/$c$. The $pK^0_s$ invariant mass spectrum shows resonant structures with $M_{p K_s^0}=1540\\pm 8$, $1613\\pm10$, $1821\\pm11$ MeV/$c^2$ and $\\Gamma_{p K_s^0}= 9.2\\pm1.8$, $16.1\\pm4.1$, $28.0\\pm9.4$ MeV/$c^2$. The statistical significance of these peaks has been estimated as $5.5$, $4.8$ and $5.0$ s.d., respectively. There are also small peaks in mass regions of 1487 (3.0 s.d.), 1690 (3.6 s.d.) and 1980 (3.0 s.d.) MeV/$c^2$.
Semenov, K. N.; Ivanova, N. M.; Charykov, N. A.; Keskinov, V. A.; Kalacheva, S. S.; Duryagina, N. N.; Garamova, P. V.; Kulenova, N. A.; Nabieva, A.
2017-02-01
Concentration dependences of the density of aqueous solutions of bisadducts of light fullerene C60 and essential amino acids are studied by pycnometry. Concentration dependences of the average molar volumes and partial volumes of components (H2O and corresponding bisadducts) are calculated for C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems at 25°C. Concentration dependences of the indices of refraction of C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems are determined at 25°C. The concentration dependences of specific refraction and molar refraction of bisadducts and aqueous solutions of them are calculated.
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Test Specifications for PM10, PM2.5 and PM10-2.5 Candidate Equivalent Methods C Table C-4 to Subpart C of Part 53 Protection of Environment... Pt. 53, Subpt. C, Table C-4 Table C-4 to Subpart C of Part 53—Test Specifications for PM10, PM2.5 and...
International Nuclear Information System (INIS)
Abd el-Kariem, S.E.S.
1984-01-01
In the framework of a systematic analysis of many-particle transfer reactions on light nuclei in the present thesis the two-particle transfer reactions of the type (d,α) on the nucleus 10 B at Esub(d) = 16 MeV and on the nuclei 11 B, 12 C and 13 C at Esub(d) = 24 MeV as well as the three-particle transfer reaction 13 C(p,α) 10 B at eight incident energies between 16 and 45 MeV have been studied. In the case of the residual nuclei 10 B and 11 B transitions up to an excitation energy Esub(x) approx.= 7.5 respectively approx.= 9,0 MeV, in the case of the residual nuclei 8 Be and 9 Be transitions up to Esub(x) approx.= 17 respectively 2.5 MeV were evaluated. Under the assumption that the studied reactions behave as direct one-stage transfer processes the measurement results were analyzed in the framework of the DWBA theory in zero-range approximation. The parameters for the optical potentials used in the DWBA calculations were taken from literature and partly modified by fitting to the angular distributions of the reactions studied here. Microscopic and semimicroscopic calculations were performed. In the semimicroscopic calculations the spectroscopic amplitudes calculated microscopically or in SU(3) approximation were used together with a cluster form factor, in the other case with a microscopically calculated form factor. For the residual nucleus for some higher excited states results on spin, parity, and isospin could be partly obtained, partly confirmed. (orig./HSI) [de
Antimalarial Activity of C-10 Substituted Triazolyl Artemisinin.
Park, Gab-Man; Park, Hyun; Oh, Sangtae; Lee, Seokjoon
2017-12-01
We synthesized C-10 substituted triazolyl artemisinins by the Huisgen cycloaddition reaction between dihydroartemisinins (2) and variously substituted 1, 2, 3-triazoles (8a-8h). The antimalarial activities of 32 novel artemisinin derivatives were screened against a chloroquine-resistant parasite. Among them, triazolyl artemisinins with electron-withdrawing groups showed stronger antimalarial activities than those shown by the derivatives having electron-donating groups. In particularly, m-chlorotriazolyl artemisinin (9d-12d) showed antimalarial activity equivalent to that of artemisinin and could be a strong drug candidate.
Ishiuchi, Yuri; Sato, Hitoshi; Tsujimura, Kazuki; Kawaguchi, Hideo; Matsuwaki, Takashi; Yamanouchi, Keitaro; Nishihara, Masugi; Nedachi, Taku
2018-01-01
Accumulating evidence indicates that skeletal muscle secrets proteins referred to as myokines and that exercise contributes to their regulation. In this study, we propose that chemokine (C-X-C motif) ligand 10 (CXCL10) functions as a novel myokine. Initially, we stimulated differentiated C2C12 myotubes with or without electrical pulse stimulation (EPS) to identify novel myokines. Cytokine array analysis revealed that CXCL10 secretion was significantly reduced by EPS, which was further confirmed by enzyme-linked immunosorbent assay and quantitative polymerase chain reaction analysis. Treadmill experiments in mice identified significant reduction of Cxcl10 gene expression in the soleus muscle. Additionally, contraction-dependent p38 MAPK activation appeared to be involved in this reduction. Furthermore, C2C12 conditioned medium obtained after applying EPS could induce survival of MSS31, a vascular endothelial cell model, which was partially attenuated by the addition of recombinant CXCL10. Overall, our findings suggest CXCL10 as a novel exercise-reducible myokine, to control endothelial cell viability.
Glycine-U-14C metabolism in young rats fed the 10% casein diets containing excess glycine
International Nuclear Information System (INIS)
Takeuchi, Hisanao; Wakatsuki, Tetsuo; Muramatsu, Keiichiro
1975-01-01
Nine hours after rats fed ad libitum for 14 days a 10% casein diet (10C), a 10% casein diet containing 7% glycine (10C7G) and a 10% casein diet containing 7% glycine with 1.4% L-arginine.HCl and 0.9% L-methionine (10C7GArgMet) were force-fed 10 ml of each diet suspension containing 5μCi of glycine-U- 14 C per 100 g of body weight, the radioactivity recoveries of 14 C in expired CO 2 , tissue components and urine were determined. The radioactivity recovery of 14 C in the expired CO 2 of the 10C7G group was generally higher than that of the 10C7GArgMet group. The recovery of 14 C in the trichloroacetic acid (TCA) soluble fraction of muscle of the 10C7G and the 10C7GArgMet groups were greater than that of the 10C group. The recoveries of 14 C in the TCA soluble fraction and protein of plasma and liver, and the muscle protein were negligible in all the groups. The amount of glycine- 14 C incorporated into the carcass lipids of the 10C7GArgMet group was larger than that of other groups. The recoveries of 14 C in the liver and muscle glycogen, and liver lipids were remarkably small in all the groups. From the above results, it was suggested that the degradation of glycine- 14 C to expiratory CO 2 was not accelerated, but the rate of incorporation of the isotope into carcass lipids was increased by the supplementation of L-arginine and L-methionine to the 10C7G diet as compared with that of rats fed the 10C7G diet. (JPN)
Directory of Open Access Journals (Sweden)
Enard, Thierry
1996-04-01
Full Text Available Trans polyunsaturated fatty acids are produced in vegetable oils during heat treatment (240-250 °C.ln order to study the metabolic pathway of 9c, 12t and 9t, 12c linoleic acid and 9c, 12c, 15t and 9t, 12c, 15c linolenic acid, these products were prepared labelled with carbon 14 in the carboxylic position. 5c, 8c, 11c, 14t-Arachidonic acid was also labelled on the carboxylic position with carbon 14 in order to study its physiological effects. To introduce the labelling (E-bromo precursors with a 17 carbons chain or a 19 carbon chain were needed. The different syntheses were done by elongation steps and creation of cis double bonds via highly stereospecific Wittig reactions. The radioactive carbon atom was introduced from [14C]-potassium cyanide. The final radioactive fatty acids had a specific activity greater than 50 mCi/mmol and a radioactive purity better than 99 % for linoleic and linolenic and better than 98.6 % for arachidonic acid.
International Nuclear Information System (INIS)
Trowbridge, L.D.
2000-01-01
As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes is under way. This report summarizes studies directed at estimating the chemical and thermal stability of three candidate coolants, c-C 4 F 8 O, n-C 4 F 10 and c-C 4 4F 8 , in a few specific environments to be found in gaseous diffusion plant operations
Dicty_cDB: Contig-U01201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca
CYP2C9 polymorphism in non-steroidal anti-inflammatory drugs-induced gastropathy.
Ma, Juan; Yang, Xiu Yan; Qiao, Liang; Liang, Liu Qin; Chen, Min Hu
2008-05-01
Non-steroidal anti-inflammatory drugs (NSAID) induce gastroduodenal mucosal injury and are metabolized by cytochrome P450 2C9 (CYP2C9). It is postulated that CYP2C9 genotype is associated with NSAID-induced gastropathy. This study aims to determine whether individuals with a CYP2C9 allele mutation are susceptible to NSAID-induced gastropathy. A total of 109 patients diagnosed as having rheumatic diseases and taking NSAID were appraised as having gastropathy by endoscopy, stool occult blood test and questionnaire two weeks after entering the study. Their peripheral blood was analyzed by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP). A total of 47.7% gastropathy (33% erosions, 14.7% ulcers, 2.75% ulcer bleeding) and 56% dyspeptic symptoms were presented. Only one CYP2C9*2 heterozygote (*1/*2) was found in the group with gastropathy and two variant alleles (CYP2C9*2 and CYP2C9* 3) could not be found in the group without gastropathy. There was no significant difference in both CYP2C9 genotype (0.96%vs 0%) and CYP2C9 variant allele frequency (1.92%vs 0%) between patients with and without gastropathy. These results confirm the high prevalence of NSAID-induced gastropathy but do not support the postulation that CYP2C9*2 and CYP2C9*3 contribute to the development of NSAID-induced gastropathy. This may be due to the low frequency of the two alleles in the population studied.
Thermal infrared and optical photometry of Asteroidal Comet C/2002 CE10
Sekiguchi, Tomohiko; Miyasaka, Seidai; Dermawan, Budi; Mueller, Thomas; Takato, Naruhisa; Watanabe, Junichi; Boehnhardt, Hermann
2018-04-01
C/2002 CE10 is an object in a retrograde elliptical orbit with Tisserand parameter - 0.853 indicating a likely origin in the Oort Cloud. It appears to be a rather inactive comet since no coma and only a very weak tail was detected during the past perihelion passage. We present multi-color optical photometry, lightcurve and thermal mid-IR observations of the asteroidal comet. With the photometric analysis in BVRI, the surface color is found to be redder than asteroids, corresponding to cometary nuclei and TNOs/Centaurs. The time-resolved differential photometry supports a rotation period of 8.19 ± 0.05 h. The effective diameter and the geometric albedo are 17.9 ± 0.9 km and 0.03 ± 0.01, respectively, indicating a very dark reflectance of the surface. The dark and redder surface color of C/2002 CE10 may be attribute to devolatilized material by surface aging suffered from the irradiation by cosmic rays or from impact by dust particles in the Oort Cloud. Alternatively, C/2002 CE10 was formed of very dark refractory material originally like a rocky planetesimal. In both cases, this object lacks ices (on the surface at least). The dynamical and known physical characteristics of C/2002 CE10 are best compatible with those of the Damocloids population in the Solar System, that appear to be exhaust cometary nucleus in Halley-type orbits. The study of physical properties of rocky Oort cloud objects may give us a key for the formation of the Oort cloud and the solar system.
21 CFR 82.1260 - D&C Orange No. 10.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false D&C Orange No. 10. 82.1260 Section 82.1260 Food... CERTIFIED PROVISIONALLY LISTED COLORS AND SPECIFICATIONS Drugs and Cosmetics § 82.1260 D&C Orange No. 10. The color additive D&C Orange No. 10 shall conform in identity and specifications to the requirements...
21 CFR 74.2260 - D&C Orange No. 10.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false D&C Orange No. 10. 74.2260 Section 74.2260 Food... COLOR ADDITIVES SUBJECT TO CERTIFICATION Cosmetics § 74.2260 D&C Orange No. 10. (a) Identity and specifications. The color additive D&C Orange No. 10 shall conform in identity and specifications to the...
3C-SiC nanocrystal growth on 10° miscut Si(001) surface
Energy Technology Data Exchange (ETDEWEB)
Deokar, Geetanjali, E-mail: gitudeo@gmail.com [INSP, UPMC, CNRS UMR 7588, 4 place Jussieu, Paris F-75005 (France); D' Angelo, Marie; Demaille, Dominique [INSP, UPMC, CNRS UMR 7588, 4 place Jussieu, Paris F-75005 (France); Cavellin, Catherine Deville [INSP, UPMC, CNRS UMR 7588, 4 place Jussieu, Paris F-75005 (France); Faculté des Sciences et Technologie UPEC, 61 av. De Gaulle, Créteil F-94010 (France)
2014-04-01
The growth of 3C-SiC nano-crystal (NC) on 10° miscut Si(001) substrate by CO{sub 2} thermal treatment is investigated by scanning and high resolution transmission electron microscopies. The vicinal Si(001) surface was thermally oxidized prior to the annealing at 1100 °C under CO{sub 2} atmosphere. The influence of the atomic steps at the vicinal SiO{sub 2}/Si interface on the SiC NC growth is studied by comparison with the results obtained for fundamental Si(001) substrates in the same conditions. For Si miscut substrate, a substantial enhancement in the density of the SiC NCs and a tendency of preferential alignment of them along the atomic step edges is observed. The SiC/Si interface is abrupt, without any steps and epitaxial growth with full relaxation of 3C-SiC occurs by domain matching epitaxy. The CO{sub 2} pressure and annealing time effect on NC growth is analyzed. The as-prepared SiC NCs can be engineered further for potential application in optoelectronic devices and/or as a seed for homoepitaxial SiC or heteroepitaxial GaN film growth. - Highlights: • Synthesis of 3C-SiC nanocrystals epitaxied on miscut-Si using a simple technique • Evidence of domain matching epitaxy at the SiC/Si interface • SiC growth proceeds along the (001) plane of host Si. • Substantial enhancement of the SiC nanocrystal density due to the miscut • Effect of the process parameters (CO{sub 2} pressure and annealing duration)
Dicty_cDB: Contig-U02054-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 0.080 1 ( DT656898 ) pgr1n.UA001.227 Normalized chicken reproductive t... 50 0.080 1 ( AJ454996 ) Gallus gallus EST, clone library...90810 XtSt10-30 Xenopus (Silurana) t... 36 0.17 2 ( DV037739 ) BRS3230 storage root cDNA library Ipomoea bat..... 44 4.9 1 ( BM959958 ) cihA1L9S Ascidian hemocytes cDNA library Ciona in... 44 4.9 1 ( BM230365 ) K0294C12-3 NIA Mouse Unferti...... 36 0.010 3 ( EY189411 ) LLAE1039S Spider Loxosceles laeta cDNA library Lo... ... riken1, clone 4e... 50 0.080 1 ( AJ453299 ) Gallus gallus EST, clone library riken1,
Search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c .
Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dorjkhaidav, O.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, S.; Gu, Y. T.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Kiese, P.; Kliemt, R.; Kloss, B.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Y. Y.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Morello, G.; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, J. J.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B. T.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Wei, J. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhou, Y. X.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.; Besiii Collaboration
2017-12-01
Using the data samples of (1310.6 ±7.2 )×106 J /ψ events and (448.1 ±2.9 )×106 ψ (3686 ) events collected with the BESIII detector, we search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c . No significant signals are observed and the corresponding upper limits on the branching fractions at the 90% confidence level are determined to be B (J /ψ →D0e+e-+c .c .)<8.5 ×10-8 and B (ψ (3686 )→D0e+e-+c .c .)<1.4 ×10-7 , respectively. Our limit on B (J /ψ →D0e+e-+c .c .) is more stringent by 2 orders of magnitude than the previous results, and B (ψ (3686 )→D0e+e-+c .c .) is measured for the first time.
C9ORF72 G4C2-repeat expansion and frontotemporal dementia first reported case in Argentina.
Fernández Suarez, M; Surace, Ezequiel; Harris, P; Tapajoz, F; Sevlever, G; Allegri, R; Russo, G N
2016-06-01
We present a female patient aged 51 who developed behavioral disorders followed by cognitive impairment over 3 years. Neuropsychological, neuropsychiatric, and radiological features suggested a probable behavioral variant of frontotemporal dementia (bvFTD). A family history of amyotrophic lateral sclerosis and parkinsonism suggested the hexanucleotide repeat expansion G4C2 in C9ORF72 . We set up a two-step genotyping algorithm for the detection of the expansion using fragment-length analysis polymerase chain reaction (PCR) and repeat-primed PCR with fluorescent primers. We confirmed the presence of an expanded G4C2 allele in the patient. This represents the first documented case of bvFTD due to a C9ORF72 expansion in Argentina.
International Nuclear Information System (INIS)
Zakharkin, K.I.; Zhigareva, G.G.; Antonovich, V.A.; Yanovskij, A.I.; Struchkov, Yu.T.
1986-01-01
Using the methods of 1 H and 11 B NMR-spectroscopy and X-ray diffraction analysis skeleton polyhedral rearrangements of carboranes are studied. During protonation of anion 8-R-7, 9-R' 2 -7, 9-C 2 B 9 H 9 - the skeleton polyhedral rearrangement in the series of nido-carboranes, resulting in 2,7-R' 2 -11-R-2, 7-C 2 B 9 H 10 (R=Me, PhCH 2 , R'=H, Me) is observed. The rearrangement is reversible. On the detachment of two protons from 2,7-Me 2 -11-PhCH 2 -2,7-C 2 B 9 H 10 and during subsequent protonation the skeleton polyhedral rearrangement with the formation of anion 9-PhCH 2 -7,8-Me 2 -7,8-C 2 B 9 H 9 - takes place
21 CFR 74.1260 - D&C Orange No. 10.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false D&C Orange No. 10. 74.1260 Section 74.1260 Food... COLOR ADDITIVES SUBJECT TO CERTIFICATION Drugs § 74.1260 D&C Orange No. 10. (a) Identity. (1) The color additive D&C Orange No. 10 is a mixture consisting principally of 4′,5′-diiodofluorescein, 2′,4′,5...
International Nuclear Information System (INIS)
Ricotti, Leonardo; Genchi, Giada G; Menciassi, Arianna; Polini, Alessandro; Iandolo, Donata; Pisignano, Dario; Ciofani, Gianni; Mattoli, Virgilio; Vazão, Helena; Ferreira, Lino
2012-01-01
This study aims at investigating the behavior in terms of the proliferation and skeletal muscle differentiation capability of two myoblastic cell lines, C2C12 and H9c2, on both isotropic and anisotropic electrospun nanofibrous poly(hydroxybutyrate) (PHB) scaffolds, as well as on PHB films and polystyrene controls. After a careful characterization of the matrices in terms of surface morphology, surface roughness and mechanical properties, the proliferation rate and the capability of the two cell lines to form skeletal myotubes were evaluated. Genetic analyses were also performed in order to assess the differentiation level of the cells on the different substrates. We demonstrated that the aligned nanofibrous mesh decreases the proliferation activity and provides a higher differentiative stimulus. We also clarified how the nanofibrous substrate influences myotube formation, and quantified a series of myotube-related parameters for both C2C12 and H9c2 cells. (paper)
Lifescience Database Archive (English)
Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006
Cytotoxicity of the coagulant Moringa oleifera lectin (cMoL) to B16-F10 melanoma cells.
de Andrade Luz, Luciana; Rossato, Franco Aparecido; Costa, Rute Alves Pereira E; Napoleão, Thiago Henrique; Paiva, Patrícia Maria Guedes; Coelho, Luana Cassandra Breitenbach Barroso
2017-10-01
Moringa oleifera seeds are used in alternative medicine to treat inflammation, tumors and bacterial and protozoan infections, for example. The seeds contain lectins, which are carbohydrate-binding proteins with several biological properties including cytotoxicity to cancer cells. In this work, we examined the cytotoxicity of the coagulant M. oleifera lectin (cMoL) on B16-F10 murine melanoma cells. cMoL cytotoxic effects were evaluated through trypan blue assay and flow cytometry analysis. Mitochondrial superoxide levels and activation of caspases 3, 8 and 9 were measured. cMoL (1.5-16μM) reduced viability and caused cell death of B16-F10 cells with an IC 50 of 9.72μM. Flow cytometry analysis indicated induction of necrosis and suggested the presence of cells in late apoptosis. Specificity for tumor cells was observed since death of normal human fibroblasts (GN) was not higher than 20% in treatments with cMoL from 1.5 to 16μM. Microscopy images revealed rounded shape and reduction of volume in B16-F10 cells treated with cMoL. cMoL increased mitochondrial ROS production and promoted caspases 3, 8 and 9 activation in B16-F10 cells, indicating the activation of apoptosis-related pathway. In conclusion, this study demonstrates that cMoL is cytotoxic to B16-F10 cells, which stimulates more investigation on the anticancer potential of this lectin. Copyright © 2017 Elsevier Ltd. All rights reserved.
The metabolic signature of C9ORF72-related ALS: FDG PET comparison with nonmutated patients
Energy Technology Data Exchange (ETDEWEB)
Cistaro, Angelina; Fania, Piercarlo [Positron Emission Tomography Center IRMET S.p.A, Torino (Italy); Pagani, Marco [Institute of Cognitive Sciences and Technologies, Consiglio Nazionale delle Ricerche (CNR), Rome (Italy); Karolinska Hospital, Department of Nuclear Medicine, Stockholm (Sweden); Montuschi, Anna; Moglia, Cristina; Canosa, Antonio [University of Torino, ' Rita Levi Montalcini' Department of Neuroscience, Torino (Italy); Calvo, Andrea; Lopiano, Leonardo [University of Torino, ' Rita Levi Montalcini' Department of Neuroscience, Torino (Italy); Neuroscience Institute of Turin, Turin (Italy); Restagno, Gabriella; Brunetti, Maura [Azienda Ospedaliera Citta della Salute e della Scienza, Molecular Genetics Unit, Department of Clinical Pathology, Torino (Italy); Traynor, Bryan J. [National Institute on Ageing, National Institutes of Health, Neuromuscular Diseases Research Unit, Laboratory of Neurogenetics, Bethesda, MD (United States); Nobili, Flavio [University of Genova, Clinical Neurophysiology Unit, Department of Neurosciences, Ophthalmology and Genetics, Genova (Italy); Carrara, Giovanna; Valentini, M.C. [Azienda Ospedaliera Citta della Salute e della Scienza, Department of Neuroradiology, Torino (Italy); Chio, Adriano [University of Torino, ' Rita Levi Montalcini' Department of Neuroscience, Torino (Italy); Neuroscience Institute of Turin, Turin (Italy); ALS Center, ' Rita Levi Montalcini' Department of Neuroscience, Torino (Italy)
2014-05-15
Recently, a GGGGCC hexanucleotide repeat expansion in the C9ORF72 gene, located on chromosome 9p21 has been demonstrated to be the commonest cause of familial amyotrophic lateral sclerosis (ALS) and to account for 5 to 10 % of apparently sporadic ALS. Relatively little is known about the brain metabolism profile of patients carrying the expansion. Our aim was to identify the [{sup 18}F]FDG PET profile in ALS patients with the C9ORF72 expansion (C9ORF72-ALS). Fifteen C9ORF72-ALS patients were compared with 12 patients with ALS and comorbid frontotemporal dementia (FTD) without the C9ORF72 expansion (ALS-FTD) and 30 cognitively normal patients with ALS without mutations of ALS-related genes (sALS). The three groups were then cross-matched to 40 neurologically normal controls. All patients underwent FDG PET within 4 months of diagnosis. The C9ORF72-ALS patients compared with the sALS patients showed significant hypometabolism in the anterior and posterior cingulate cortex, insula, caudate and thalamus, the left frontal and superior temporal cortex, and hypermetabolism in the midbrain, bilateral occipital cortex, globus pallidus and left inferior temporal cortex. The ALS-FTD patients compared with the sALS patients showed more limited hypometabolic areas, including the orbitofrontal, prefrontal, anterior cingulate and insular cortex, and hypermetabolic areas, including the bilateral occipital cortex, the left precentral and postcentral cortex and superior temporal gyrus. The C9ORF72-ALS patients compared with the ALS-FTD patients showed hypometabolism in the left temporal cortex. ALS patients with the C9ORF72 hexanucleotide repeat expansion had a more widespread central nervous system involvement than ALS patients without genetic mutations, with or without comorbid FTD, consistent with their more severe clinical picture. (orig.)
The metabolic signature of C9ORF72-related ALS: FDG PET comparison with nonmutated patients
International Nuclear Information System (INIS)
Cistaro, Angelina; Fania, Piercarlo; Pagani, Marco; Montuschi, Anna; Moglia, Cristina; Canosa, Antonio; Calvo, Andrea; Lopiano, Leonardo; Restagno, Gabriella; Brunetti, Maura; Traynor, Bryan J.; Nobili, Flavio; Carrara, Giovanna; Valentini, M.C.; Chio, Adriano
2014-01-01
Recently, a GGGGCC hexanucleotide repeat expansion in the C9ORF72 gene, located on chromosome 9p21 has been demonstrated to be the commonest cause of familial amyotrophic lateral sclerosis (ALS) and to account for 5 to 10 % of apparently sporadic ALS. Relatively little is known about the brain metabolism profile of patients carrying the expansion. Our aim was to identify the [ 18 F]FDG PET profile in ALS patients with the C9ORF72 expansion (C9ORF72-ALS). Fifteen C9ORF72-ALS patients were compared with 12 patients with ALS and comorbid frontotemporal dementia (FTD) without the C9ORF72 expansion (ALS-FTD) and 30 cognitively normal patients with ALS without mutations of ALS-related genes (sALS). The three groups were then cross-matched to 40 neurologically normal controls. All patients underwent FDG PET within 4 months of diagnosis. The C9ORF72-ALS patients compared with the sALS patients showed significant hypometabolism in the anterior and posterior cingulate cortex, insula, caudate and thalamus, the left frontal and superior temporal cortex, and hypermetabolism in the midbrain, bilateral occipital cortex, globus pallidus and left inferior temporal cortex. The ALS-FTD patients compared with the sALS patients showed more limited hypometabolic areas, including the orbitofrontal, prefrontal, anterior cingulate and insular cortex, and hypermetabolic areas, including the bilateral occipital cortex, the left precentral and postcentral cortex and superior temporal gyrus. The C9ORF72-ALS patients compared with the ALS-FTD patients showed hypometabolism in the left temporal cortex. ALS patients with the C9ORF72 hexanucleotide repeat expansion had a more widespread central nervous system involvement than ALS patients without genetic mutations, with or without comorbid FTD, consistent with their more severe clinical picture. (orig.)
Directory of Open Access Journals (Sweden)
Mojmír Baroň
2014-01-01
Full Text Available The issue of preventing the re-fermentation and protection against undesirable malolactic fermentation (MLF in order to safe content of acids in wine is very complicated. In this paper the saturated higher fatty acids (HFA – C8, C10 and C12, dimethyldicarbonate (DMDC and sulphur dioxide (SO2 were tested. The re-fermentation test showed the strongest inhibition power at ratio 2:8, 1:9 and 0:10 as C8:C10 acids – 65 days without re-fermentation. MLF experiments confirmed that addition of SO2 into the fermenting media causes rapid inhibition of lactic acid bacteria metabolic activity. Malic acid concentrations were proportionally decreasing during 6 days of experiment and at the end the content of this acid varied between 0.16 and 0.22 g/L, the only exception formed a variant with the addition of SO2 (1.57 g/L of malic acid. After calculation of the average consumption rate of malic acid, the results showed the inhibition power – SO2 (81.05% followed by variant of 40 mg/L mixture of HFA (40.76%, a variant of 200 mg/L of DMDC (31.98% and a variant of 20 mg/L mixture of HFA (12.59%. The addition of HFA can significantly reduce the dosage of other preservatives, especially SO2. Based on results, this method can be recommend in the production of wines with residual sugar and also wines made from over-mature material to prevent undesirable MLF.
Leaching studies on SYNROC at 950C and 2000C
International Nuclear Information System (INIS)
Oversby, V.M.; Ringwood, A.E.
1982-01-01
Crushed samples of SYNROC containing 9%, 16% and 20% of simulated high-level nuclear waste were tested for leaching behavior in distilled water at 95 0 C and 200 0 . Leach solutions were analyzed for Cs, Ca, Ba, Sr, Ti, Zr, Nd and U. Results showed that leach rates based on these elements did not change significantly as the waste loading was increased from 9 to 20%. At both temperatures, leach rates showed a decrease as leaching progressed until a plateau level was reached. Plateau leach rates, which were between 10 and 100 times lower than initial leach rates, reflect the expected long term leaching behaviour of the samples. Plateau values of leach rates for SYNROC depend on the element being leached. Highest values are found for Cs and Ba (1 to 2 x 10 -7 g/cm 2 d at 95 0 C) and lowest values for U (5 x 10 -10 g/cm 2 d at 95 0 C). Increasing leaching temperature to 200 0 C produces higher leach rates for all elements except Nd. Comparison of SYNROC leach rate data with that for PNL 76-68 glass shows that at 200 0 C the leach rate for U from SYNROC is 3000 times less than that from glass. (Auth.)
Dicty_cDB: Contig-U16238-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 5I14R Mouse 10kb plasmid UUGC2M library Mus ... 46 2.0 1 ( AZ954756 ) 2M0220N05R Mouse 10kb plasmid UUGC2M library...... 46 2.0 1 ( DT769112 ) EST1202962 Aquilegia cDNA library Aqui...legia formo... 46 2.0 1 ( DT765721 ) EST1199570 Aquilegia cDNA library Aquilegia formo... 46 2.0 1 ( DT76040...9 ) EST1194258 Aquilegia cDNA library Aquilegia formo... 46 2.0 1 ( DT753653 ) EST1187502 Aquilegia cDNA library... Aquilegia formo... 46 2.0 1 ( DR922919 ) EST1114458 Aquilegia cDNA library Aquilegia formo... 46 2.0 1
Lifescience Database Archive (English)
Full Text Available sequence update 2002. 9.10 Translated Amino Acid sequence ---TVSLLFSPLTKSVSPXKNL*lihmsx...xss Frame B: ---ngisslftfn*kcvtxkefvidpyvxgl*cxllnxhh Frame C: ---TVSLLFSPLTKSVSPXKNL*lihmsxdynvxy*xii Homol
Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5b6 and sC5b9
Directory of Open Access Journals (Sweden)
Michael A. Hadders
2012-03-01
Full Text Available Activation of the complement system results in formation of membrane attack complexes (MACs, pores that disrupt lipid bilayers and lyse bacteria and other pathogens. Here, we present the crystal structure of the first assembly intermediate, C5b6, together with a cryo-electron microscopy reconstruction of a soluble, regulated form of the pore, sC5b9. Cleavage of C5 to C5b results in marked conformational changes, distinct from those observed in the homologous C3-to-C3b transition. C6 captures this conformation, which is preserved in the larger sC5b9 assembly. Together with antibody labeling, these structures reveal that complement components associate through sideways alignment of the central MAC-perforin (MACPF domains, resulting in a C5b6-C7-C8β-C8α-C9 arc. Soluble regulatory proteins below the arc indicate a potential dual mechanism in protection from pore formation. These results provide a structural framework for understanding MAC pore formation and regulation, processes important for fighting infections and preventing complement-mediated tissue damage.
Dicty_cDB: Contig-U15132-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s) Value N ( C22922 ) Dictyostelium discoideum gamete cDNA, clone FC-AM03. 1122 0.0 1 ( EY489954 ) CBBP17356.rev CBBP Hirudo medicina...lis hermaphrodi... 56 9e-12 4 ( EY481037 ) CBBP11163.rev CBBP Hirudo medicinalis he...( CZ542454 ) SRAA-aad44c05.g1 Strongyloides ratti whole genome... 66 1e-10 3 ( EY491469 ) CBBP18281.fwd CBBP Hirudo medicina...lis hermaphrodi... 56 3e-10 2 ( EY481038 ) CBBP11163.fwd CBBP Hirudo medicina...lis hermaphrodi... 56 3e-10 2 ( EY489955 ) CBBP17356.fwd CBBP Hirudo medicinalis hermaphrodi...
Energy Technology Data Exchange (ETDEWEB)
Lewis, D J; Gonska, H; Karcher, W
1984-01-01
The closed cup flashpoints of five pure hydrocarbon materials (iso-octane, toluene, n-dodecane, n-tetradecane and n-hexadecane) have been determined by equilibrium methods in an interlaboratory exercise, involving twelve laboratories of the European Community member countries and one laboratory of the Commission of the European Communities. The methods used were based on IP303/74 (or ASTM D3278-73; Rapid Tester) and IP304/74 (Abel, Abel-Pensky, Pensky-Martens Cups) with extension to allow equilibrium conditions to be maintained outside the ranges of these methods. For each hydrocarbon material, the numbers of individual measurements accepted have been between 81 and 92. As a result, the closed cup flashpoints of these materials by an equilibrium method are certified at the following temperatures: CRM No. Hydrocarbon Equilibrium closed cup flashpoint 83 iso-octane -9.5 +- 0.5/sup 0/C 84 toluene +6.0 +- 0.5/sup 0/C 85 n-dodecane +81.0 +- 1.0/sup 0/C 86 n-tetradecane +108.0 +- 1.0/sup 0/C 87 n-hexadecane +133.5 +- 1.0/sup 0/C. This report describes the experimental details of the interlaboratory measurements and the certification procedure. The procedure required extensions to be made to methods IP303/74 and IP304/74 which are given in detail and recommendations are made for the improvement of these methods over the temperature range covered by the flashpoint reference materials.
Lifescience Database Archive (English)
Full Text Available ificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL15...142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA ...(cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006
International Nuclear Information System (INIS)
Rodak, Kinga; Hernas, Adam; Vodarek, Vlastimil
2015-01-01
Microstructural changes in high alloy (9-12% Cr) creep resistant martensitic X10CrMoVNb9-1 and 12CrMoW . CuVNb steels after 100 000 h of steam exposure at 550 C have been studied using scanning transmission electron microscopy. Precipitates were identified using electron diffraction patterns and energy dispersive X-ray spectroscopy analysis. After long time exposure, a significant coarsening of M 23 C 6 carbides, and intensive precipitation of the coarse Laves phase were observed. Moreover, in the 12CrMoW . CuVNb steel, a low amount of the modified Z-phase particles was detected. The microstructures of the X10Cr . MoVNb9-1 and 12CrMoWCuVNb steels after 100 000 h of exposure differ in several aspects.
Energy Technology Data Exchange (ETDEWEB)
Rodak, Kinga; Hernas, Adam [Silesian Univ. of Technology, Inst. of Materials Science, Katowice (Poland); Vodarek, Vlastimil [VSB-Technical Univ. of Ostrava (Czech Republic)
2015-07-15
Microstructural changes in high alloy (9-12% Cr) creep resistant martensitic X10CrMoVNb9-1 and 12CrMoW . CuVNb steels after 100 000 h of steam exposure at 550 C have been studied using scanning transmission electron microscopy. Precipitates were identified using electron diffraction patterns and energy dispersive X-ray spectroscopy analysis. After long time exposure, a significant coarsening of M{sub 23}C{sub 6} carbides, and intensive precipitation of the coarse Laves phase were observed. Moreover, in the 12CrMoW . CuVNb steel, a low amount of the modified Z-phase particles was detected. The microstructures of the X10Cr . MoVNb9-1 and 12CrMoWCuVNb steels after 100 000 h of exposure differ in several aspects.
26 CFR 1.381(c)(9)-1 - Amortization of bond discount or premium.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Amortization of bond discount or premium. 1.381(c)(9)-1 Section 1.381(c)(9)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(9)-1 Amortization of...
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Fees. 9.85 Section 9.85 Energy NUCLEAR REGULATORY COMMISSION PUBLIC RECORDS Privacy Act Regulations Fees § 9.85 Fees. Fees shall not be charged for search or... available for review, although fees may be charged for additional copies. Fees established under 31 U.S.C...
Dicty_cDB: Contig-U15610-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 32 1 ( DT767192 ) EST1201041 Aquilegia cDNA library Aquilegia formo... 42 0.040 3 ( EU151142 ) Haemophilus haemolyticu...e... 48 2.0 1 ( ET896158 ) CHO_OF385xi02r1.ab1 CHO_OF Nicotiana tabacum geno... 48 2.0 1 ( EI773383 ) PM1006E24TF BAC library...46 7.9 1 ( AG294250 ) Mus musculus molossinus DNA, clone:MSMg01-070C15.... 46 7.9 1 ( ES370059 ) 5-CP713-021G04 Normalized cDNA libra...03850-501 Normalized CNS library (juven... 42 1.1 2 ( EX859113 ) CBNF4825.rev CBN... 4 ( DU743946 ) ASNC1989.g2 HF10_10-07-02 uncultured marine micro... 38 2.5 3 ( EK037583 ) 1092959478755 Glo
Eganhouse, R.P.; Dorsey, T.F.; Phinney, C.S.; Westcott, A.M.
1993-01-01
A method is described for the determination of the C6-C10 aromatic hydrocarbons in water based on purge-and-trap capillary gas chromatography with flame ionization and mass spectrometric detection. Retention time data and 70 eV mass spectra were obtained for benzene and all 35 C7-C10 aromatic hydrocarbons. With optimized chromatographic conditions and mass spectrometric detection, benzene and 33 of the 35 alkylbenzenes can be identified and measured in a 45-min run. Use of a flame ionization detector permits the simultaneous determination of benzene and 26 alkylbenzenes.
Genetic Association of the Porcine C9 Complement Component with Hemolytic Complement Activity
Directory of Open Access Journals (Sweden)
D. V. A. Khoa
2015-09-01
Full Text Available The complement system is a part of the natural immune regulation mechanism against invading pathogens. Complement activation from three different pathways (classical, lectin, and alternative leads to the formation of C5-convertase, an enzyme for cleavage of C5 into C5a and C5b, followed by C6, C7, C8, and C9 in membrane attack complex. The C9 is the last complement component of the terminal lytic pathway, which plays an important role in lysis of the target cells depending on its self-polymerization to form transmembrane channels. To address the association of C9 with traits related to disease resistance, the complete porcine C9 cDNA was comparatively sequenced to detect single nucleotide polymorphisms (SNPs in pigs of the breeds Hampshire (HS, Duroc (DU, Berlin miniature pig (BMP, German Landrace (LR, Pietrain (PIE, and Muong Khuong (Vietnamese potbelly pig. Genotyping was performed in 417 F2 animals of a resource population (DUMI: DU×BMP that were vaccinated with Mycoplasma hyopneumoniae, Aujeszky diseases virus and porcine respiratory and reproductive syndrome virus at 6, 14 and 16 weeks of age, respectively. Two SNPs were detected within the third exon. One of them has an amino acid substitution. The European porcine breeds (LR and PIE show higher allele frequency of these SNPs than Vietnamese porcine breed (MK. Association of the substitution SNP with hemolytic complement activity indicated statistically significant differences between genotypes in the classical pathway but not in the alternative pathway. The interactions between eight time points of measurement of complement activity before and after vaccinations and genotypes were significantly different. The difference in hemolytic complement activity in the both pathways depends on genotype, kind of vaccine, age and the interaction to the other complement components. These results promote the porcine C9 (pC9 as a candidate gene to improve general animal health in the future.
1987-01-01
22 7.V.: 14 -1b Jil -7 1 N.- .- WETLANDS RESEARCH PROGRAM TECHNICAL REPORT Y-87-1 CORPS OF ENGINEERS WETLANDS DELINEATION MANUAL APPENDIX C SECTIONS ...ARMYLA- US Army Corps of Engineers Washington, DC 20314-1000 B , , , -I *. 4 -w *" APPENDIX C SECTION 1 NATIONAL LIST OF PLANT SPECIES THAT OCCUR IN...Redtop FACW A. hiernalia (Walter) B.S.P. Winter bent FAC A. scabra Wilid. Rough bentgrass FAC A. st~nfyaL. Carpet bentgrass FACW Aletris aurea
Pharmacogenetic Variation at CYP2D6, CYP2C9, and CYP2C19: Population Genetic and Forensic Aspects
Sistonen, Johanna
2008-01-01
Pharmacogenetics deals with genetically determined variation in drug response. In this context, three phase I drug-metabolizing enzymes, CYP2D6, CYP2C9, and CYP2C19, have a central role, affecting the metabolism of about 20-30% of clinically used drugs. Since genes coding for these enzymes in human populations exhibit high genetic polymorphism, they are of major pharmacogenetic importance. The aims of this study were to develop new genotyping methods for CYP2D6, CYP2C9, and CYP2C19 that would...
Dorado, P; López-Torres, E; Peñas-Lledó, E M; Martínez-Antón, J; Llerena, A
2013-08-01
Pharmacogenetic studies have shown that genetic defects in drug-metabolizing enzymes encoded by CYP2C9, CYP2C19 genes and by the transporter ABCB1 gene can influence phenytoin (PTH) plasma levels and toxicity. The patient reported here is a 2-year-old girl with a medical history of cryptogenic (probably symptomatic) epilepsy, who had her first focal seizure with secondary generalization at 13 months of age. She initially received oral valproate treatment and three months later, she was prescribed an oral oxcarbazepine treatment. At 20 months of age, she was admitted to the Emergency Department because of generalized convulsive Status Epilepticus needing to be immediately treated with rectal diazepam (0.5 mg kg(-1)), intravenous diazepam (0.3 mg kg(-1)), and intravenous phenytoin with an initial-loading dose of 15 mg kg(-1). However, two hours after the initial-loading dose of PTH, the patient developed dizziness, nystagmus, ataxia and excessive sedation. Other potential causes of PTH toxicity were excluded such as drug interactions, decreased albumin or lab error. Therefore, to explain the neurological toxicity, PTH plasma levels and CYP2C9, CYP2C19 and ABCB1 genetic polymorphisms were analyzed. Initial plasma PTH levels were higher than expected (69 mg l(-1); normal range: 10-20 mg l(-1)), and the patient was homozygous for the CYP2C9*2 allele, heterozygous for the CYP2C19*4 allele and homozygous for the 3435C and 1236C ABCB1 alleles. Present findings support the previously established relationship between CYP2C9 and CYP2C19 genetic polymorphisms and the increased risk to develop PTH toxicity owing to high plasma concentrations. Nevertheless, although the association of these genes with PTH-induced adverse effects has been well-documented in adult populations, this is the first report examining the influence of these genetic polymorphisms on PTH plasma levels and toxicity in a pediatric patient.
Lifescience Database Archive (English)
Full Text Available nificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 4e-21 ...none) Micromonas sp. RCC299 chromosome... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 BC171956_1( BC17...1956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 AB006708_10( AB006708 |pid:none) Arabidopsis
Antiproton-nucleus interactions at 5 to 9 GeV/c
International Nuclear Information System (INIS)
Ahmad, S.; Bonner, B.E.; Buchanan, J.A.; Chan, C.S.; Clement, J.M.; Eiseman, S.E.; Empl, A.; Etkin, A.; Foley, K.J.; Hackenburg, R.W.; Hallman, T.J.; Kramer, M.A.; Kruk, J.; Lindenbaum, S.J.; Longacre, R.S.; Love, W.A.; Madansky, L.; Morris, W.; Mutchler, G.S.; Peaslee, D.C.; Platner, E.D.; Saulys, A.C.; Toshkov, S.
1993-01-01
Antiproton beams of 5, 7 and 9 GeV/c were used to interact with C, Al, Cu, Sn and Pb nuclear targets. Charged particle multiplicity distributions, strange particle production cross sections and rapidity distributions were measured. The charged particle multiplicities are reported in this paper. (orig.)
Optical and Near-infrared Polarimetry of Non-periodic Comet C/2013 US10 (Catalina)
Energy Technology Data Exchange (ETDEWEB)
Kwon, Yuna Grace; Ishiguro, Masateru; Lee, Myung Gyoon [Department of Physics and Astronomy, Seoul National University, 1 Gwanak, Seoul 08826 (Korea, Republic of); Kuroda, Daisuke; Toda, Hiroyuki; Yanagisawa, Kenshi [Okayama Astrophysical Observatory, National Astronomical Observatory of Japan, 3037-5 Honjo, Kamogata, Asakuchi, Okayama, 719-0232 (Japan); Hanayama, Hidekazu [Ishigakijima Astronomical Observatory, National Astronomical Observatory of Japan, 1024-1 Arakawa, Ishigaki, Okinawa 907-0024 (Japan); Kawabata, Koji S.; Nakaoka, Tatsuya [Hiroshima Astrophysical Science Center, Hiroshima University, Kagamiyama 1-3-1, Higashi-Hiroshima 739-8526 (Japan); Akitaya, Hiroshi [Center for Astronomy, Ibaraki University, 2-1-1 Bunkyo, Mito, Ibaraki 310-8512 (Japan); Itoh, Ryosuke; Kawai, Nobuyuki [Department of Physics, Tokyo Institute of Technology, Meguro, Tokyo 152-8551 (Japan); Ohta, Kouji [Department of Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Yoshida, Michitoshi [Subaru Telescope, National Astronomical Observatory of Japan, Hilo, HI 96720 (United States); Watanabe, Jun-Ichi, E-mail: ishiguro@astro.snu.ac.kr [National Astronomical Observatory, Mitaka, Tokyo 181-8588 (Japan)
2017-10-01
We present an optical and near-infrared (hereafter NIR) polarimetric study of a comet C/2013 US10 (Catalina) observed on UT 2015 December 17–18 at phase angles of α = 52.°1–53.°1. Additionally, we obtained an optical spectrum and multi-band images to examine the influence of gas emission. We find that the observed optical signals are significantly influenced by gas emission; that is, the gas-to-total intensity ratio varies from 5 to 30% in the R {sub C} and 3%–18% in the I {sub C} bands, depending on the position in the coma. We derive the “gas-free dust polarization degrees” of 13.8% ± 1.0% in the R {sub C} and 12.5% ± 1.1% in the I {sub C} bands and a gray polarimetric color, i.e., −8.7% ± 9.9% μ m{sup −1} in optical and 1.6% ± 0.9% μ m{sup −1} in NIR. The increments of polarization obtained from the gas correction show that the polarimetric properties of the dust in this low-polarization comet are not different from those in high-polarization comets. In this process, the cometocentric distance dependence of polarization has disappeared. We also find that the R {sub C}-band polarization degree of the southeast dust tail, which consists of large dust particles (100 μ m–1 mm), is similar to that in the outer coma where small and large ones are mixed. Our study confirms that the dichotomy of cometary polarization does not result from the difference of dust properties, but from depolarizing gas contamination. This conclusion can provide a strong support for similarity in origin of comets.
Vapour pressures and heat capacity measurements on the C7-C9 secondary aliphatic alcohols
International Nuclear Information System (INIS)
Verevkin, Sergey P.; Schick, Christoph
2007-01-01
Molar enthalpies of vaporization of secondary C 7 -C 9 alkanols were obtained from the temperature dependence of the vapour pressure measured by the transpiration method. The measured data sets were checked for internal consistency successfully. A large number of the primary experimental results on temperature dependences of vapour pressures of secondary alcohols have been collected from the literature and have been treated uniform in order to derive their vaporization enthalpies at the reference temperature 298.15 K. This collection, together with our experimental results, have helped to ascertain the database for branched aliphatic alcohols
Structural and functional brain signatures of C9orf72 in motor neuron disease.
Agosta, Federica; Ferraro, Pilar M; Riva, Nilo; Spinelli, Edoardo Gioele; Domi, Teuta; Carrera, Paola; Copetti, Massimiliano; Falzone, Yuri; Ferrari, Maurizio; Lunetta, Christian; Comi, Giancarlo; Falini, Andrea; Quattrini, Angelo; Filippi, Massimo
2017-09-01
This study investigated structural and functional magnetic resonance imaging abnormalities in hexanucleotide repeat expansion in chromosome 9 open reading frame 72 (C9orf72) motor neuron disease (MND) relative to disease severity-matched sporadic MND cases. We enrolled 19 C9orf72 and 67 disease severity-matched sporadic MND patients, and 22 controls. Sporadic cases were grouped in patients with: no cognitive/behavioral deficits (sporadic-motor); same patterns of cognitive/behavioral impairment as C9orf72 cases (sporadic-cognitive); shorter disease duration versus other sporadic groups (sporadic-early). C9orf72 patients showed cerebellar and thalamic atrophy versus all sporadic cases. All MND patients showed motor, frontal, and temporoparietal cortical thinning and motor and extramotor white matter damage versus controls, independent of genotype and presence of cognitive impairment. Compared with sporadic-early, C9orf72 patients revealed an occipital cortical thinning. C9orf72 patients had enhanced visual network functional connectivity versus sporadic-motor and sporadic-early cases. Structural cerebellar and thalamic damage and posterior cortical alterations are the brain magnetic resonance imaging signatures of C9orf72 MND. Frontotemporal cortical and widespread white matter involvement are likely to be an effect of the disease evolution rather than a C9orf72 marker. Copyright © 2017 Elsevier Inc. All rights reserved.
Dicty_cDB: Contig-U00762-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s nodule library 5 and... 42 0.012 2 ( BI417355 ) LjNEST38c2r Lotus japonicus nodule library...KT7B.103O19F.060124T7 KT7 Nicotiana tabacum cDNA ... 36 0.012 2 ( CK417989 ) AUF_IpInt_57_n24 Intestine cDNA library Ictalur...3' end. 42 0.012 2 ( FG637668 ) TT-33_B14 Samsun trichome library Nicotiana tabac... 36 0.012 2 ( CX557480 ) yda37e04.y2 Sea ur...( CX552206 ) ydb21c02.y2 Sea urchin EST Lib1 Strongylocentrotu... 42 9e-04 2 ( DN149991 ) 5218_B03_C06 Switchgrass callus cDNA librar...10F Mouse 10kb plasmid UUGC1M library Mus ... 42 0.003 2 ( BQ858872 ) QGC11H15.yg.ab1 QG_ABCDI lettuce salinas Lactu
Ferroelectric response in an achiral non-symmetric bent liquid crystal:C{sub 12}C{sub 10}
Energy Technology Data Exchange (ETDEWEB)
Subrahmanyam, S.V.; Chalapathi, P.V. [Department of Physics, University College of Engineering, Jawaharlal Nehru Technological University Kakinada, Kakinada 533003 (India); Mahabaleshwara, S.; Srinivasulu, M. [Department of Chemistry, Manipal Institute of Technology, Manipal University, Manipal 576104 (India); George, A.K. [Department of Physics, College of Sciences, Sultan Qaboos University, PO Box-36, PC-123, Muscat (Oman); Potukuchi, D.M., E-mail: potukuchidm@yahoo.com [Department of Physics, University College of Engineering, Jawaharlal Nehru Technological University Kakinada, Kakinada 533003 (India)
2014-10-01
An achiral Non-Symmetric Bent Liquid Crystal (BLC) with a Oxadiazole based hetero cyclic central moiety, abbreviated as C{sub 12}C{sub 10} viz., dodecyl[4-{5-(4′-decyloxy)biphenyl-4-yl}-1,2,4-oxadiazol-3-yl]benzoate, exhibiting FerroElectric (FE) response is reported. Product is confirmed by {sup 1}H NMR, {sup 13}C NMR and elemental analysis. Characterization of BLC phases is carried out by Polarized Optical Microscopy (POM), Differential Scanning Calorimetry (DSC), Spontaneous Polarization (P{sub S}) and Low Frequency (10 Hz–10 MHz) Dielectric Relaxation studies. C{sub 12}C{sub 10} exhibits enantiotropic LC SmA, FE B{sub 2}, SmG, SmE phase variance. I–SmA, B{sub 2}–SmG and SmG–SmE transitions are of first order nature. FE B{sub 2} phases exhibits a moderate P{sub S} of ∼80 nC cm{sup −2}. B{sub 2} phase exhibits Curie–Weiss behavior to confirm FE nature. Off-centered low frequency (KHz) dispersion infers a scissor mode and a high frequency (MHz) mode to reflect the distinct time-scale response. Dielectric Dispersion is relatively susceptible in lower frequency KHz region. Arrhenius shift in Relaxation Frequency (f{sub R}) infers higher activation energy (E{sub a}) in non-FE phases for HF mode and lower value for KHz mode. Trends of f{sub R}, dielectric strength Δε, α-parameter and E{sub a} are discussed in view of the data reported in other LC compounds.
The analyzing power Asub(y)[(theta) for 12C(n,nsub(0,1))12C betwen 8.9 and] 14.9 MeV neutron energy
International Nuclear Information System (INIS)
Woye, E.; Tornow, W.; Mack, G.; Clegg, T.B.; Wylie, W.
1983-01-01
The analyzing power Asub(#betta#)(theta) for 12 C(n,n) 12 C elastic scattering and for inelastic scattering to the first excited state (Jsup(π) = 2 + , Q = -4.44 MeV) of 12 C was measured in the energy range from 8.9 to 14.9 MeV in 1 MeV steps. A pulsed polarized neutron beam was produced via the 2 H(d vector,n vector) 3 He polarization transfer reaction. Monte Carlo simulations were used to correct the data for finite geometry and multiple scattering effects. The Asub(#betta#) data, together with publsihed cross-section data, were analyzed in the framework of the spherical optical model and in the coupled-channels formalism. A good description of the data has been achieved. (orig.)
Directory of Open Access Journals (Sweden)
Yuyang Du
2018-04-01
Full Text Available Araloside C (AsC is a cardioprotective triterpenoid compound that is mainly isolated from Aralia elata. This study aims to determine the effects of AsC on hypoxia-reoxygenation (H/R-induced apoptosis in H9c2 cardiomyocytes and its underlying mechanisms. Results demonstrated that pretreatment with AsC (12.5 μM for 12 h significantly suppressed the H/R injury in H9c2 cardiomyocytes, including improving cell viability, attenuating the LDH leakage and preventing cardiomyocyte apoptosis. AsC also inhibited H/R-induced ER stress by reducing the activation of ER stress pathways (PERK/eIF2α and ATF6, and decreasing the expression of ER stress-related apoptotic proteins (CHOP and caspase-12. Moreover, AsC greatly improved the expression level of HSP90 compared with that in the H/R group. The use of HSP90 inhibitor 17-AAG and HSP90 siRNA blocked the above suppression effect of AsC on ER stress-related apoptosis caused by H/R. Taken together, AsC could reduce H/R-induced apoptosis possibly because it attenuates ER stress-dependent apoptotic pathways by increasing HSP90 expression.
Energy Technology Data Exchange (ETDEWEB)
Vikas, Shailendra; Wood-Vasey, W. Michael [Pittsburgh Particle Physics, Astrophysics, and Cosmology Center (PITT PACC), Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA 15260 (United States); Lundgren, Britt [Department of Physics, Yale University, New Haven, CT 06511 (United States); Ross, Nicholas P. [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 92420 (United States); Myers, Adam D. [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States); AlSayyad, Yusra [Department of Astronomy, University of Washington, Seattle, WA 98195 (United States); York, Donald G. [Department of Astronomy, University of Chicago, 5640 S. Ellis Ave, Chicago, IL 60637 (United States); Schneider, Donald P. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Brinkmann, J.; Bizyaev, Dmitry; Brewington, Howard; Malanushenko, Elena; Malanushenko, Viktor; Oravetz, Daniel; Pan, Kaike; Snedden, Stephanie [Apache Point Observatory, P.O. Box 59, Sunspot, NM 88349-0059 (United States); Ge, Jian [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Muna, Demitri [Center for Cosmology and Particle Physics, New York University, New York, NY 10003 (United States); Paris, Isabelle; Petitjean, Patrick, E-mail: skv4@pitt.edu [UPMC-CNRS, UMR7095, Institut d' Astrophysique de Paris, F-75014 Paris (France); and others
2013-05-01
We measure the two-point cross-correlation function of C IV absorber systems and quasars, using spectroscopic data from the Sloan Digital Sky Survey III Baryon Oscillation Spectroscopic Survey (BOSS; Data Release 9). The 19,701 quasars and 6149 C IV ''moderate'' absorbers, 0.28 A < rest-frame equivalent width (EW) < 5 A, in our study cover a redshift range of 2.1 < z < 2.5 over 3300 deg{sup 2} and represent a factor of two increase in sample size over previous investigations. We find a correlation scale length and slope of the redshift-space cross-correlation function of s{sub 0} = 8.46 {+-} 1.24 Mpc, {gamma} = 1.68 {+-} 0.19, in the redshift-space range 10 < s < 100 Mpc. We find a projected cross-correlation function of C IV absorption systems and quasars of r{sub 0} = 7.76 {+-} 2.80 Mpc, {gamma} = 1.74 {+-} 0.21. We measure the combined quasar and C IV bias to be b{sub QSO} b{sub C{sub IV}} = 8.81 {+-} 2.28. Using an estimate of b{sub QSO} from the quasar auto-correlation function we find b{sub CIV} = 2.38 {+-} 0.62. This b{sub CIV} implies that EW > 0.28 A C IV absorbers at z {approx} 2.3 are typically found in dark matter halos that have masses {>=}10{sup 11.3}-10{sup 13.4} M{sub Sun} at that redshift. The complete BOSS sample will triple the number of both quasars and absorption systems and increase the power of this cross-correlation measurement by a factor of two.
Analysis list: Kmt2c [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Kmt2c Embryonic fibroblast,Liver,Muscle + mm9 http://dbarchive.biosciencedbc.jp/kyu...shu-u/mm9/target/Kmt2c.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Kmt2c.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/target/Kmt2c.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Km...t2c.Embryonic_fibroblast.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/...Kmt2c.Liver.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Kmt2c.Muscle.tsv http://dbarchive.bioscience
Characterisation of 10 kV 10 A SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Incau, Bogdan Ioan; Munk-Nielsen, Stig
2015-01-01
The objective of this paper is to characterize and evaluate the static and dynamic performances of 10 kV 10 A 4H-SIC MOSFETs at high temperatures. The results show good electrical performances of the SiC MOSFETs for high temperature operations. The double-pulse test results showed interesting...
Fluoride induces apoptosis in H9c2 cardiomyocytes via the mitochondrial pathway.
Yan, Xiaoyan; Wang, Lu; Yang, Xia; Qiu, Yulan; Tian, Xiaolin; Lv, Yi; Tian, Fengjie; Song, Guohua; Wang, Tong
2017-09-01
Numerous studies have shown that chronic excessive fluoride intake can adversely affect different organ systems. In particular, the cardiovascular system is susceptible to disruption by a high concentration of fluoride. The objectives of this study were to explore the mechanism of apoptosis by detecting the toxic effects of different concentrations of sodium fluoride (NaF) in H9c2 cells exposed for up to 96 h. NaF not only inhibited H9c2 cell proliferation but also induced apoptosis and morphological damage. With increasing NaF concentrations, early apoptosis of H9c2 cells was increased while the mitochondrial membrane potential was decreased. Compared with the control group, the mRNA levels of caspase-3, caspase-9, and cytochrome c all increased with increasing concentrations of NaF. In summary, these data suggest that apoptosis is involved in NaF-induced H9c2 cell toxicity and that activation of the mitochondrial pathway may occur. Copyright © 2017 Elsevier Ltd. All rights reserved.
Effect of CYP2C9*3 gene polymorphism on lipid-lowering efficacy of ...
African Journals Online (AJOL)
Purpose: To investigate the frequency of gene CYP2C9*3 in Chinese populations, and to analyze the impact of CYP2C9*3 genetic polymorphism on the cholesterol-lowering effect of fluvastatin in a Chinese hyperlipidemic population. Methods: CYP2C9 genotype was determined by polymerase chain reaction - restriction ...
Characterization of Material from Wells 299-W10-35 (C7573) and 299-W14-74 (C7024)
International Nuclear Information System (INIS)
Tilton, Fred A.; Wellman, Dawn M.; Bovaird, Chase C.; Strandquist, Sara C.
2011-01-01
The objective of this work was to characterize material accumulating on wells 299-W10-35 (C7573) and 299-W14-74 (C7024) to determine the type of material (i.e., chemical or biological) and, if the material is biological, to identify the microorganisms present. Extraction and injection wells 299-W10-35 (C7573) and 299-W14-74 (C7024) possess unknown material attached to the well screens (Figure 1). Both wells are located on the Hanford Site. Well 299-W10-35 (C7573) is located west of the 218-W-3A dry waste burial ground, west of Dayton Avenue, and north of 23rd Street and has accumulated white material on the screen and in the sump. Well 299-W14-74 (C7024) is located south of 23rd Street and east of Beloit Avenue. There are two types of material: one is reddish/orange (hypothesized to be iron-utilizing bacterial colonies) and the other is white and may or may not be biological. CH2M HILL Plateau Remediation Company (CHPRC) is conducting onsite sampling for total organic carbon, calcium carbonate, and metals. Table 1 presents chemical data for the groundwater samples associated with these materials. The objective of this work was to characterize material accumulating on wells 299-W10-35 (C7573) and 299-W14-74 (C7024) to determine the type of material (i.e., chemical or biological), and if the material is biological, to identify the microorganisms present.
Energy Technology Data Exchange (ETDEWEB)
Paoli, H.
2002-11-01
Surface-active synthesis by the way of LAB (Linear Alkyl Benzene) chain needs linear alkanes between C10 and C14. The petroleum cut used is a mixture of linear and branched paraffins, and therefore a separation is needed. It is realised using of a Simulated Counter Current process, developed and licensed by IFP. The molecular sieve employed, i.e. zeolite 5A, is obtained by ion exchange and thermal treatment from a 4A zeolite. These post synthesis operations modify the adsorbent structure and consequently its adsorption and diffusion properties. After having obtained a range as complete as possible of samples of various exchange ratios and treated in various conditions, we have characterised these adsorbent structures by X-Rays Diffraction. A limited number of structures has been refined by the Rietveld method, on the basis of anomalous diffraction experiments at the Ca K edge. Aluminium NMR was used as well. These structural data allowed to explain adsorption properties modifications of various probe molecules (H{sub 2}O, nC{sub 6}, nC{sub 10} and nC{sub 14}) studied by TPD and diffusion properties modifications studied by Quasi Elastic Neutron Scattering. (author)
Lifescience Database Archive (English)
Full Text Available ichosuri cDNA 5' similar to SW:HUTH_CAEEL Q20502 PROBABLE HISTIDINE AMMONIA-LYASE...W:HUTH_CAEEL Q20502 PROBABLE HISTIDINE AMMONIA-LYASE ;, mRNA sequence. 44 1.4 1 dna update 2003. 9.10 Homolo
Investigation into solubility and diffusion in SiC-NbC, SiC-TiC, SiC-ZrC systems
International Nuclear Information System (INIS)
Safaraliev, G.K.; Tairov, Yu.M.; Tsvetkov, V.F.; Shabanov, Sh.Sh.
1991-01-01
An investigation is carried out which demonstrates solid-phase interaction between SiC and NbC, TiC and ZrC monocrystals. The monocrystals are subjected to hot pressing in SiC powder with dispersity of 5x10 -6 m. The pressing temperature is 2270-2570 K and pressure is varied in the range of 20-40 MPa. Element composition and the distribution profile in a thin layer near the boundary of SiC-NbC, SiC-TiC and SiC-ZrC are investigated by the Anger spectroscopy method. The obtained results permit to make the conclusion in the possibility of solid solution formation in investigated systems
Vassbotn, F S; Skar, R; Holmsen, H; Lillehaug, J R
1992-09-01
The effect of platelet-derived growth factor (PDGF) on c-fos mRNA transcription was studied in the immortalized mouse embryo fibroblast C3H/10T1/2 Cl 8 (10T1/2) cells and the chemically transformed, tumorigenic subclone C3H/10T1/2 Cl 16 (Cl 16). In the 10T1/2 cells as well as the Cl 16 subclone, the dose-dependent PDGF stimulation of c-fos mRNA synthesis was similar in both logarithmically growing and confluent cultures. c-fos mRNA was induced severalfold by 12-O-tetradecanoylphorbol-13-acetate (TPA) in both 10T1/2 and Cl 16. Down-regulation of protein kinase C (PKC) activity by TPA pretreatment inhibited PDGF-stimulated c-fos mRNA expression in Cl 16 cells but did not affect this induction in the 10T1/2 cells. This inhibition was not a general phenomenon of 3-methylcholanthrene-mediated transformation of 10T1/2 cells since experiments with another transformed 10T1/2 cell clone, C3H/10T1/2 TPA 482, gave qualitatively the same results as the 10T1/2 cells. Receptor binding experiments showed that the nontransformed and transformed cells had a comparable number of PDGF receptors, 1.3 x 10(5) and 0.7 x 10(5) receptors per cell, respectively. Furthermore, cAMP-induced c-fos expression induced by forskolin is formerly shown to be independent of PKC down-regulation. In our experiments, forskolin induced c-fos expression in both clones. However, PKC down-regulation inhibited the forskolin-induced c-fos expression in Cl 16 cells. This apparently demonstrates cross talk between PKC and PKA in the c-fos induction pathway. The present results provide evidence for an impaired mechanism for activating c-fos expression through PKC-independent, PDGF-induced signal transduction in the chemically transformed Cl 16 fibroblasts compared to that in nontransformed 10T1/2 cells.
Lessons learned from fossil FAC assessments
Energy Technology Data Exchange (ETDEWEB)
Dooley, R. Barry; Shields, Kevin J. [Structural Integrity Associates, Inc., Oakville, ON (Canada); Shulder, Stephen J. [Structural Integrity Associates, Inc., Annapolis, MD (United States)
2010-09-15
In their work the authors have noted great diversity in the Flow-Accelerated Corrosion (FAC) Programs used at conventional fossil power plants. The results and findings of FAC Program assessments conducted at 22 conventional plants are summarized and discussed. By comparing the FAC Program characteristics and relevant unit features with damage and failure experiences, a number of common factors requiring attention from fossil utility organizations have been identified. The assessment experiences have also provided a picture of trends in specific FAC activities and general awareness within the conventional fossil fleet. One of the most important aspects of these studies is that while a few new locations of FAC have been found, there is some consolidation of the most frequently found locations. (orig.)
Directory of Open Access Journals (Sweden)
Calvo AM
2017-07-01
Full Text Available Adriana Maria Calvo, Paulo Zupelari-Gonçalves, Thiago José Dionísio, Daniel Thomas Brozoski, Flávio Augusto Faria, Carlos Ferreira Santos Department of Biological Sciences, Bauru School of Dentistry, University of São Paulo, São Paulo, Brazil Objective: Nonsteroidal anti-inflammatory drugs (NSAIDs are metabolized by the cytochrome P450 enzymes (CYPs, predominantly CYP2C8 and CYP2C9. The aim of this study was to evaluate the possible association of polymorphisms in the CYP2C8*3 and CYP2C9 genes with the clinical efficacy of oral piroxicam (20 mg daily for 4 days after lower third molar surgeries with regard to postoperative pain, swelling, trismus, adverse reactions, need for rescue medication and the volunteer’s overall satisfaction. Materials and methods: For this purpose, 102 volunteers were genotyped for CYP2C8*3 and CYP2C9 polymorphisms. Briefly, genomic DNA was isolated from saliva collected from volunteers subjected to invasive lower third molar surgeries, and the preoperative, intraoperative and postoperative parameters were collected and analyzed. Results: An equal amount of piroxicam sufficiently managed postoperative pain and inflammatory symptoms, with visual analog pain scores typically <40 mm for all genotypes investigated. Furthermore, only two out of 102 volunteers heterozygous for CYP2C8*3 and CYP2C9*3 reported adverse side effects. Conclusion: In general, slow metabolizers of piroxicam, who were volunteers with mutant alleles, were indifferent from normal metabolizers with the wild-type alleles and therefore did not require specialized piroxicam doses to manage postoperative pain and inflammation. Keywords: piroxicam, lower third molar surgery, P450, CYP2C8, CYP2C9, pharmacogenetics
Dicty_cDB: Contig-U03890-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Mouse 10kb plasmid UUGC1M library Mus ... 42 1.9 2 ( CJ499454 ) Triticum aestivum cDNA clone whfl33j15 5', ...8 1 ( CC656540 ) OGWEY73TH ZM_0.7_1.5_KB Zea mays genomic clone ZM... 46 2.8 1 ( DW710040 ) EST033521 Trichophyton rubrum cDNA librar...y 8 Tric... 46 2.8 1 ( DW703138 ) EST026619 Trichophyton rubrum cDNA library... 7 Tric... 46 2.8 1 ( DW697470 ) EST020951 Trichophyton rubrum cDNA library 6 Tric... 46... 2.8 1 ( DW697281 ) EST020762 Trichophyton rubrum cDNA library 6 Tric... 46 2.8 1 ( DW691333 ) EST014814 Trichophyton rubrum cDNA lib
DEFF Research Database (Denmark)
Afzelius, Lovisa; Raubacher, Florian; Karlén, Anders
2004-01-01
, newly built homology models, and repeated molecular dynamics simulations. The CPCA was based on molecular interaction fields focused on the active site regions of the proteins and include detailed amino acid analysis. The comparison of the CYP2C9 and CYP2C5 crystal structures revealed differences...... improved the similarity to the crystal target in some cases and could be recommended even though it requires a careful manual alignment process. The application of molecular dynamics simulations to highly flexible proteins such as cytochromes P450 is also explored and the information is extracted...... in the flexible regions such as the B-C and F-G loop and the N and C termini. Cross homology models of CYP2C9 and CYP2C5, using their respective crystal structures as templates, indicated that such models were more similar to their templates than to their target proteins. Inclusion of multiple templates slightly...
The Metabolic Effects of Traditional Chinese Medication Qiliqiangxin on H9C2 Cardiomyocytes
Directory of Open Access Journals (Sweden)
Shenghui Lin
2015-11-01
Full Text Available Background/Aims: A traditional Chinese medicine, Qiliqiangxin (QLQX has been identified to perform protective effects on myocardium energy metabolism in mice with acute myocardial infarction, though the effects of QLQX on myocardial mitochondrial biogenesis under physiological condition is still largely elusive. Methods: H9C2 cells were treated with different concentrations of QLQX (0.25, 0.5, and 1.0 µg/mL from 6 to 48 hours. Oxidative metabolism and glycolysis were measured by oxygen consumption and extracellular acidification with XF96 analyzer (SeaHorse. Mitochondrial content and ultrastructure were assessed by Mitotracker staining, confocal microscopy, flow cytometry, and transmission electron microscopy. Mitochondrial biogenesis-related genes were measured by qRT-PCR and Western blot. Results: H9C2 cells treated with QLQX exhibited increased glycolysis at earlier time points (6, 12, and 24 hours, while QLQX could enhance oxidative metabolism and mitochondrial uncoupling in H9C2 cells with longer duration of treatment (48 hours. QLQX also increased mitochondrial content and mitochondrial biogenesis-related gene expression levels, including 16sRNA, SSBP1, TWINKLE, TOP1MT and PLOG, with an activation of peroxisome proliferator-activated receptor coactivator 1 alpha (PGC-1α and its downstream effectors. Silencing PGC-1α could abolish the increased mitochondrial content in H9C2 cells treated with QLQX. Conclusion: Our study is the first to document enhanced metabolism in cardiomyocytes treated with QLQX, which is linked to increased mitochondrial content and mitochondrial biogenesis via activation of PGC-1α.
SurR9C84A protects and recovers human cardiomyocytes from hypoxia induced apoptosis
Energy Technology Data Exchange (ETDEWEB)
Ashok, Ajay [Nanomedicine-Laboratory of Immunology and Molecular Biomedical Research (NLIMBR), School of Medicine (SoM), Faculty of Health, Centre for Molecular and Medical Research - C-MMR, Deakin University, Waurn Ponds, Victoria 3216 (Australia); Department of Pathology, Case Western Reserve University, 2103 Cornell Rd. WRB 5128, Cleveland, OH 44106-7288 (United States); Kanwar, Jagat Rakesh [Nanomedicine-Laboratory of Immunology and Molecular Biomedical Research (NLIMBR), School of Medicine (SoM), Faculty of Health, Centre for Molecular and Medical Research - C-MMR, Deakin University, Waurn Ponds, Victoria 3216 (Australia); Krishnan, Uma Maheswari [Centre for Nanotechnology & Advanced Biomaterials (CeNTAB), School of Chemical & Biotechnology (SCBT), SASTRA University, Thanjavur 613401 (India); Kanwar, Rupinder Kaur, E-mail: rupinder.kanwar@deakin.edu.au [Nanomedicine-Laboratory of Immunology and Molecular Biomedical Research (NLIMBR), School of Medicine (SoM), Faculty of Health, Centre for Molecular and Medical Research - C-MMR, Deakin University, Waurn Ponds, Victoria 3216 (Australia)
2017-01-01
Survivin, as an anti-apoptotic protein and a cell cycle regulator, is recently gaining importance for its regenerative potential in salvaging injured hypoxic cells of vital organs such as heart. Different strategies are being employed to upregulate survivin expression in dying hypoxic cardiomyocytes. We investigated the cardioprotective potential of a cell permeable survivin mutant protein SurR9C84A, for the management of hypoxia mediated cardiomyocyte apoptosis, in a novel and clinically relevant model employing primary human cardiomyocytes (HCM). The aim of this research work was to study the efficacy and mechanism of SurR9C84A facilitated cardioprotection and regeneration in hypoxic HCM. To mimic hypoxic microenvironment in vitro, well characterized HCM were treated with 100 µm (48 h) cobalt chloride to induce hypoxia. Hypoxia induced (HI) HCM were further treated with SurR9C84A (1 µg/mL) in order to analyse its cardioprotective efficacy. Confocal microscopy showed rapid internalization of SurR9C84A and scanning electron microscopy revealed the reinstatement of cytoskeleton projections in HI HCM. SurR9C84A treatment increased cell viability, reduced cell death via, apoptosis (Annexin-V assay), and downregulated free cardiac troponin T and MMP-9 expression. SurR9C84A also upregulated the expression of proliferation markers (PCNA and Ki-67) and downregulated mitochondrial depolarization and ROS levels thereby, impeding cell death. Human Apoptosis Array further revealed that SurR9C84A downregulated expression of pro-apoptotic markers and augmented expression of HSPs and HTRA2/Omi. SurR9C84A treatment led to enhanced levels of survivin, VEGF, PI3K and pAkt. SurR9C84A proved non-toxic to normoxic HCM, as validated through unaltered cell proliferation and other marker levels. Its pre-treatment exhibited lesser susceptibility to hypoxia/damage. SurR9C84A holds a promising clinical potential for human cardiomyocyte survival and proliferation following hypoxic injury
Lifescience Database Archive (English)
Full Text Available GGTA TCCCACCAGATCT sequence update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxxxxxxxxxi*xxx...LTGKTITLE VEGSDNIENVKTKIQDKEGIPPD Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxxi*xxx...ENVKTKIQDKEGIPPD Frame B: ---xxmxxxxxxxxxixxxfsxxxkxwyxxfcxnpxw*xynxxklkvlxxlrmlk...pkxkt kkvfhqinxvsfspvxnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhxk lkvvttlrm*kqkfktkkvshqi Frame C: ---xxxxxxxxxkxxsxxxlvxxxxggxxx
Liu, Nan-Nan; Xue, Ying-Ying; Ding, Yi-Hong
2017-02-09
[5]Radialene, the missing link for synthesis of radialene family, has been finally obtained via the preparation and decomplexation of the [5]radialene-bis-Fe(CO) 3 complex. The stability of [5]radialene complex benefits from the coordination with Fe(CO) 3 by losing free 1,3-butadiene structures to avoid polymerization. In light of the similar coordination ability of half-sandwiches CpM(Cp = η 5 -C 5 H 5 ; M = Fe, Co, Ni), there is a great possibility that the sandwiched complexes of [5]radialene with CpM are available. Herein, we present the first theoretical prediction on the geometry, spin states and bonding of (CpM)(C 10 H 10 ) and (CpM) 2 (C 10 H 10 ). For M = Fe, Co, Ni, the ground states of (CpM)(C 10 H 10 ) and (CpM) 2 (C 10 H 10 ) are doublet and triplet, singlet and singlet, and doublet and triplet states, where each Fe, Co, and Ni adopts 17, 18, and 19 electron-configuration, respectively. In particular, (CpFe) 2 (C 10 H 10 ) and (CpNi) 2 (C 10 H 10 ) have considerable open-shell singlet features. Generally the trans isomers of (CpM) 2 (C 10 H 10 ) with two CpM fragments on the opposite sides of the [5]radialene plane are apparently more stable than the cis ones with CpM fragments on the same side. However, for the singlet and triplet isomers of (CpNi) 2 (C 10 H 10 ) (both cis and trans isomers), the energy differences are relatively small, indicating that these isomers all have the opportunity to exist. Besides, the easy Diels-Alder (DA) dimerization between the [3]dendralene-like fragments of (CpM)(C 10 H 10 ) suggests the great difficulty in isolating the (CpM)(C 10 H 10 ) monomer.
Energy Technology Data Exchange (ETDEWEB)
Woye, E.; Tornow, W.; Mack, G. (Tuebingen Univ. (Germany, F.R.). Physikalisches Inst.); Floyd, C.E.; Guss, P.P.; Murphy, K.; Byrd, R.C.; Wender, S.A.; Walter, R.L. (Duke Univ., Durham, NC (USA). Dept. of Physics; Triangle Universities Nuclear Lab., Durham, NC (USA))
1983-02-01
The analyzing power Asub(..gamma..)(theta) for /sup 12/C(n,n)/sup 12/C elastic scattering and for inelastic scattering to the first excited state (Jsup(..pi..) = 2/sup +/, Q = -4.44 MeV) of /sup 12/C was measured in the energy range from 8.9 to 14.9 MeV in 1 MeV steps. A pulsed polarized neutron beam was produced via the /sup 2/H(d vector,n vector)/sup 3/He polarization transfer reaction. Monte Carlo simulations were used to correct the data for finite geometry and multiple scattering effects. The Asub(..gamma..) data, together with publsihed cross-section data, were analyzed in the framework of the spherical optical model and in the coupled-channels formalism. A good description of the data has been achieved.
Directory of Open Access Journals (Sweden)
Jon Meadus
2017-02-01
Full Text Available Background: Commercial conjugated linoleic acid (CLA dietary supplements contain an equal mixture of the C18:2 isomers, cis-9trans-11 and trans-10cis-12. Predominantly, CLA-c9t11 occurs naturally in meat and dairy products at ~ 0.5% of total fat , whereas CLA-t10c12 occurs at >0.1%. Recent studies show that CLA-c9t11 generally promotes lipid accumulation but CLA-t10c12 may inhibit lipid accumulation and may also promote inflammation. The omega-3 fatty acids α-linolenic acid (C18:3n-3 and docosahexaenoic acid (DHA have also been observed to inhibit lipid accumulation and effect inflammation; therefore we examined the effects of the two main isomersof CLA and omega -3 fatty acids C18:3n-3 and DHA at the molecular levelto determine if they are causing similar oxidative stresses.Methods:Purified CLA-c9t11 and CLA-t10c12 were added to 3T3 cells induced into mature adipocyte cultures at 100uM concentrations and compared with 100uM C18:3n-3(α-linolenic acid and 50uM docosahexaenoic acid (DHA to observe their effect on growth, gene transcription and general oxidation. The results of multiple separate trials were averaged and compared for significance at levels of P< 0.05, using one way ANOVA and Student’s t-test.Results:C18:3n-3, DHA and CLA-t10c12inhibited 3T3 adipose cell growth and caused a significant increase in lipid hydro peroxide activity. CLA-t10c12 and c9t11 increased AFABP, FAS and ACOX1 mRNA gene expression but DHA and C18:3n-3decreased the same mRNAs. CLA-c9t11 but not the t10c12 stimulated adipoQ expression even though; CLA-c9t11 had only a slightly greater affinity for PPARγ than CLA-t10c12, according to TR-FRET assays. The expression of the xenobiotic metabolism genes, aldo-keto reduct as 1c1 (akr1c1, superoxide dismutase (SODand inflammation chemokine secretions of eotaxin (CCL11, Rantes (CCL5, MIG (CCL9 and MCP-1 were increased by DHA, C18:3n-3and CLA-t10c12 but not CLA-c9t11. This correlated with an increase in apoptosis factors
DEFF Research Database (Denmark)
Tetens, Inge
2015-01-01
Following an application from BASF SE and Stepan Lipid Nutrition, submitted for the authorisation of a health claim pursuant to Article 13(5) of Regulation (EC) No 1924/2006 via the Competent Authority of the Netherlands, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked...... to deliver an opinion on the scientific substantiation of a health claim related to an equimolar mixture (marketed under the trade names Clarinol® and Tonalin®) of the two conjugated linoleic acid (CLA) isomers c9,t11 and t10,c12. The Panel considers that the food is sufficiently characterised. The claimed...... of the CLA isomers c9,t11 and t10,c12, marketed under the trade names of Clarinol® and Tonalin®, and a beneficial physiological effect....
Search for resonant states in 10C and 11C and their impact on the primordial 7Li abundance
Hammache, F.; Coc, A.; de Séréville, N.; Stefan, I.; Roussel, P.; Assié, M.; Audouin, L.; Beaumel, D.; Franchoo, S.; Fernandez-Dominguez, B.; Fox, S.; Hamadache, C.; Kiener, J.; Laird, A.; Le Crom, B.; Lefebvre-Schuhl, A.; Lefebvre, L.; Matea, I.; Matta, A.; Mavilla, G.; Mrazek, J.; Morfouace, P.; de Oliveira Santos, F.; Parikh, A.; Perrot, L.; Sanchez-Benitez, A. M.; Suzuki, D.; Tatischeff, V.; Ujic, P.; Vandebrouck, Marine
2018-01-01
The cosmological 7Li problem arises from the significant discrepancy of about a factor 3 between the predicted primordial 7Li abundance and the observed one. The main process for the production of 7Li during Big-Bang nucleosynthesis is the decay of 7Be. Many key nuclear reactions involved in the production and destruction of 7Be were investigated in attempt to explain the 7Li deficit but none of them led to successful conclusions. However, some authors suggested recently the possibility that the destruction of 7Be by 3He and 4He may reconcile the predictions and observations if missing resonant states in the compound nuclei 10C and 11C exist. Hence, a search of these missing resonant states in 10C and 11C was investigated at the Orsay Tandem-Alto facility through 10B(3He,t)10C and 11B(3He,t)11C charge-exchange reactions respectively. After a short overview of the cosmological 7Li problem from a nuclear physics point of view, a description of the Orsay experiment will be given as well as the obtained results and their impact on the 7Li problem.
TiC growth in C fiber/Ti alloy composites during liquid infiltration
Warrier, S. G.; Lin, R. Y.
1993-01-01
A cylindrical model is developed for predicting the reaction zone thickness of carbon fiber-reinforced Ti-matrix composites, and good agreement is obtained between its predicted values and experimental results. The reaction-rate constant for TiC formation is estimated to be 1.5 x 10 exp -9 sq cm/sec. The model is extended to evaluate the relationship between C-coating thicknesses on SiC fibers and processing times.
Dicty_cDB: Contig-U16120-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available lasmodium falciparum strain SEN16 from Senegal C... 32 1.5 3 ( AF134666 ) Plasmodium falciparum strain IVC3 ...patent US 7365185. 30 2.6 5 ( AF134680 ) Plasmodium falciparum strain SEN23 from Senegal C... 32 2.6 4 ( AF1...atus clone R3-12D17, WOR... 38 2.6 9 ( AF134678 ) Plasmodium falciparum strain SEN12 from Senegal...rain EQG2 from Equatorial... 32 3.0 4 ( AF134687 ) Plasmodium falciparum strain SEN13 from Senegal C... 32 3...lciparum strain SEN10 from Senegal C... 32 3.7 3 ( AC174290 ) Medicago truncatula clone mth2-52e11, complete
Dicty_cDB: Contig-U16487-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2 ( DW406563 ) EST000984 Trichophyton rubrum cDNA library Tricho... 72 1e-17 4 ( FL496835 ) Mg_Nor01_07E06 Nor01 Myti... stress library Fra... 101 6e-18 3 ( DB668091 ) Saccharomyces cerevisiae mRNA, clon...isia annua normalized leaf... 62 2e-15 4 ( DW680253 ) EST003734 Trichophyton rubrum cDNA library 0 Tric... 7...R946874 ) EST1138413 Aquilegia cDNA library Aquilegia formo... 66 5e-10 2 ( FC787763 ) CBGC17953.fwd CBGC Lotti...:VS... 293 9e-75 1 ( DT758323 ) EST1192172 Aquilegia cDNA library Aquilegia formo
Energy Technology Data Exchange (ETDEWEB)
Mendez Martin, Francisca [Graz Univ. of Technology (Austria). Inst. for Materials Science and Welding; Panait, Clara Gabriela [MINES ParisTech, UMR CNRS, Evry (France). Centre des Materiaux; V et M France CEV, Aulnoye-Aymeries (France); Bendick, Walter [Salzgitter Mannesmann Forschung GmbH (SZMF), Duisburg (DE)] (and others)
2010-07-01
9-12% Cr heat resistant steels are used for applications at high temperatures and pressures in steam power plants. 12% Cr steels show higher creep strength and higher corrosion resistance compared to 9% Cr steels for short term creep exposure. However, the higher creep strength of 12 %Cr steels drops increasingly after 10,000-20,000 h of creep. This is probably due to a microstructural instability such as the precipitation of new phases (e.g. Laves phases and Z-phases), the growth of the precipitates and the recovery of the matrix. 9% Cr and 12% Cr tempered martensitic steels that have been creep tested for times up to 50,000 h at 600 C and 650 C were investigated using Transmission Electron Microscopy (TEM) on extractive replicas and thin foils together with Backscatter Scanning Electron Microscopy (BSE-SEM) to better understand the different creep behaviour of the two different steels. A significant precipitation of Laves phase and low amounts of Z-phase was observed in the 9% Cr steels after long-term creep exposure. The size distribution of Laves phases was measured by image analysis of SEM-BSE images. In the 12% Cr steel two new phases were identified, Laves phase and Z-phase after almost 30,000 h of creep test. The quantification of the different precipitated phases was studied. (orig.)
C9orf72 expansion presenting as an eating disorder.
Sanders, Peter; Ewing, Isobel; Ahmad, Kate
2016-03-01
This report describes a 64-year-old woman with a strong family history of motor neuron disease, whose diagnosis of behavioural variant frontotemporal dementia was delayed due to her initial presentation with atypical manifestations, including restriction of oral intake resulting in low weight, disordered eating and anxiety. Upon investigation, she was found to be a carrier of the C9orf72 hexanucleotide repeat expansion. Our case supports previous publications asserting that C9orf72 mutation carriers manifest with diverse clinical syndromes, and expands the phenotype to include anorexia and food refusal as potential features of the condition. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.
fac-Tris(pyridine-2-carboxylato-κ2N,Ocobalt(III
Directory of Open Access Journals (Sweden)
Irina A. Golenia
2011-11-01
Full Text Available In the title compound, [Co(C6H4NO23], the CoIII ion lies on a threefold rotation axis and is in a distorted octahedral environment defined by three N and three O donor atoms from three fac-disposed pyridine-2-carboxylate ligands. The ligands are coordinated in a chelate fashion, forming three five-membered rings. In the crystal, translationally related complex molecules are organized into columns along [001] via C—H...O hydrogen bonds.
Evaluation of sampling plans to detect Cry9C protein in corn flour and meal.
Whitaker, Thomas B; Trucksess, Mary W; Giesbrecht, Francis G; Slate, Andrew B; Thomas, Francis S
2004-01-01
StarLink is a genetically modified corn that produces an insecticidal protein, Cry9C. Studies were conducted to determine the variability and Cry9C distribution among sample test results when Cry9C protein was estimated in a bulk lot of corn flour and meal. Emphasis was placed on measuring sampling and analytical variances associated with each step of the test procedure used to measure Cry9C in corn flour and meal. Two commercially available enzyme-linked immunosorbent assay kits were used: one for the determination of Cry9C protein concentration and the other for % StarLink seed. The sampling and analytical variances associated with each step of the Cry9C test procedures were determined for flour and meal. Variances were found to be functions of Cry9C concentration, and regression equations were developed to describe the relationships. Because of the larger particle size, sampling variability associated with cornmeal was about double that for corn flour. For cornmeal, the sampling variance accounted for 92.6% of the total testing variability. The observed sampling and analytical distributions were compared with the Normal distribution. In almost all comparisons, the null hypothesis that the Cry9C protein values were sampled from a Normal distribution could not be rejected at 95% confidence limits. The Normal distribution and the variance estimates were used to evaluate the performance of several Cry9C protein sampling plans for corn flour and meal. Operating characteristic curves were developed and used to demonstrate the effect of increasing sample size on reducing false positives (seller's risk) and false negatives (buyer's risk).
Pooja, Sharma; Pushpanathan, Muthuirulan; Gunasekaran, Paramasamy; Rajendhran, Jeyaprakash
2015-01-01
Streptococcus agalactiae infection causes high mortality in cardiovascular disease (CVD) patients, especially in case of setting prosthetic valve during cardiac surgery. However, the pathogenesis mechanism of S. agalactiae associate with CVD has not been well studied. Here, we have demonstrated the pathogenicity of S. agalactiae in rat cardiomyocytes (H9C2). Interestingly, both live and dead cells of S. agalactiae were uptaken by H9C2 cells. To further dissect the process of S. agalactiae internalization, we chemically inhibited discrete parts of cellular uptake system in H9C2 cells using genistein, chlorpromazine, nocodazole and cytochalasin B. Chemical inhibition of microtubule and actin formation by nocodazole and cytochalasin B impaired S. agalactiae internalization into H9C2 cells. Consistently, reverse‒ transcription PCR (RT‒PCR) and quantitative real time‒PCR (RT-qPCR) analyses also detected higher levels of transcripts for cytoskeleton forming genes, Acta1 and Tubb5 in S. agalactiae‒infected H9C2 cells, suggesting the requirement of functional cytoskeleton in pathogenesis. Host survival assay demonstrated that S. agalactiae internalization induced cytotoxicity in H9C2 cells. S. agalactiae cells grown with benzyl penicillin reduced its ability to internalize and induce cytotoxicity in H9C2 cells, which could be attributed with the removal of surface lipoteichoic acid (LTA) from S. agalactiae. Further, the LTA extracted from S. agalactiae also exhibited dose‒dependent cytotoxicity in H9C2 cells. Taken together, our data suggest that S. agalactiae cells internalized H9C2 cells through energy‒dependent endocytic processes and the LTA of S. agalactiae play major role in host cell internalization and cytotoxicity induction.
10Be and 14C in the Earth system
International Nuclear Information System (INIS)
Oeschger, H.; Beer, J.; Andree, M.
1987-01-01
In a very short period of time, 10 Be data have significantly improved our knowledge in various fields of Earth and planetary sciences. Examples are solar modulation of isotope production, revealed in 10 Be ice-core profiles; geomagnetic modulation of isotope production, revealed in 10 Be ice-core (from the past 10 ka) and ocean-sediment profiles (geomagnetic reversals); climatic effects reflected in 10 Be profiles in loess and polar ice cores ( 10 Be behaviour in atmosphere); comparison of 10 Be and 14 C variations (tree rings) from carbon-cycle models and information on ocean circulation history from 14 C measurements on benthic and planktonic Foraminifera in ocean sediments. An overview on work in collaboration with the Zurich AMS (accelerator mass spectroscopy) facility is given. (author)
Search for the rare decay of ψ (3686 )→Λc+p ¯ e+e-+c .c . at BESIII
Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Alekseev, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bai, Y.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Begzsuren, K.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, P. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Cossio, F.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garillon, B.; Garzia, I.; Gilman, A.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guo, A. Q.; Guo, R. P.; Guo, Y. P.; Guskov, A.; Haddadi, Z.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Irshad, M.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jin, Y.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Khoukaz, A.; Kiese, P.; Kliemt, R.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuessner, M.; Kupsc, A.; Kurth, M.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, J. W.; Li, Jin; Li, K. J.; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, L. Z.; Libby, J.; Lin, C. X.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, D. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. L.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, X. L.; Lusso, S.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mangoni, A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Meng, Z. X.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Muchnoi, N. Yu.; Muramatsu, H.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peng, Z. Y.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Pitka, A.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qi, T. Y.; Qian, S.; Qiao, C. F.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rolo, M.; Rong, G.; Rosner, Ch.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shan, X. Y.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shi, X.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, L.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tan, Y. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, Meng; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, F.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Yang, Yifan; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, T. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Q.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, A. N.; Zhu, J.; Zhu, J.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Besiii Collaboration
2018-05-01
Based on a data sample of (448.1 ±2.9 )×106ψ (3686 ) decays collected with the BESIII experiment, a search for the flavor changing neutral current transition ψ (3686 )→Λc+p ¯ e+e-+c .c . is performed for the first time. No signal candidates are observed and the upper limit on the branching fraction of ψ (3686 )→Λc+p ¯e+e- is determined to be 1.7 ×10-6 at the 90% confidence level. The result is consistent with expectations from the standard model, and no evidence for new physics is found.
Indian Academy of Sciences (India)
J. Chem. Sci. Vol. 128, No. 7, July 2016, pp. 1037–1045. c Indian Academy of ..... Teraski O, Barry J C and Thomas J M 1987 Nature ... Betteridge P W, Carruthers J R, Cooper R I, Prout K and ... Clegg W and Watson D G 2007 Acta Cryst.
C9orf72 hexanucleotide repeat expansions in Chinese sporadic amyotrophic lateral sclerosis.
He, Ji; Tang, Lu; Benyamin, Beben; Shah, Sonia; Hemani, Gib; Liu, Rong; Ye, Shan; Liu, Xiaolu; Ma, Yan; Zhang, Huagang; Cremin, Katie; Leo, Paul; Wray, Naomi R; Visscher, Peter M; Xu, Huji; Brown, Matthew A; Bartlett, Perry F; Mangelsdorf, Marie; Fan, Dongsheng
2015-09-01
A hexanucleotide repeat expansion (HRE) in the C9orf72 gene has been identified as the most common mutation in amyotrophic lateral sclerosis (ALS) among Caucasian populations. We sought to comprehensively evaluate genetic and epigenetic variants of C9orf72 and the contribution of the HRE in Chinese ALS cases. We performed fragment-length and repeat-primed polymerase chain reaction to determine GGGGCC copy number and expansion within the C9orf72 gene in 1092 sporadic ALS (sALS) and 1062 controls from China. We performed haplotype analysis of 23 single-nucleotide polymorphisms within and surrounding C9orf72. The C9orf72 HRE was found in 3 sALS patients (0.3%) but not in control subjects (p = 0.25). For 2 of the cases with the HRE, genotypes of 8 single-nucleotide polymorphisms flanking the HRE were inconsistent with the haplotype reported to be strongly associated with ALS in Caucasian populations. For these 2 individuals, we found hypermethylation of the CpG island upstream of the repeat, an observation not detected in other sALS patients (p HRE were highly associated with repeat lengths >8 repeats implying that both haplotypes may confer instability of repeat length. Copyright © 2015 Elsevier Inc. All rights reserved.
Cold-Induced Ascites in Broilers: Effects of Vitamin C and Coenzyme Q10
Directory of Open Access Journals (Sweden)
MH Nemati
Full Text Available ABSTRACT We hypothesized that the supplementation of vitamin C (Vit. C and coenzyme Q10 (CoQ10 alone or in combination could reduce the negative effects of cold stress in broilers. Four hundred male chicks were exposed for 24 h to cold stress (15 ºC starting from 15d of age, while a positive control group (PC, 100 birds was kept under normal temperature condition. The experimental groups under cold stress (four treatments in 5 replicates of 20 birds were: negative control (NC, basal diet, Vit. C (basal diet + 300 mg/kg Vit. C, CoQ10 (basal diet + 40 mg/kg CoQ10 and Vit. C plus CoQ10 (basal diet + Vit. C+ CoQ10at above mentioned doses. Vit. C or CoQ10 supplementation were restored (p<0.01 performance and lowered (p<0.01 ascites mortality. Blood hematocrit and hemoglobin concentration were decreased (p<0.01 to the level comparable to PC by Vit. C supplementation. Lower plasma concentrations of thyroxin (T4 and higher triiodothyronine (T3 were observed in NC birds (p<0.01 and were not affected by Vit. C or CoQ10. In conclusion, supplementation of Vit. C or CoQ10 in diet of broilers under cold stress conditions resulted improved performance parameters (body weight and feed conversion ratio and ascites related traits (low red blood cell count, hematocrit, T3, and heart weights and high T4. No additional benefit was observed by combination of Vit. C and CoQ10.
International Nuclear Information System (INIS)
Batha, Steven H.; Fincke, James R.; Schmitt, Mark J.
2012-01-01
LANL has two projects in C10.2: Defect-Induced Mix Experiment (DIME) (ongoing, several runs at Omega; NIF shots this summer); and Shock/Shear (tested at Omega for two years; NIF shots in second half of FY13). Each project is jointly funded by C10.2, other C10 MTEs, and Science Campaigns. DIME is investigating 4π and feature-induced mix in spherically convergent ICF implosions by using imaging of the mix layer. DIME prepared for NIF by demonstrating its PDD mix platform on Omega including imaging mid-Z doped layers and defects. DIME in FY13 will focus on PDD symmetry-dependent mix and moving burn into the mix region for validation of mix/burn models. Re-Shock and Shear are two laser-driven experiments designed to study the turbulent mixing of materials. In FY-2012 43 shear and re-shock experimental shots were executed on the OMEGA laser and a complete time history obtained for both. The FY-2013 goal is to transition the experiment to NIF where the larger scale will provide a longer time period for mix layer growth.
Morphometric studies with attached mouse C3H/10T 1/2 cells
International Nuclear Information System (INIS)
Geard, C.R.; Harding, T.
1981-01-01
Studies of in vitro transformation using the Syrian hamster embryo cell system and the mouse C3H/10T 1/2 cell system form an integral part of this laboratory's activities. As part of the studies with the mouse cell line we have monitored the behavior of these cells in culture in order to ascertain those variables which might influence the expression of transformation. The study of transformed cells versus normal cells could lead to insight into an earlier definition of transformation that the clonal morphological change currently in use. This present report details the changes in cellular morphology with time in culture of normal mouse C3H/10T 1/2 cells from early passages (9 to 13) and x-ray transformed cells which have been maintained in culture for three years
Photoionization of three isomers of the C9H7 radical.
Hemberger, Patrick; Steinbauer, Michael; Schneider, Michael; Fischer, Ingo; Johnson, Melanie; Bodi, Andras; Gerber, Thomas
2010-04-15
Three resonance-stabilized radicals, 1-indenyl (Ind), 1-phenylpropargyl (1PPR), and 3-phenylpropargyl (3PPR), all isomers of the composition C(9)H(7), were generated by jet flash pyrolysis. Their photoionization was examined by VUV synchrotron radiation. The mass spectra show a clean and efficient radical generation when the pyrolysis is turned on. To study the photoionization, photoion yield measurements and threshold photoionization spectroscopy techniques were applied. We determined adiabatic ionization energies (IE(ad)) of 7.53 eV for Ind, 7.20 eV for 3PPR, and 7.4 eV for 1PPR. Ab initio calculations show no major change in geometry upon ionization, in agreement with ionization from a nonbonding molecular orbital. The IEs were also computed and are in agreement with the measured ones. The difference in the IE might allow a distinction of the three isomers in flames. In the indenyl spectrum, an excited a(+) (3)B(2) state of the cation was identified at 8.10 eV, which shows a low-energy vibrational progression of 61 meV. Furthermore, we have examined the dissociative photoionization of the precursors. The indenyl precursor, 1-indenyl bromide, undergoes dissociative photoionization to Ind(+). An appearance energy (AE(0K)) of 10.2 eV was obtained from fitting the experimental breakdown diagram. A binding energy of 1.8 eV can thus be determined for the C-Br bond in 1-indenyl bromide. The phenylpropargyl precursors 1PPBr (1-phenylpropargyl bromide/3-phenyl-3-bromopropyne) and 3PPBr (3-phenylpropargyl bromide/1-phenyl-3-bromopropyne) also lose a bromine atom upon dissociative photoionization. Approximate appearance energies of 9.8 eV for 3PPBr and 9.3 eV for 1PPBr have been determined.
Dicty_cDB: Contig-U12055-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 941236 ) CHPX9058.b1_C10.ab1 CHP(XYZ) plains sunflower Hel... 34 9.3 2 ( EL485942 ) CHUM7676.b1_H24.ab1 CHU(LMS) puzzle... sunflower Hel... 34 9.4 2 ( EL481883 ) CHUM3888.b1_O11.ab1 CHU(LMS) puzzle
26 CFR 1.381(c)(10)-1 - Deferred exploration and development expenditures.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Deferred exploration and development expenditures. 1.381(c)(10)-1 Section 1.381(c)(10)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(10...
Synthesis of some 11C-labelled alkaloids
International Nuclear Information System (INIS)
Laangstroem, B.; Antoni, G.; Halldin, H.; Svaerd, H.; Bergson, G.
1982-01-01
Using ( 11 C)-methyl iodide in N-alkylation reactions in dimethylformamide (DMF), the alkaloids N-( 11 C-methyl)-morphine, N-( 11 C-methyl)-codeine, 6-N(methyl)-9, 10-dihydroergotamine, 6-N-( 11 C-methyl)-bromocriptine and N-( 11 C-methyl)-nicotine have been synthesized in radiochemical yields of 50-95%, within 5-10 min of introducing ( 11 C)-methyl iodide into the reaction vial. ( 11 C)-Methyl iodide was obtained within 4-7 min from ( 11 C)-carbon dioxide prepared by the 14 N(p,α) 11 C reaction. (Authors)
Strength behaviour of 10CrMo9.10 steel in nonsteady-state applications
International Nuclear Information System (INIS)
Seidel, C.
2 testing runs with cyclic temperature increase were conducted on steel 10CrMo9.10 samples, i.e., at 500 degC and cyclic increase by 10, 25 and 50 degC, and at 550 degC and cyclic increase by 50 degC. Long-term strength was studied under a strain of 6.1 to 25.6 kp/mm 2 for 22,000 hours and the effect of periodical unloading was investigated on long-term strength at 550 degC. Sample loading and unloading proceeded within the range of 8.8 to 24.7 kp/mm 2 at an unloading rate of 8 to 100 %/min. Steel lifetime was not affected by the number of cycles. The effect of the changing load and of constant temperature without load on the long-term strength of the steel at 550 degC is shown graphically. The results showed a clear dependence of steel life on dwell time at the given temperature without load. (J.P.)
Network degeneration and dysfunction in presymptomatic C9ORF72 expansion carriers
Directory of Open Access Journals (Sweden)
Suzee E. Lee
2017-01-01
Full Text Available Hexanucleotide repeat expansions in C9ORF72 are the most common known genetic cause of familial and sporadic frontotemporal dementia and amyotrophic lateral sclerosis. Previous work has shown that patients with behavioral variant frontotemporal dementia due to C9ORF72 show salience and sensorimotor network disruptions comparable to those seen in sporadic behavioral variant frontotemporal dementia, but it remains unknown how early in the lifespan these and other changes in brain structure and function arise. To gain insights into this question, we compared 15 presymptomatic carriers (age 43.7 ± 10.2 years, nine females to matched healthy controls. We used voxel-based morphometry to assess gray matter, diffusion tensor imaging to interrogate white matter tracts, and task-free functional MRI to probe the salience, sensorimotor, default mode, and medial pulvinar thalamus-seeded networks. We further used a retrospective chart review to ascertain psychiatric histories in carriers and their non-carrier family members. Carriers showed normal cognition and behavior despite gray matter volume and brain connectivity deficits that were apparent as early as the fourth decade of life. Gray matter volume deficits were topographically similar though less severe than those in patients with behavioral variant frontotemporal dementia due to C9ORF72, with major foci in cingulate, insula, thalamus, and striatum. Reduced white matter integrity was found in the corpus callosum, cingulum bundles, corticospinal tracts, uncinate fasciculi and inferior longitudinal fasciculi. Intrinsic connectivity deficits were detected in all four networks but most prominent in salience and medial pulvinar thalamus-seeded networks. Carrier and control groups showed comparable relationships between imaging metrics and age, suggesting that deficits emerge during early adulthood. Carriers and non-carrier family members had comparable lifetime histories of psychiatric symptoms. Taken
Choi, Michael K.
2013-01-01
A concept of using paraffin wax phase change material (PCM) with a melting point between -10 deg C and 10 deg C for payload thermal energy storage in a Space Exploration Technologies (SpaceX) Dragon trunk is presented. It overcomes the problem of limited heater power available to a payload with significant radiators when the Dragon is berthed to the International Space Station (ISS). It stores adequate thermal energy to keep a payload warm without power for 6 hours during the transfer from the Dragon to an ExPRESS logistics carrier (ELC) on the ISS.
SystemC and systemC-AMS in practice systemC 2.3, 2.2 and systemC-AMS 1.0
Banerjee, Amal
2013-01-01
This book describes how engineers can make optimum use of the two industry standard analysis/design tools, SystemC and SystemC-AMS. The authors use a system-level design approach, emphasizing how SystemC and SystemC-AMS features can be exploited most effectively to analyze/understand a given electronic system and explore the design space. The approach taken by this book enables system engineers to concentrate on only those SystemC/SystemC-AMS features that apply to their particular problem, leading to more efficient design. The presentation includes numerous, realistic and complete examples,
17 CFR 240.15c1-9 - Use of pro forma balance sheets.
2010-04-01
... pro forma balance sheets. The term manipulative, deceptive, or other fraudulent device or contrivance... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Use of pro forma balance sheets. 240.15c1-9 Section 240.15c1-9 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...
Coding sequence of human rho cDNAs clone 6 and clone 9
Energy Technology Data Exchange (ETDEWEB)
Chardin, P; Madaule, P; Tavitian, A
1988-03-25
The authors have isolated human cDNAs including the complete coding sequence for two rho proteins corresponding to the incomplete isolates previously described as clone 6 and clone 9. The deduced a.a. sequences, when compared to the a.a. sequence deduced from clone 12 cDNA, show that there are in human at least three highly homologous rho genes. They suggest that clone 12 be named rhoA, clone 6 : rhoB and clone 9 : rhoC. RhoA, B and C proteins display approx. 30% a.a. identity with ras proteins,. mainly clustered in four highly homologous internal regions corresponding to the GTP binding site; however at least one significant difference is found; the 3 rho proteins have an Alanine in position corresponding to ras Glycine 13, suggesting that rho and ras proteins might have slightly different biochemical properties.
Role of CXCL10 in pathogenesis of hepatitis C and antiviral therapy
Directory of Open Access Journals (Sweden)
LI Mi
2015-11-01
Full Text Available Hepatitis C virus (HCV infection represents an important public health problem worldwide. Eradicating HCV can finally delay or prevent the progression of HCV infection to end-stage liver diseases such as liver cirrhosis and liver cancer. Chemokine (C-X-C motif ligand 10 (CXCL10 is a chemokine belonging to the CXC chemokine family, and it exerts its function through binding to chemokine (C-X-C motif receptor 3 (CXCR3, playing a critical role in eradication of HCV. This article reviews the relationship of CXCL10 with the pathogenesis of HCV and the effectiveness of antiviral treatment, as well as the CXCL10 measurements. Meanwhile, this article introduces the clinical value of CXCL10 in assessing the risk of liver fibrosis and liver cancer. Further studies are needed to investigate the association between CXCL10 and liver diseases, and CXCL10 may provide a new therapeutic strategy for HCV infection.
Effects of CYP2C9*1/*3 genotype on the pharmacokinetics of flurbiprofen in Korean subjects.
Lee, Yun-Jeong; Byeon, Ji-Yeong; Kim, Young-Hoon; Kim, Se-Hyung; Choi, Chang-Ik; Bae, Jung-Woo; Sohn, Uy-Dong; Jang, Choon-Gon; Lee, Jeongmi; Lee, Seok-Yong
2015-06-01
The aim of this study was to investigate the impact of CYP2C9*1/*3 genotype on the pharmacokinetics of flurbiprofen and its metabolite. The CYP2C9 genotypes were determined with the use of polymerase chain reaction and restriction fragment and DNA sequencing analysis in 358 healthy Koreans. Among them, twenty individuals with CYP2C9*1/*1 (n = 12) or CYP2C9*1/*3 (n = 8) genotypes received a single 40 mg oral dose of flurbiprofen. The plasma concentrations of flurbiprofen and its metabolite, 4'-hydroxyflurbiprofen were measured by HPLC. AUCinf of flurbiprofen was significantly higher and its clearance was significantly lower in the CYP2C9*1/*3 individuals than in those with CYP2C9*1/*1. The AUC ratio of 4'-hydroxyflurbiprofen to flurbiprofen was significantly lower in the CYP2C9*1/*3 individuals than in those with CYP2C9*1/*1. These results indicate that the individuals carrying of CYP2C9*3 have significant reduction in flurbiprofen metabolism. The clinical use of this information may allow for more efficient personalized pharmacotherapy.
Dicty_cDB: Contig-U01127-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( BJ076721 ) Xenopus laevis cDNA clone:XL058i17, 3' end, singl... 44 5.9 1 ( FG291907 ) 1108800220021 New World... Screwworm Egg 9261 ESTs C... 44 5.9 1 ( FG291539 ) 1108793348396 New World Sc...rewworm Egg 9261 ESTs C... 44 5.9 1 ( FG286660 ) 1108770723740 New World Screwworm Egg 9261 ESTs C... 44 5.9
12C(d,p) 13C reaction at Esub(d) = 30 MeV to the positive-parity states in 13C
International Nuclear Information System (INIS)
Ohnuma, H.; Hoshino, N.; Mikoshiba, O.
1985-07-01
The 12 C(d, p) 13 C reaction has been studied at Esub(d) = 30 MeV. All the known positive-parity states of 13 C below 10 MeV in excitation energy, including the 7/2 + and 9/2 + states, are observed in this reaction. The angular distributions for these positive-parity bound and unbound states are analyzed in CCBA frame work. The 13 C wave functions, which reproduce the resonant and non-resonant scattering of neutrons from 12 C, also give good accounts of the experimentally observed angular distributions and energy spectra of outgoing protons in the 12 C(d, p) 13 C reaction. In most cases the cross section magnitude and the angular distribution shape are primarily determined by the 0 + x j component, even if it is only a small fraction of the total wave function. An exception is the 7/2 + state, where the main contribution comes from the 2 + x dsub(5/2) component. The inclusion of the 4 + state in 12 C and the gsub(9/2) and gsub(7/2) neutron components in the n + 12 C system has very small effects on the low-spin states, but is indispensable for a good fit to the 7/2 + and 9/2 + angular distributions. The transitions to the negative-parity states, 1/2 1 - , 3/2 1 - , 5/2 - , 7/2 - and 1/2 3 - , are also observed experimentally, and analyzed by DWBA. (author)
Hepatitis c virus antibodies in mother-infant blood pair in Zaria
African Journals Online (AJOL)
2017-06-01
Jun 1, 2017 ... Abstract: Objectives: To deter- mine the prevalence of Hepatitis. C virus (HCV) antibodies in mother-infant pair, and risk fac- tors for vertical transmission of. HCV in ABUTH Zaria. Method: One hundred mother- infant pair had serological deter- mination for HCV antibodies from birth to 28days and a repeat.
Dysregulation of C-X-C motif ligand 10 during aging and association with cognitive performance.
Bradburn, Steven; McPhee, Jamie; Bagley, Liam; Carroll, Michael; Slevin, Mark; Al-Shanti, Nasser; Barnouin, Yoann; Hogrel, Jean-Yves; Pääsuke, Mati; Gapeyeva, Helena; Maier, Andrea; Sipilä, Sarianna; Narici, Marco; Robinson, Andrew; Mann, David; Payton, Antony; Pendleton, Neil; Butler-Browne, Gillian; Murgatroyd, Chris
2018-03-01
Chronic low-grade inflammation during aging (inflammaging) is associated with cognitive decline and neurodegeneration; however, the mechanisms underlying inflammaging are unclear. We studied a population (n = 361) of healthy young and old adults from the MyoAge cohort. Peripheral levels of C-X-C motif chemokine ligand 10 (CXCL10) was found to be higher in older adults, compared with young, and negatively associated with working memory performance. This coincided with an age-related reduction in blood DNA methylation at specific CpGs within the CXCL10 gene promoter. In vitro analysis supported the role of DNA methylation in regulating CXCL10 transcription. A polymorphism (rs56061981) that altered methylation at one of these CpG sites further associated with working memory performance in 2 independent aging cohorts. Studying prefrontal cortex samples, we found higher CXCL10 protein levels in those with Alzheimer's disease, compared with aged controls. These findings support the association of peripheral inflammation, as demonstrated by CXCL10, in aging and cognitive decline. We reveal age-related epigenetic and genetic factors which contribute to the dysregulation of CXCL10. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.
Analysis list: Nr3c1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Nr3c1 Adipocyte,Blood,Breast,Embryo,Embryonic fibroblast,Liver,Neural + mm9 http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/target/Nr3c1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/ta...rget/Nr3c1.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr3c1.10.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Nr3c1.Adipocyte.tsv,http://dbarchive.biosciencedbc.jp.../kyushu-u/mm9/colo/Nr3c1.Blood.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr3c1.Breast.tsv,http://dbarchive.bioscience
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS24 (Link to dictyBase) - - - Contig-U16209-1 FC-BS24Z (Li...nk to Original site) - - FC-BS24Z 721 - - - - Show FC-BS24 Library FC (Link to library) Clone ID FC-BS24 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...nce. 52 9e-12 4 BQ096846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ict...N SA ;, mRNA sequence. 44 1e-10 4 BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDN
Yin, Bin; Tang, Shu; Sun, Jiarui; Zhang, Xiaohui; Xu, Jiao; Di, Liangjiao; Li, Zhihong; Hu, Yurong; Bao, Endong
2018-02-13
Heat stress is exacerbated by global warming and affects human and animal health, leading to heart damage caused by imbalances in reactive oxygen species (ROS) and the antioxidant system, acid-base chemistry, electrolytes and respiratory alkalosis. Vitamin C scavenges excess ROS, and sodium bicarbonate maintains acid-base and electrolyte balance, and alleviates respiratory alkalosis. Herein, we explored the ability of vitamin C alone and in combination with equimolar sodium bicarbonate (Vitamin C-Na) to stimulate endogenous antioxidants and heat shock proteins (HSPs) to relieve heat stress in H9C2 cells. Control, vitamin C (20 μg/ml vitamin C for 16 h) and vitamin C-Na (20 μg/ml vitamin C-Na for 16 h) groups were heat-stressed for 1, 3 or 5 h. Granular and vacuolar degeneration, karyopyknosis and damage to nuclei and mitochondria were clearly reduced in treatment groups, as were apoptosis, lactate dehydrogenase activity and ROS and malondialdehyde levels, while superoxide dismutase activity was increased. Additionally, CRYAB, Hsp27, Hsp60 and Hsp70 mRNA levels were upregulated at 3 h (p < 0.01), and protein levels were increased for CRYAB at 0 h (p < 0.05) and 1 h (p < 0.01), and for Hsp70 at 3 and 5 h (p < 0.01). Thus, pre-treatment with vitamin C or vitamin C-Na might protect H9C2 cells against heat damage by enhancing the antioxidant ability and upregulating CRYAB and Hsp70.
Understanding the degree of condensation of phenolic and etherified C-9 units of in situ lignins.
Nanayakkara, Bernadette; Manley-Harris, Merilyn; Suckling, Ian D
2011-12-14
A novel approach for the quantification of the degree of condensation at the C(5) position of etherified and phenolic phenylpropane (C-9) units of in situ lignin is described. This is achieved by degrading unmethylated and methylated wood by thioacidolysis and analyzing the resultant product mixtures by quantitative (31)P NMR spectroscopy. Applying this new method to compression wood and normal wood from Pinus radiata showed that, whereas 41-47% of etherified guaiacyl C-9 units are condensed at the C(5) position, almost all phenolic guaiacyl C-9 units exist as uncondensed moieties. Analysis of milled wood lignin (MWL) isolated from the same wood by (31)P NMR spectroscopy before and after thioacidolysis showed that the phenolic guaiacyl C-9 units were more condensed than those in the in situ lignin. This is likely due to partial cleavage of the more condensed etherified linkages during the lignin isolation, leading to a relative increase in condensed phenolic guaiacyl C-9 units.
V{sub 18}P{sub 9}C{sub 2}. A complex phosphide carbide
Energy Technology Data Exchange (ETDEWEB)
Boller, Herbert [Linz Univ. (Austria). Inst. fuer Anorganische Chemie; Effenberger, Herta [Wien Univ. (Austria). Inst. fuer Mineralogie und Kristallographie
2016-08-01
V{sub 18}P{sub 9}C{sub 2} crystallizes in the orthorhombic space group Pmma with the lattice parameters a = 17.044(3), b = 3.2219(7), and c = 13.030(2) Aa, Z = 2. The crystal structure is composed of 19 symmetry-independent atoms. The crystal structure is considered as a network formed by the transition metal atoms exhibiting cubic, trigonal prismatic, and octahedral voids centered by V, P, and C atoms, respectively. Vice versa, the V and P atoms form a three-dimensional network. The two CV{sub 6} octahedra are edge- and corner-connected to chains running parallel to [010]. The five unique P atoms are trigonal prismatically coordinated by V atoms with one to three faces capped again by a V atom. The V atoms have mainly cubic environments formed solely by V or by V and P atoms. V{sub 18}P{sub 9}C{sub 2} exhibits some structural relations to other compounds of the ternary system V-P-C as well as to other intermetallic phases. Despite the low carbon content, V{sub 18}P{sub 9}C{sub 2} is considered as a ternary compound rather than an interstitially stabilized (binary) phosphide in view of its special structural features.
Dicty_cDB: Contig-U04925-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available RT0512 Chinese cabbage root library Brassica rapa... 46 2.3 1 ( CT736909 ) Danio rerio EST, clone ZF_mu...S30TF EI_10_12_KB Entamoeba invadens genomic ... 44 8.9 1 ( ES277776 ) PQ028A01.XT7 non-sporulating culture ...202 ) 1095462295981 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.57 1 ( CV871352 ) PDUts1090D04 Porcine testis cDNA library...clone:VS... 46 2.3 1 ( CX056831 ) PDUts2007A02 Porcine testis cDNA library II Sus s... 46 2.3 1 ( CV432331 )...a tectiformis cDNA, cleaving embryo clone:m... 40 5.1 2 ( CV874903 ) PDUts1132F08 Porcine testis cDNA library
Katritzky, Alan R; Jain, Ritu; Xu, Yong-Jiang; Steel, Peter J
2002-11-15
Condensation reactions of benzotriazole and 2-(pyrrol-1-yl)-1-ethylamine (1) with formaldehyde and glutaric dialdehyde, respectively, afforded intermediates 2 and 6. Subsequent nucleophilic substitutions of the benzotriazole group in 2 and 6 with Grignard reagents, sodium cyanide, and sodium borohydride gave 1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazines 3a-e, 4, 5 and 5,6,9,10,11,11a-hexahydro-8H-pyrido[1,2-a]pyrrolo[2,1-c]pyrazines 7a-c, 8, 9, respectively, in good yields.
XRD and HRTEM characterization of mechanosynthesized Ti{sub 0.9}W{sub 0.1}C cermet
Energy Technology Data Exchange (ETDEWEB)
Bandyopadhyay, S. [Department of Physics, The University of Burdwan, Golapbag, Burdwan 713104, West Bengal (India); Dutta, H. [Department of Physics, Vivekananda College, Burdwan 713103, West Bengal (India); Pradhan, S.K., E-mail: skp_bu@yahoo.com [Department of Physics, The University of Burdwan, Golapbag, Burdwan 713104, West Bengal (India)
2013-12-25
Highlights: •Cubic Ti{sub 0.9}W{sub 0.1}C is formed after 50 min of milling of α-Ti, W and graphite powders. •Nanocrystalline Ti{sub 0.9}W{sub 0.1}C with particle size ∼11 nm is obtained after 8 h milling. •Average particle size of Ti{sub 0.9}W{sub 0.1}C from XRD analysis and HRTEM is very close. •Formation of Ti{sub 0.9}W{sub 0.1}C is hindered as compared with TiC. -- Abstract: Elemental powder mixture of titanium, tungsten and graphite is milled by high energy planetary ball mill at a fixed ball to powder mass ratio (BPMR) for different duration to produce nanosized particles of Ti{sub 0.9}W{sub 0.1}C hard metal. Microstructure characterization in terms of lattice imperfections and phase quantification of ball-milled samples has been done primarily by analyzing the XRD pattern and employing Rietveld method of structure and microstructure refinement. After 8 h of ball-milling full formation of Ti{sub 0.9}W{sub 0.1}C is noticed without any contamination of other phase or milling media. TEM study of 8 h ball-milled sample gives direct supportive evidence of structural and microstructural evaluation by XRD pattern analysis. A comparative study of microstructural changes between TiC and Ti{sub 0.9}W{sub 0.1}C helps to understand the effect of addition of W as solute in Ti–C metal matrix.
Directory of Open Access Journals (Sweden)
Jason T Blackard
Full Text Available GB virus C (GBV-C may have a beneficial impact on HIV disease progression; however, the epidemiologic characteristics of this virus are not well characterized. Behavioral factors and gender may lead to differential rates of GBV-C infection; yet, studies have rarely addressed GBV-C infections in women or racial/ethnic minorities. Therefore, we evaluated GBV-C RNA prevalence and genotype distribution in a large prospective study of high-risk women in the US.438 hepatitis C virus (HCV seropositive women, including 306 HIV-infected and 132 HIV-uninfected women, from the HIV Epidemiologic Research Study were evaluated for GBV-C RNA. 347 (79.2% women were GBV-C RNA negative, while 91 (20.8% were GBV-C RNA positive. GBV-C positive women were younger than GBV-C negative women. Among 306 HIV-infected women, 70 (22.9% women were HIV/GBV-C co-infected. Among HIV-infected women, the only significant difference between GBV-negative and GBV-positive women was age (mean 38.4 vs. 35.1 years; p<0.001. Median baseline CD4 cell counts and plasma HIV RNA levels were similar. The GBV-C genotypes were 1 (n = 31; 44.3%, 2 (n = 36; 51.4%, and 3 (n = 3; 4.3%. The distribution of GBV-C genotypes in co-infected women differed significantly by race/ethnicity. However, median CD4 cell counts and log10 HIV RNA levels did not differ by GBV-C genotype. GBV-C incidence was 2.7% over a median follow-up of 2.9 (IQR: 1.5, 4.9 years, while GBV-C clearance was 35.7% over a median follow-up of 2.44 (1.4, 3.5 years. 4 women switched genotypes.Age, injection drug use, a history of sex for money or drugs, and number of recent male sex partners were associated with GBV-C infection among all women in this analysis. However, CD4 cell count and HIV viral load of HIV/HCV/GBV-C co-infected women were not different although race was associated with GBV-C genotype.
C9orf72’s interaction with Rab GTPases - modulation of membrane traffic and autophagy
Directory of Open Access Journals (Sweden)
Bor Luen Tang
2016-10-01
Full Text Available Hexanucleotide repeat expansion in an intron of Chromosome 9 open reading frame 72 (C9orf72 is the most common genetic cause of Amyotrophic Lateral Sclerosis (ALS and Frontotemporal Dementia (FTD. While functional haploinsufficiency of C9orf72 resulting from the mutation may play a role in ALS/FTD, the actual cellular role of the protein has been unclear. Recent findings have now shown that C9orf72 physically and functionally interacts with multiple members of the Rab small GTPases family, consequently exerting important influences on cellular membrane traffic and the process of autophagy. Loss of C9orf72 impairs endocytosis in neuronal cell lines, and attenuated autophagosome formation. Interestingly, C9orf72 could influence autophagy both as part of a Guanine nucleotide exchange factor (GEF complex, or as a Rab effector that facilitates transport of the Unc-51-like Autophagy Activating Kinase 1 (Ulk1 autophagy initiation complex. The cellular function of C9orf72 is discussed in the light of these recent findings
Tian, Min; Kliewer, Kara L; Asp, Michelle L; Stout, Michael B; Belury, Martha A
2011-02-01
Cancer cachexia is characterized by muscle and adipose tissue wasting caused partly by chronic, systemic inflammation. Conjugated linoleic acids (CLAs) are a group of fatty acids with various properties including anti-inflammatory cis9, trans11 (c9t11)-CLA and lipid-mobilizing trans10, cis12 (t10c12)-CLA. The purpose of this study was to test whether dietary supplementation of a c9t11-CLA-rich oil (6:1 c9t11:t10c12) could attenuate wasting of muscle and adipose tissue in colon-26 adenocarcinoma-induced cachexia in mice. Loss of body weight, muscle and adipose tissue mass caused by tumors were not rescued by supplementation with the c9t11-CLA-rich oil. In quadriceps muscle, c9t11-CLA-rich oil exacerbated tumor-induced gene expression of inflammatory markers tumor necrosis factor-α, IL-6 receptor and the E3 ligase MuRF-1 involved in muscle proteolysis. In epididymal adipose tissue, tumor-driven delipidation and atrophy was aggravated by the c9,t11-CLA-rich oil, demonstrated by further reduced adipocyte size and lower adiponectin expression. However, expression of inflammatory cytokines and macrophage markers were not altered by tumors, or CLA supplementation. These data suggest that addition of c9t11-CLA-rich oil (0.6% c9t11, 0.1% t10c12) in diet did not ameliorate wasting in mice with cancer cachexia. Instead, it increased expression of inflammatory markers in the muscle and increased adipose delipidation. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
McAnaw, Amelia; Lopez, Maria Elena; Ellis, David; Rosair, Georgina M; Welch, Alan J
2014-04-07
The isolation of six isomeric, low-symmetry, dicobaltacarboranes with bicapped hexagonal antiprismatic cage structures, always in low yield, is described from reactions in which 13-vertex cobaltacarborane anions and sources of cobalt-containing cations were present. The vertex-to-centroid distance (VCD) and boron-H distance (BHD) methods are used to locate the correct C atom positions in the cages, thus allowing the compounds to be identified as 1,13-Cp2-1,13,2,10-closo-Co2C2B10H12 (1), 1,8-Cp2-3-OEt-1,8,2,10-closo-Co2C2B10H11 (2), 1,13-Cp2-1,13,2,9-closo-Co2C2B10H12 (3), 1,8-Cp2-1,8,2,4-closo-Co2C2B10H12 (4), 1,13-Cp2-1,13,2,4-closo-Co2C2B10H12 (5) and 1,8-Cp2-1,8,2,5-closo-Co2C2B10H12 (6). It is shown that a common alternative method of cage C atom identification, using refined (as B) U(eq) values, does not work well, at least in these cases. Having identified the correct isomeric forms of the six dicobaltacarboranes, their syntheses are tentatively rationalised in terms of the direct electrophilic insertion of a {CpCo(+)} fragment into [CpCoC2B10](-) anions and it is demonstrated that compounds 1, 4, 5 and 6 can be successfully prepared by deliberately performing such reactions.
Hosaka, Shinya; Murayama, Norie; Satsukawa, Masahiro; Uehara, Shotaro; Shimizu, Makiko; Iwasaki, Kazuhide; Iwano, Shunsuke; Uno, Yasuhiro; Yamazaki, Hiroshi
2015-07-01
Cynomolgus monkeys are widely used as primate models in preclinical studies, because of their evolutionary closeness to humans. In humans, the cytochrome P450 (P450) 2C enzymes are important drug-metabolizing enzymes and highly expressed in livers. The CYP2C enzymes, including CYP2C9, are also expressed abundantly in cynomolgus monkey liver and metabolize some endogenous and exogenous substances like testosterone, S-mephenytoin, and diclofenac. However, comprehensive evaluation regarding substrate specificity of monkey CYP2C9 has not been conducted. In the present study, 89 commercially available drugs were examined to find potential monkey CYP2C9 substrates. Among the compounds screened, 20 drugs were metabolized by monkey CYP2C9 at a relatively high rates. Seventeen of these compounds were substrates or inhibitors of human CYP2C9 or CYP2C19, whereas three drugs were not, indicating that substrate specificity of monkey CYP2C9 resembled those of human CYP2C9 or CYP2C19, with some differences in substrate specificities. Although efavirenz is known as a marker substrate for human CYP2B6, efavirenz was not oxidized by CYP2B6 but by CYP2C9 in monkeys. Liquid chromatography-mass spectrometry analysis revealed that monkey CYP2C9 and human CYP2B6 formed the same mono- and di-oxidized metabolites of efavirenz at 8 and 14 positions. These results suggest that the efavirenz 8-oxidation could be one of the selective markers for cynomolgus monkey CYP2C9 among the major three CYP2C enzymes tested. Therefore, monkey CYP2C9 has the possibility of contributing to limited specific differences in drug oxidative metabolism between cynomolgus monkeys and humans. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.
Modelling of phase equilibria in CH4–C2H6–C3H8–nC4H10–NaCl–H2O systems
International Nuclear Information System (INIS)
Li, Jun; Zhang, Zhigang; Luo, Xiaorong; Li, Xiaochun
2015-01-01
Highlights: • A new model was established for the phase equilibria of C1–C2–C3–nC4–brine systems. • The model can reproduce of hydrocarbon–brine equilibria to high T&P and salinity. • The model can well predict H 2 O solubility in light hydrocarbon rich phases. - Abstract: A thermodynamic model is presented for the mutual solubility of CH 4 –C 2 H 6 –C 3 H 8 –nC 4 H 10 –brine systems up to high temperature, pressure and salinity. The Peng–Robinson model is used for non-aqueous phase fugacity calculations, and the Pitzer model is used for aqueous phase activity calculations. The model can accurately reproduce the experimental solubilities of CH 4 , C 2 H 6 , C 3 H 8 and nC 4 H 10 in water or NaCl solutions and H 2 O solubility in the non-aqueous phase. The experimental data of mutual solubility for the CH 4 –brine subsystem are sufficient for temperatures exceeding 250 °C, pressures exceeding 1000 bar and NaCl molalities greater than 6 molal. Compared to the CH 4 –brine system, the mutual solubility data of C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine are not sufficient. Based on the comparison with the experimental data of H 2 O solubility in C 2 H 6 -, C 3 H 8 - or nC 4 H 10 -rich phases, the model has an excellent capability for the prediction of H 2 O solubility in hydrocarbon-rich phases, as these experimental data were not used in the modelling. Predictions of hydrocarbon solubility (at temperatures up to 200 °C, pressures up to 1000 bar and NaCl molalities greater than 6 molal) were made for the C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine systems. The predictions suggest that increasing pressure generally increases the hydrocarbon solubility in water or brine, especially in the lower-pressure region. Increasing temperature usually decreases the hydrocarbon solubility at lower temperatures but increases the hydrocarbon solubility at higher temperatures. Increasing water salinity dramatically decreases
International Nuclear Information System (INIS)
Bora, Pritom J; Ramamurthy, Praveen C; Madras, Giridhar; Vinoy, K J; Kishore
2015-01-01
A solid waste material fly ash cenosphere (FAC) was nickel coated and polyaniline in situ polymerized at −30 ± 2 °C in nitrogen atmosphere. A thin film of this composite material was prepared by solution processing and surface morphology/topography was studied. High electromagnetic shielding effectiveness (SE) was obtained for this film; 59 ± 4 μm and 133 ± 4 μm films show an average of 38 and 60 dB SE, respectively, in the frequency range 8.2–12.4 GHz (X-band). Unlike PANI film, the SE of these composite films is high at high frequency. The presence of magneto dielectric microsphere (Ni-FAC) increases the heterogeneity of the composite film in an efficient way for EMI shielding by changing film topography and increasing ac conductivity and permeability. (paper)
A fully automated GC-FID system was designed and built to measure ambient concentrations of C2-C10 volatile organic compounds, including many oxygenated compounds, without using liquid cryogen. It was deployed at Blodgett Forest Research Station in Georgetown, CA USA, 38 deg 53' ...
Brenz, Yannick; Eschbach, Marie-Luise; Hartmann, Wiebke; Haben, Irma; Sparwasser, Tim; Huehn, Jochen; Kühl, Anja; Feyerabend, Thorsten B.; Rodewald, Hans-Reimer; Breloer, Minka
2014-01-01
Accumulating evidence suggests that IL-9-mediated immunity plays a fundamental role in control of intestinal nematode infection. Here we report a different impact of Foxp3+ regulatory T cells (Treg) in nematode-induced evasion of IL-9-mediated immunity in BALB/c and C57BL/6 mice. Infection with Strongyloides ratti induced Treg expansion with similar kinetics and phenotype in both strains. Strikingly, Treg depletion reduced parasite burden selectively in BALB/c but not in C57BL/6 mice. Treg function was apparent in both strains as Treg depletion increased nematode-specific humoral and cellular Th2 response in BALB/c and C57BL/6 mice to the same extent. Improved resistance in Treg-depleted BALB/c mice was accompanied by increased production of IL-9 and accelerated degranulation of mast cells. In contrast, IL-9 production was not significantly elevated and kinetics of mast cell degranulation were unaffected by Treg depletion in C57BL/6 mice. By in vivo neutralization, we demonstrate that increased IL-9 production during the first days of infection caused accelerated mast cell degranulation and rapid expulsion of S. ratti adults from the small intestine of Treg-depleted BALB/c mice. In genetically mast cell-deficient (Cpa3-Cre) BALB/c mice, Treg depletion still resulted in increased IL-9 production but resistance to S. ratti infection was lost, suggesting that IL-9-driven mast cell activation mediated accelerated expulsion of S. ratti in Treg-depleted BALB/c mice. This IL-9-driven mast cell degranulation is a central mechanism of S. ratti expulsion in both, BALB/c and C57BL/6 mice, because IL-9 injection reduced and IL-9 neutralization increased parasite burden in the presence of Treg in both strains. Therefore our results suggest that Foxp3+ Treg suppress sufficient IL-9 production for subsequent mast cell degranulation during S. ratti infection in a non-redundant manner in BALB/c mice, whereas additional regulatory pathways are functional in Treg-depleted C57BL/6
C5b-9 Staining Correlates With Clinical and Tumor Stage in Gastric Adenocarcinoma.
Chen, Jian; Yang, Wei-Jun; Sun, Hai-Jian; Yang, Xia; Wu, Yu-Zhang
2016-08-01
The complement system is a critical part of the immune response, acting in defense against viral infections, clearance of immune complexes, and maintenance of tissue homeostasis. Upregulated expression of the terminal complement complex, C5b-9, has been observed on various tumor cells, such as stomach carcinoma cells, and on cells in the necrotic regions of these tumors as well; however, whether and how C5b-9 is related to gastric cancer progression and severity remains unknown. In this study, human gastric adenocarcinoma (HGAC) tissues (n=47 cases) and patient-matched adjacent nontumoral parenchyma (n=20 cases) were evaluated by tissue microarray and immunohistochemistry. The HGAC tissues showed upregulated C5b-9 expression. Multinomial logistic regression and likelihood ratio testing showed that overexpression of C5b-9 in HGAC tissue was significantly correlated with clinical stage (P=0.007) and tumor stage (P=0.005), but not with tumor distant organ metastasis, lymphoid nodal status, sex, or age. Patients with late-stage gastric adenocarcinoma had a higher amount of tumor cells showing positive staining for C5b-9 than patients with early-stage disease. These results may help in diagnosis and assessment of disease severity of human gastric carcinoma.
Thymosin beta 10 Prompted the VEGF-C Expression in Lung Cancer Cell
Directory of Open Access Journals (Sweden)
Zixuan LI
2014-05-01
Full Text Available Background and objective Our previous study found that thymosin β10 overexpressed in lung cancer and positively correlated with differentiation, lymph node metastasis and stage of lung cancer. In this reasearch we aim to study the effects and mechanism of exogenous human recombinant Tβ10 on the expression of VEGF-C on non-small cell lung cancer. Methods After SPC, A549 and LK2 cells were treated with 100 ng/mL recombinant human Tβ10, the mRNA level of VEGF-C were detected by RT-PCR. The mean while the protein expression of VEGF-C, P-AKT and AKT were determined by Western blot assay. Results Exogenous recombinant human Tβ10 were significantly promote the expression levels of VEGF-C mRNA and protein while promoting the phosphorylation of AKT. Exogenous Tβ10 can promote the expression of VEGF-C mRNA and protein in lung cancer cell lines A549 and LK2 (P<0.05, and this effect can be inhibited by use AKT inhibitor LY294002 (P<0.05. Conclusion Tβ10 human recombinant proteins can promote the expression of VEGF-C by activating AKT phosphorylation in lung cancer cell lines.
Experimental investigation of slow-positron emission from 4H-SiC and 6H-SiC surfaces
International Nuclear Information System (INIS)
Ling, C.C.; Beling, C.D.; Fung, S.; Weng, H.M.
2002-01-01
Slow-positron emission from the surfaces of as-grown n-type 4H-SiC and 6H-SiC (silicon carbide) with a conversion efficiency of ∼10 -4 has been observed. After 30 min of 1000 deg. C annealing in forming gas, the conversion efficiency of the n-type 6H-SiC sample was observed to be enhanced by 75% to 1.9x10 -4 , but it then dropped to ∼10 -5 upon a further 30 min annealing at 1400 deg. C. The positron work function of the n-type 6H-SiC was found to increase by 29% upon 1000 deg. C annealing. For both p-type 4H-SiC and p-type 6H-SiC materials, the conversion efficiency was of the order of ∼10 -5 , some ten times lower than that for the n-type materials. This was attributed to the band bending at the p-type material surface which caused positrons to drift away from the positron emitting surface. (author)
Characterization of Material from Wells 299-W10-35 (C7573) and 299-W14-74 (C7024)
Energy Technology Data Exchange (ETDEWEB)
Tilton, Fred A.; Wellman, Dawn M.; Bovaird, Chase C.; Strandquist, Sara C.
2011-07-15
The objective of this work was to characterize material accumulating on wells 299-W10-35 (C7573) and 299-W14-74 (C7024) to determine the type of material (i.e., chemical or biological) and, if the material is biological, to identify the microorganisms present.
Farzamikia, Negin; Sakhinia, Ebrahim; Afrasiabirad, Abbas
2017-12-22
Many lines of evidence suggest that warfarin dosing variability is significantly associated with cytochrome P450 2C9 (CYP2C9) and vitamin K epoxide reductase complex subunit 1 (VKORC1) variant alleles. Therefore, we investigated the influence of CYP2C9*2 (430C/T), *3 (1075A/C) and VKORC1 (-1639G/A) polymorphisms on warfarin dose requirements in patients who underwent cardiac valve surgery during the postoperative period.A total of 100 patients with heart valve replacement who had a prescribed target international normalized ratio (INR) range of 2-3 were enrolled in the study. Genotyping of CYP2C9 and VKORC1 was carried out using polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) technique. The demographic and clinical data were collected using a precodified questionnaire and clinical examination and then were analyzed.Our findings revealed that the prevalence of CYP2C9 *2, *3 and VKORC1 -1639A alleles in patients were 10.5%, 39%, and 48%, respectively. We also found that patients with CYP2C9 *1 and VKORC1 -1639G alleles required the highest dosages of warfarin, while the carriers of CYP2C9 variant *2 and *3 alleles and VKORC1 -1639A required less warfarin. Univariate regression analysis showed that age and presence of CYP2C9 *2 allele significantly influenced the daily warfarin dose requirement. Our findings provide additional evidence to support the hypothesis that CYP2C9*2 (430C/T), *3 (1075A/C) and VKORC1 (-1639G/A) polymorphisms explain a considerable proportion of interindividual variability in warfarin dose. Therefore, testing for these variants might be helpful for adjusting patient warfarin dosage to an effective and safe level. © American Society for Clinical Pathology 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Early antihepatitis C virus response with second-generation C200/C22 ELISA
van der Poel, C. L.; Bresters, D.; Reesink, H. W.; Plaisier, A. A.; Schaasberg, W.; Leentvaar-Kuypers, A.; Choo, Q. L.; Quan, S.; Polito, A.; Houghton, M.
1992-01-01
Detection of early antibody to hepatitis C virus (HCV) by a new second-generation C200/C22 anti-HCV enzyme-linked immunosorbent assay (ELISA) and a four-antigen recombinant immunoblot assay (4-RIBA) was compared with the first-generation anti-HCV C100 ELISA using sequential serum samples of 9
Comparison of soil organic carbon speciation using C NEXAFS and CPMAS 13C NMR spectroscopy.
Prietzel, Jörg; Müller, Svenja; Kögel-Knabner, Ingrid; Thieme, Jürgen; Jaye, Cherno; Fischer, Daniel
2018-07-01
We compared synchrotron-based C near-edge X-ray absorption fine structure (NEXAFS) and CPMAS 13 C nuclear magnetic resonance (NMR) spectroscopy with respect to their precision and accuracy to quantify different organic carbon (OC) species in defined mixtures of soil organic matter source compounds. We also used both methods to quantify different OC species in organic surface horizons of a Histic Leptosol as well as in mineral topsoil and subsoil horizons of two soils with different parent material, stage of pedogenesis, and OC content (Cambisol: 15-30 OC mgg -1 , Podzol: 0.9-7 OC mgg -1 ). CPMAS 13 C NMR spectroscopy was more accurate and precise (mean recovery of different C functional groups 96-103%) than C NEXAFS spectroscopy (mean recovery 92-113%). For organic surface and topsoil samples, NMR spectroscopy consistently yielded larger O-alkyl C percentages and smaller alkyl C percentages than C NEXAFS spectroscopy. For the Cambisol subsoil samples both methods performed well and showed similar C speciation results. NEXAFS spectroscopy yielded excellent spectra with a high signal-to-noise ratio also for OC-poor Podzol subsoil samples, whereas this was not the case for CPMAS 13 C NMR spectroscopy even after sample treatment with HF. Our results confirm the analytical power of CPMAS 13 C NMR spectroscopy for a reliable quantitative OC speciation in soils with >10mgOCg -1 . Moreover, they highlight the potential of synchrotron-based C NEXAFS spectroscopy as fast, non-invasive method to semi-quantify different C functional groups in soils with low C content (0.9-10mgg -1 ). Copyright © 2018 Elsevier B.V. All rights reserved.
Evidence for a narrow NN-bar state at 2.02 GEV/C2 in 6 and 9 GEV/C antiproton interactions
International Nuclear Information System (INIS)
Azooz, F.; Butterworth, I.; Dornan, P.J.
1982-11-01
Evidence for the existence of a charged narrow state of mass M approximately 2.02 GeV/c 2 and width GAMMA approximately 2 , decaying into NN-bar is reported. The state was observed in the reaction p-barp → psub(fast)n-barπ + π - π - at 6 GeV/c and in p-barp → π + sub(fast)p-barnπ + π - at 9 GeV/c in a triggered bubble chamber experiment at the SLAC Hybrid Facility. (author)
Chemical grafting of Co9S8 onto C60 for hydrogen spillover and storage.
Han, Lu; Qin, Wei; Zhou, Jia; Jian, Jiahuang; Lu, Songtao; Wu, Xiaohong; Fan, Guohua; Gao, Peng; Liu, Boyu
2017-04-20
Metal modified C 60 is considered to be a potential hydrogen storage medium due to its high theoretical capacity. Research interest is growing in various hybrid inorganic compounds-C 60 . While the design and synthesis of a novel hybrid inorganic compound-C 60 is difficult to attain, it has been theorized that the atomic hydrogen could transfer from the inorganic compound to the adjacent C 60 surfaces via spillover and surface diffusion. Here, as a proof of concept experiment, we graft Co 9 S 8 onto C 60 via a facile high energy ball milling process. The Raman, XPS, XRD, TEM, HTEM and EELS measurements have been conducted to evaluate the composition and structure of the pizza-like hybrid material. In addition, the electrochemical measurements and calculated results demonstrate that the chemical "bridges" (C-S bonds) between these two materials enhance the binding strength and, hence, facilitate the hydriding reaction of C 60 during the hydrogen storage process. As a result, an increased hydrogen storage capacity of 4.03 wt% is achieved, along with a favorable cycling stability of ∼80% after 50 cycles. Excluding the direct hydrogen storage contribution from Co 9 S 8 in the hybrid paper, the hydrogen storage ability of C 60 was enhanced by 5.9× through the hydriding reaction caused by the Co 9 S 8 modifier. Based on these experimental measurements and theoretical calculations, the unique chemical structure reported here could potentially inspire other C 60 -based advanced hybrids.
Muscle, skin and core temperature after -110°c cold air and 8°c water treatment.
Costello, Joseph Thomas; Culligan, Kevin; Selfe, James; Donnelly, Alan Edward
2012-01-01
The aim of this investigation was to elucidate the reductions in muscle, skin and core temperature following exposure to -110°C whole body cryotherapy (WBC), and compare these to 8°C cold water immersion (CWI). Twenty active male subjects were randomly assigned to a 4-min exposure of WBC or CWI. A minimum of 7 days later subjects were exposed to the other treatment. Muscle temperature in the right vastus lateralis (n=10); thigh skin (average, maximum and minimum) and rectal temperature (n=10) were recorded before and 60 min after treatment. The greatest reduction (P<0.05) in muscle (mean ± SD; 1 cm: WBC, 1.6 ± 1.2°C; CWI, 2.0 ± 1.0°C; 2 cm: WBC, 1.2 ± 0.7°C; CWI, 1.7 ± 0.9°C; 3 cm: WBC, 1.6 ± 0.6°C; CWI, 1.7 ± 0.5°C) and rectal temperature (WBC, 0.3 ± 0.2°C; CWI, 0.4 ± 0.2°C) were observed 60 min after treatment. The largest reductions in average (WBC, 12.1 ± 1.0°C; CWI, 8.4 ± 0.7°C), minimum (WBC, 13.2 ± 1.4°C; CWI, 8.7 ± 0.7°C) and maximum (WBC, 8.8 ± 2.0°C; CWI, 7.2 ± 1.9°C) skin temperature occurred immediately after both CWI and WBC (P<0.05). Skin temperature was significantly lower (P<0.05) immediately after WBC compared to CWI. The present study demonstrates that a single WBC exposure decreases muscle and core temperature to a similar level of those experienced after CWI. Although both treatments significantly reduced skin temperature, WBC elicited a greater decrease compared to CWI. These data may provide information to clinicians and researchers attempting to optimise WBC and CWI protocols in a clinical or sporting setting.
Muscle, skin and core temperature after -110°c cold air and 8°c water treatment.
Directory of Open Access Journals (Sweden)
Joseph Thomas Costello
Full Text Available The aim of this investigation was to elucidate the reductions in muscle, skin and core temperature following exposure to -110°C whole body cryotherapy (WBC, and compare these to 8°C cold water immersion (CWI. Twenty active male subjects were randomly assigned to a 4-min exposure of WBC or CWI. A minimum of 7 days later subjects were exposed to the other treatment. Muscle temperature in the right vastus lateralis (n=10; thigh skin (average, maximum and minimum and rectal temperature (n=10 were recorded before and 60 min after treatment. The greatest reduction (P<0.05 in muscle (mean ± SD; 1 cm: WBC, 1.6 ± 1.2°C; CWI, 2.0 ± 1.0°C; 2 cm: WBC, 1.2 ± 0.7°C; CWI, 1.7 ± 0.9°C; 3 cm: WBC, 1.6 ± 0.6°C; CWI, 1.7 ± 0.5°C and rectal temperature (WBC, 0.3 ± 0.2°C; CWI, 0.4 ± 0.2°C were observed 60 min after treatment. The largest reductions in average (WBC, 12.1 ± 1.0°C; CWI, 8.4 ± 0.7°C, minimum (WBC, 13.2 ± 1.4°C; CWI, 8.7 ± 0.7°C and maximum (WBC, 8.8 ± 2.0°C; CWI, 7.2 ± 1.9°C skin temperature occurred immediately after both CWI and WBC (P<0.05. Skin temperature was significantly lower (P<0.05 immediately after WBC compared to CWI. The present study demonstrates that a single WBC exposure decreases muscle and core temperature to a similar level of those experienced after CWI. Although both treatments significantly reduced skin temperature, WBC elicited a greater decrease compared to CWI. These data may provide information to clinicians and researchers attempting to optimise WBC and CWI protocols in a clinical or sporting setting.
Jonsson, Frida; Westin, Ida Maria; Österman, Lennart; Sandgren, Ola; Burstedt, Marie; Holmberg, Monica; Golovleva, Irina
2018-02-20
Inherited retinal dystrophies (IRDs) represent a group of progressive conditions affecting the retina. There is a great genetic heterogeneity causing IRDs, and to date, more than 260 genes are associated with IRDs. Stargardt disease, type 1 (STGD1) or macular degeneration with flecks, STGD1 represents a disease with early onset, central visual impairment, frequent appearance of yellowish flecks and mutations in the ATP-binding cassette subfamily A, member 4 (ABCA4) gene. A large number of intronic sequence variants in ABCA4 have been considered pathogenic although their functional effect was seldom demonstrated. In this study, we aimed to reveal how intronic variants present in patients with Stargardt from the same Swedish family affect splicing. The splicing of the ABCA4 gene was studied in human embryonic kidney cells, HEK293T, and in human retinal pigment epithelium cells, ARPE-19, using a minigene system containing variants c.4773+3A>G and c.5461-10T>C. We showed that both ABCA4 variants, c.4773+3A>G and c.5461-10T>C, cause aberrant splicing of the ABCA4 minigene resulting in exon skipping. We also demonstrated that splicing of ABCA4 has different outcomes depending on transfected cell type. Two intronic variants c.4773+3A>G and c.5461-10T>C, both predicted to affect splicing, are indeed disease-causing mutations due to skipping of exons 33, 34, 39 and 40 of ABCA4 gene. The experimental proof that ABCA4 mutations in STGD patients affect protein function is crucial for their inclusion to future clinical trials; therefore, functional testing of all ABCA4 intronic variants associated with Stargardt disease by minigene technology is desirable. © 2018 Acta Ophthalmologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.
10 CFR Appendix C to Subpart B of... - Compliance Certification
2010-01-01
... Energy Efficiency and Renewable Energy, Building Technologies (EE-2J), Forrestal Building, 1000... 10 Energy 3 2010-01-01 2010-01-01 false Compliance Certification C Appendix C to Subpart B of Part 431 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY EFFICIENCY PROGRAM FOR CERTAIN COMMERCIAL...
Sonobe, Yoshifumi; Ghadge, Ghanashyam; Masaki, Katsuhisa; Sendoel, Ataman; Fuchs, Elaine; Roos, Raymond P
2018-08-01
Expansion of a hexanucleotide repeat (HRE), GGGGCC, in the C9ORF72 gene is recognized as the most common cause of familial amyotrophic lateral sclerosis (FALS), frontotemporal dementia (FTD) and ALS-FTD, as well as 5-10% of sporadic ALS. Despite the location of the HRE in the non-coding region (with respect to the main C9ORF72 gene product), dipeptide repeat proteins (DPRs) that are thought to be toxic are translated from the HRE in all three reading frames from both the sense and antisense transcript. Here, we identified a CUG that has a good Kozak consensus sequence as the translation initiation codon. Mutation of this CTG significantly suppressed polyglycine-alanine (GA) translation. GA was translated when the G 4 C 2 construct was placed as the second cistron in a bicistronic construct. CRISPR/Cas9-induced knockout of a non-canonical translation initiation factor, eIF2A, impaired GA translation. Transfection of G 4 C 2 constructs induced an integrated stress response (ISR), while triggering the ISR led to a continuation of translation of GA with a decline in conventional cap-dependent translation. These in vitro observations were confirmed in chick embryo neural cells. The findings suggest that DPRs translated from an HRE in C9ORF72 aggregate and lead to an ISR that then leads to continuing DPR production and aggregation, thereby creating a continuing pathogenic cycle. Copyright © 2018 Elsevier Inc. All rights reserved.
Solvent-free synthesis of C10 and C11 branched alkanes from furfural and methyl isobutyl ketone.
Yang, Jinfan; Li, Ning; Li, Guangyi; Wang, Wentao; Wang, Aiqin; Wang, Xiaodong; Cong, Yu; Zhang, Tao
2013-07-01
Our best results jet: C10 and C11 branched alkanes, with low freezing points, are synthesized through the aldol condensation of furfural and methyl isobutyl ketone from lignocellulose, which is then followed by hydrodeoxygenation. These jet-fuel-range alkanes are obtained in high overall yields (≈90%) under solvent-free conditions. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Ranjan Batra
2017-07-01
Full Text Available The presence of hexanucleotide repeat expansion (HRE in the first intron of the human C9orf72 gene is the most common genetic cause underlying both familial amyotrophic lateral sclerosis (ALS and frontotemporal dementia (FTD. Studies aimed at elucidating the pathogenic mechanisms associated of C9orf72 FTD and ALS (C9FTD/ALS have focused on the hypothesis of RNA and protein toxic gain-of-function models, including formation of nuclear RNA foci containing GGGGCC (G4C2 HRE, inclusions containing dipeptide repeat proteins through a non-canonical repeat associated non-ATG (RAN translation mechanism, and on loss-of-function of the C9orf72 protein. Immense effort to elucidate these mechanisms has been put forth and toxic gain-of-function models have especially gained attention. Various mouse models that recapitulate distinct disease-related pathological, functional, and behavioral phenotypes have been generated and characterized. Although these models express the C9orf72 HRE mutation, there are numerous differences among them, including the transgenesis approach to introduce G4C2-repeat DNA, genomic coverage of C9orf72 features in the transgene, G4C2-repeat length after genomic stabilization, spatiotemporal expression profiles of RNA foci and RAN protein aggregates, neuropathological features, and neurodegeneration-related clinical symptoms. This review aims to (1 provide an overview of the key characteristics; (2 provide insights into potential pathological factors contributing to neurotoxicity and clinical phenotypes through systematic comparison of these models.
Directory of Open Access Journals (Sweden)
Emmanuel Aubert
2016-11-01
Full Text Available The coordination polymer {[Cu(SiF6(C10H8N22]·2C10H8N2·5H2O}n, systematic name: poly[[bis(μ2-4,4′-bipyridine(μ2-hexafluoridosilicatocopper(II] 4,4′-bipyridine disolvate pentahydrate], contains pores which are filled with water and 4,4′-bipyridine molecules. As a result of the presence of these ordered species, the framework changes its symmetry from P4/mmm to P21/c. The 4,4′-bipyridine guest molecules form chains inside the 6.5 × 6.9 Å pores parallel to [100] in which the molecules interact through π–π stacking. Ordered water molecules form infinite hydrogen-bonded chains inside a second pore system (1.6 × 5.3 Å free aperture perpendicular to the 4,4′-bipyridine channels.
Directory of Open Access Journals (Sweden)
Hongxia Liu
2017-11-01
Full Text Available PM10 samples were collected from Huangshi (HS city, Central China during April 2012 to March 2013, and were analyzed for short-chain saturated dicarboxylic acids (diacids using a capillary gas chromatograph (GC. We found that oxalic acid (C2, 318 ± 104 ng·m−3 was the most abundant diacid species, followed by malonic acid (C3, 25.4 ± 9.11 ng·m−3 and succinic acid (C4, 2.09 ± 0.52 ng·m−3. The concentrations of C2 and C4 diacids were highest in winter, followed by summer and spring, and lowest in autumn. C3 diacid was decreased in the order of summer > winter > autumn > spring. Further, the seasonal variations of WSOC (water-soluble organic carbon- and OC (organic carbon-normalized diacid concentrations were similar to those of diacid concentrations, suggesting that both primary emission and secondary production are important sources for diacids in Huangshi (HS aerosols. Strong correlations were found among C2 diacid and the three ions SO42−, NO3−, and NH4+ in summer and winter, suggesting that the species could undergo a similar secondary oxidation processing. C2 had good correlation with K+ in summer and autumn, which indicates an enhanced contribution of combustion sources for C2 diacid. Moreover, according to the ratio of C2/K+, we can conclude that C2 diacid should be formed by a secondary reaction of biomass combustion in HS aerosols, especially in summer and autumn. The ratios of C2/C4 and C3/C4 were compared with those reported in other sites, and the results suggest that HS aerosols should be more photochemically aged than at other urban areas. Principal component analysis of diacids and selected water-soluble inorganic ions over four seasons suggests that HS aerosols are influenced not only from primary emission, but also from secondary reaction. According to the linear relation between C2 and C3 diacids, the results indicate that C2 diacid is formed from the oxidation of hydrocarbon compounds in spring, while it is from
Weber, Lothar; Kahlert, Jan; Brockhinke, Regina; Böhling, Lena; Halama, Johannes; Brockhinke, Andreas; Stammler, Hans-Georg; Neumann, Beate; Nervi, Carlo; Harder, Rachel A; Fox, Mark A
2013-08-14
Six new C,C'-bis(benzodiazaborolyl)dicarba-closo-dodecaboranes, 1,A-R2-1,A-C2B10H10, where R represents the group 2-(1,3-Et2-1,3,2-N2BC6H4) or 2-(1,3-Ph2-1,3,2-N2BC6H4) and A is 2, 7 or 12, were synthesized from o-, m-, and p-dicarbadodecaboranes (carboranes) by lithiation and subsequent treatment with the respective 2-bromo-1,3,2-benzodiazaboroles. UV-visible and fluorescence spectra of all carboranes display low energy charge transfer emissions. While such emissions with Stokes shifts between 17,330 and 21,290 cm(-1) are typical for C,C'-bis(aryl)-ortho-carboranes, the observed low-energy emissions with Stokes shifts between 8320 and 15,170 cm(-1) for the meta- and para-isomers are unusual as high-energy emissions are typical for meta- and para-dicarbadodecaboranes. Fluorescence quantum yields (φF) for the novel 1,7- and 1,12-bis(benzodiazaborolyl)-carboranes depend on the substituents at the nitrogen atoms of the heterocycle. Thus, the para-carborane with N-ethyl substituents 1,12-(1',3'-Et2-1',3',2'-N2BC6H4)2-1,12-C2B10H10 has a φF value of 41% in cyclohexane solution and only of 9% in the solid state, whereas the analogous 1,12-(1',3'-Ph2-1',3',2'-N2BC6H4)2-1,12-C2B10H10 shows quantum yields of 3% in cyclohexane solution and 72% in the solid state. X-ray crystallographic, computational and cyclic voltammetry studies for these carboranes are also presented.
Dicty_cDB: Contig-U04429-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available BP230009B10H9 Soares normalized bovine placenta B... 46 2.4 1 ( EW982243 ) EST_sras_evg_774543 srasevg mixed_tissue Sebaste...s... 46 2.4 1 ( EW982242 ) EST_sras_evg_774159 srasevg mixed_tissue Sebastes... 46 2.4 1 ( C
High temperature oxidation of carbide-carbon materials of NbC-C, NbC-TiC-C systems
International Nuclear Information System (INIS)
Afonin, Yu.D.; Shalaginov, V.N.; Beketov, A.R.
1981-01-01
The effect of titanium carbide additions on the oxidation of carbide - carbon composition NbC-TiC-C in oxygen under the pressure of 10 mm Hg and in the air at atmospheric pressure in the temperature range 800-1300 deg is studied. It is shown that the region of negative temperature coefficient during oxidation in the system NbC+C is determined by the processes of sintering and polymorphous transformation. The specific character of the oxide film, formed during oxidation of Nbsub(x)Tisub(y)C+C composites is connected with non-equilibrium nature of carbide grain in its composition. Carbon gasification takes place with the formation of carbon dioxide. Composite materials, containing titanium carbide in complex carbide up to 50-83 mol. %, are the most corrosion resisting ones [ru
Olah, George A; Surya Prakash, G K; Rasul, Golam
2008-07-16
The structures and energies of the carbocations C 4H 7 (+) and C 5H 9 (+) were calculated using the ab initio method. The (13)C NMR chemical shifts of the carbocations were calculated using the GIAO-CCSD(T) method. The pisigma-delocalized bisected cyclopropylcarbinyl cation, 1 and nonclassical bicyclobutonium ion, 2 were found to be the minima for C 4H 7 (+) at the MP2/cc-pVTZ level. At the MP4(SDTQ)/cc-pVTZ//MP2/cc-pVTZ + ZPE level the structure 2 is 0.4 kcal/mol more stable than the structure 1. The (13)C NMR chemical shifts of 1 and 2 were calculated by the GIAO-CCSD(T) method. Based on relative energies and (13)C NMR chemical shift calculations, an equilibrium involving the 1 and 2 in superacid solutions is most likely responsible for the experimentally observed (13)C NMR chemical shifts, with the latter as the predominant equilibrating species. The alpha-methylcyclopropylcarbinyl cation, 4, and nonclassical bicyclobutonium ion, 5, were found to be the minima for C 5H 9 (+) at the MP2/cc-pVTZ level. At the MP4(SDTQ)/cc-pVTZ//MP2/cc-pVTZ + ZPE level ion 5 is 5.9 kcal/mol more stable than the structure 4. The calculated (13)C NMR chemical shifts of 5 agree rather well with the experimental values of C 5H 9 (+).
C5 Extract Induces Apoptosis in B16F10 Murine Melanoma Cells ...
African Journals Online (AJOL)
Purpose: To investigate the anti-cancer activities of C5 extract (C5E), a new herbal preparation from Korea, on B16F10 cells. Methods: The anti-proliferative effects of C5E were assessed by culturing B16F10 cells in the presence or absence of C5E. Cell cycle progression was analyzed by PI staining using flow cytometry.
Emotional Contagion is not Altered in Mice Prenatally Exposed to Poly (I:C) on Gestational Day 9.
Gonzalez-Liencres, Cristina; Juckel, Georg; Esslinger, Manuela; Wachholz, Simone; Manitz, Marie-Pierre; Brüne, Martin; Friebe, Astrid
2016-01-01
Prenatal immune activation has been associated with increased risk of developing schizophrenia. The polyinosinic-polycytidylic acid (Poly(I:C)) mouse model replicates some of the endophenotype characteristic of this disorder but the social deficits observed in schizophrenia patients have not been well studied in this model. Therefore we aimed to investigate social behavior, in particular emotional contagion for pain, in this mouse model. We injected pregnant mouse dams with Poly(I:C) or saline (control) on gestation day 9 (GD9) and we evaluated their offspring in the pre-pulse inhibition (PPI) test at age 50-55 days old to confirm the reliability of our model. Mice were then evaluated in an emotional contagion test immediately followed by the light/dark test to explore post-test anxiety-like behavior at 10 weeks of age. In the emotional contagion test, an observer (prenatally exposed to Poly(I:C) or to saline) witnessed a familiar wild-type (WT) mouse (demonstrator) receiving electric foot shocks. Our results replicate the sensory gating impairments in the Poly(I:C) offspring but we only observed minor group differences in the social tasks. One of the differences we found was that demonstrators deposited fewer feces in the presence of control observers than of observers prenatally exposed to Poly(I:C), which we suggest could be due to the observers' behavior. We discuss the findings in the context of age, sex and day of prenatal injection, suggesting that Poly(I:C) on GD9 may be a valuable tool to assess other symptoms or symptom clusters of schizophrenia but perhaps not comprising the social domain.
Ionic fragmentation of a natural product, limonene (C10H16), following core [C 1s] photoionization
International Nuclear Information System (INIS)
Castilho, R.B. de; Nunez, C.V.; Coutinho, L.H.; Lago, A.F.; Bernini, R.B.; Souza, G.G.B. de
2007-01-01
Photoionization of the limonene [C 10 H 16 ] molecule was studied for the first time following C 1s ionization, using synchrotron radiation and time-of-fight mass spectrometry. As a reference for further analysis of the photon induced fragmentation of the limonene molecule, the He(I) mass spectrum was also obtained. Previously unreported singly charged species have been observed at 310 eV: H + , C + , CH + , CH 2 + , CH 3 + . A close similarity has been observed between the high photon energy mass spectrum and the standard electron impact mass spectrum of limonene, obtained at 70 eV. In particular, the base peak [C 5 H 8 + , m/q = 68], known to result from a Retro Diels-Alder reaction, remains the same in both cases. Approximate values for the mean kinetic energy were determined for all ionic species
10kV SiC MOSFET split output power module
DEFF Research Database (Denmark)
Beczkowski, Szymon; Li, Helong; Uhrenfeldt, Christian
2015-01-01
The poor body diode performance of the first generation of 10kV SiC MOSFETs and the parasitic turn-on phenomenon limit the performance of SiC based converters. Both these problems can potentially be mitigated using a split output topology. In this paper we present a comparison between a classical...
The upgraded control and instrumentation system of C9 irradiation device
International Nuclear Information System (INIS)
Pulpa, A.; Parvu, C.; Valeca, S. C.; Ancuta, M.; Ana, E.
2016-01-01
C9 Capsule is an irradiation device of TRIGA SSR, which was designed for nuclear fuel cycling testing. It simulates the load follow-up by the power reactor, i.e. CANDU 700MW operating with variable load. The irradiation tests in the power cycling conditions were conceived for complete characterization of the fuel behaviour. The irradiation conditions are similar to those found in nuclear power plant when it is operated in load following mode. The power cycling tests are performed by using an under flux moving system. The paper presents the upgraded control and instrumentation system of the ''9C irradiation device, designed and manufactured in order to enhance the performance of this system for better surveillance and processing of the acquired experimental data. (authors)
A green emissive amorphous fac-Alq3 solid generated by grinding crystalline blue fac-Alq3 powder.
Bi, Hai; Chen, Dong; Li, Di; Yuan, Yang; Xia, Dandan; Zhang, Zuolun; Zhang, Hongyu; Wang, Yue
2011-04-14
A novel green emissive Alq(3) solid with a facial isomeric form has been obtained by grinding the typical blue luminescent fac-Alq(3) crystalline powder. This is the first report, to the best of our knowledge, that a fac-Alq(3) isomer emits green light.
Experimental ion mobility measurements in Xe-C2H6
Perdigoto, J. M. C.; Cortez, A. F. V.; Veenhof, R.; Neves, P. N. B.; Santos, F. P.; Borges, F. I. G. M.; Conde, C. A. N.
2017-10-01
In this paper we present the results of the ion mobility measurements made in gaseous mixtures of xenon (Xe) with ethane (C2H6) for pressures ranging from 6 to 10 Torr (8-10.6 mbar) and for low reduced electric fields in the 10 Td to 25 Td range (2.4-6.1 kVṡcm-1ṡ bar-1), at room temperature. The time of arrival spectra revealed two peaks throughout the entire range studied which were attributed to ion species with 3-carbons (C3H5+, C3H6+ C3H8+ and C3H9+) and with 4-carbons (C4H7+, C4H9+ and C4H10+). Besides these, and for Xe concentrations above 70%, a bump starts to appear at the right side of the main peak for reduced electric fields higher than 20 Td, which was attributed to the resonant charge transfer of C2H6+ to C2H6 that affects the mobility of its ion products (C3H8+ and C3H9+). The time of arrival spectra for Xe concentrations of 20%, 50%, 70% and 90% are presented, together with the reduced mobilities as a function of the Xe concentration calculated from the peaks observed for the low reduced electric fields and pressures studied.
Observation of χc 2→η'η' and χc 0 ,2→η η'
Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bai, Y.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dorjkhaidav, O.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, S.; Gu, Y. T.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jin, Y.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Khoukaz, A.; Kiese, P.; Kliemt, R.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, K. J.; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Meng, Z. X.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Morello, G.; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Pitka, A.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, J. J.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rolo, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, L.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B. T.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Wei, J. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhou, Y. X.; Zhu, J.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.; Besiii Collaboration
2017-12-01
Using a sample of 448.1 ×106 ψ (3686 ) events collected with the BESIII detector in 2009 and 2012, we study the decays χc 0 ,2→η'η' and η η' . The decays χc 2→η'η' , χc 0→η η' and χc 2→η η' are observed for the first time with statistical significances of 9.6 σ , 13.4 σ and 7.5 σ , respectively. The branching fractions are determined to be B (χc 0→η'η')=(2.19 ±0.03 ±0.14 )×10-3 , B (χc 2→η'η')=(4.76 ±0.56 ±0.38 )×10-5 , B (χc 0→η η')=(8.92 ±0.84 ±0.65 )×10-5 and B (χc 2→η η')=(2.27 ±0.43 ±0.25 )×10-5 , where the first uncertainties are statistical and the second are systematic. The precision for the measurement of B (χc 0→η'η') is significantly improved compared to previous measurements. Based on the measured branching fractions, the role played by the doubly and singly Okubo-Zweig-Iizuka disconnected transition amplitudes for χc 0 ,2 decays into pseudoscalar meson pairs can be clarified.
2002-01-01
We propose to study the elastic resonance scattering reactions $^{9}$Li+p and $^{16}$C+p to investigate the energies, spins and parities of the lowest T=2 states in $^{10}$Be and the T=5/2 states in $^{17}$N. These are analogue states of the ground states and first excited states in $^{10}$Li and $^{17}$C.
Ciura, Sorana; Lattante, Serena; Le Ber, Isabelle; Latouche, Morwena; Tostivint, Hervé; Brice, Alexis; Kabashi, Edor
2013-08-01
To define the role that repeat expansions of a GGGGCC hexanucleotide sequence of the C9orf72 gene play in the pathogenesis of amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). A genetic model for ALS was developed to determine whether loss of function of the zebrafish orthologue of C9orf72 (zC9orf72) leads to abnormalities in neuronal development. C9orf72 mRNA levels were quantified in brain and lymphoblasts derived from FTLD and ALS/FTLD patients and in zebrafish. Knockdown of the zC9orf72 was performed using 2 specific antisense morpholino oligonucleotides to block transcription. Quantifications of spontaneous swimming and tactile escape response, as well as measurements of axonal projections from the spinal cord, were performed. Significantly decreased expression of C9orf72 transcripts in brain and lymphoblasts was found in sporadic FTLD and ALS/FTLD patients with normal-size or expanded hexanucleotide repeats. The zC9orf72 is selectively expressed in the developing nervous system at developmental stages. Loss of function of the zC9orf72 transcripts causes both behavioral and cellular deficits related to locomotion without major morphological abnormalities. These deficits were rescued upon overexpression of human C9orf72 mRNA transcripts. Our results indicate C9orf72 haploinsufficiency could be a contributing factor in the spectrum of ALS/FTLD neurodegenerative disorders. Loss of function of the zebrafish orthologue of zC9orf72 expression in zebrafish is associated with axonal degeneration of motor neurons that can be rescued by expressing human C9orf72 mRNA, highlighting the specificity of the induced phenotype. These results reveal a pathogenic consequence of decreased C9orf72 levels, supporting a loss of function mechanism of disease. © 2013 American Neurological Association.
International Nuclear Information System (INIS)
Wetsel, R.A.; Lemons, R.S.; Le Beau, M.M.; Barnum, S.R.; Noack, D.; Tack, B.F.
1988-01-01
A human C5 clone (pC5HG2) was isolated from a cDNA library constructed from Hep G2 mRNA. he DNA sequence showed that the pC5HG2 insert was comprised of 3309 base pairs of pro-C5 coding sequence and 404 base pairs of 3'-untranslated sequence. The derived amino acid sequence contained the entire coding sequence of the C5 α-chain, the β-α-chain junction region, and 100 amino acids (approximately 50%) of the β-chain. Protein sequences of four C5 tryptic peptides were aligned exactly to this sequence and demonstrated that C5 synthesized and secreted by Hep G2 cells is probably identical with plasma-derived C5. Coding sequence alignment of the human C5 sequences with those of murine C5 indicated that 80% of the nucleotides and 79% of the amino acids were placed identically in the two species. Amino acid sequence alignment of the homologous family members C3, C4, and α 2 -macroglobulin with that of C5 demonstrated 27%, 25%, and 19% identity, respectively. As was found in murine C5, the corresponding thiol ester region of human C5 contained several conserved amino acids, but the critical cysteine and glutamine residues which give rise to the intramolecular thiol ester bond in C3, C4, and α 2 -macroglobulin were absent in C5, having been replaced by serine and alanine, respectively. With the use of a panel of hamster-human somatic cell hybrids, the C5 gene was mapped to human chromosome 9. In situ chromosomal hybridization studies employing metaphase cells further localized the gene to bands 9q32-34, with the largest cluster of grains at 9q34.1
Xu, Wenxuan; Liu, Yajuan; Ye, Yanxin; Liu, Meng; Han, Laichuang; Song, Andong; Liu, Liangwei
2016-10-01
The 9_2 carbohydrate-binding module (C2) locates natively at the C-terminus of the GH10 thermophilic xylanase from Thermotoga marimita. When fused to the C-terminus, C2 improved thermostability of a GH11 xylanase (Xyn) from Aspergillus niger. However, a question is whether the C-terminal C2 would have a thermostabilizing effect when fused to the N-terminus of a catalytic module. A chimeric enzyme, C2-Xyn, was created by step-extension PCR, cloned in pET21a(+), and expressed in E. coli BL21(DE3). The C2-Xyn exhibited a 2 °C higher optimal temperature, a 2.8-fold longer thermostability, and a 4.5-fold higher catalytic efficiency on beechwood xylan than the Xyn. The C2-Xyn exhibited a similar affinity for binding to beechwood xylan and a higher affinity for oat-spelt xylan than Xyn. C2 is a thermostabilizing carbohydrate-binding module and provides a model of fusion at an enzymatic terminus inconsistent with the modular natural terminal location.
Multiple proton decays of 6Be, 8C, 8B(IAS) and excited states in 10C
Sobotka, Lee
2011-10-01
Recent technical advances have allowed for high-order correlation experiments to be done. We have primarily focused on experiments in which the final channels are composed of only alphas and protons. Four cases we have studied are: 6Be, 10C*, 8C, and 8B*(IAS) via 3, 4, 5, and 3-particle correlation measurements, respectively. While the first case had been studied before, our work presents very high statistics in the full Jacobi coordinates (the coordinates needed to describe 3-body decay.) Our study of 10C excited states provides isolatable examples of: correlated 2p decay, from one state, and the decay of another which is unusually highly correlated, a ``ménage a quatre.'' 8C decay presents the only case of sequential 3-body 2p decay steps (i.e. 2p-2p.) The intermediate in this 2-step process is the first example (6Be) mentioned above. Unlike the well-studied second step (6Be decay), the first step in this 2p-2p process provides another example of correlated 2p emission. The decay of 8B(IAS), the isobaric analog of 8C, also decays overwhelmingly by 2p emission, in this case to 6Li(IAS). This IAS-to-IAS 2p decay is one for which decay to the potential 1p intermediates is energetically allowed but isospin forbidden. This represents an expansion, over that originally envisioned by Goldanski, of the conceivable nuclear territory for 2p decay.
Collisional Removal of O2 (c(sup 1) Sigma(sup-)(sub u), nu=9) by O2, N2, and He
Copeland, Richard A.; Knutsen, Karen; Onishi, Marc E.; Yalcin, Talat
1996-01-01
The collisional removal Of 02 molecules in selected vibrational levels of the c state is studied using a two-laser double-resonance technique. The output of the first laser excites the 02 to nu = 9 or 10 of the c Sigma - state, and the ultraviolet output of the second laser monitors specific rovibrational levels via resonance-enhanced ionization. The temporal evolution of the c Sigma u state vibrational level is observed by scanning the time delay between the two pulsed lasers. As the rate constants for 02 and N2 are similar in magnitude, N2 collisions dominate the removal rate in the earth's atmosphere. For v= 10 colliding with 02, we find a removal rate constant that is 2-5 times that for v=9 and that single quantum collision cascade is an important pathway for removal.
ΛcN interaction from lattice QCD and its application to Λc hypernuclei
Miyamoto, Takaya; Aoki, Sinya; Doi, Takumi; Gongyo, Shinya; Hatsuda, Tetsuo; Ikeda, Yoichi; Inoue, Takashi; Iritani, Takumi; Ishii, Noriyoshi; Kawai, Daisuke; Murano, Keiko; Nemura, Hidekatsu; Sasaki, Kenji
2018-03-01
The interaction between Λc and a nucleon (N) is investigated by employing the HAL QCD method in the (2 + 1)-flavor lattice QCD on a (2.9fm) 3 volume at mπ ≃ 410 , 570 , 700 MeV. We study the central potential in S10 channel as well as central and tensor potentials in S31-3D1 channel, and find that the tensor potential for Λc N is negligibly weak and central potentials in both S10 and S31-3D1 channels are almost identical with each other except at short distances. Phase shifts and scattering lengths calculated with these potentials show that the interaction of Λc N system is attractive and has a similar strength in S10 and S31 channels at low energies (i.e. the kinetic energy less than about 40 MeV). While the attractions are not strong enough to form two-body bound states, our results lead to a possibility to form Λc hypernuclei for sufficiently large atomic numbers (A). To demonstrate this, we derive a single-folding potential for Λc hypernuclei from the Λc-nucleon potential obtained in lattice QCD, and find that Λc hypernuclei can exist for A ≥ 12 with the binding energies of a few MeV. We also estimate the Coulomb effect for the Λc hypernuclei.
Dicty_cDB: Contig-U12697-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ebrafish DNA sequence from clone BUSM1-21A14 in ... 40 1.7 3 ( AY781284 ) Human rotavirus C strain V460 nons...tructural prote... 46 1.9 1 ( AY781283 ) Human rotavirus C strain V966 nonstructural prote... 46 1.9 1 ( AY770979 ) Human rotavirus... C strain v508 nonstructural prote... 46 1.9 1 ( AJ132205 ) Human rotavirus
Blankenhaus, Birte; Reitz, Martina; Brenz, Yannick; Eschbach, Marie-Luise; Hartmann, Wiebke; Haben, Irma; Sparwasser, Tim; Huehn, Jochen; Kühl, Anja; Feyerabend, Thorsten B; Rodewald, Hans-Reimer; Breloer, Minka
2014-02-01
Accumulating evidence suggests that IL-9-mediated immunity plays a fundamental role in control of intestinal nematode infection. Here we report a different impact of Foxp3⁺ regulatory T cells (Treg) in nematode-induced evasion of IL-9-mediated immunity in BALB/c and C57BL/6 mice. Infection with Strongyloides ratti induced Treg expansion with similar kinetics and phenotype in both strains. Strikingly, Treg depletion reduced parasite burden selectively in BALB/c but not in C57BL/6 mice. Treg function was apparent in both strains as Treg depletion increased nematode-specific humoral and cellular Th2 response in BALB/c and C57BL/6 mice to the same extent. Improved resistance in Treg-depleted BALB/c mice was accompanied by increased production of IL-9 and accelerated degranulation of mast cells. In contrast, IL-9 production was not significantly elevated and kinetics of mast cell degranulation were unaffected by Treg depletion in C57BL/6 mice. By in vivo neutralization, we demonstrate that increased IL-9 production during the first days of infection caused accelerated mast cell degranulation and rapid expulsion of S. ratti adults from the small intestine of Treg-depleted BALB/c mice. In genetically mast cell-deficient (Cpa3-Cre) BALB/c mice, Treg depletion still resulted in increased IL-9 production but resistance to S. ratti infection was lost, suggesting that IL-9-driven mast cell activation mediated accelerated expulsion of S. ratti in Treg-depleted BALB/c mice. This IL-9-driven mast cell degranulation is a central mechanism of S. ratti expulsion in both, BALB/c and C57BL/6 mice, because IL-9 injection reduced and IL-9 neutralization increased parasite burden in the presence of Treg in both strains. Therefore our results suggest that Foxp3⁺ Treg suppress sufficient IL-9 production for subsequent mast cell degranulation during S. ratti infection in a non-redundant manner in BALB/c mice, whereas additional regulatory pathways are functional in Treg-depleted C57BL/6
Directory of Open Access Journals (Sweden)
Dinender Singla
2016-01-01
Full Text Available We hypothesized that fibroblast growth factor-9 (FGF-9 would enhance angiogenesis via activating c-kit positive stem cells in the infarcted nondiabetic and diabetic heart. In brief, animals were divided into three groups: Sham, MI, and MI+FGF-9. Two weeks following MI or sham surgery, our data suggest that treatment with FGF-9 significantly diminished vascular apoptosis compared to the MI group in both C57BL/6 and db/db mice (p<0.05. Additionally, the number of c-kit+ve/SM α-actin+ve cells and c-kit+ve/CD31+ve cells were greatly enhanced in the MI+FGF-9 groups relative to the MI suggesting FGF-9 enhances c-Kit cell activation and their differentiation into vascular smooth muscle cells and endothelial cells, respectively (p<0.05. Histology shows that the total number of vessels were quantified for all groups and our data suggest that the FGF-9 treated groups had significantly more vessels than their MI counterparts (p<0.05. Finally, echocardiographic data suggests a significant improvement in left ventricular output, as indicated by fractional shortening and ejection fraction in both nondiabetic and diabetic animals treated with FGF-9 (p<0.05. Overall, our data suggests FGF-9 has the potential to attenuate vascular cell apoptosis, activate c-Kit progenitor cells, and enhance angiogenesis and neovascularization in C57BL/6 and db/db mice leading to improved cardiac function.
Lifescience Database Archive (English)
Full Text Available e E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL1...57766 |pid:none) 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 B...C138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin
Benkheiri, P; D'Almagne, B; De Rosny, G; Eisenstein, B I; Ferrer, A; Fleury, P; Jacholkowski, A; Petroff, P; Richard, F; Rivet, P; Roudeau, P; Rougé, A; Six, J; Thénard, J M; Treille, D; Volte, A; Yoshida, H
1977-01-01
The backward production of mesons is studied in the reaction pi /sup - /p to p rho /sup -/. The differential cross section and the rho /sup - / density matrix are obtained using a Monte Carlo analysis of high statistics CERN experimental data on pi /sup -/p to p pi /sup -/ pi /sup 0/ reactions at 9 and 12 GeV/c. (10 refs).
Synaptic dysfunction and altered excitability in C9ORF72 ALS/FTD.
Starr, Alexander; Sattler, Rita
2018-02-14
Amyotrophic lateral sclerosis (ALS) is characterized by a progressive degeneration of upper and lower motor neurons, resulting in fatal paralysis due to denervation of the muscle. Due to genetic, pathological and symptomatic overlap, ALS is now considered a spectrum disease together with frontotemporal dementia (FTD), the second most common cause of dementia in individuals under the age of 65. Interestingly, in both diseases, there is a large prevalence of RNA binding proteins (RBPs) that are mutated and considered disease-causing, or whose dysfunction contribute to disease pathogenesis. The most common shared genetic mutation in ALS/FTD is a hexanucleuotide repeat expansion within intron 1 of C9ORF72 (C9). Three potentially overlapping, putative toxic mechanisms have been proposed: loss of function due to haploinsufficient expression of the C9ORF72 mRNA, gain of function of the repeat RNA aggregates, or RNA foci, and repeat-associated non-ATG-initiated translation (RAN) of the repeat RNA into toxic dipeptide repeats (DPRs). Regardless of the causative mechanism, disease symptoms are ultimately caused by a failure of neurotransmission in three regions: the brain, the spinal cord, and the neuromuscular junction. Here, we review C9 ALS/FTD-associated synaptic dysfunction and aberrant neuronal excitability in these three key regions, focusing on changes in morphology and synapse formation, excitability, and excitotoxicity in patients, animal models, and in vitro models. We compare these deficits to those seen in other forms of ALS and FTD in search of shared pathways, and discuss the potential targeting of synaptic dysfunctions for therapeutic intervention in ALS and FTD patients. Copyright © 2018. Published by Elsevier B.V.
GOT C+: Galactic Plane Survey of the 1.9 THz [CII] Line
Langer, William
2012-01-01
The ionized carbon [CII] 1.9 THz fine structure line is a major gas coolant in the interstellar medium (ISM) and controls the thermal conditions in diffuse gas clouds and Photodissociation Regions (PDRs). The [CII] line is also an important tracer of the atomic gas and atomic to molecular transition in diffuse clouds throughout the Galaxy. I will review some of the results from the recently completed Galactic Observations of Terahertz C+ (GOT C+) survey. This Herschel Open Time Key Project is a sparse, but uniform volume sample survey of [CII] line emission throughout the Galactic disk using the HIFI heterodyne receiver. HIFI observations, with their high spectral resolution, isolate and locate individual clouds in the Galaxy and provide excitation information on the gas. I will present [CII] position-velocity maps that reveal the distribution and motion of the clouds in the inner Galaxy and discuss results on the physical properties of the gas using spectral observations of [CII] and ancillary HI and 12CO, 13CO, and C18O J=1-0 data. The [CII] emission is also a useful tracer of the "Dark H2 Gas", and I will discuss its distribution in a sample of interstellar clouds. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration.
48 CFR 15.403-4 - Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).
2010-10-01
... or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b). 15.403-4 Section 15.403-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 15.403-4 Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C...
Screening for the C9ORF72 repeat expansion in a greek frontotemporal dementia cohort.
Kartanou, Chrisoula; Karadima, Georgia; Koutsis, Georgios; Breza, Marianthi; Papageorgiou, Sokratis G; Paraskevas, George P; Kapaki, Elisabeth; Panas, Marios
2018-02-01
The C9orf72 repeat expansion is a common genetic cause of frontotemporal dementia (FTD) and amyotrophic lateral sclerosis (ALS) in European populations. A previous study has reported a high frequency of the expansion in Greek ALS. However, no data have been reported on the frequency of the expansion in Greek FTD. Currently, we investigated the frequency of the C9orfF72 expansion in a well-characterized cohort of 64 Greek FTD patients. We detected the C9orf72 repeat expansion in 9.3% of cases. Overall, 27.7% of familial and 2.2% of sporadic cases were expansion-positive. Five out of 6 cases had a diagnosis of behavioral variant FTD. All expansion-positive cases had fairly typical FTD presentations. Clinical features included motor neuron disease, Parkinsonism and hallucinations. We conclude that the overall frequency of C9orf72-positive cases in Greek FTD is high, comparable to Greek ALS, similar to some Western European, but significantly higher than some Mediterranean FTD populations.
Bioinformatics Data Mining Approach Suggests Coexpression of AGTPBP1 with an ALS-linked Gene C9orf72
Directory of Open Access Journals (Sweden)
Shouta Kitano
2015-01-01
Full Text Available Background Expanded GGGGCC hexanucleotide repeats located in the noncoding region of the chromosome 9 open reading frame 72 ( C9orf72 gene represent the most common genetic abnormality for familial and sporadic amyotrophic lateral sclerosis (ALS and frontotemporal dementia (FTD. Formation of nuclear RNA foci, accumulation of repeat-associated non-ATG-translated dipeptide-repeat proteins, and haploinsufficiency of C9orf72 are proposed for pathological mechanisms of C9ALS/FTD. However, at present, the physiological function of C9orf72 remains largely unknown. Methods By searching on a bioinformatics database named COXPRESdb composed of the comprehensive gene coexpression data, we studied potential C9orf72 interactors. Results We identified the ATP/GTP binding protein 1 ( AGTPBP1 gene alternatively named NNA1 encoding a cytosolic carboxypeptidase whose mutation is causative of the degeneration of Purkinje cells and motor neurons as the most significant gene coexpressed with C9orf72. We verified coexpression and interaction of AGTPBP1 and C9orf72 in transfected cells by immunoprecipitation and in neurons of the human brain by double-labeling immunohistochemistry. Furthermore, we found a positive correlation between AGTPBP1 and C9orf72 mRNA expression levels in the set of 21 human brains examined. Conclusions These results suggest that AGTPBP1 serves as a C9orf72 interacting partner that plays a role in the regulation of neuronal function in a coordinated manner within the central nervous system.
Λc photoproduction and lifetime measurement
International Nuclear Information System (INIS)
Amendolia, S.R.; Bagliesi, G.; Batignani, G.; Bertolucci, E.; Bettoni, D.; Bizetti, A.; Bosisio, L.; Bottigli, U.; Bradaschia, C.; Dell'Orso, M.; Fidecaro, F.; Foa, L.; Focardi, E.; Giannetti, P.; Giorgi, M.A.; Marrocchesi, P.S.; Menzione, A.; Raso, G.; Ristori, L.; Scribano, A.; Stefanini, A.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Beck, G.A.; Bologna, G.; D'Ettorre Piazzoli, B.; Picchi, P.; Budinich, M.; Liello, F.; Milotti, E.; Rolandi, L.; Carter, J.; Green, M.G.; Landon, M.P.J.; March, P.V.; Sacks, L.; Sanjari, A.H.; Strong, J.A.; Ciocci, M.A.; Enorini, M.; Fabbri, F.L.; Laurelli, P.; Mannocchi, G.; Simonelli, L.; Spillantini, P.; Zallo, A.
1987-01-01
A measurement of the lifetime of the Λ c baryon photoproduced coherently of a germanium-silicon target is presented. A signal of Λ c → ΔΚ * → pKππ 0 has been observed and the two different decay diagrams for this process are compared. A sample of 9 Λ c decays give a lifetime of 1.1(+0.8-0.4)10 13 s. (orig.)
Watanabe, Ryoya; Nie, Yulun; Wakahara, Shinichiro; Komori, Daisuke; Li, Yu-You
2017-11-01
Anaerobic membrane bioreactor (AnMBR) for sewage treatment was operated for 650days with the decrease of temperature from 25°C to 10°C. At higher temperature >15°C, COD removal was above 94% while sewage treatment efficiency and relevant CH 4 production decreased below 15°C. The effluent COD at 10°C was 134mg/L at HRT of 16h. Moreover, low temperature can result in a higher membrane fouling rate due to the microbial self-protection behavior in coping with the temperature decrease by releasing soluble microbial products (SMP) and extracellular polymeric substances (EPS). The contribution of pore blocking to membrane fouling caused by protein from SMP and EPS increased from 17% to 45% and that of cake layer decreased from 81% to 53% at 25°C and 15°C respectively. The inhibition to hydrolysis and acidification process was responsible to the decrease of sewage treatment at lower temperature. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Klauss, E.U.
1984-01-01
In the present thesis the excitation functions of the reaction 10 B( 14 N, 12 C) 12 C to the ground states, the first excited state at 4.43 MeV (Jsup(π) = 2 1 + ) of a 12 C residual nucleus, and to the double excitation of ejectile and residue nucleus to the 4.43 state are studied. The measurements were performed in an energy range 13MeV 14 N) 0 (in the c.m. system). By a fitting to elastic scattering data the optical potential for 10 B+ 14 N was determined. With this potential it was tried by means of Hauser-Feshbach calculations to calculate the cross sections of the reaction 10 B( 14 N, 12 C) 12 C. The strong 16 + resonance and indications of 18 + in the excitation function of the reaction 10 B( 14 N, 12 Csub(g.s.)) 12 Csub(g.s.) should be pronounced. An unexpected large cross section was observed in the reaction 10 B( 14 N, 12 Csub(g.s.)) 12 C(4 1 + ). This is considered as a further indication to the strong contribution of a direct process. (orig./HSI) [de
A Clinical Update of the Hb Siirt [β27(B9)Ala→Gly; HBB: c.83C>G] Hemoglobin Variant.
Cappabianca, Maria Pia; Colosimo, Alessia; Sabatucci, Annalaura; Dainese, Enrico; Di Biagio, Paola; Piscitelli, Roberta; Sarra, Ofelia; Zei, Daniela; Amato, Antonio
2017-01-01
We report a clinical update of the hemoglobin (Hb) variant [β27(B9)Ala→Gly; HBB: c.83C>G], named Hb Siirt, that was previously described as a silent variant in a 23-year-old Kurdish female. The patient was also a carrier of the codon 5 (-CT) (HBB: c.17_18delCT) frameshift mutation and of the ααα anti 3.7 triplication. Her initial moderate β-thalassemia intermedia (β-TI) phenotype worsened with time, causing the patient to become a transfusion-dependent subject at the age of ∼40 years. Subsequent molecular characterization of both parents revealed that the Hb Siirt variant was inherited by the mother, while the other two globin alterations (HBB: c.17_18delCT and ααα anti 3.7 triplication) were genetically transmitted by the father. The latter remained a carrier of a mild β-TI phenotype throughout his life, at least until the age of 65 years. We hypothesize that the worsened clinical conditions in the daughter were due to the additional, maternally inherited Hb Siirt variant. However, protein 3D conformational analysis did not seem to reveal substantial overall structural changes. Among the other three described variants [Hb Volga (HBB: c.83C>A), Hb Knossos (HBB: c.82 G>T), Hb Grange-Blanche (HBB: c.83C>T] that are due to nucleotide substitutions at codon 27 of the β-globin gene; only Hb Knossos causes a β + -thalassemia (β + -thal) phenotype.
Sriraman, Shravan Kumar; Pan, Jiayi; Sarisozen, Can; Luther, Ed; Torchilin, Vladimir
2016-02-01
Current research in cancer therapy is beginning to shift toward the use of combinational drug treatment regimens. However, the efficient delivery of drug combinations is governed by a number of complex factors in the clinical setting. Therefore, the ability to synchronize the pharmacokinetics of the individual therapeutic agents present in combination not only to allow for simultaneous tumor accumulation but also to allow for a synergistic relationship at the intracellular level could prove to be advantageous. In this work, we report the development of a novel folic acid-targeted liposomal formulation simultaneously co-loaded with C6 ceramide and doxorubicin [FA-(C6+Dox)-LP]. In vitro cytotoxicity assays showed that the FA-(C6+Dox)-LP was able to significantly reduce the IC50 of Dox when compared to that after the treatment with the doxorubicin-loaded liposomes (Dox-LP) as well as the untargeted drug co-loaded (C6+Dox)-LP on HeLa, A2780-ADR, and H69-AR cells. The analysis of the cell cycle distribution showed that while the C6 liposomes (C6-LP) did not cause cell cycle arrest, all the Dox-containing liposomes mediated cell cycle arrest in HeLa cells in the G2 phase at Dox concentrations of 0.3 and 1 μM and in the S phase at the higher concentrations. It was also found that this arrest in the S phase precedes the progression of the cells to apoptosis. The targeted FA-(C6+Dox)-LP were able to significantly enhance the induction of apoptotic events in HeLa cell monolayers as compared to the other treatment groups. Next, using time-lapse phase holographic imaging microscopy, it was found that upon treatment with the FA-(C6+Dox)-LP, the HeLa cells underwent rapid progression to apoptosis after 21 h as evidenced by a drastic drop in the average area of the cells after loss of cell membrane integrity. Finally, upon evaluation in a HeLa spheroid cell model, treatment with the FA-(C6+Dox)-LP showed significantly higher levels of cell death compared to those with C6-LP and
Dicty_cDB: Contig-U03903-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available A sequence from clone DKEYP-86F8 in l... 52 0.023 1 ( BV433213 ) S237P6285FG10.T0 Portuguese...6 1 ( BV438906 ) S237P6374FA9.T0 PortugueseWaterDog Canis familiar... 44 5.6 1 ( AM456273 ) Vitis vinifera c
Lifescience Database Archive (English)
Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0
Mechanochemical synthesis of 1-stanna-2,3-dicarba-closo-dodecaborane SnB9C2H11
International Nuclear Information System (INIS)
Volkov, V.V.; Myakishev, K.G.; Solomatina, L.Ya.
1990-01-01
The possibility of synthesis of 1-stanna-2, 3-dicarba-dodecaborane (2), SnB 9 C 2 H 11 by the mechanical activation of solid mixtures of CsB 9 C 2 H 12 , NaH and SnCl 2 has been studied. These solid phase mechano-chemical reactions were performed in vacuum vibration mills without any liquid solvents at room temperature. Crystalline SnB 9 C 2 H 11 was produced by sublimation in vacuum at 140 deg C. Yioeld of the sublimate was 3-6%
Kruyt, F A; Youssoufian, H
1998-10-01
Fanconi anemia (FA) is an autosomal recessive disease characterized by chromosomal instability, bone marrow failure, and a high risk of developing malignancies. Although the disorder is genetically heterogeneous, all FA cells are defined by their sensitivity to the apoptosis-inducing effect of cross-linking agents, such as mitomycin C (MMC). The cloned FA disease genes, FAC and FAA, encode proteins with no homology to each other or to any known protein. We generated a highly specific antibody against FAA and found the protein in both the cytoplasm and nucleus of mammalian cells. By subcellular fractionation, FAA is also associated with intracellular membranes. To identify the subcellular compartment that is relevant for FAA activity, we appended nuclear export and nuclear localization signals to the carboxy terminus of FAA and enriched its localization in either the cytoplasm or the nucleus. Nuclear localization of FAA was both necessary and sufficient to correct MMC sensitivity in FA-A cells. In addition, we found no evidence for an interaction between FAA and FAC either in vivo or in vitro. Together with a previous finding that FAC is active in the cytoplasm but not in the nucleus, our results indicate that FAA and FAC function in separate subcellular compartments. Thus, FAA and FAC, if functionally linked, are more likely to be in a linear pathway rather than form a macromolecular complex to protect against cross-linker cytotoxicity.
Styl RFLP recognized by a human IRBP cDNA localized to chromosome 10
Energy Technology Data Exchange (ETDEWEB)
Chin, K S; Mathew, C G.P.; Fong, S L; Bridges, C D; Ponder, B A.J.
1988-02-25
A 2184 bp cDNA (H.4 IRBP) encoding human interstitial retinol-biding protein isolated from a human retina cDNA library in lambdagt10 by screening with a bovine IRBP cDNA probe. Styl identifies a 2-allele polymorphism with bands at 2.3 kb (Cl) and 1.95 kb (C2) and invariant bands at 1.1, 1.0 and 0.8kb. Codominant segregation was observed in two informative families. The RFLP was mapped to chromosome 10 using somatic cell hybrids. In situ hybridization suggests regional assignments near p11.2 -q11.2 with a secondary site of hybridization at q24-25.
Directory of Open Access Journals (Sweden)
Birte Blankenhaus
2014-02-01
Full Text Available Accumulating evidence suggests that IL-9-mediated immunity plays a fundamental role in control of intestinal nematode infection. Here we report a different impact of Foxp3⁺ regulatory T cells (Treg in nematode-induced evasion of IL-9-mediated immunity in BALB/c and C57BL/6 mice. Infection with Strongyloides ratti induced Treg expansion with similar kinetics and phenotype in both strains. Strikingly, Treg depletion reduced parasite burden selectively in BALB/c but not in C57BL/6 mice. Treg function was apparent in both strains as Treg depletion increased nematode-specific humoral and cellular Th2 response in BALB/c and C57BL/6 mice to the same extent. Improved resistance in Treg-depleted BALB/c mice was accompanied by increased production of IL-9 and accelerated degranulation of mast cells. In contrast, IL-9 production was not significantly elevated and kinetics of mast cell degranulation were unaffected by Treg depletion in C57BL/6 mice. By in vivo neutralization, we demonstrate that increased IL-9 production during the first days of infection caused accelerated mast cell degranulation and rapid expulsion of S. ratti adults from the small intestine of Treg-depleted BALB/c mice. In genetically mast cell-deficient (Cpa3-Cre BALB/c mice, Treg depletion still resulted in increased IL-9 production but resistance to S. ratti infection was lost, suggesting that IL-9-driven mast cell activation mediated accelerated expulsion of S. ratti in Treg-depleted BALB/c mice. This IL-9-driven mast cell degranulation is a central mechanism of S. ratti expulsion in both, BALB/c and C57BL/6 mice, because IL-9 injection reduced and IL-9 neutralization increased parasite burden in the presence of Treg in both strains. Therefore our results suggest that Foxp3⁺ Treg suppress sufficient IL-9 production for subsequent mast cell degranulation during S. ratti infection in a non-redundant manner in BALB/c mice, whereas additional regulatory pathways are functional in
Phytoremediation of carbamazepine and its metabolite 10,11-epoxycarbamazepine by C3 and C4 plants.
Ryšlavá, Helena; Pomeislová, Alice; Pšondrová, Šárka; Hýsková, Veronika; Smrček, Stanislav
2015-12-01
The anticonvulsant drug carbamazepine is considered as an indicator of sewage water pollution: however, its uptake by plants and effect on metabolism have not been sufficiently documented, let alone its metabolite (10,11-epoxycarbamazepine). In a model system of sterile, hydroponically cultivated Zea mays (as C4 plant) and Helianthus annuus (as C3 plant), the uptake and effect of carbamazepine and 10,11-epoxycarbamazepine were studied in comparison with those of acetaminophen and ibuprofen. Ibuprofen and acetaminophen were effectively extracted from drug-supplemented media by both plants, while the uptake of more hydrophobic carbamazepine was much lower. On the other hand, the carbamazepine metabolite, 10,11-epoxycarbamazepine, was, unlike sunflower, willingly taken up by maize plants (after 96 h 88 % of the initial concentration) and effectively stored in maize tissues. In addition, the effect of the studied pharmaceuticals on the plant metabolism (enzymes of Hatch-Slack cycle, peroxidases) was followed. The activity of bound peroxidases, which could cause xylem vessel lignification and reduction of xenobiotic uptake, was at the level of control plants in maize leaves contrary to sunflower. Therefore, our results indicate that maize has the potential to remove 10,11-epoxycarbamazepine from contaminated soils.
pPKCδ activates SC35 splicing factor during H9c2 myoblastic differentiation.
Zara, Susi; Falconi, Mirella; Rapino, Monica; Zago, Michela; Orsini, Giovanna; Mazzotti, Giovanni; Cataldi, Amelia; Teti, Gabriella
2011-01-01
Although Protein Kinase C (PKC) isoforms' role in the neonatal and adult cardiac tissue development and ageing has been widely described "in vivo", the interaction of such enzymes with specific nuclear substrates needs to be investigated. The aim of our research has been the study of the expression, localization and interaction with the splicing factor SC35 of PKC isoforms (α, δ, ε, ζ) and their potential role in modulating the transcription machinery. H9c2 cells induced to myoblast differentiation in the presence of 1% Horse Serum (HS) have represented our experimental model. The expression of PKC isoforms, their distribution and interaction with SC35 have been evaluated by western blotting, co-immunoprecipitation and double gold immunolabeling for transmission and scanning electron microscopy. Our results show PKCδ as the most expressed isoform in differentiated cells. Surprisingly, the distribution of PKCδ and SC35 does not show any significant modification between 10%FBS and 1%HS treated samples and no co-localization is observed. Moreover the interaction between the phosphorylated form of PKCδ (pPKCδ) and SC35 increases, is distributed and co-localizes within the nucleus of differentiated H9c2. These data represent reasonable evidence of pPKCδ mediated SC35 splicing factor activation, suggesting its direct effect on transcription via interaction with the transcription machinery. Furthermore, this co-localization represents a crucial event resulting in downstream changes in transcription of components which determine the morphological modifications related to cardiomyoblast differentiated phenotype.
Lifescience Database Archive (English)
Full Text Available tula EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar...C10B03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrh... cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 62...13 |AL382813.1 Medicago truncatula EST MtBC10B03R1 : T7 end of clone MtBC10B03 of
An XmnI RFLP detected with a cDNA probe for the CYP2C gene locus on chromosome 10
Energy Technology Data Exchange (ETDEWEB)
Gough, A C; Spurr, N K [Clare Hall Laboratories, Herts (England); Meehan, R R; Miles, J S; Wolf, C R [Univ. Department of Biochemistry, Edinburgh (England)
1989-06-12
A 700 bp fragment of the cDNA clone for the human cytochrome P450 gene cloned in pUC9 at the PstI restriction site. XmnI detects a two allele polymorphism with bands at 10.00 kb (A1), 4.8 kb (A2) and constants bands at 13.0, 8.3, 4.6, 3.1, 2.8, 2.5, 2.3, 2.2, 1.8 and 1.5 kb. A total of 16 unrelated individuals of Caucasian origin were screened for A1 (.625) and A2 (.375). The probe was assigned to chromosome 10q24.1-q24.3 using a panel of human-rodent somatic cell hybrids and in situ hybridization. Co-dominant inheritance was observed in 3 families from CEPH, K1329 2 K1331 and K1333.
Bedada, Satish Kumar; Neerati, Prasad
2018-02-01
The purpose of present study was to evaluate the effect of quercetin on pharmacokinetics of diclofenac sodium (DIC) in healthy volunteers. The open-label, 2 period, sequential study was conducted in 12 healthy volunteers. DIC 100 mg was administered during control and after quercetin phases. Quercetin 500 mg was administered twice daily for 10 days during quercetin phase. Treatment with quercetin significantly enhanced maximum plasma concentration (C max ) , area under the curve (AUC 0-∞ ), and half life, while significantly decreased elimination rate constant (k el ) and apparent oral clearance (CL/F) of DIC compared with control. On the other hand, C max and AUC 0-∞ of 4-hydroxydiclofenac (4-OHDIC) were decreased after quercetin treatment. In addition, geometric mean ratios and 90% confidence intervals for C max and AUC 0-∞ of DIC and 4-OHDIC were both out of the no-effect limits of 0.80-1.25, which indicates a significant pharmacokinetic interaction between quercetin and DIC. Furthermore, quercetin treatment significantly decreased metabolic ratios of C max and AUC 0-∞ suggesting that reduced formation of DIC to 4-OHDIC. The results suggest that quercetin might have inhibited CYP2C9-mediated metabolism of DIC. Accordingly, caution should be taken when quercetin is used in combination with therapeutic drugs metabolized by CYP2C9, and dose adjustment of CYP2C9 substrates may be necessary. Copyright © 2017 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
Bayukov, Yu.D.; Gavrilov, V.B.; Goryainov, N.A.
1983-01-01
The tables of cross sections of neutron production with energies 7.5-190 MeV for reactions p+A→n+X at 1-9 GeV/c, π + +A→n+X at 1-6 GeV/c and π - +A→n+X at 1.4 and 5 GeV/c are presented. A-dependence (for Be, C, Al, Ti, Fe, Cu, Nb, Cd, Sn, Ta, Pb and U targets) for incident 7.5 GeV/c protons and dependence on incident particle momentum (for protons at 1, 1.4, 2, 3, 5, 6, 6.25, 6.5, 7, 7.5, 8.25, 8.5 and 9 GeV/c, for π + -mesons at 1, 1.4, 2, 3, 4, 5 and 6 GeV/c, π - -mesons at 1,4 and 5 GeV/c) for C, Cu, Pb, U targets are measured in detail, for secondary neutrons at 119 deg. Detailed angular dependences in the range from 10 deg to 160 deg are presented for C, Cu, Pb, U targets for incident 7.5 GeV/c protons and 5 GeV/c π - -mesons. Some of typical dependences are illustrated by diagrams
Observation of ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ.
Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Baldini Ferroli, R; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Dou, Z L; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Farinelli, R; Fava, L; Fedorov, O; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, L; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G S; Huang, J S; Huang, X T; Huang, X Z; Huang, Y; Huang, Z L; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kupsc, A; Kühn, W; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, Q Y; Li, T; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, Y B; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Ma, Y M; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Mitchell, R E; Mo, X H; Mo, Y J; Morales Morales, C; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, H R; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, B L; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, W P; Wang, X F; Wang, Y; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, Q N; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, S Q; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y N; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H
2017-06-02
Using 4.479×10^{8} ψ(3686) events collected with the BESIII detector, we search for the decays ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ, where J=0, 1, 2. The decays ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ are observed for the first time. The measured branching fractions are B(ψ(3686)→e^{+}e^{-}χ_{cJ})=(11.7±2.5±1.0)×10^{-4}, (8.6±0.3±0.6)×10^{-4}, (6.9±0.5±0.6)×10^{-4} for J=0, 1, 2, and B(χ_{cJ}→e^{+}e^{-}J/ψ)=(1.51±0.30±0.13)×10^{-4}, (3.73±0.09±0.25)×10^{-3}, (2.48±0.08±0.16)×10^{-3} for J=0, 1, 2, respectively. The ratios of the branching fractions B(ψ(3686)→e^{+}e^{-}χ_{cJ})/B(ψ(3686)→γχ_{cJ}) and B(χ_{cJ}→e^{+}e^{-}J/ψ)/B(χ_{cJ}→γJ/ψ) are also reported. Also, the α values of helicity angular distributions of the e^{+}e^{-} pair are determined for ψ(3686)→e^{+}e^{-}χ_{c1,2} and χ_{c1,2}→e^{+}e^{-}J/ψ.
Repetitive element transcripts are elevated in the brain of C9orf72 ALS/FTLD patients.
Prudencio, Mercedes; Gonzales, Patrick K; Cook, Casey N; Gendron, Tania F; Daughrity, Lillian M; Song, Yuping; Ebbert, Mark T W; van Blitterswijk, Marka; Zhang, Yong-Jie; Jansen-West, Karen; Baker, Matthew C; DeTure, Michael; Rademakers, Rosa; Boylan, Kevin B; Dickson, Dennis W; Petrucelli, Leonard; Link, Christopher D
2017-09-01
Significant transcriptome alterations are detected in the brain of patients with amyotrophic lateral sclerosis (ALS), including carriers of the C9orf72 repeat expansion and C9orf72-negative sporadic cases. Recently, the expression of repetitive element transcripts has been associated with toxicity and, while increased repetitive element expression has been observed in several neurodegenerative diseases, little is known about their contribution to ALS. To assess whether aberrant expression of repetitive element sequences are observed in ALS, we analysed RNA sequencing data from C9orf72-positive and sporadic ALS cases, as well as healthy controls. Transcripts from multiple classes and subclasses of repetitive elements (LINEs, endogenous retroviruses, DNA transposons, simple repeats, etc.) were significantly increased in the frontal cortex of C9orf72 ALS patients. A large collection of patient samples, representing both C9orf72 positive and negative ALS, ALS/FTLD, and FTLD cases, was used to validate the levels of several repetitive element transcripts. These analyses confirmed that repetitive element expression was significantly increased in C9orf72-positive compared to C9orf72-negative or control cases. While previous studies suggest an important link between TDP-43 and repetitive element biology, our data indicate that TDP-43 pathology alone is insufficient to account for the observed changes in repetitive elements in ALS/FTLD. Instead, we found that repetitive element expression positively correlated with RNA polymerase II activity in postmortem brain, and pharmacologic modulation of RNA polymerase II activity altered repetitive element expression in vitro. We conclude that increased RNA polymerase II activity in ALS/FTLD may lead to increased repetitive element transcript expression, a novel pathological feature of ALS/FTLD. © The Author 2017. Published by Oxford University Press.
International Nuclear Information System (INIS)
Sorrentino, V.; Drozdoff, V.; Zeitz, L.; Fleissner, E.
1987-01-01
C3H/10T 1/2 cells were infected with a retroviral vector expressing a mouse c-myc oncogene and a drug-selection marker. The resulting cells, morphologically indistinguishable from C3H/10T l/1, displayed a greatly enhanced sensitivity to neoplastic transformation by ionizing radiation or by a chemical carcinogen. Constitutive expression of myc therefore appears to synergize with an initial carcinogenic event, providing a function analogous to a subsequent event that apparently is required for the neoplastic transformation of these cells. This cell system should prove useful in exploring early stages in radiation-induced transformation
Directory of Open Access Journals (Sweden)
Saul Herranz-Martin
2017-07-01
Full Text Available Intronic GGGGCC repeat expansions in C9orf72 are the most common genetic cause of amyotrophic lateral sclerosis (ALS and frontotemporal dementia (FTD. Two major pathologies stemming from the hexanucleotide RNA expansions (HREs have been identified in postmortem tissue: intracellular RNA foci and repeat-associated non-ATG dependent (RAN dipeptides, although it is unclear how these and other hallmarks of disease contribute to the pathophysiology of neuronal injury. Here, we describe two novel lines of mice that overexpress either 10 pure or 102 interrupted GGGGCC repeats mediated by adeno-associated virus (AAV and recapitulate the relevant human pathology and disease-related behavioural phenotypes. Similar levels of intracellular RNA foci developed in both lines of mice, but only mice expressing 102 repeats generated C9orf72 RAN pathology, neuromuscular junction (NMJ abnormalities, dispersal of the hippocampal CA1, enhanced apoptosis, and deficits in gait and cognition. Neither line of mice, however, showed extensive TAR DNA-binding protein 43 (TDP-43 pathology or neurodegeneration. Our data suggest that RNA foci pathology is not a good predictor of C9orf72 RAN dipeptide formation, and that RAN dipeptides and NMJ dysfunction are drivers of C9orf72 disease pathogenesis. These AAV-mediated models of C9orf72-associated ALS/FTD will be useful tools for studying disease pathophysiology and developing new therapeutic approaches.
Functions of Tenascin-C and Integrin alpha9beta1 in Mediating Prostate Cancer Bone Metastasis
2017-10-01
AWARD NUMBER: W81XWH-16-1-0523 TITLE: Functions of Tenascin- C and Integrin alpha9beta1 in Mediating Prostate Cancer Bone Metastasis...Prostat Prostate Cancer Bone Metastasis 5a. CONTRACT NUMBER Functions of Tenascin- C and Integrin alpha9beta1 in Mediating Prostate Cancer...SUPPLEMENTARY NOTES 14. ABSTRACT The purpose of this work is to dissect mechanisms responsible for interactions between integrin a9b1 and tenascin- C that are
The comparison of 18C(n; γ)19C and 18C(α; n)21O reaction rates: consequences for the r-process
International Nuclear Information System (INIS)
Dan, M.; Singh, G.; Chatterjee, R.; Shubhchintak
2017-01-01
Neutron rich light and medium mass nuclei play a major role in determining the reaction flow towards the r-process seed nuclei production. In this text, we calculate the neutron capture rate of 18 C and compare it with that of α-capture by the same nucleus in the temperature range T 9 = 0:1 - 10. This temperature range roughly equals to an energy range of 1 keV to 1 MeV in centre of mass frame, where it is very difficult to perform direct reaction experiments. Further, the theoretical construction of 18 C-n continuum state for the 18 C(n; γ) 19 C direct reaction is a tedious job
Six key elements' analysis of FAC effective management in nuclear power plant
International Nuclear Information System (INIS)
Zhong Zhaojiang; Chen Hanming
2010-01-01
Corporate Commitment, Analysis, Operating Experience, Inspection, Training and Engineering Judgment, Long-Term Strategy are the six key elements of FAC effective management in nuclear power plant. Corporate commitment is the economy base of FAC management and ensure of management system, Analysis is the method of FAC's optimization and consummation, Operating experience is the reference and complementarity of FAC, Inspection is the base of accumulating FAC data, Training and engineering judgment is the technical complementarity and deepening, Long-term strategy is successful key of FAC management. Six key elements supplement each other, and make up of a full system of FAC effective management. For present FAC management in our national nuclear power plant, six key elements are the core and bring out the best in each other to found the FAC effective management system and prevent great FAC occurrence. (authors)
Zang, Hongjun; Chen, Eugene Y. X.
2015-01-01
There is increasing interest in the upgrading of C5 furfural (FF) and C6 5-hydroxymethyl furfural (HMF) into C10 and C12 furoins as higher energy-density intermediates for renewable chemicals, materials, and biofuels. This work utilizes the organocatalytic approach, using the in situ generated N,S-heterocyclic carbene catalyst derived from thiazolium ionic liquids (ILs), to achieve highly efficient self-coupling reactions of FF and HMF. Specifically, variations of the thiazolium IL structure have led to the most active and efficient catalyst system of the current series, which is derived from a new thiazolium IL carrying the electron-donating acetate group at the 5-ring position. For FF coupling by this IL (0.1 mol %, 60 °C, 1 h), when combined with Et3N, furoin was obtained in >99% yield. A 97% yield of the C12 furoin was also achieved from the HMF coupling by this catalyst system (10 mol % loading, 120 °C, 3 h). On the other hand, the thiazolium IL bearing the electron-withdrawing group at the 5-ring position is the least active and efficient catalyst. The mechanistic aspects of the coupling reaction by the thiazolium catalyst system have also been examined and a mechanism has been proposed. PMID:25830482
Directory of Open Access Journals (Sweden)
Hongjun Zang
2015-03-01
Full Text Available There is increasing interest in the upgrading of C5 furfural (FF and C6 5-hydroxymethyl furfural (HMF into C10 and C12 furoins as higher energy-density intermediates for renewable chemicals, materials, and biofuels. This work utilizes the organocatalytic approach, using the in situ generated N,S-heterocyclic carbene catalyst derived from thiazolium ionic liquids (ILs, to achieve highly efficient self-coupling reactions of FF and HMF. Specifically, variations of the thiazolium IL structure have led to the most active and efficient catalyst system of the current series, which is derived from a new thiazolium IL carrying the electron-donating acetate group at the 5-ring position. For FF coupling by this IL (0.1 mol %, 60 °C, 1 h, when combined with Et3N, furoin was obtained in >99% yield. A 97% yield of the C12 furoin was also achieved from the HMF coupling by this catalyst system (10 mol % loading, 120 °C, 3 h. On the other hand, the thiazolium IL bearing the electron-withdrawing group at the 5-ring position is the least active and efficient catalyst. The mechanistic aspects of the coupling reaction by the thiazolium catalyst system have also been examined and a mechanism has been proposed.
DEFF Research Database (Denmark)
Frederiksen, Hanne; Frandsen, Henrik Lauritz; Pfau, W.
2004-01-01
2-Amino-3-methyl-9H-pyrido[2,3-b]indole (MeAalphaC) and 2-amino-3-methyl-9H-pyrido[2,3-b]indole (AalphaC) are mutagenic and carcinogenic heterocyclic amines formed during ordinary cooking. MeAalphaC and AalphaC are activated to mutagenic metabolites by cytochrome P450-mediated N-oxidation...... by reaction of the parent amines with acetylated guanine N3-oxide. N-2-OH-MeAalphaC and N-2-OH-AalphaC reacted with calf thymus DNA after addition of acetic anhydride. P-32-postlabelling analysis of modified DNA showed one major adduct co-migrating with N-2-(3',5'-diphospho-2'-deoxyguanosin-8-yl...
Search for anomalously interacting stable particles in the mass range from 1.0 to 1.8 GeV/c2
International Nuclear Information System (INIS)
Abramov, V.V.; Arbuzov, V.A.; Baldin, B.Yu.
1986-01-01
A search for stable (r > 10 -8 s) anomalously interacting particles with the charge Z=±1 has been performed in the mass range from 1.0 to 1.8 GeV/c 2 . Secondary positive and negative particles with mean transverse momentum of 3 GeV/c produced in the collision of 70 GeV protons with the lead target have been investigated. Upper limits for invariant differential production cross-sections of anomalously interacting particles (1.8x10 -33 -9.5x10 -32 cm 2 xGeV -2 ) per lead nucleus have been obtained at the 90 % considence level
Study of \\Omega_c^0 and \\Omega_c^{*0} Baryons at Belle
Solovieva, E.; Chistov, R.; Collaboration, for the Belle
2008-01-01
We report results from a study of the charmed double strange baryons \\Omega_c^0 and \\Omega_c^{*0} at Belle. The \\Omega_c^0 is reconstructed using the \\Omega_c^0 --> \\Omega^- \\pi^+ decay mode, and its mass is measured to be (2693.6 \\pm 0.3 {+1.8 \\atop -1.5}) MeV/c^2. The \\Omega_c^{*0} baryon is reconstructed in the \\Omega_c^0 \\gamma mode. The mass difference M_{\\Omega_c^{*0}} - M_{\\Omega_c^0} is measured to be (70.7 \\pm 0.9 {+0.1 \\atop -0.9}) MeV/c^2. The analysis is performed using 673 fb^{-1...
Armour, E P; Wang, Z H; Corry, P M; Martinez, A
1991-06-15
Modification of survival by long duration, 41 degrees C hyperthermia in combination with low dose rate radiation (0.5 Gy/h) was determined in rat 9L gliosarcoma cells. Cells were exposed to radiation in a manner that simulated continuous irradiation at a dose rate relevant to clinical brachytherapy. High dose rate X-irradiation was fractionated in 1.0-Gy fractions at 2-h intervals (FLDRI). Previous studies had demonstrated that 9L cells exposed to FLDRI with these parameters have survival characteristics that are equivalent to continuous low dose rate irradiation. Cells exposed to 41 degrees C throughout FLDRI were sensitized significantly (thermal enhancement ratio of 2.07) compared with cells irradiated at 37 degrees C. Incubation for 24 h at 41 degrees C before and/or after FLDRI at either 37 degrees C or 41 degrees C did not increase the slope of the radiation survival curves but did reduce the shoulder. Similarly, heating at 43 degrees C for 30 or 60 min before and/or after irradiation at 0.5 Gy/h also did not enhance cell sensitivity. Survival of cells after irradiation at high dose rate (60 Gy/h) was independent of the temperature during irradiation. Preheat at 41 degrees C for 24 h did not sensitize cells to high dose rate irradiation by increasing the slope of the survival curve, although a loss of shoulder was observed. Sensitization of cells heated at 43 degrees C for 30 or 60 min before high dose rate irradiation was expressed as classical slope modification. Our results demonstrate that 41 degrees C heating during FLDRI greatly sensitizes cells to radiation-induced killing for exposure durations up to 36 h. Heating 9L cells at 41 degrees C or 43 degrees C adjacent to FLDRI at 0.5 Gy/h resulted in no additional enhancement of terminal sensitivity, although shoulder modification was observed. The sensitization by simultaneous heating described above occurred even though thermotolerance developed during extended incubation at 41 degrees C. These in vitro
International Nuclear Information System (INIS)
Schupfner, R.
2016-01-01
The determination of the activity concentration of the radionuclides "1"4C/C and "9"0Sr/Ca and "2"2"8Th/"2"3"2Th applying combined radionuclide analyses methods has been proved to be a suitable tool for the purpose of an unambiguous age determination of elephant ivory [1, 2, 3, 10, 11, 12, 13]. Analysing representative and independently dated samples (N = 28) of ivory the curves fitting the post mortal interval (PMI) versus the activity concentration of the radionuclides mentioned above produced the data base enabling a more unambiguous age determination. Data from these studies origin [1, 2, 3, 10, 11, 12, 13] in analyses of ivory samples which were available up to the 2012. During the last five years there was a gap in information of the future trend of "1"4C/C and "9"0Sr/Ca. Up to this study it was not possible to assess whether the future level of "1"4C/C as well as "9"0Sr/Ca can analytically be distinguished from the level before 1954. At about 1954 the activity concentration of radionuclides from the atmospheric nuclear explosion, as "1"4C and "9"0Sr, increased in ivory significantly. This study aims in closing this information gap. The results of analyses of "1"4C/C, "9"0Sr/Ca, "2"2"8Th/"2"3"2Th in ivory with PMI values ranging from 1 to 5 years are presented and interpreted. These data enable an actualization of the calibration curves of PMI versus specific activities. This is necessary for a better understanding of the effect of blindness of "1"4C/C dating and its prevention. On the base of all available results form independent dated ivory sample available up to 2015 a suitable analytical procedure is suggested which aims in a more precise and reliable age determination of elephant tusks. Results of determining of radionuclides "1"4C/C and "9"0Sr/Ca and "2"2"8Th/"2"3"2Th in ivory are shown from before 1950 to 2015. These results are discussed with respect the purposes of dating as well as their significance to the radiation protection of nonhuman species.
Miyazaki, S; Koga, R; Bohnert, H J; Fukuhara, T
1999-03-01
Ten transcripts (Mpc1-10) homologous to protein phosphatases of the 2C family have been isolated from the halophyte Mesembryanthemum crystallinum (common ice plant). Transcripts range in size from 1.6 to 2.6 kb, and encode proteins whose catalytic domains are between 24% and 62% identical to that of the Arabidopsis PP2C, ABI1. Transcript expression is tissue specific. Two isoforms are present only in roots (Mpc1 and Mpc5), three in young leaves (Mpc6, 8 and 9), two in old leaves (Mpc6 and Mpc8), and two in post-flowering leaves (Mpc8 and Mpc9). Mpc2 is strongly expressed in roots and also in seeds, meristematic tissues and mature flowers. Mpc3 is specific for leaf meristems, and Mpc4 is found in root and leaf meristems. Mpc7 is restricted to meristematic tissues. Mpc10 is only present in mature flowers. Mpc2 (in roots and leaves), Mpc5 (in roots) and Mpc8 (weakly in leaves) are induced by salinity stress and drought conditions with different kinetics in different tissues, but other Mpcs are downregulated by stress. Cold stress (4 degrees C) leads to a decline in Mpc5 and Mp6, but low temperature provoked a long-term (days) increase in Mpc2 levels in leaves and a transient increase (less than 24 h) in roots. Four full-length transcripts have been obtained. In each case, after over-expression in E. coli, the isolated proteins exhibited (Mg2+-dependent, okadeic acid-insensitive) protein phosphatase activity, although activity against 32P-phosphocasein varied among different PP2Cs. Determination of tissue developmental and stress response specificity of PP2C will facilitate functional studies of signal-transducing enzymes in this halophytic organism.
International Nuclear Information System (INIS)
Porwoll, J.P.; Leete, E.
1985-01-01
Potential advanced intermediates in the biosynthesis of delta 9 -tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous 13 C atoms and 14 C. Methyl [5,6- 13 C 2 , 1- 14 C]olivetolate was prepared from lithium [ 13 C 2 ]acetylide and dimethyl [2- 14 C]malonate. Reaction with geranyl bromide afforded methyl [5,6- 13 C 2 , 1- 14 C]cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The 13 C- 13 C couplings observable in the 13 C NMR spectra of these 13 C-enriched compounds and their synthetic precursors are recorded. Methyl [1'- 14 C]olivetolate was prepared from 13 CO 2 to confirm assignments of the 13 C chemical shifts in the pentyl side chain of these compounds. (author)
fac-Tris(pyridine-2-carboxylato-κ2 N,O)cobalt(III)
Golenia, Irina A.; Boyko, Alexander N.; Kotova, Natalia V.; Haukka, Matti; Kalibabchuk, Valentina A.
2011-01-01
In the title compound, [Co(C6H4NO2)3], the CoIII ion lies on a threefold rotation axis and is in a distorted octahedral environment defined by three N and three O donor atoms from three fac-disposed pyridine-2-carboxylate ligands. The ligands are coordinated in a chelate fashion, forming three five-membered rings. In the crystal, translationally related complex molecules are organized into columns along [001] via C—H⋯O hydrogen bonds. PMID:22219826
DEFF Research Database (Denmark)
Palarasah, Yaseelan; Skjodt, Karsten; Brandt, Jette
2010-01-01
complex (C5b-C9) and quantification of complement split products by precipitation-in-gel techniques (e.g. C3d). We have developed a mouse monoclonal antibody (mAb) that is able to detect fluid phase C3c without interference from other products generated from the complement component C3. The C3c specific m....... The C3c mAb was confirmed to be C3c specific, as it showed no cross-reactivity with native (un-cleaved) C3, with C3b, iC3b, or with C3d. Also, no significant reaction was observed with C3 fragments in factor I deficient sera or plasma. This antibody forms the basis for the generation of a robust ELISA...... that allows for a quick and reliable evaluation of complement activation and consumption as a marker for inflammatory processes. We established the C3c plasma range in 100 healthy Danish blood donors with a mean of 3.47 μg/ml and a range of 2.12-4.92 μg/ml. We believe that such an antibody might...
Mutations in c10orf11, a melanocyte-differentiation gene, cause autosomal-recessive albinism.
Grønskov, Karen; Dooley, Christopher M; Østergaard, Elsebet; Kelsh, Robert N; Hansen, Lars; Levesque, Mitchell P; Vilhelmsen, Kaj; Møllgård, Kjeld; Stemple, Derek L; Rosenberg, Thomas
2013-03-07
Autosomal-recessive albinism is a hypopigmentation disorder with a broad phenotypic range. A substantial fraction of individuals with albinism remain genetically unresolved, and it has been hypothesized that more genes are to be identified. By using homozygosity mapping of an inbred Faroese family, we identified a 3.5 Mb homozygous region (10q22.2-q22.3) on chromosome 10. The region contains five protein-coding genes, and sequencing of one of these, C10orf11, revealed a nonsense mutation that segregated with the disease and showed a recessive inheritance pattern. Investigation of additional albinism-affected individuals from the Faroe Islands revealed that five out of eight unrelated affected persons had the nonsense mutation in C10orf11. Screening of a cohort of autosomal-recessive-albinism-affected individuals residing in Denmark showed a homozygous 1 bp duplication in C10orf11 in an individual originating from Lithuania. Immunohistochemistry showed localization of C10orf11 in melanoblasts and melanocytes in human fetal tissue, but no localization was seen in retinal pigment epithelial cells. Knockdown of the zebrafish (Danio rerio) homolog with the use of morpholinos resulted in substantially decreased pigmentation and a reduction of the apparent number of pigmented melanocytes. The morphant phenotype was rescued by wild-type C10orf11, but not by mutant C10orf11. In conclusion, we have identified a melanocyte-differentiation gene, C10orf11, which when mutated causes autosomal-recessive albinism in humans. Copyright © 2013 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.
Representation of the properties 10 CrMoNiNb 9 10
International Nuclear Information System (INIS)
Dette, M.; Hahn, H.; Nieuwland, H.C.D.; Tichler, J.W.
The high-temperature ferritic steal 10 CrMoNiNb 9 10 is used as structural material in nuclear steam generators. It is exposed to loads within the creep range. In order to resist safety also loads caused by incidents after long temperature stress, the time-independent stability parameters must not fall below specified minimum values. The material is characterised by the stability degree Nb/C+N and the niobium excess δ Nb. (orig.) [de
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHA365 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHA365Z 352 - - - - Show VHA365 Library VH (Link to library) Clone ID VHA365 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...TTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTT sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...wfmv Frame C: ---QLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS SSGQLY
Dicty_cDB: Contig-U10229-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9_231( CP000909 |pid:none) Chloroflexus aurantiacus J-10-fl... 39 0.54 EU016654_19( EU016654 |pid:none) Uncultured marine mic...405735 ) T7 end of clone AU0AA006A10 of library AU0AA from... 42 6e-18 5 ( CX531734 ) s13dNF81G04MJ024_257410 Methyl Jasmonate-Elic...e-18 5 ( BG585361 ) EST487125 MHAM Medicago truncatula/Glomus versifo... 78 1e-17 3 ( BF649659 ) NF083E04EC1F1033 Elicited cell cultu... 2e-16 2 ( BF650114 ) NF088A08EC1F1055 Elicited cell culture Medicago t... 78 2e-... CP000745 |pid:none) Methanococcus maripaludis C7, c... 151 1e-66 AM114193_1839( AM114193 |pid:none) Uncultured methanogenic
Study of the unimolecular decompositions of the (C3H6)+2 and (c-C3H6)+2 complexes
International Nuclear Information System (INIS)
Tzeng, W.; Ono, Y.; Linn, S.H.; Ng, C.Y.
1985-01-01
The major product channels identified in the unimolecular decompositions ofC 3 H + 6 xC 3 H 6 and c-C 3 H + 6 xc-C 3 H 6 in the total energy [neutral (C 3 H 6 ) 2 or (c-C 3 H 6 ) 2 heat of formation plus excitation energy] range of approx.230--450 kcal/mol are C 3 H + 7 +C 3 H 5 , C 4 H + 7 +C 2 H 5 , C 4 H + 8 +C 2 H 4 , and C 5 H + 9 +CH 3 . The measured appearance energy for C 4 H + 7 (9.54 +- 0.04 eV) from (C 3 H 6 ) 2 is equal to the thermochemical threshold for the formation of C 4 H + 7 +C 2 H 5 from (C 3 H 6 ) 2 , indicating that the exit potential energy barrier for the ion--molecule reaction C 3 H + 6 +C 3 H 6 →C 4 H + 7 +C 2 H 5 is negligible. There is evidence that the formations of C 4 H + 7 +C 2 H 4 +H from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 also proceed with high probabilities when they are energetically allowed. The variations of the relative abundances for C 4 H + 7 ,C 4 H + 8 , and C 5 H + 9 from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 as a function of ionizing photon energy are in qualitative agreement, suggesting that (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 rearrange to similar C 6 H + 12 isomers prior to fragmentation. The fact that C 6 H + 11 is found to be a primary ion from the unimolecular decomposition of (c-C 3 H 6 ) + 2 but not (C 3 H 6 ) + 2 supports the conclusion that the distribution of C 6 H + 12 collision complexes involved in the C 3 H + 6 +C 3 H 6 reactions is different from that in the cyclopropane ion--molecule reactions
Correlation of MMP-9, GA, HbA1c, and adipokines levels with DR
Directory of Open Access Journals (Sweden)
Cheng Qian
2017-12-01
Full Text Available AIM: To investigate the correlation of matrix metalloproteinase -9(MMP-9, glycated albumin(GA, glycosylated hemoglobin(HbA1cand adipokines(including visfatin, resistin and leptinwith diabetic retinopathy(DR. METHODS: From March 2015 to March 2017, 74 patients with DR were treated in our hospital, including 40 patients(80 eyeswith non proliferative diabetic retinopathy(NPDRand 34 patients(68 eyeswith proliferative diabetic retinopathy(PDR, and diabetes mellitus 40 patients(80 eyeswith non DR(NDRand 40 healthy volunteers(80 eyeswere selected as controls, the levels of MMP-9, GA, HbA1c, visfatin, resistin and leptin in each group were detected. RESULTS: PDR group visfatin was 4.41±0.82ng/mL, was significantly lower than the NPDR group, NDR group and control group(PPPPrs=0.523, 0.461 and 0.414, Prs=-0.433, Prs=0.401 and 0.460, PCONCLUSION: MMP-9, GA, HbA1c, and adipokines may play a role in the development and progression of DR, in which MMP-9 is associated with adipokines, both are not significantly related to the levels of GA and HbA1c.
Efficient generation of Rosa26 knock-in mice using CRISPR/Cas9 in C57BL/6 zygotes.
Chu, Van Trung; Weber, Timm; Graf, Robin; Sommermann, Thomas; Petsch, Kerstin; Sack, Ulrike; Volchkov, Pavel; Rajewsky, Klaus; Kühn, Ralf
2016-01-16
The CRISPR/Cas9 system is increasingly used for gene inactivation in mouse zygotes, but homology-directed mutagenesis and use of inbred embryos are less established. In particular, Rosa26 knock-in alleles for the insertion of transgenes in a genomic 'safe harbor' site, have not been produced. Here we applied CRISPR/Cas9 for the knock-in of 8-11 kb inserts into Rosa26 of C57BL/6 zygotes. We found that 10-20 % of live pups derived from microinjected zygotes were founder mutants, without apparent off-target effects, and up to 50 % knock-in embryos were recovered upon coinjection of Cas9 mRNA and protein. Using this approach, we established a new mouse line for the Cre/loxP-dependent expression of Cas9. Altogether, our protocols and resources support the fast and direct generation of new Rosa26 knock-in alleles and of Cas9-mediated in vivo gene editing in the widely used C57BL/6 inbred strain.
Lifescience Database Archive (English)
Full Text Available sativa cDNA clone QGJ1L02, mRNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library... of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre
Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Su{á}rez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; D{é}l{é}age, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; F{ä}rber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; Garc{í}a Pardi{ñ}as, Juli{á}n; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gian{ì}, Sebastiana; Gibson, Valerie; Girard, Olivier G{ö}ran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa G{á}ndara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Gr{ü}nberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; G{ö}bel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adl{è}ne; Hill, Donal; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefran{ç}ois, Jacques; Lef{è}vre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean Fran{ç}ois; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, J{ö}rg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, Andr{é}; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mord{à}, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; M{ü}ller, Dominik; M{ü}ller, Janine; M{ü}ller, Katharina; M{ü}ller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, C{é}dric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stenzel Martins, Julian; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh T{â}m; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; V{á}zquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Winn, Michael Andreas; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano
2016-11-30
A study of $B_c^+\\to K^+K^-\\pi^+$ decays is performed for the first time using data corresponding to an integrated luminosity of 3.0 $\\mathrm{fb}^{-1}$ collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of $7$ and $8$ TeV. Evidence for the decay $B_c^+\\to\\chi_{c0}(\\to K^+K^-)\\pi^+$ is reported with a significance of 4.0 standard deviations, resulting in the measurement of $\\frac{\\sigma(B_c^+)}{\\sigma(B^+)}\\times\\mathcal{B}(B_c^+\\to\\chi_{c0}\\pi^+)$ to be $(9.8^{+3.4}_{-3.0}(\\mathrm{stat})\\pm 0.8(\\mathrm{syst}))\\times 10^{-6}$. Here $\\mathcal{B}$ denotes a branching fraction while $\\sigma(B_c^+)$ and $\\sigma(B^+)$ are the production cross-sections for $B_c^+$ and $B^+$ mesons. An indication of $\\overline b c$ weak annihilation is found for the region $m(K^-\\pi^+)<1.834\\mathrm{\\,Ge\\kern -0.1em V\\!/}c^2$, with a significance of 2.4 standard deviations.
Energy Technology Data Exchange (ETDEWEB)
Plisson, Christophe, E-mail: Christophe.2.plisson@gsk.com [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Salinas, Cristian [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Weinzimmer, David; Labaree, David; Lin, Shu-Fei; Ding, Yu-Shin [Yale University PET Center, Yale University School of Medicine, PO Box 208048 New Haven, CT (United States); Jakobsen, Steen [Aarhus PET Centre, Aarhus Sygehus, Norrebrogade 44, DK-8000 Aarhus C (Denmark); Smith, Paul W. [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Eiji, Kawanishi [Medicinal Chemistry Research Laboratories II, Research Division, Mitsubishi Tanabe Pharma Corporation, Saitama 335-8505 (Japan); Carson, Richard E. [Yale University PET Center, Yale University School of Medicine, PO Box 208048 New Haven, CT (United States); Gunn, Roger N.; Rabiner, Eugenii A. [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom)
2011-08-15
Introduction: The aim of this study was to evaluate a newly reported positron emission tomography (PET) radioligand [{sup 11}C]MP-10, a potent and selective inhibitor of the central phosphodiesterase 10A enzyme (PDE10A) in vivo, using PET. Methods: A procedure was developed for labeling MP-10 with carbon-11. [{sup 11}C]MP-10 was evaluated in vivo both in the pig and baboon brain. Results: Alkylation of the corresponding desmethyl compound with [{sup 11}C]methyl iodide produced [{sup 11}C]MP-10 with good radiochemical yield and specific activity. PET studies in the pig showed that [{sup 11}C]MP-10 rapidly entered the brain reaching peak tissue concentration at 1-2 min postadministration, followed by washout from the tissue. Administration of a selective PDE10A inhibitor reduced the binding in all brain regions to the levels of the cerebellum, demonstrating the saturability and selectivity of [{sup 11}C]MP-10 binding. In the nonhuman primate, the brain tissue kinetics of [{sup 11}C]MP-10 were slower, reaching peak tissue concentrations at 30-60 min postadministration. In both species, the observed rank order of regional brain signal was striatum>diencephalon>cortical regions=cerebellum, consistent with the known distribution and concentration of PDE10A. [{sup 11}C]MP-10 brain kinetics were well described by a two-tissue compartment model, and estimates of total volume of distribution (V{sub T}) were obtained. Blocking studies with unlabeled MP-10 revealed the suitability of the cerebellum as a reference tissue and enabled the estimation of regional binding potential (BP{sub ND}) as the outcome measure of specific binding. Quantification of [{sup 11}C]MP-10 binding using the simplified reference tissue model with cerebellar input function produced BP{sub ND} estimates consistent with those obtained by the two-tissue compartment model. Conclusion: We demonstrated that [{sup 11}C]MP-10 possesses good characteristics for the in vivo quantification of the PDE10A in the
EquiFACS: The Equine Facial Action Coding System.
Directory of Open Access Journals (Sweden)
Jen Wathan
Full Text Available Although previous studies of horses have investigated their facial expressions in specific contexts, e.g. pain, until now there has been no methodology available that documents all the possible facial movements of the horse and provides a way to record all potential facial configurations. This is essential for an objective description of horse facial expressions across a range of contexts that reflect different emotional states. Facial Action Coding Systems (FACS provide a systematic methodology of identifying and coding facial expressions on the basis of underlying facial musculature and muscle movement. FACS are anatomically based and document all possible facial movements rather than a configuration of movements associated with a particular situation. Consequently, FACS can be applied as a tool for a wide range of research questions. We developed FACS for the domestic horse (Equus caballus through anatomical investigation of the underlying musculature and subsequent analysis of naturally occurring behaviour captured on high quality video. Discrete facial movements were identified and described in terms of the underlying muscle contractions, in correspondence with previous FACS systems. The reliability of others to be able to learn this system (EquiFACS and consistently code behavioural sequences was high--and this included people with no previous experience of horses. A wide range of facial movements were identified, including many that are also seen in primates and other domestic animals (dogs and cats. EquiFACS provides a method that can now be used to document the facial movements associated with different social contexts and thus to address questions relevant to understanding social cognition and comparative psychology, as well as informing current veterinary and animal welfare practices.
The KMTNet/K2-C9 (Kepler) Data Release
Kim, H.-W.; Hwang, K.-H.; Kim, D.-J.; Albrow, M. D.; Cha, S.-M.; Chung, S.-J.; Gould, A.; Han, C.; Jung, Y. K.; Kim, S.-L.; Lee, C.-U.; Lee, D.-J.; Lee, Y.; Park, B.-G.; Pogge, R. W.; Ryu, Y.-H.; Shin, I.-G.; Shvartzvald, Y.; Yee, J. C.; Zang, W.; Zhu, W.; KMTNet Collaboration
2018-05-01
We present Korea Microlensing Telescope Network (KMTNet) light curves for microlensing-event candidates in the Kepler K2 C9 field having peaks within three effective timescales of the Kepler observations. These include 181 “clear microlensing” and 84 “possible microlensing” events found by the KMTNet event finder, plus 56 other events found by OGLE and/or MOA that were not found by KMTNet. All data for the first two classes are immediately available for public use without restriction.
Zondervan, A.; Hauser, T. M.; Kaiser, J.; Kitchen, R. L.; Turnbull, J. C.; West, J. G.
2015-10-01
A detailed description is given of the 0.5 MV tandem accelerator mass spectrometry (AMS) system for 10Be, 14C, 26Al, installed in early 2010 at GNS Science, New Zealand. Its design follows that of previously commissioned Compact 14C-only AMS (CAMS) systems based on the Pelletron tandem accelerator. The only basic departure from that design is an extension of the rare-isotope achromat with a 45° magnet and a two-anode gas-ionisation detector, to provide additional filtering for 10Be. Realised performance of the three AMS modes is discussed in terms of acceptance-test scores, 14C Poisson and non-Poisson errors, and 10Be detection limit and sensitivity. Operational details and hardware improvements, such as 10Be beam transport and particle detector setup, are highlighted. Statistics of repeat measurements of all graphitised 14C calibration cathodes since start-up show that 91% of their total uncertainty values are less than 0.3%, indicating that the rare-isotope beamline extension has not affected precision of 14C measurement. For 10Be, the limit of detection in terms of the isotopic abundance ratio 10Be/9Be is 6 × 10-15 at at-1 and the total efficiency of counting atoms in the sample cathode is 1/8500 (0.012%).
Lifescience Database Archive (English)
Full Text Available complete sequence. 38 0.17 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS0... Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.2 1 CX072512 |CX0
Energy Technology Data Exchange (ETDEWEB)
Azhgirej, L S; Chernykh, E V [Laboratory of High Energies, Joint Institute for Nuclear Research, Dubna (Russian Federation); Kobushkin, A P [Institute of Theoretical Physics, Ukrainian Academy of Sciences, Kiev (Ukraine); and others
1998-12-01
Tensor analysing power T{sub 20} for inelastic (d, d`) X reaction at deuteron momentum from 4.2 to 9 GeV/c is presented. It is observed that T{sub 20} taken as a function of the four-momentum transfer squared t demonstrates an approximate scaling; its absolute value is small at |t| <{approx_equal} (0.05 - 0.1) GeV{sup 2}/c{sup 2} and has a maximum at -t {approx_equal}0.3 GeV{sup 2}/c{sup 2}. No significant dependence on the type of the target was observed 10 refs., 4 figs., 4 tabs.
Rosdi, Rasmaizatul Akma; Mohd Yusoff, Narazah; Ismail, Rusli; Soo Choon, Tan; Saleem, Mohamed; Musa, Nurfadhlina; Yusoff, Surini
2016-09-01
CYP2C9 gene polymorphisms modulate inter-individual variations in the human body's responses to various endogenous and exogenous drug substrates. To date, little is known about the CYP2C9 gene polymorphisms among the aboriginal populations of the world, including those in Malaysia. To characterise and compare the CYP2C9 polymorphisms (CYP2C9*2, CYP2C9*3, CYP2C9*4 and CYP2C9*5) between one of Malaysia's aboriginal populations, Jahai, with the national major ethnic, Malay. To also compare the allele frequencies from these two populations with available data of other aboriginal populations around the world. The extracted DNA of 155 Jahais and 183 Malays was genotyped for CYP2C9 polymorphisms using a nested multiplex allele-specific polymerase chain reaction technique. The results were confirmed by DNA direct sequencing. Genotyping results revealed that CYP2C9*2, CYP2C9*4 and CYP2C9*5 were absent in Jahais, while only the latter two were absent in Malays. The CYP2C9*3 allelic frequency in Jahais was 36.2%, making them the most frequent carriers of the allele thus far reported in any ethnic group from Southeast Asia. The high frequency of CYP2C9*3 and the absence of CYP2C9*2 in Jahais suggest that genetic drift may be occurring in this ethnic group. This is the first study to determine the CYP2C9 polymorphisms in an aboriginal population in Malaysia.
Dicty_cDB: Contig-U08861-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C
Dicty_cDB: Contig-U09615-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1
Characterization of 2D-C/C composite for application of very high temperature reactor
International Nuclear Information System (INIS)
Shibata, Taiju; Sumita, Junya; Kunimoto, Eiji; Sawa, Kazuhiro; Makita, Taiyo; Takagi, Takashi; Kim, W.J.; Jung, C.H.; Park, J.Y.
2010-01-01
For in-core components of VHTR (Very High Temperature Reactor), carbon fiber reinforced carbon matrix composite (C/C composite) is one of the major candidate materials. In this study, fracture behaviors of two dimensional (2D-) C/C composites were examined by SENB specimens with four-point bending test. The surface of specimens was observed by a CCD camera during the bending test, and observed by a stereomicroscope before and after the bending test. The following results were obtained through mode-I fracture test. (1) Three types of the composites were evaluated by tentatively using the stress intensity factor equation for metallic materials. The equivalent stress intensity factor of 2D-C/C composite is in the range of 5.9 - 10.0MPa m 1/2 . It was expected that the fracture mechanism for the composite materials could be assessed by this test method. (2) The crack opening displacement-load behavior of C/C composite might depend not only on the propagation of crack but also on delaminating between layers. (author)
A FPGA Implementation of the CAR-FAC Cochlear Model
Directory of Open Access Journals (Sweden)
Ying Xu
2018-04-01
Full Text Available This paper presents a digital implementation of the Cascade of Asymmetric Resonators with Fast-Acting Compression (CAR-FAC cochlear model. The CAR part simulates the basilar membrane's (BM response to sound. The FAC part models the outer hair cell (OHC, the inner hair cell (IHC, and the medial olivocochlear efferent system functions. The FAC feeds back to the CAR by moving the poles and zeros of the CAR resonators automatically. We have implemented a 70-section, 44.1 kHz sampling rate CAR-FAC system on an Altera Cyclone V Field Programmable Gate Array (FPGA with 18% ALM utilization by using time-multiplexing and pipeline parallelizing techniques and present measurement results here. The fully digital reconfigurable CAR-FAC system is stable, scalable, easy to use, and provides an excellent input stage to more complex machine hearing tasks such as sound localization, sound segregation, speech recognition, and so on.
A FPGA Implementation of the CAR-FAC Cochlear Model.
Xu, Ying; Thakur, Chetan S; Singh, Ram K; Hamilton, Tara Julia; Wang, Runchun M; van Schaik, André
2018-01-01
This paper presents a digital implementation of the Cascade of Asymmetric Resonators with Fast-Acting Compression (CAR-FAC) cochlear model. The CAR part simulates the basilar membrane's (BM) response to sound. The FAC part models the outer hair cell (OHC), the inner hair cell (IHC), and the medial olivocochlear efferent system functions. The FAC feeds back to the CAR by moving the poles and zeros of the CAR resonators automatically. We have implemented a 70-section, 44.1 kHz sampling rate CAR-FAC system on an Altera Cyclone V Field Programmable Gate Array (FPGA) with 18% ALM utilization by using time-multiplexing and pipeline parallelizing techniques and present measurement results here. The fully digital reconfigurable CAR-FAC system is stable, scalable, easy to use, and provides an excellent input stage to more complex machine hearing tasks such as sound localization, sound segregation, speech recognition, and so on.
International Nuclear Information System (INIS)
Fujiwara, K.; Domae, M.; Yoneda, K.; Inada, F.
2010-01-01
Flow Accelerated Corrosion (FAC) of carbon steel is one of the most important subjects in coolant systems of power plants. FAC is influenced by material, flow condition, temperature, and water chemistry. Iron and chromium solubility should be the most effective factor to determine the effect of water chemistry on the FAC. It is very important to evaluate the correlation between the solubility and the FAC rate of the carbon steel. In the present study, the effects of pH and Cr concentration of material on the FAC rate of carbon steel were evaluated by using high temperature loop equipment with on-line corrosion-monitoring system. Effect of dissolved oxygen concentration at pH 7 was also evaluated. The experimental FAC rates were compared with the calculation result, which was obtained from a FAC model developed previously by the authors' group. The tube specimens made of STPT 480 carbon steel were used for the FAC tests. The Cr concentration of STPT 480 was specially adjusted to 0.001 and 0.08 %. The inner diameters of the tubes were 1.6, 2.4, and 3.2 mm. The solutions were fed to the specimens with the flow rate of 1.5 l/min. The temperature of the solution at the specimen was controlled at 140 o C. Test solutions were demineralized water or NH 3 solutions of pH 8.0, 9.2, and 10.0. The increase in pH more than 9 decreased the FAC rates of both 0.001 and 0.08 % Cr specimens at 140 o C. Increase of the Cr concentration of the material decreased the FAC rate in the solution of pH 7.0, 8.0, 9.2, and 10.0. The FAC model reproduced well dependence of the experimental FAC behavior on water chemistry. It was confirmed that effect of pH and Cr concentration of material on the FAC rate were closely related to the solubility and diffusion of iron and chromium. (author)
Céspedes-Garro, Carolina; Rodrigues-Soares, Fernanda; Jiménez-Arce, Gerardo; Naranjo, María-Eugenia G; Tarazona-Santos, Eduardo; Fariñas, Humberto; Barrantes, Ramiro; Llerena, Adrián
2016-09-01
CYP2C9, CYP2C19 and CYP2D6 metabolize around 40% of drugs and their genes vary across populations. The Costa Rican population has a trihybrid ancestry and its key geographic location turns it into a suitable scenario to evaluate interethnic differences across populations. This study aims to describe the diversity of CYP2C9, CYP2C19 and CYP2D6 polymorphisms in Costa Rican populations in the context of their ancestry. A total of 448 healthy individuals were included in the study: Bribri (n= 47), Cabécar (n= 27), Maleku (n= 16), Guaymí (n= 30), Huetar (n= 48), Chorotega (n= 41), Admixed/Mestizos from the Central Valley/Guanacaste (n= 189), and Afro-Caribbeans (n= 50) from Limón. CYP2C9 (alleles *2, *3, *6) and CYP2C19 (*2, *3, *4, *5, *17) genotypes were determined by Real-Time PCR. African, European and Native American ancestry were inferred using 87 ancestry informative markers. The frequency of the decreased activity allele CYP2C9*2 is lower in the self-reported Amerindian groups compared to the admixed population, and the highest frequencies of CYP2C19*2 (null activity) and the CYP2C19*17 (increased activity) were found in the self-reported Afro-Caribbean population. Moreover, a frequency of 0.7 % CYP2C9 gPMs in the Admixed population and a variable frequency of CYP2C19 gUMs (0.0-32.6 %, more prevalent in Afro-Caribbeans) in Costa Rican populations, was found. Finally, the following alleles were positively correlated with genomic African ancestry and negatively correlated with genomic Native American ancestry: CYP2D6*5 (null activity), CYP2D6*17 (decreased activity), CYP2D6*29 (decreased activity) and CYP2C19*17 (increased activity). No correlation for CYP2C9 polymorphisms and genomic ancestry was found. Further studies assessing the CYP2C9 and CYP2C19 sequence in these populations, preferentially by sequencing these genes, are warranted.
13C/12C ratios in human urine concrementes
International Nuclear Information System (INIS)
Hoefs, J.; Armbruster, T.
1978-01-01
Oxalate, uric acid, and phosphate stones have been analyzed for their carbon isotope composition. The oxalate stones show delta 13 C values between -17.0 and -19.5 pro mille, the uric acid stones between -14.9 and -19.4 pro mille, and the phosphate stones between -13.0 and -23.9 pro mille. It is proposed that endogenic rather than exogenic sources are responsible for the 13 C/ 12 C ratios of the stones. The isotopic composition of the phosphate stones seems to be influenced primarily by bacterial activity. (orig.) [de
Hepatitis C virus recurrence after liver transplantation: a 10-year evaluation.
Gitto, Stefano; Belli, Luca Saverio; Vukotic, Ranka; Lorenzini, Stefania; Airoldi, Aldo; Cicero, Arrigo Francesco Giuseppe; Vangeli, Marcello; Brodosi, Lucia; Panno, Arianna Martello; Di Donato, Roberto; Cescon, Matteo; Grazi, Gian Luca; De Carlis, Luciano; Pinna, Antonio Daniele; Bernardi, Mauro; Andreone, Pietro
2015-04-07
To evaluate the predictors of 10-year survival of patients with hepatitis C recurrence. Data from 358 patients transplanted between 1989 and 2010 in two Italian transplant centers and with evidence of hepatitis C recurrence were analyzed. A χ(2), Fisher's exact test and Kruskal Wallis' test were used for categorical and continuous variables, respectively. Survival analysis was performed at 10 years after transplant using the Kaplan-Meier method, and a log-rank test was used to compare groups. A P level less than 0.05 was considered significant for all tests. Multivariate analysis of the predictive role of different variables on 10-year survival was performed by a stepwise Cox logistic regression. The ten-year survival of the entire population was 61.2%. Five groups of patients were identified according to the virological response or lack of a response to antiviral treatment and, among those who were not treated, according to the clinical status (mild hepatitis C recurrence, "too sick to be treated" and patients with comorbidities contraindicating the treatment). While the 10-year survival of treated and untreated patients was not different (59.1% vs 64.7%, P = 0.192), patients with a sustained virological response had a higher 10-year survival rate than both the "non-responders" (84.7% vs 39.8%, P < 0.0001) and too sick to be treated (84.7% vs 0%, P < 0.0001). Sustained virological responders had a survival rate comparable to patients untreated with mild recurrence (84.7% vs 89.3%). A sustained virological response and young donor age were independent predictors of 10-year survival. Sustained virological response significantly increased long-term survival. Awaiting the interferon-free regimen global availability, antiviral treatment might be questionable in selected subjects with mild hepatitis C recurrence.
Progress in AMS measurement of "1"2"9I and "1"4C at CIAE
International Nuclear Information System (INIS)
Yang Xuran; Dong, K.J.; Shan, J.; He Ming; Xie, L.B.
2013-01-01
Twenty-four years have passed since the AMS was built at China Institute of Atomic Energy (CIAE) in 1989. We have measured "2"3"6U, "1"8"2Hf, "5"9Ni and other elements. Recently, the routine method of measuring the "1"2"9I concentration in air particle samples using AMS have been set up due to it has great advantages to measure long-lived radioisotopes. For the applications, "1"2"9I could be used for monitoring nuclear environment. "1"2"9I was collected in air particle samples after the accident of Fukushima nuclear power plant and measured at the China Institute of Atomic Energy (CIAE) by using AMS, the result show that "1"2"9I derived from FNPP accident had been arrived in Beijing early on March 26th and "1"2"9I concentration had been greatly increased relative to March 20th. On the other hand, a new system to measure "1"4C of AMS will be designed for the application in bio-medical science: urea breath test (UBT). UBT has been carried out widely by using carbon isotope of "1"3C and "1"4C, respectively, in the world. They are two tracers with different measurement methods but applied by the same principle. Optimizing UBT methods with using "1"4C is the priori for the diagnosis of helicobacter pylori in the future. (author)
Dicty_cDB: Contig-U06086-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 34 1.9 2 ( CT531391 ) A BAC library has been constructed from cultivar ... 34 1.9 3 ( CT536760 ) A BAC lib...u... 36 2.9 2 ( CT504385 ) A BAC library has been constructed from cultivar ... 38 3.0 2 ( BX005275 ) ...1 ( DH327531 ) Oryzias latipes Fosmid clone:GOLWFno690_k15, forw... 46 3.2 1 ( CT562554 ) A BAC library has been constructed from cul...9 ) 16372 Swollen Stolon Solanum tuberosum cDNA, mRNA... 48 0.81 1 ( CK277118 ) EST723196 potato abiotic stress cDNA library... Sola... 48 0.81 1 ( CK277117 ) EST723195 potato abiotic stress cDNA library Sola... 48 0.81
Basic Data Report for Drillhole SNL-9 (C-2950)
International Nuclear Information System (INIS)
Powers, Dennis W.
2005-01-01
SNL-9 (permitted by the State Engineer as C-2950) was drilled to provide geological data and hydrological testing of the Culebra Dolomite Member of the Permian Rustler Formation within a proposed re-entrant of the margin of halite dissolved from the upper part of the Salado near Livingston Ridge. SNL-9 is located in the southeast quarter of section 23, T22S, R30E, in eastern Eddy County, New Mexico. SNL-9 was drilled to a total depth of 845 ft below the ground surface. Below surface dune sand and the Berino soil, SNL-9 encountered, in order, the Mescalero caliche, Gatuna, Dewey Lake, Rustler, and uppermost Salado Formations. Two intervals were cored: (1) from the lower Forty-niner Member through the Magenta Dolomite and into the upper Tamarisk Member; and (2) from the lower Tamarisk Member through the Culebra Dolomite and Los Medanos Members and into the uppermost Salado Formation. Geophysical logs were acquired from the open hole to total depth, and the drillhole was successfully completed with a screened interval open across the Culebra.
Basic Data Report for Drillhole SNL-9 (C-2950)
Energy Technology Data Exchange (ETDEWEB)
Dennis W. Powers; Washington Regulatory and Environmental Services
2005-01-19
SNL-9 (permitted by the State Engineer as C-2950) was drilled to provide geological data and hydrological testing of the Culebra Dolomite Member of the Permian Rustler Formation within a proposed re-entrant of the margin of halite dissolved from the upper part of the Salado near Livingston Ridge. SNL-9 is located in the southeast quarter of section 23, T22S, R30E, in eastern Eddy County, New Mexico. SNL-9 was drilled to a total depth of 845 ft below the ground surface. Below surface dune sand and the Berino soil, SNL-9 encountered, in order, the Mescalero caliche, Gatuna, Dewey Lake, Rustler, and uppermost Salado Formations. Two intervals were cored: 1) from the lower Forty-niner Member through the Magenta Dolomite and into the upper Tamarisk Member; and 2) from the lower Tamarisk Member through the Culebra Dolomite and Los Meda?os Members and into the uppermost Salado Formation. Geophysical logs were acquired from the open hole to total depth, and the drillhole was successfully completed with a screened interval open across the Culebra.
Impaired ALDH2 activity decreases the mitochondrial respiration in H9C2 cardiomyocytes.
Mali, Vishal R; Deshpande, Mandar; Pan, Guodong; Thandavarayan, Rajarajan A; Palaniyandi, Suresh S
2016-02-01
Reactive oxygen species (ROS)-mediated reactive aldehydes induce cellular stress. In cardiovascular diseases such as ischemia-reperfusion injury, lipid-peroxidation derived reactive aldehydes such as 4-hydroxy-2-nonenal (4HNE) are known to contribute to the pathogenesis. 4HNE is involved in ROS formation, abnormal calcium handling and more importantly defective mitochondrial respiration. Aldehyde dehydrogenase (ALDH) superfamily contains NAD(P)(+)-dependent isozymes which can detoxify endogenous and exogenous aldehydes into non-toxic carboxylic acids. Therefore we hypothesize that 4HNE afflicts mitochondrial respiration and leads to cell death by impairing ALDH2 activity in cultured H9C2 cardiomyocyte cell lines. H9C2 cardiomyocytes were treated with 25, 50 and 75 μM 4HNE and its vehicle, ethanol as well as 25, 50 and 75 μM disulfiram (DSF), an inhibitor of ALDH2 and its vehicle (DMSO) for 4 h. 4HNE significantly decreased ALDH2 activity, ALDH2 protein levels, mitochondrial respiration and mitochondrial respiratory reserve capacity, and increased 4HNE adduct formation and cell death in cultured H9C2 cardiomyocytes. ALDH2 inhibition by DSF and ALDH2 siRNA attenuated ALDH2 activity besides reducing ALDH2 levels, mitochondrial respiration and mitochondrial respiratory reserve capacity and increased cell death. Our results indicate that ALDH2 impairment can lead to poor mitochondrial respiration and increased cell death in cultured H9C2 cardiomyocytes. Copyright © 2015 Elsevier Inc. All rights reserved.
C-C Coupling on Single-Atom-Based Heterogeneous Catalyst.
Zhang, Xiaoyan; Sun, Zaicheng; Wang, Bin; Tang, Yu; Nguyen, Luan; Li, Yuting; Tao, Franklin Feng
2018-01-24
Compared to homogeneous catalysis, heterogeneous catalysis allows for ready separation of products from the catalyst and thus reuse of the catalyst. C-C coupling is typically performed on a molecular catalyst which is mixed with reactants in liquid phase during catalysis. This homogeneous mixing at a molecular level in the same phase makes separation of the molecular catalyst extremely challenging and costly. Here we demonstrated that a TiO 2 -based nanoparticle catalyst anchoring singly dispersed Pd atoms (Pd 1 /TiO 2 ) is selective and highly active for more than 10 Sonogashira C-C coupling reactions (R≡CH + R'X → R≡R'; X = Br, I; R' = aryl or vinyl). The coupling between iodobenzene and phenylacetylene on Pd 1 /TiO 2 exhibits a turnover rate of 51.0 diphenylacetylene molecules per anchored Pd atom per minute at 60 °C, with a low apparent activation barrier of 28.9 kJ/mol and no cost of catalyst separation. DFT calculations suggest that the single Pd atom bonded to surface lattice oxygen atoms of TiO 2 acts as a site to dissociatively chemisorb iodobenzene to generate an intermediate phenyl, which then couples with phenylacetylenyl bound to a surface oxygen atom. This coupling of phenyl adsorbed on Pd 1 and phenylacetylenyl bound to O ad of TiO 2 forms the product molecule, diphenylacetylene.
Dicty_cDB: Contig-U05633-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) PUHQF14TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 46 1.9 1 ( EC770709 ) EST 7205 Guarana fruits cDNA library Paullinia cu...o... 44 7.7 1 ( BM027318 ) GIT0000656 Root-induced cDNA library from Glomus ... 44 7.7 1 ( BJ427410 ) Dic...ble cien cDNA librar... 50 0.12 1 ( EW965375 ) BRHL_03_O01_T7 Headlice composite library... DN564657 ) 90838967 Sea Urchin primary mesenchyme cell cDNA ... 46 1.9 1 ( CN845958 ) PG07006A08 Ginseng cDNA library from MeJA tre... BF648097 ) NF044C02EC1F1017 Elicited cell culture Medicago t... 44 7.7 1 ( BF646377 ) NF071B12EC1F1096 Elicited cell culture Medic
International Nuclear Information System (INIS)
Vikas, Shailendra; Wood-Vasey, W. Michael; Lundgren, Britt; Ross, Nicholas P.; Myers, Adam D.; AlSayyad, Yusra; York, Donald G.; Schneider, Donald P.; Brinkmann, J.; Bizyaev, Dmitry; Brewington, Howard; Malanushenko, Elena; Malanushenko, Viktor; Oravetz, Daniel; Pan, Kaike; Snedden, Stephanie; Ge, Jian; Muna, Demitri; Pâris, Isabelle; Petitjean, Patrick
2013-01-01
We measure the two-point cross-correlation function of C IV absorber systems and quasars, using spectroscopic data from the Sloan Digital Sky Survey III Baryon Oscillation Spectroscopic Survey (BOSS; Data Release 9). The 19,701 quasars and 6149 C IV ''moderate'' absorbers, 0.28 Å 2 and represent a factor of two increase in sample size over previous investigations. We find a correlation scale length and slope of the redshift-space cross-correlation function of s 0 = 8.46 ± 1.24 Mpc, γ = 1.68 ± 0.19, in the redshift-space range 10 0 = 7.76 ± 2.80 Mpc, γ = 1.74 ± 0.21. We measure the combined quasar and C IV bias to be b QSO b C I V = 8.81 ± 2.28. Using an estimate of b QSO from the quasar auto-correlation function we find b CIV = 2.38 ± 0.62. This b CIV implies that EW > 0.28 Å C IV absorbers at z ∼ 2.3 are typically found in dark matter halos that have masses ≥10 11.3 -10 13.4 M ☉ at that redshift. The complete BOSS sample will triple the number of both quasars and absorption systems and increase the power of this cross-correlation measurement by a factor of two.
Inhibitory effects of C2 to C10 1-alkynes on ammonia oxidation in two Nitrososphaera species.
Taylor, A E; Taylor, K; Tennigkeit, B; Palatinszky, M; Stieglmeier, M; Myrold, D D; Schleper, C; Wagner, M; Bottomley, P J
2015-03-01
A previous study showed that ammonia oxidation by the Thaumarchaeota Nitrosopumilus maritimus (group 1.1a) was resistant to concentrations of the C8 1-alkyne, octyne, which completely inhibits activity by ammonia-oxidizing bacteria. In this study, the inhibitory effects of octyne and other C2 to C10 1-alkynes were evaluated on the nitrite production activity of two pure culture isolates from Thaumarchaeota group 1.1b, Nitrososphaera viennensis strain EN76 and Nitrososphaera gargensis. Both N. viennensis and N. gargensis were insensitive to concentrations of octyne that cause complete and irreversible inactivation of nitrite production by ammonia-oxidizing bacteria. However, octyne concentrations (≥20 μM) that did not inhibit N. maritimus partially inhibited nitrite production in N. viennensis and N. gargensis in a manner that did not show the characteristics of irreversible inactivation. In contrast to previous studies with an ammonia-oxidizing bacterium, Nitrosomonas europaea, octyne inhibition of N. viennensis was: (i) fully and immediately reversible, (ii) not competitive with NH4 (+), and (iii) without effect on the competitive interaction between NH4 (+) and acetylene. Both N. viennensis and N. gargensis demonstrated the same overall trend in regard to 1-alkyne inhibition as previously observed for N. maritimus, being highly sensitive to ≤C5 alkynes and more resistant to longer-chain length alkynes. Reproducible differences were observed among N. maritimus, N. viennensis, and N. gargensis in regard to the extent of their resistance/sensitivity to C6 and C7 1-alkynes, which may indicate differences in the ammonia monooxygenase binding and catalytic site(s) among the Thaumarchaeota. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+
Energy Technology Data Exchange (ETDEWEB)
Aubert, : B.
2008-08-13
The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.
Zhou, Yanli; Yan, Dong; Xu, Huayun; Liu, Shuo; Yang, Jian; Qian, Yitai
2015-02-01
A one-dimensional MWCNT@a-C@Co9S8 nanocomposite has been prepared via a facile solvothermal reaction followed by a calcination process. The amorphous carbon layer between Co9S8 and MWCNT acts as a linker to increase the loading of sulfides on MWCNT. When evaluated as anode materials for lithium ion batteries, the MWCNT@a-C@Co9S8 nanocomposite shows the advantages of high capacity and long life, superior to Co9S8 nanoparticles and MWCNT@Co9S8 nanocomposites. The reversible capacity could be retained at 662 mA h g-1 after 120 cycles at 1 A g-1. The efficient synthesis and excellent performances of this nanocomposite offer numerous opportunities for other sulfides as a new anode for lithium ion batteries.A one-dimensional MWCNT@a-C@Co9S8 nanocomposite has been prepared via a facile solvothermal reaction followed by a calcination process. The amorphous carbon layer between Co9S8 and MWCNT acts as a linker to increase the loading of sulfides on MWCNT. When evaluated as anode materials for lithium ion batteries, the MWCNT@a-C@Co9S8 nanocomposite shows the advantages of high capacity and long life, superior to Co9S8 nanoparticles and MWCNT@Co9S8 nanocomposites. The reversible capacity could be retained at 662 mA h g-1 after 120 cycles at 1 A g-1. The efficient synthesis and excellent performances of this nanocomposite offer numerous opportunities for other sulfides as a new anode for lithium ion batteries. Electronic supplementary information (ESI) available: Infrared spectrogram (IR) of glucose treated MWCNT; TEM images of MWCNT@a-C treated by different concentrations of glucose; SEM and TEM images of the intermediate product obtained from the solvothermal reaction between thiourea and Co(Ac)2; EDS spectrum of MWCNT@a-C@Co9S8 composites; SEM and TEM images of MWCNT@Co9S8 nanocomposites obtained without the hydrothermal treatment by glucose; SEM and TEM images of Co9S8 nanoparticles; Galvanostatic discharge-charge profiles and cycling performance of MWCNT@a-C; TEM images
Lifescience Database Archive (English)
Full Text Available g significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 5...e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA
Lifescience Database Archive (English)
Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je
File list: InP.Myo.20.AllAg.C2C12 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Myo.20.AllAg.C2C12 mm9 Input control Muscle C2C12 SRX262224,SRX262225,SRX148229...695944 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Myo.20.AllAg.C2C12.bed ...
International Nuclear Information System (INIS)
Gudilenkov, I.D.; Fukin, G.K.; Cherkasov, A.V.; Shavyrin, A.S.; Trifonov, A.A.; Larionova, Yu.E.
2008-01-01
Reaction of ytterbium bisindenyl complex (C 9 H 7 ) 2 Yb II (THF) 2 (1) with 1,4-diazabutadiene 2-MeC 6 H 4 N=C(Me)-C(Me)=NC 6 H 4 Me-2 ( Me DAD) is accompanied by the oxidation of metal atom until trivalent state and results in the formation of paramagnetic compound of metallocenes type (C 9 H 7 ) 2 Yb III ( Me DAD -. ) (3) containing 1,4-diazabutadiene anion-radical. Structure of complex 3 is ascertained by the X-ray structure analysis. Reactions of bisindenyl (1) and bisfluorenyl (C 13 H 9 ) 2 Yb II (THF) 2 (2) derivatives of bivalent ytterbium with 1,4-diazabutadiene PhN=C(Ph)-C(Ph)=NPh ( Ph DAD) (at 1:2 molar ratio of reagents) proceed with the complete break of Yb-C bonds, oxidation of ytterbium atom until trivalent state, and result in the formation of homoligand complex ( Ph DAD -. ) 3 Yb (6) containing three anion-radical 1,4-diazadiene ligands. Complex 6 was also prepared by the exchange reaction of YbCl 3 with Ph DAD -. K + (1:3) in THF. Complex 6 is characterized by the X-ray structure analysis [ru
Dicty_cDB: Contig-U04403-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 6 0.067 10 ( EF583051 ) Human rotavirus A genotype G9P[8] capping protein... 38 0.086 3 ( AY277920 ) Human rotavirus... A strain A64 VP3 gene, complete cds. 38 0.091 3 ( AY277918 ) Human rotavirus A strain L26 VP3 gene,... complete cds. 38 0.091 3 ( AY277917 ) Human rotavirus A strain WI-61 VP3 gene, c
International Nuclear Information System (INIS)
Ito, Hitoshi; Sato, Tomotaro
1973-01-01
The species of microorganisms which can grow on commercial viennas on the storage at 10 deg C were Lactobacillus, Streptococcus and yeasts. When the viennas specially made which did not contain preservatives in it were used for this investigation, growth of microorganisms such as Lactobacillus, Streptococcus, Micrococcus, Bacillus and yeasts were predominant on the storage at 10 deg C, and Pseudomonas and molds some time propagated. When smoked-viennas specially made for the National Project were used for preservation, growth of microorganisms consisted mainly of the species of Lactobacillus, Micrococcus, Acinetobacter, Flavobacterium, Streptococcus, Serratia, Corynebacterium and yeasts. Irradiation of viennas at 300 and 500 krad reduced the aforementioned flora to the Lactobacillus, Streptococcus, Acinetobacter and yeasts. The number of microorganisms on the viennas packed with nitrogen gas was not increased for 3 to 7 days by means of 300 krad irradiation, and extended the storage-life 2 to 3 times. When irradiated with a dose of 500 krad, the number of microorganisms was not increased for 9 to 14 days on the storage at 10 deg C. (author)
Dicty_cDB: Contig-U15762-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 Root cold Pinus taeda cDNA c... 46 6.7 1 ( CO166910 ) FLD1_65_A02.g1_A029 Root flood...ed Pinus taeda cDNA... 46 6.7 1 ( CO161061 ) FLD1_26_H12.b1_A029 Root flooded Pinus taeda cDNA... 46 6.
Single-neutron knockout from 20C and the structure of 19C
Directory of Open Access Journals (Sweden)
J.W. Hwang
2017-06-01
Full Text Available The low-lying unbound level structure of the halo nucleus 19C has been investigated using single-neutron knockout from 20C on a carbon target at 280 MeV/nucleon. The invariant mass spectrum, derived from the momenta of the forward going beam velocity 18C fragment and neutrons, was found to be dominated by a very narrow near threshold (Erel=0.036(1 MeV peak. Two less strongly populated resonance-like features were also observed at Erel=0.84(4 and 2.31(3 MeV, both of which exhibit characteristics consistent with neutron p-shell hole states. Comparisons of the energies, measured cross sections and parallel momentum distributions to the results of shell-model and eikonal reaction calculations lead to spin-parity assignments of 5/21+ and 1/21− for the levels at Ex=0.62(9 and 2.89(10 MeV with Sn=0.58(9 MeV. Spectroscopic factors were also deduced and found to be in reasonable accord with shell-model calculations. The valence neutron configuration of the 20C ground state is thus seen to include, in addition to the known 1s1/22 component, a significant 0d5/22 contribution. The level scheme of 19C, including significantly the 1/21− cross-shell state, is well accounted for by the YSOX shell-model interaction developed from the monopole-based universal interaction.
Institute of Scientific and Technical Information of China (English)
无
2006-01-01
The performance of Al-Ti-C master alloy in refining Al-10Mg and A1-5Cu alloys was studied by using electron probe micro-analyzer (EPMA) and X-ray diffractometer (XRD) analysis.The results indicate that there are obvious fading phenomena in both Al-10Mg and Al-5Cu alloys with the addition of Al-5Ti-0.4C refiner which contains TiC and TiAl3 compounds.Mg element has no influence on the stability of TiC and TiAl3, while TiC particles in Al-10Mg alloy react with Al to form Al4C3 particles, resulting in the refinement fading.However, TiC particles are relatively stable in Al-5Cu alloy, while TiAl3 phase reacts with Al2Cu to produce a new phase Ti(Al, Cu)2, which is responsible for the refinement fading in Al-5Cu alloy.These indicate that the refinement fading will not occur only when both the TiC particles and TiAl3 compound of Al-Ti-C refiner are stable in Al alloys.
International Nuclear Information System (INIS)
Cheredilin, D.N.; Balagurova, E.V.; Godovikov, I.A.; Solodovnikov, S.P.; Chizhevskij, I.T.
2005-01-01
It is established that the substitution of PPh 3 -ligands by diphosphines [Ph 2 P(CH 2 ) n PPh] (n=3, 4) in three-bridging exo-nido-ruthena carborane 5,6,10-[RuCl(PPh 3 ) 2 ]-5,6,10-(μ-H) 3 -10-H-exo-nido-7,8-C 2 B 9 H 8 (1) decreases temperature of exo-nido→closo-regrouping (22 Deg C). It is demonstrated that the exo-nido-ruthena carborane complex (1) is well suited and available as reagent for preparation of closo-ruthena carboranes with different chelate diphosphines. Formation of closo-products follows through the stage of exo-nido→closo-regrouping of diphosphine complexes with exo-nido-structure [ru
χ_{c1} and χ_{c2} Resonance Parameters with the Decays χ_{c1,c2}→J/ψμ^{+}μ^{-}.
Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Alfonso Albero, A; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Atzeni, M; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Beliy, N; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Berninghoff, D; Bertholet, E; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bizzeti, A; Bjørn, M; Blake, T; Blanc, F; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bordyuzhin, I; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Brundu, D; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Byczynski, W; Cadeddu, S; Cai, H; Calabrese, R; Calladine, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Chapman, M G; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chitic, S-G; Chobanova, V; Chrzaszcz, M; Chubykin, A; Ciambrone, P; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Colombo, T; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Douglas, L; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fazzini, D; Federici, L; Ferguson, D; Fernandez, G; Fernandez Declara, P; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabowski, J P; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hancock, T H; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Hasse, C; Hatch, M; He, J; Hecker, M; Heinicke, K; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Hu, W; Huard, Z C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Ibis, P; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kazeev, N; Kecke, M; Keizer, F; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozeiha, M; Kravchuk, L; Kreps, M; Kress, F; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, P-R; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Lisovskyi, V; Liu, X; Loh, D; Loi, A; Longstaff, I; Lopes, J H; Lucchesi, D; Luchinsky, A; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Macko, V; Mackowiak, P; Maddrell-Mander, S; Maev, O; Maguire, K; Maisuzenko, D; Majewski, M W; Malde, S; Malecki, B; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Marangotto, D; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Mead, J V; Meadows, B; Meaux, C; Meier, F; Meinert, N; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Millard, E; Minard, M-N; Minzoni, L; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Mombächer, T; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pisani, F; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Pullen, H; Punzi, G; Qian, W; Quagliani, R; Quintana, B; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Robert, A; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Ruiz Vidal, J; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarpis, G; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepulveda, E S; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stepanova, M; Stevens, H; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, J; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szumlak, T; Szymanski, M; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Usachov, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagner, A; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Weisser, C; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xu, M; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zonneveld, J B; Zucchelli, S
2017-12-01
The decays χ_{c1}→J/ψμ^{+}μ^{-} and χ_{c2}→J/ψμ^{+}μ^{-} are observed and used to study the resonance parameters of the χ_{c1} and χ_{c2} mesons. The masses of these states are measured to be m(χ_{c1})=3510.71±0.04(stat)±0.09(syst) MeV and m(χ_{c2})=3556.10±0.06(stat)±0.11(syst) MeV, where the knowledge of the momentum scale for charged particles dominates the systematic uncertainty. The momentum-scale uncertainties largely cancel in the mass difference m(χ_{c2})-m(χ_{c1})=45.39±0.07(stat)±0.03(syst) MeV. The natural width of the χ_{c2} meson is measured to be Γ(χ_{c2})=2.10±0.20(stat)±0.02(syst) MeV. These results are in good agreement with and have comparable precision to the current world averages.
Lifescience Database Archive (English)
Full Text Available lignments: (bits) Value BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 112 3e-23 BC13...8482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 112 4e-23 (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 112 4e-23 (Q9JLC8) RecName: Full=Sacsin; 112 4e-2
Lifescience Database Archive (English)
Full Text Available BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 35 0.63 (Q9NZJ4) RecName: Full=Sacs...in; &AL157766_4( AL157766 |pid:none) 35 0.63 (Q9JLC8) RecName: Full=Sacsin; 35 0.63... BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 35 0.63 AL732351_6( AL732351 |pid:non
Lifescience Database Archive (English)
Full Text Available ents: (bits) Value BC142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 97 6e-19 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 97 9e-19 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 1e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 2e-18 (Q9JLC8) RecName: Full=Sacsin; 96 2e-18 CP001577_292( CP001577 |pid:none) Mi
Secretin enhances [14C]erythritol clearance in unanesthetized dogs
International Nuclear Information System (INIS)
Lewis, M.H.; Baker, A.L.; Dhorajiwala, J.; Moossa, A.R.
1982-01-01
To determine the effect of secretin infusion on clearance of inert markers into bile, unanesthetized dogs fitted with Thomas cannulas received continuous infusions of [ 14 C]erythritol and [ 3 H]inulin throughout study. Taurocholic acid administered sequentially at 9.0, 20.0, and 40.0 mumol/min enhanced [ 14 C]erythritol clearance, and GIH secretin (3 units/min) administered along with TCA (40.0 mumol/min) increased [ 14 C]erythritol clearance from 4.9 +/- 1.2 ml/10 min to 6.8 +/- 1.3 ml/10 min (P less than 0.001), but simultaneously measured [ 3 H]inulin clearance was unaltered. Secretin alone also increased [ 14 C]erythritol clearance but did not alter [ 3 H]inulin clearance. The increase in [ 14 C]erythritol clearance per unit increase in bile flow was less during secretin infusion than TCA. Thus, secretin increases [ 14 C]erythritol transport through restricted channels, probably distal to the canaliculi. [ 14 C]Erythritol may not be an accurate marker for canalicular bile flow in dogs during secretin infusion
Dicty_cDB: Contig-U13401-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available musculus c... 139 2e-31 AY651828_5( AY651828 |pid:none) Cotesia plutellae polydnavirus seg... 139 2e-31 AK30... 1e-29 AY651829_10( AY651829 |pid:none) Cotesia plutellae polydnavirus se... 132 1e-29 Z36237_5( Z36237 |pid...K294673_1( AK294673 |pid:none) Homo sapiens cDNA FLJ59320 complet... 127 6e-28 EF067328_9( EF067328 |pid:none) Cotesia plutella..._1( U20807 |pid:none) Bos taurus protein tyrosine phosphatas... 127 8e-28 AY651829_1( AY651829 |pid:none) Cotesia plutella...sph... 126 1e-27 EF067324_5( EF067324 |pid:none) Cotesia plutellae polydnavirus seg... 126 1e-27 AK064263_1(
Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Duan, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.
2015-01-01
Using a sample of 1.06 x 10(8) psi(3686) events produced in e(+)e(-) collisions at root s = 3.686 GeV and collected with the BESIII detector at the BEPCII collider, we present studies of the decays psi(3686) -> K-Lambda(Xi) over bar (+) + c.c. and psi(3686) -> gamma K-Lambda(Xi) over bar (+) + c.c.
International Nuclear Information System (INIS)
Dias, Ricardo Rodrigues
2009-01-01
In this work, Pt/C, PtRh (90:10), PtRh/C (50:50), PtSn/C (50:50), PtRu (50:50)/C, PtRuRh/C (50:40:10) and PtSnRh/C (50:40:10) were prepared by an alcohol-reduction process with metal loading of 20 wt.% using H 2 PtCl 6 .6H 2 O (Aldrich), SnCl 2 .2H 2 O (Aldrich),and RhCl 2 .XH 2 O (Aldrich) as metals sources and Vulcan XC72 as support. The electrocatalysts were characterized by EDX, XRD and cyclic voltammetry (CV). The electro-oxidation of ethanol was studied by CV, chronoamperomety at room temperature in acid medium and tests at 100 deg C on a single cell of a direct methanol or ethanol fuel cell. The EDX analysis showed that the metal atomic ratios of the obtained electrocatalysts were similar to the nominal atomic ratios used in the preparation. The diffractograms of electrocatalysts prepared showed four peaks at approximately 2θ = 40 0 , 47 0 , 67 0 and 82 0 , which are associated with the (111), (200), (220) and (311) planes, respectively, of a face cubic-centered (fcc) structure characteristic of platinum and platinum alloys. The average crystallite sizes using the Scherrer equation and the calculated values were in the range of 2–3 nm. For PtSn/C and PtSnRh/C two additional peaks were observed at 2θ = 34 0 and 52 0 that were identified as a SnO 2 phase. PtSn/C (50:50) and PtSnRh/C (50:40:10) electrocatalyst showed the best performance for ethanol oxidation at room temperature. For methanol oxidation at room temperature PtRu/C, PtSn/C and PtRuRh/C electrocatalysts showed the best performance. Tests at 100 deg C on a single cell of a direct ethanol fuel cell PtSnRh/C showed the best performance, for methanol oxidation PtRuRh/C showed the best performance. (author)
Pooja, Sharma; Pushpanathan, Muthuirulan; Gunasekaran, Paramasamy; Rajendhran, Jeyaprakash
2015-01-01
Streptococcus agalactiae infection causes high mortality in cardiovascular disease (CVD) patients, especially in case of setting prosthetic valve during cardiac surgery. However, the pathogenesis mechanism of S. agalactiae associate with CVD has not been well studied. Here, we have demonstrated the pathogenicity of S. agalactiae in rat cardiomyocytes (H9C2). Interestingly, both live and dead cells of S. agalactiae were uptaken by H9C2 cells. To further dissect the process of S. agalactiae int...
Standard Molar Enthalpy of Formation of RE(C5H8NS2)3(C12H8N2)
Institute of Scientific and Technical Information of China (English)
Meng Xiangxin; Shuai Qi; Chen Sanping; Xie Gang; Gao Shengli; Shi Qizhen
2005-01-01
Four solid ternary complexes of RE (C5H8NS2)3(C12H8N2) (RE=Eu, Gd, Tb, Dy) were synthesized in absolute ethanol by rare earth chloride low hydrate with the mixed ligands of ammonium pyrrolidinedi-thiocarbamate (APDC) and 1, 10-phenanthroline*H2O (o-phen*H2O) in the ordinary laboratory atmosphere without any cautions against moisture or air sensitivity. IR spectra of the complexes show that the RE3+ coordinated with six sulfur atoms of three PDC- and two nitrogen atoms of o-phen*H2O. It was assumed that the coordination number of RE3+ is eight. The constant-volume combustion energies of the complexes, ΔcU, were determined as (-16937.88±9.79 ), (-17588.79±8.62 ), (-17747.14±8.25 ) and (-17840.37±8.87 ) kJ*mol-1, by a precise rotating-bomb calorimeter at 298.15 K. Its standard molar enthalpies of combustion, ΔcHθm, and standard molar enthalpies of formation, ΔfHθm, were calculated as (-16953.37±9.79), (-17604.28±8.62), (-17762.63±8.25), (-17855.86±8.87) kJ*mol-1 and (-857.04±10.52), (-282.43±9.58), (-130.08±9.13), (-55.75±9.83) kJ*mol-1.
Directory of Open Access Journals (Sweden)
Manna Jose
2014-01-01
Full Text Available Aim: Pregnancy in women with epilepsy (WWE who are on anti-epileptic drugs (AEDs has two- to three-fold increased risk of fetal malformations. AEDs are mostly metabolized by Cyp2C9, Cyp2C19 and Cyp3A4 and transported by ABCB1. Patients on AED therapy can have folate deficiency. We hypothesize that the polymorphisms in ABCB1, Cyp2C9, Cyp2C19 and methylene tetrahydrofolate reductase (MTHFR might result in differential expression resulting in differential drug transport, drug metabolism and folate metabolism, which in turn may contribute to the teratogenic impact of AEDs. Materials and Methods: The ABCB1, Cyp2C9, Cyp2C19 and MTHFR polymorphisms were genotyped for their role in teratogenic potential and the nature of teratogenecity in response to AED treatment in WWE. The allelic, genotypic associations were tested in 266 WWE comprising of 143 WWE who had given birth to babies with WWE-malformation (WWE-M and 123 WWE who had normal offsprings (WWE-N. Results: In WWE-M, CC genotype of Ex07 + 139C/T was overrepresented (P = 0.0032 whereas the poor metabolizer allele FNx012 and FNx012 FNx012 genotype of CYP2C219 was significantly higher in comparison to WWE-N group (P = 0.007 and P = 0.005, respectively. All these observations were independent of the nature of malformation (cardiac vs. non cardiac malformations. Conclusion: Our study indicates the possibility that ABCB1 and Cyp2C19 may play a pivotal role in the AED induced teratogenesis, which is independent of nature of malformation. This is one of the first reports indicating the pharmacogenetic role of Cyp2C19 and ABCB1 in teratogenesis of AED in pregnant WWE.
International Nuclear Information System (INIS)
Gentschev, Ivaylo; Fensterle, Joachim; Schmidt, Andreas; Potapenko, Tamara; Troppmair, Jakob; Goebel, Werner; Rapp, Ulf R
2005-01-01
Serine-threonine kinases of the Raf family (A-Raf, B-Raf, C-Raf) are central players in cellular signal transduction, and thus often causally involved in the development of cancer when mutated or over-expressed. Therefore these proteins are potential targets for immunotherapy and a possible basis for vaccine development against tumors. In this study we analyzed the functionality of a new live C-Raf vaccine based on an attenuated Salmonella enterica serovar Typhimurium aroA strain in two Raf dependent lung tumor mouse models. The antigen C-Raf has been fused to the C-terminal secretion signal of Escherichia coli α-hemolysin and expressed in secreted form by an attenuated aroA Salmonella enterica serovar Typhimurium strain via the α-hemolysin secretion pathway. The effect of the immunization with this recombinant C-Raf strain on wild-type C57BL/6 or lung tumor bearing transgenic BxB mice was analyzed using western blot and FACS analysis as well as specific tumor growth assays. C-Raf antigen was successfully expressed in secreted form by an attenuated Salmonella enterica serovar Typhimurium aroA strain using the E. coli hemolysin secretion system. Immunization of wild-type C57BL/6 or tumor bearing mice provoked specific C-Raf antibody and T-cell responses. Most importantly, the vaccine strain significantly reduced tumor growth in two transgenic mouse models of Raf oncogene-induced lung adenomas. The combination of the C-Raf antigen, hemolysin secretion system and Salmonella enterica serovar Typhimurium could form the basis for a new generation of live bacterial vaccines for the treatment of Raf dependent human malignancies
P-wave excited {B}_{c}^{* * } meson photoproduction at the LHeC
Kai, He; Huan-Yu, Bi; Ren-You, Zhang; Xiao-Zhou, Li; Wen-Gan, Ma
2018-05-01
As an important sequential work of the S-wave {B}c(* ) ({}1{S}0({}3{S}1) ) meson production at the large hadron electron collider (LHeC), we investigate the production of the P-wave excited {B}c* * states (1 P 1 and 3 P J with J = 0, 1, 2) via photoproduction mechanism within the framework of nonrelativistic QCD at the LHeC. Generally, the {e}-+P\\to γ +g\\to {B}c* * +b+\\bar{c} process is considered as the main production mechanism at an electron–proton collider due to the large luminosity of the gluon. However, according to our experience on the S-wave {B}c(* ) meson production at the LHeC, the extrinsic production mechanism, i.e., {e}-+P\\to γ +c\\to {B}c* * +b and {e}-+P\\to γ +\\bar{b} \\to {B}c* * +\\bar{c}, could also provide dominating contributions at low p T region. A careful treatment between these channels is performed and the results on total and differential cross sections, together with main uncertainties are discussed. Taking the quark masses m b = 4.90 ± 0.40 GeV and m c = 1.50 ± 0.20 GeV into account and summing up all the production channels, we expect to accumulate ({2.48}-1.75+3.55)× {10}4 {B}c* * ({}1{P}1), ({1.14}-0.82+1.49)× {10}4 {B}c* * ({}3{P}0),({2.38}-1.74+3.39)× {10}4 {B}c* * ({}3{P}1) and ({5.59}-3.93+7.84)× {10}4 {B}c* * ({}3{P}2) events at the \\sqrt{S}=1.30 {{T}}{{e}}{{V}} LHeC in one operation year with luminosity { \\mathcal L }={10}33 cm‑2 s‑1. With such sizable events, it is worth studying the properties of excited P-wave {B}c* * states at the LHeC.
Lifescience Database Archive (English)
Full Text Available RNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library o...f Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 8e-09 3 CV172465 |CV172465.1 rsmsxlre_0
Dicty_cDB: Contig-U05076-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Dictyostelium discoideum slug cDNA, clone SSF125. 767 0.0 2 ( FG291554 ) 1108793348415 New World Screwworm E...CF-24-HW liver cDNA li... 48 0.34 1 ( FG284835 ) 1108770682807 New World Screwworm Egg 9261 ESTs C... 36 0.9
Lifescience Database Archive (English)
Full Text Available ucing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 1...05 4e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 CP0015
Microfluidic system for monitoring of cardiac (H9C2) cell proliferation
Kobuszewska, A.; Cwik, P.; Jastrzebska, E.; Brzozka, Z.; Chudy, M.; Renaud, P.; Dybko, A.
2017-05-01
The paper presents the application of electrical impedance spectroscopy (EIS) analysis for investigation of cardiac cell (H9C2 - rat cardiomyoblast) proliferation after verapamil hydrochloride exposure. For this purpose, two different PDMS/glass microsystems with circular microchamber and longitudinal microchannel integrated with Pt/Al electrodes were used. The microchambers were fabricated in PDMS using photolithography and replica moulding techniques. Pt/Al electrodes were fabricated on a 4-inch glass substrate using Physical Vapor Deposition (PVD). Solution of verapamil hydrochloride was continuously introduced into the microsystems with H9C2 cell culture (a flow rate of 1 μl/min) for 72 h. The impedance spectra were recorded from 100 Hz to 1 MHz. We confirmed that impedance spectroscopy can be used for non-invasive, label-free and real-time analysis of cardiac cells proliferation based on cells dielectric properties and biological structure.
The accuracy of warfarin dosage based on VKORC1 and CYP2C9 phenotypes in a Chinese population
Directory of Open Access Journals (Sweden)
Agustinus Wijaya
2012-05-01
Full Text Available Background: The aim of this study is to assess the accuracy of warfarin dosage based on VKORC1 and CYP2C9 genotype in Chinese population.Methods: Blood samples were taken from 37 patients. We compared the warfarin dosage obtained from genotype (according to www.warfarindosing.org and treatment dosage with international normalized ratio (INR value within 2.0-3.0.Results: The majority of Chinese people in our study are VKORC1 homozygous AA (89.2%, rarely VKORC1 heterozygous AG and we cannot find a patient with homozygous GG. For CYP2C9 genotype, most patients have the wildtype variants (CYP2C9*2 CC and CYP2C9*3 AA. The warfarin dosage for patients with VKORC1 AA and CYP2C9*3 AC is lower than for patients with other genotype variants.Conclusion: There is no significant difference between pharmacogenetic algorithm (www.warfarindosing.org and our treatment dosage. Our conclusion is that the pharmacogenetic algorithm is accurate to predict the warfarin dose. (Med J Indones. 2012;21:108-12Keywords: CYP2C9, pharmacogenetic algorithm, VKORC1, warfarin
Ham, Annelies C; Ziere, Gijsbertus; Broer, Linda; Swart, Karin M A; Enneman, Anke W; van Dijk, Suzanne C; van Wijngaarden, Janneke P; van der Zwaluw, Nikita L; Brouwer-Brolsma, Elske M; Dhonukshe-Rutten, Rosalie A M; van Schoor, Natasja M; Zillikens, M Carola; van Gelder, Teun; de Vries, Oscar J; Lips, Paul; Deeg, Dorly J H; de Groot, Lisette C P G M; Hofman, Albert; Witkamp, Renger F; Uitterlinden, André G; Stricker, Bruno H; van der Velde, Nathalie
2017-01-01
To investigate whether the CYP2C9*2 and *3 variants modify benzodiazepine-related fall risk. Three prospective studies; the Rotterdam Study, B-PROOF, and LASA. Community-dwelling individuals living in or near five Dutch cities. There were 11,485 participants aged ≥55 years. Fall incidents were recorded prospectively. Benzodiazepine use was determined using pharmacy dispensing records or interviews. Cox proportional hazard models adjusted for age and sex were applied to determine the association between benzodiazepine use and fall risk stratified for CYP2C9 genotype and comparing benzodiazepine users to nonusers. The results of the three studies were combined applying meta-analysis. Within benzodiazepine users, the association between genotypes and fall risk was also assessed. Three thousand seven hundred five participants (32%) encountered a fall during 91,996 follow-up years, and 4% to 15% (depending on the study population) used benzodiazepines. CYP2C9 variants had frequencies of 13% for the *2 allele and 6% for the *3 allele. Compared to nonusers, current benzodiazepine use was associated with an 18% to 36% increased fall risk across studies with a combined hazard ratio (HR) = 1.26 (95% confidence interval [CI], 1.13; 1.40). CYP2C9*2 or *3 allele variants modified benzodiazepine-related fall risk. Compared to nonusers, those carrying a CYP2C9*2 or *3 allele and using benzodiazepines had a 45% increased fall risk (HR, 1.45 95% CI, 1.21; 1.73), whereas CYP2C9*1 homozygotes using benzodiazepines had no increased fall risk (HR, 1.14; 95% CI, 0.90; 1.45). Within benzodiazepine users, having a CYP2C9*2 or *3 allele was associated with an increased fall risk (HR, 1.35; 95% CI, 1.06; 1.72). Additionally, we observed an allele dose effect; heterozygous allele carriers had a fall risk of (HR = 1.30; 95% CI, 1.05; 1.61), and homozygous allele carriers of (HR = 1.91 95% CI, 1.23; 2.96). CYP2C9*2 and *3 allele variants modify benzodiazepine-related fall risk. Those
Energy Technology Data Exchange (ETDEWEB)
Serne, R JEFFREY.; Bjornstad, Bruce N.; Horton, Duane G.; Lanigan, David C.; Lindenmeier, Clark W.; Lindberg, Michael J.; Clayton, Ray E.; LeGore, Virginia L.; Orr, Robert D.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.
2004-04-01
Pacific Northwest National Laboratory performed detailed analyses on vadose zone sediments from within Waste Management Area T-TX-TY. This report contains all the geologic, geochemical, and selected physical characterization data collected on vadose zone sediment recovered from three probe holes (C3830, C3831, and C3832) in the TX Tank Farm, and from borehole 299-W-10-27. Sediments from borehole 299-W-10-27 are considered to be uncontaminated sediments that can be compared with contaminated sediments. This report also presents our interpretation of the sediment lithologies, the vertical extent of contamination, the migration potential of the contaminants, and the likely source of the contamination in the vadose zone and groundwater below the TX Tank Farm. Sediment from the probe holes was analyzed for: moisture, radionuclide and carbon contents;, one-to-one water extracts (soil pH, electrical conductivity, cation, trace metal, and anion data), and 8 M nitric acid extracts. Overall, our analyses showed that common ion exchange is a key mechanism that influences the distribution of contaminants within that portion of the vadose zone affected by tank liquor. We did not observe significant indications of caustic alteration of the sediment mineralogy or porosity, or significant zones of slightly elevated pH values in the probe holes. The sediments do show that sodium-, nitrate-, and sulfate-dominated fluids are present. The fluids are more dilute than tank fluids observed below tanks at the SX and BX Tank Farms. Three primary stratigraphic units were encountered in each probe hole: (1) backfill material, (2) the Hanford formation, and (3) the Cold Creek unit. Each of the probe holes contain thin fine-grained layers in the Hanford H2 stratigraphic unit that may impact the flow of leaked fluids and effect irregular and horizontal flow. The probe holes could not penetrate below the enriched calcium carbonate strata of the Cold Creek lower subunit; therefore, we did not
Dicty_cDB: Contig-U03055-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -67 2 ( FG284490 ) 1108770671670 New World Screwworm Egg 9261 ESTs C... 143 7e-67... 3 ( FG286862 ) 1108770727001 New World Screwworm Egg 9261 ESTs C... 143 9e-67 3 ( FG284489 ) 1108770671669 New World...ld Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG286245 ) 1108770714398 New World... Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG290225 ) 1108793315348 New World Screw...T1 Hydractinia echinata cD... 147 1e-64 4 ( FG285211 ) 1108770694495 New World Screwworm Egg 9261 ESTs C...
Yenilmez, Ebru Dundar; Tamam, Lut; Karaytug, Onur; Tuli, Abdullah
2018-06-19
The interindividual genetic variations in drug metabolizing enzymes effects the impact and toxicity in plenty of drugs. The CYP1A2, CYP2C9, CYP2C19 and CYP2D6 gene polymorphisms characterized using high resolution melting analysis (HRMA) in follow-up patients in psychiatry clinic as a preliminary preparation for personalized medicine. Genotyping of CYP1A2*1F, CYP2C9 *2, *3, CYP2C19 *2, *3 and *17 and CYP2D6 *3, *4 was conducted in 101 patients using HRMA. Genotype and allele frequencies of the CYP variants were found to be in equilibrium with the Hardy-Weinberg equation. The frequency of the CYP1A2*1F allele in schizophrenia and bipolar disease was 0.694 and 0.255, respectively. The CYP2C9 allele frequencies were 0.087 (CYP2C9*2), and 0.549 (CYP2C9*3) for bipolar; 0.278 (CYP2C9*2) and 0.648 (CYP2C9*3) in schizophrenias. The CYP2C19*2 and *17 allele frequencies was 0.111 and 0.185 in schizophrenia and variant *2 was 0.117 and variant *17 was 0.255 in bipolar group. The frequency of the CYP2D6*3 allele was 0.027 in schizophrenias. The frequencies for the CYP2D6*4 variant was 0.092 and 0.096 in schizophrenia and bipolar groups, respectively. The knowledge in pharmacogenomics and also the developments in molecular genetics are growing rapidly. In the future this can be expected to provide new methodologies in the prediction of the activity in drug metabolizing enzymes. The HRMA is a rapid and useful technique to identify the genotypes for drug dosage adjustment before therapy in psychiatry patients. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
AKR1B10 induces cell resistance to daunorubicin and idarubicin by reducing C13 ketonic group
International Nuclear Information System (INIS)
Zhong Linlin; Shen Honglin; Huang Chenfei; Jing, Hongwu; Cao Deliang
2011-01-01
Daunorubicin, idarubicin, doxorubicin and epirubicin are anthracyclines widely used for the treatment of lymphoma, leukemia, and breast, lung, and liver cancers, but tumor resistance limits their clinical success. Aldo-keto reductase family 1 B10 (AKR1B10) is an NADPH-dependent enzyme overexpressed in liver and lung carcinomas. This study was aimed to determine the role of AKR1B10 in tumor resistance to anthracyclines. AKR1B10 activity toward anthracyclines was measured using recombinant protein. Cell resistance to anthracycline was determined by ectopic expression of AKR1B10 or inhibition by epalrestat. Results showed that AKR1B10 reduces C13-ketonic group on side chain of daunorubicin and idarubicin to hydroxyl forms. In vitro, AKR1B10 converted daunorubicin to daunorubicinol at V max of 837.42 ± 81.39 nmol/mg/min, K m of 9.317 ± 2.25 mM and k cat /K m of 3.24. AKR1B10 showed better catalytic efficiency toward idarubicin with V max at 460.23 ± 28.12 nmol/mg/min, K m at 0.461 ± 0.09 mM and k cat /K m at 35.94. AKR1B10 was less active toward doxorubicin and epirubicin with a C14-hydroxyl group. In living cells, AKR1B10 efficiently catalyzed reduction of daunorubicin (50 nM) and idarubicin (30 nM) to corresponding alcohols. Within 24 h, approximately 20 ± 2.7% of daunorubicin (1 μM) or 23 ± 2.3% of idarubicin (1 μM) was converted to daunorubicinol or idarubicinol in AKR1B10 expression cells compared to 7 ± 0.9% and 5 ± 1.5% in vector control. AKR1B10 expression led to cell resistance to daunorubicin and idarubicin, but inhibitor epalrestat showed a synergistic role with these agents. Together our data suggest that AKR1B10 participates in cellular metabolism of daunorubicin and idarubicin, resulting in drug resistance. These data are informative for the clinical use of idarubicin and daunorubicin. - Highlights: → This study defines enzyme activity of AKR1B10 protein towards daunorubicin, idarubicin, doxorubicin, and epirubicin. → This study pinpoints
Cluster correlation effects in 12C+12C and 14N+10B fusion-evaporation reactions
Directory of Open Access Journals (Sweden)
Morelli L.
2015-01-01
Full Text Available The decay of highly excited states of 24Mg is studied in fusion evaporation events completely detected in charge in the reactions 12C+12C and 14N+10B at 95 and 80 MeV incident energy respectively. The comparison of light charged particles measured spectra with statistical model predictions suggests that the dominant reaction mechanism is compound nucleus (CN formation and decay. However, in both reactions, a discrepancy with statistical expectations is found for α particles detected in coincidence with Carbon, Oxigen and Neon residues. The comparison between the two reactions shows that this discrepancy is only partly explained by an entrance channel effect. Evidence for cluster correlations in excited 24Mg CN is suggested by the comparison between the measured and calculated branching ratios for the channels involving α particles.
Diels-Alder reactions of anthracenes with C-sulfonyldithioformates
DEFF Research Database (Denmark)
El-Sayed, I.; Ali, O.M.; Fischer, A.
2003-01-01
C-Sulfonyldithioformates (2) (R-1 = ArSO2, R 2 = ArS) readily add to anthracene and 9-methylanthracene (1) in a Diels-Alder fashion with formation of 9,10-dihydro-10,9-(epithiomethano)anthracenes (3) which in turn may suffer thermally induced elimination of arenesulfinic acid to yield the 9......-anthracenedithiocarboxylic esters (4). The reactions with the unsymmetrical diene 9-methylanthracene take place in a highly stereoselective fashion....
2010-04-01
... recreational activities such as athletic leagues are considered other benefits. The provision of child-care...; life, sick, accident, or other benefits. 1.501(c)(9)-3 Section 1.501(c)(9)-3 Internal Revenue INTERNAL..., or other benefits. (a) In general. The life, sick, accident, or other benefits provided by a...
Lifescience Database Archive (English)
Full Text Available 0.90 3 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Cit...rus sinensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 0.92 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent
Stereoselective chlorothiolation of artemisinin-derived C-10 oxa terminal alkynes.
Surineni, Naresh; Buragohain, Pori; Barua, Nabin C
2015-11-01
A mild and efficient strategy is explored on the highly sensitive artemisinin-derived C-10 oxa terminal alkynes. Several novel artemisinin-derived (E)-2-chloroalkenyl sulfides (20) have been synthesized by using this protocol to study their anticancer activities.
Short-Circuit Degradation of 10-kV 10-A SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Beczkowski, Szymon; Munk-Nielsen, Stig
2017-01-01
The short-circuit behavior of power devices is highly relevant for converter design and fault protection. In this work, the degradation during short-circuit of a 10 kV 10 A 4H-SiC MOSFET is investigated at 6 kV DC-link voltage. The study aims to present the behavior of the device during short-circuit...... transients as it sustains increasing short-circuit pulses during its life-time. As the short-circuit pulse length increases, degradation of the device can be observed in periodically performed characterizations. The initial degradation seems to be associated with the channel region, and continuous stressing...
Phase diagrams for pseudo-binary carbide systems TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC and HfC-TaC
International Nuclear Information System (INIS)
Gusev, A.I.
1985-01-01
Parameters of interaction and energy of mutual exchange in the liquid and solid phases of pseudobinary TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC, HfC-TaC systems are calculated with account of dependence on composition and temperature. Positions of liquidus-solidus phase boundaries on the phase diagrams of the mentioned systems are calculated on the basis of the determined mutual exchange energies in approximati.on of subregular solutions. The existance of latent decomposition ranges in the solid phase on the phase diagrams of the investgated systems is established
Lifescience Database Archive (English)
Full Text Available 8 |CB290208.1 UCRCS01_01aa10_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus....1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis c
Radiosynthesis of the D2/3 agonist [3-11C]-(+)-PHNO using [11C]iodomethane
International Nuclear Information System (INIS)
Francisco Garcia-Arguello, Segundo; Fortt, Robin; Steel, Colin J.; Brickute, Diana; Glaser, Matthias; Turton, David R.; Robins, Edward G.; Årstad, Erik; Luthra, Sajinder K.
2013-01-01
We report here a radiosynthesis for the D 2/3 agonist (+)-4-([3- 11 C]propyl)-3,4,4a,5,6,10b-hexahydro-2H-naphtho[1,2-b][1,4] oxazin-9-ol (3-[ 11 C]-(+)-PHNO) labelled at the terminal carbon of the N-propyl chain. The protocol is based on 11 C-methylation of an N-acetyl precursor. This initial step is followed by a reduction with LiAlH 4 to give ([3- 11 C]-(+)-PHNO). We first applied the method for the synthesis of a model compound, N-3-([ 11 C]propyl)-1,2,3,4-tetrahydroisoquinoline, which we obtained in 77–97% analytical radiochemical yield (n=6) in 20 min. Similarly, we prepared ([3- 11 C]-(+)-PHNO) in 55–60% analytical radiochemical yield (n=5) using a one-pot procedure. We have also been able to implement the complete process on a semi-automated module. This platform delivered purified and formulated [3- 11 C]PHNO with an average radiochemical yield of 9% (n=13, range 2–30%, non-decay corrected), a radiochemical purity >95%, and a specific radioactivity of 26.8–81.1 GBq/μmol in a total time of 63–65 min. - Highlights: ► We report an alternative method to obtain carbon-11 labelled PHNO. ► The method is based on readily available [ 11 C]methyl iodide as starting material. ► We have automated the alkylation/reduction protocol including purification and formulation
Energy Technology Data Exchange (ETDEWEB)
Papineau, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1956-07-01
The relationship between the path and energy of ions with 3{<=}Z{<=}10 in Ilford C2 nuclear emulsions is studied. It determined the average state of charge of ions in each velocity intervals. Results are given in a table for {sub 2}He, {sub 3}Li, {sub 4}Be, {sub 5}B, {sub 6}C, {sub 7}N, {sub 8}O and {sub 10}Ne. For each velocity interval, it is possible to apply the Blackett relation which links, for the same velocity, the path {delta}R of a particle with M (mass) and Z (charge) to the path {delta}R' of a particle with M' and Z'. Results are given in tables and graphics representing the particles energy with the particles path. (M.P.)
Lifescience Database Archive (English)
Full Text Available one) Pichia stipitis CBS 6054 chromos... 35 4.8 EU095850_1( EU095850 |pid:none) Turkey coronavirus isolate M...G10, c... 35 4.8 EU095850_2( EU095850 |pid:none) Turkey coronavirus isolate MG10, c... 35 4.8 CP000094_2730(
Identification of cytochrome P450 2D6 and 2C9 substrates and inhibitors by QSAR analysis
DEFF Research Database (Denmark)
Jónsdóttir, Svava Ósk; Ringsted, Tine; Nikolov, Nikolai G.
2012-01-01
This paper presents four new QSAR models for CYP2C9 and CYP2D6 substrate recognition and inhibitor identification based on human clinical data. The models were used to screen a large data set of environmental chemicals for CYP activity, and to analyze the frequency of CYP activity among these com......This paper presents four new QSAR models for CYP2C9 and CYP2D6 substrate recognition and inhibitor identification based on human clinical data. The models were used to screen a large data set of environmental chemicals for CYP activity, and to analyze the frequency of CYP activity among...... these compounds. A large fraction of these chemicals were found to be CYP active, and thus potentially capable of affecting human physiology. 20% of the compounds within applicability domain of the models were predicted to be CYP2C9 substrates, and 17% to be inhibitors. The corresponding numbers for CYP2D6 were 9...... of specific CYP activity. An overrepresentation was seen for poly-aromatic hydrocarbons (group of procarcinogens) among CYP2C9 active and mutagenic compounds compared to CYP2C9 inactive and mutagenic compounds. The mutagenicity was predicted with a QSAR model based on Ames in vitro test data....
Digital Repository Service at National Institute of Oceanography (India)
Ciavatta, M.L.; Gresa, M.P.L.; Manzo, E.; Gavagnin, M.; Wahidullah, S.; Cimino, G.
, m), 1.65 (H-8, m), 1.58 (H-16b, m), 1.28 (H-15b, m), 1.24 (H 3 -19, s), 1.10 (H-9, m), 1.08 (H-7b, m), 1.07 (H-12b, m), 1.02(H-14, m), 0.67 (H 3 -18, s); 13 C NMR (75.13MHz, CDCl 3 ): d 186.5 (C-3, s), 169.0 (C-5, s), 155.9 (C-1, d), 139.3 (C-20, d...), 127.5 (C- 2, d), 123.8 (C-4, d), 114.9 (C-21, t), 55.1 (C-17, d), 54.6 (C-14, d), 52.7 (C-9, d), 43.6 (C-10 and C-13, s·2), 37.1 (C-12, t), 35.7 (C-8, d), 33.7 (C-7, t), 32.9 (C-6, t), 27.1 (C-16, t), 24.9 (C-15, t), 22.5 (C-11, t), 18.7 (C-19, q), 12...
A study of 11C-acetate production using 11C-choline commercial module
International Nuclear Information System (INIS)
Zhang Jinming; Tian Jiahe; Yao Shulin; Chen Yan
2008-01-01
Objective: 11 C-acetate is a useful PET tracer in evaluating myocardial metabolism but more interest has been focused on its application in tumor detection in recent years, especially hepatocellular carcinoma (HCC). This study was designed to evaluate the laboratory, preparation of 11 C-acetate with a modified 11 C-choline commercial module and to investigate its biodistribution in tumor (lung adenocarcinoma)-bearing mice as well as its potential as a tumor imaging agent. Methods: 11 C-acetate was synthesized with a modified 11 C choline module: Methyl magnesium bromide Grignard (0.1 ml of 1.5 mol/L) was load- ed to a Teflon loop before 11 CO 2 was recovered from the target. Cartier acetate solution (2 ml of 1 mmol/L) was pushed through the loop, SPE cartridges (mixed AG50 and IC-Ag) and then the QMA. The loop and cartridges were then rinsed with water. The product 11 C-acetate was then washed out from QMA with 0.9% NaCl solution into a collection vial containing diluted HCl. 11 C-carbonate was removed by nitrogen bubbling for 2 min. After neutralization with trisodium citrate, the injectable 11 C-acetate solution was obtained. The tumor-bearing mice were sacrificed. The percentage activity of injected dose per gram of tissue (% ID/g) for tumor and other tissues were calculated. One patient with known diagnosis of moderately differentiated HCC was injected with 11 C-acetate and imaged by PET/CT, followed by 18 F-fluorodeoxyglucose (FDG). Results: The synthesis yield of 11 C-acetate was (60.5 ± 8.7)% (decay conected, n=10); the radio-chemistry purity was > 98% and the synthesis time was 10 min from 11 CO 2 to 11 C-acetate. The radioactivity ratio for tumor/muscle was 1.76 at 30 min. A patient with known HCC showed positive 11 C-acetate accumulation in the tumor but was negative in 18 F-FDG. Conclusion: The synthesis of 11 C-acetate by modification of an 11 C-choline commercial module was feasible and it could be achieved with high yield, high radiochemical purity
Nqrs Data for C3H2Cl10N2PSb[C3HCl4N2P·Cl6HSb](Subst. No. 0601)
Chihara, H.; Nakamura, N.
This document is part of Subvolume A `Substances Containing Ag … C10H15' of Volume 48 `Nuclear Quadrupole Resonance Spectroscopy Data' of Landolt-Börnstein - Group III `Condensed Matter'. It contains an extract of Section `3.2 Data tables' of the Chapter `3 Nuclear quadrupole resonance data' providing the NQRS data for C3H2Cl10N2PSb [C3HCl4N2P·Cl6HSb] (Subst. No. 0601)
C9orf72 nucleotide repeat structures initiate molecular cascades of disease.
Haeusler, Aaron R; Donnelly, Christopher J; Periz, Goran; Simko, Eric A J; Shaw, Patrick G; Kim, Min-Sik; Maragakis, Nicholas J; Troncoso, Juan C; Pandey, Akhilesh; Sattler, Rita; Rothstein, Jeffrey D; Wang, Jiou
2014-03-13
A hexanucleotide repeat expansion (HRE), (GGGGCC)n, in C9orf72 is the most common genetic cause of the neurodegenerative diseases amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD). Here we identify a molecular mechanism by which structural polymorphism of the HRE leads to ALS/FTD pathology and defects. The HRE forms DNA and RNA G-quadruplexes with distinct structures and promotes RNA•DNA hybrids (R-loops). The structural polymorphism causes a repeat-length-dependent accumulation of transcripts aborted in the HRE region. These transcribed repeats bind to ribonucleoproteins in a conformation-dependent manner. Specifically, nucleolin, an essential nucleolar protein, preferentially binds the HRE G-quadruplex, and patient cells show evidence of nucleolar stress. Our results demonstrate that distinct C9orf72 HRE structural polymorphism at both DNA and RNA levels initiates molecular cascades leading to ALS/FTD pathologies, and provide the basis for a mechanistic model for repeat-associated neurodegenerative diseases.
The novel protein C9orf116 promotes rat liver cell line BRL-3A proliferation.
Directory of Open Access Journals (Sweden)
Chunyan Zhang
Full Text Available Our previous study has proved that the chromosome 9 open reading frame 116 (C9orf116 (NM_001106564.1 was significantly up-regulated in the proliferation phase of liver regeneration. To study its possible physiological function, we analyzed the effect of C9orf116 on BRL-3A cells via over-expression and interference technique. MTT results showed that the cell viability of the interference group was significantly lower than the control group at 48h after transfection (P<0.05, whereas it was significantly higher in the over-expression group (P<0.05. The flow cytometry results showed that C9orf116 knockdown or over-expression had little effect on BRL-3A cell apoptosis. However, the number of cells in division phase (G2/M was significantly reduced in the interference group (P<0.05, but significantly increased in the over-expression group (P<0.01. Furthermore, the expressions of cell proliferation-related genes CCNA2, CCND1 and MYC both at mRNA and protein levels were down-regulated in the interference group and up-regulated in the over-expression group. Therefore, we concluded that C9orf116 may promote cell proliferation by modulating cell cycle transition and the expression of key genes CCNA2, CCND1 and MYC in BRL-3A cells.
Mahoney, Colin J.; Beck, Jon; Rohrer, Jonathan D.; Lashley, Tammaryn; Mok, Kin; Shakespeare, Tim; Yeatman, Tom; Warrington, Elizabeth K.; Schott, Jonathan M.; Fox, Nick C.; Rossor, Martin N.; Hardy, John; Collinge, John; Revesz, Tamas; Mead, Simon
2012-01-01
An expanded hexanucleotide repeat in the C9ORF72 gene has recently been identified as a major cause of familial frontotemporal lobar degeneration and motor neuron disease, including cases previously identified as linked to chromosome 9. Here we present a detailed retrospective clinical, neuroimaging and histopathological analysis of a C9ORF72 mutation case series in relation to other forms of genetically determined frontotemporal lobar degeneration ascertained at a specialist centre. Eighteen probands (19 cases in total) were identified, representing 35% of frontotemporal lobar degeneration cases with identified mutations, 36% of cases with clinical evidence of motor neuron disease and 7% of the entire cohort. Thirty-three per cent of these C9ORF72 cases had no identified relevant family history. Families showed wide variation in clinical onset (43–68 years) and duration (1.7–22 years). The most common presenting syndrome (comprising a half of cases) was behavioural variant frontotemporal dementia, however, there was substantial clinical heterogeneity across the C9ORF72 mutation cohort. Sixty per cent of cases developed clinical features consistent with motor neuron disease during the period of follow-up. Anxiety and agitation and memory impairment were prominent features (between a half to two-thirds of cases), and dominant parietal dysfunction was also frequent. Affected individuals showed variable magnetic resonance imaging findings; however, relative to healthy controls, the group as a whole showed extensive thinning of frontal, temporal and parietal cortices, subcortical grey matter atrophy including thalamus and cerebellum and involvement of long intrahemispheric, commissural and corticospinal tracts. The neuroimaging profile of the C9ORF72 expansion was significantly more symmetrical than progranulin mutations with significantly less temporal lobe involvement than microtubule-associated protein tau mutations. Neuropathological examination in six cases
Querobino, Samyr Machado; Ribeiro, César Augusto João; Alberto-Silva, Carlos
2018-05-01
Bradykinin-potentiating peptides (BPPs - 5a, 7a, 9a, 10c, 11e, and 12b) of Bothrops jararaca (Bj) were described as argininosuccinate synthase (AsS) activators, improving l-arginine availability. Agmatine and polyamines, which are l-arginine metabolism products, have neuroprotective properties. Here, we investigated the neuroprotective effects of low molecular mass fraction from Bj venom (LMMF) and two synthetic BPPs (BPP-10c, BPP-12b, BPP-10c showed higher protective capacity than BPP-12b. LMMF pretreatment was unable to prevent the reduction of cell viability caused by H 2 O 2 . The neuroprotective mechanism of BPP-10c against oxidative stress was investigated. BPP-10c reduced ROS generation and lipid peroxidation in relation to cells treated only with H 2 O 2 . BBP-10c increased AsS expression and was not neuroprotective in the presence of MDLA, a specific inhibitor of AsS. BPP-10c reduced iNOS expression and nitrate levels but decreased NF-kB expression. Furthermore, BPP-10c protected the mitochondrial membrane against oxidation. Overall, we demonstrated for the first time neuroprotective mechanisms of BPPs against oxidative stress, opening new perspectives to the study and application of these peptides for the treatment of neurodegenerative diseases. Copyright © 2018 Elsevier Inc. All rights reserved.
INSPIRE-00258707; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Di Ruscio, F; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Holtrop, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; Mc Skelly, B; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polyakov, I; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-01-01
The first observation of the decay $B^0_s\\rightarrow\\chi_{c1}\\phi$ and a study of $B^0\\rightarrow\\chi_{c1,2}K^{*0}$ decays are presented. The analysis is performed using a dataset, corresponding to an integrated luminosity of 1.0 fb$^{-1}$, collected by the LHCb experiment in pp collisions at a centre-of-mass energy of 7 TeV. The following ratios of branching fractions are measured: \\begin{equation*} \\begin{array}{lll} \\dfrac{\\cal{B}(B^0_s\\rightarrow\\chi_{c1}\\phi)}{\\cal{B}(B^0_s\\rightarrow J/\\psi\\phi)} &=& (18.9 \\pm1.8\\,(stat)\\pm1.3\\,(syst)\\pm0.8\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\dfrac{\\cal{B}(B^0\\rightarrow\\chi_{c1}K^{*0})}{\\cal{B}(B^0\\rightarrow J/\\psi K^{*0})} &=& (19.8 \\pm1.1\\,(stat)\\pm1.2\\,(syst)\\pm0.9\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\dfrac{\\cal{B}(B^0\\rightarrow\\chi_{c2}K^{*0})}{\\cal{B}(B^0\\rightarrow\\chi_{c 1}K^{*0})} &=& (17.1 \\pm5.0\\,(stat)\\pm1.7\\,(syst)\\pm1.1\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\end{array} \\end{equation*} where the third uncertainty is due to the limited knowledge o...
Ikeda, Toshihiko; Aoyama, Shinsuke; Tozuka, Zenzaburo; Nozawa, Kohei; Hamabe, Yoshimi; Matsui, Takao; Kainuma, Michiko; Hasegawa, Setsuo; Maeda, Kazuya; Sugiyama, Yuichi
2013-07-16
Microdose study enables us to understand the pharmacokinetic profiles of drugs in humans prior to the conventional clinical trials. The advantage of microdose study is that the unexpected pharmacological/toxicological effects of drugs caused by drug interactions or genetic polymorphisms of metabolic enzymes/transporters can be avoided due to the limited dose. With a combination use of accelerator mass spectrometry (AMS) and (14)C-labaled compounds, the pharmacokinetics of both parent drug and its metabolites can be sensitively monitored. Thus, to demonstrate the usability of microdose study with AMS for the prediction of the impact of genetic polymorphisms of CYP enzyme on the pharmacokinetics of unchanged drugs and metabolites, we performed microdose pharmacogenetic study using tolbutamide as a CYP2C9 probe drug. A microdose of (14)C-tolbutamide (100 μg) was administered orally to healthy volunteers with the CYP2C9(∗)1/(∗)1 or CYP2C9(∗)1/(∗)3 diplotype. Area under the plasma concentration-time curve for the (14)C-radioactivity, determined by AMS, or that for the parent drug, determined by liquid chromatography/mass spectrometry, was about 1.6 times or 1.7 times greater in the CYP2C9(∗)1/(∗)3 than in the CYP2C9(∗)1/(∗)1 group, which was comparable to the previous reports at therapeutic dose. In the plasma and urine, tolbutamide, carboxytolbutamide, and 4-hydroxytolbutamide were detected and practically no other metabolites could be found in both diplotype groups. The fraction of metabolites in plasma radioactivity was slightly lower in the CYP2C9(∗)1/(∗)3 group. Microdose study can be used for the prediction of the effects of genetic polymorphisms of enzymes on the pharmacokinetics and metabolic profiles of drugs with minimal care of their pharmacological/toxicological effects. Copyright © 2013 Elsevier B.V. All rights reserved.
Dicty_cDB: Contig-U13006-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available A-FP_182294 Lysiphlebus testaceipes adult whol... 34 3.0 2 ( BU896130 ) X036A07 Populus wood cDNA library Populus tremul...1.r GM_WBc Glycine max genomic clone ... 34 2.9 2 ( DN492755 ) X036A07.3pR Populus wood cDNA library Populus tre...... 34 2.9 2 ( DN502768 ) X036A07.5pR Populus wood cDNA library Populus tre... 34 2.9 2 ( EH014215 ) USD..... 34 2.4 2 ( EU795178 ) Uncultured bacterium HF0010_09O16 genomic sequence. 34 2.4 2 ( AC182691 ) Populus tric...itermes flavipes symbiont library ... 36 3.2 2 ( DQ927304 ) Tetrahymena paravorax strain RP m
A Study of B→c$\\bar{c}$γK in the BaBar Experiment
Energy Technology Data Exchange (ETDEWEB)
Fulsom, Brian Gregory [Univ. of British Columbia, Vancouver, BC (Canada)
2009-04-01
The BABAR Collaboration is a high energy physics experiment located at the Stanford Linear Accelerator Center. The primary goal of the experiment is to study charge and parity violation in the B-meson sector, however the copious production of B mesons decaying to other final states allows for a wide-ranging physics program. In particular, one can access the charmonium system via colour-suppressed b → c decays of the type B → c$\\bar{c}$K. This thesis presents a study of B →c$\\bar{c}$γK decays where c$\\bar{c}$ includes J/Ψ and Ψ(2S), and K includes K±, KS0 and K*(892). The particular emphasis is on a search for the radiative decays X(3872) → J/Ψγ and X(3872) → Ψ(2S)γ. The X(3872) state is a recently-discovered resonance of undetermined quark composition, speculatively a conventional charmonium state or exotic four-quark di-meson molecule. This research is also sensitive to the well-known radiative charmonium decays B → χc1,2K, which are used as verification for the analysis technique. This dissertation sets the best B → χc1K branching fraction measurements to date, and sees the first evidence for factorization-suppressed B0 → χc2}K*0 decay at a level of 3.6σ. It also provides evidence for X(3872) → J/Ψγ and X(3872) → Ψ(2S)γ with 3.6σ and 3.3σ significance, respectively. The product of branching fractions β(B± → X(3872)K±) • β(X(3872) → J/Ψγ) = (2.8 ± 0.8(stat.) ± 0.2(syst.)) x 10{sup -6} and β(B{± → X(3872)K±) → β(X(3872) → Ψ(2S)γ) = (9.5 ± 2.7(stat.) ± 0.9(syst.)) x 10-6 are measured. These results improve upon previous X(3872) → J/Ψγ measurements, and represent the first evidence for X(3872) → Ψ(2S)γ.
Lifescience Database Archive (English)
Full Text Available 295 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 62 9e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...one) Synthetic construct Homo sapiens c... 61 2e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic a
MAGE-C2/CT10 protein expression is an independent predictor of recurrence in prostate cancer.
Directory of Open Access Journals (Sweden)
Lotta von Boehmer
Full Text Available The cancer-testis (CT family of antigens is expressed in a variety of malignant neoplasms. In most cases, no CT antigen is found in normal tissues, except in testis, making them ideal targets for cancer immunotherapy. A comprehensive analysis of CT antigen expression has not yet been reported in prostate cancer. MAGE-C2/CT-10 is a novel CT antigen. The objective of this study was to analyze extent and prognostic significance of MAGE-C2/CT10 protein expression in prostate cancer. 348 prostate carcinomas from consecutive radical prostatectomies, 29 castration-refractory prostate cancer, 46 metastases, and 45 benign hyperplasias were immunohistochemically analyzed for MAGE-C2/CT10 expression using tissue microarrays. Nuclear MAGE-C2/CT10 expression was identified in only 3.3% primary prostate carcinomas. MAGE-C2/CT10 protein expression was significantly more frequent in metastatic (16.3% positivity and castration-resistant prostate cancer (17% positivity; p<0.001. Nuclear MAGE-C2/CT10 expression was identified as predictor of biochemical recurrence after radical prostatectomy (p = 0.015, which was independent of preoperative PSA, Gleason score, tumor stage, and surgical margin status in multivariate analysis (p<0.05. MAGE-C2/CT10 expression in prostate cancer correlates with the degree of malignancy and indicates a higher risk for biochemical recurrence after radical prostatectomy. Further, the results suggest MAGE-C2/CT10 as a potential target for adjuvant and palliative immunotherapy in patients with prostate cancer.
International Nuclear Information System (INIS)
Kramer, M.J.; Li, C.P.; Dennis, K.W.; McCallum, R.W.; Sellers, C.H.; Branagan, D.J.; Lewis, L.H.; Wang, J.Y.
1998-01-01
Rapidly solidified samples of Nd 9.5 Fe 84.5 B 6 with and without 3 at.% TiC were prepared by melt spinning and melt extraction and then annealed in vacuum (3x10 -6 Torr) at temperatures from 600 to 750 degree C. For alloys melt spun under similar conditions, the overquenched state was achieved at wheel speeds >10 m/s for the TiC added alloy while >20 m/s was necessary without TiC. The overquenched samples contained a smaller fraction of α-Fe in smaller grains than the undercooled samples where Fe dendrites formed near the free surface during solidification. These Fe dendrites were not removed by annealing. In addition, large orientated 2-14-1 grains nucleated on the Fe dendrites. This combination is detrimental to the magnetic properties. The addition of TiC results in improved control of the microstructure over a larger fraction of the ribbon volume enhancing the magnetic properties. copyright 1998 American Institute of Physics
Recent study for multibaryon states with strangeness in pC interaction at 10 GeV/c
Energy Technology Data Exchange (ETDEWEB)
Aslanyan, P. Zh., E-mail: paslanian@jinr.ru [Joint Institute for Nuclear Research (Russian Federation)
2013-08-15
Strange multibaryon states with {Lambda}-hyperon and K{sub s}{sup 0} -meson subsystems has been studied from 700 000 stereo photographs or 10{sup 6} inelastic interactions which was obtained from expose of 2-m propane bubble chamber (PBC) LHEP, JINR to proton beams at 10 GeV/c. The obtained results from PBC can be divided into three subjects: in-medium effects of hadronic particles; baryon spectroscopy; hyper-nucleus production. At present the experimental situation is confused; so is theory. New accelerator research complexes has unique possibility for high-statistic and 4{pi}-geometry study of exotic states.
Lifescience Database Archive (English)
Full Text Available vs Protein Score E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 111 7e-23 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 109 3e-22 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 108 3e-22 (Q9JLC8) RecName: Full=Sacsin; 108 3e-22 BC142916_1( BC142916 |pid:none) Danio rerio hypothetic
Purine 3':5'-cyclic nucleotides with the nucleobase in a syn orientation: cAMP, cGMP and cIMP.
Řlepokura, Katarzyna Anna
2016-06-01
Purine 3':5'-cyclic nucleotides are very well known for their role as the secondary messengers in hormone action and cellular signal transduction. Nonetheless, their solid-state conformational details still require investigation. Five crystals containing purine 3':5'-cyclic nucleotides have been obtained and structurally characterized, namely adenosine 3':5'-cyclic phosphate dihydrate, C10H12N5O6P·2H2O or cAMP·2H2O, (I), adenosine 3':5'-cyclic phosphate 0.3-hydrate, C10H12N5O6P·0.3H2O or cAMP·0.3H2O, (II), guanosine 3':5'-cyclic phosphate pentahydrate, C10H12N5O7P·5H2O or cGMP·5H2O, (III), sodium guanosine 3':5'-cyclic phosphate tetrahydrate, Na(+)·C10H11N5O7P(-)·4H2O or Na(cGMP)·4H2O, (IV), and sodium inosine 3':5'-cyclic phosphate tetrahydrate, Na(+)·C10H10N4O7P(-)·4H2O or Na(cIMP)·4H2O, (V). Most of the cyclic nucleotide zwitterions/anions [two from four cAMP present in total in (I) and (II), cGMP in (III), cGMP(-) in (IV) and cIMP(-) in (V)] are syn conformers about the N-glycosidic bond, and this nucleobase arrangement is accompanied by Crib-H...Npur hydrogen bonds (rib = ribose and pur = purine). The base orientation is tuned by the ribose pucker. An analysis of data obtained from the Cambridge Structural Database made in the context of syn-anti conformational preferences has revealed that among the syn conformers of various purine nucleotides, cyclic nucleotides and dinucleotides predominate significantly. The interactions stabilizing the syn conformation have been indicated. The inter-nucleotide contacts in (I)-(V) have been systematized in terms of the chemical groups involved. All five structures display three-dimensional hydrogen-bonded networks.
Energy Technology Data Exchange (ETDEWEB)
Ito, H; Sato, T [Japan Atomic Energy Research Inst., Takasaki, Gunma. Takasaki Radiation Chemistry Research Establishment
1973-02-01
The species of microorganisms which can grow on commercial viennas on storage at 10/sup 0/C were Lactobacillus, Streptococcus, and yeasts. When the viennas specially made which did not contain preservatives in it were used for this investigation, growth of microorganisms such as Lactobacillus, Streptococcus, Micrococcus, Bacillus, and yeasts were predominant on storage at 10/sup 0/C, and Pseudomonas and molds some time propagated. When smoked-viennas specially made for the National Project were used for preservation, growth of microorganisms consisted mainly of the species of Lactobacillus, Micrococcus, Acinetobacter, Flavobacterium, Streptococcus, Serratia, Corynebacterium, and yeasts. Irradiation of viennas at 300 and 500 krad reduced the aforementioned flora to the Lactobacillus, Streptococcus, Acinetobacter, and yeasts. The number of microorganisms on the viennas packed with nitrogen gas was not increased for 3 to 7 days by means of 300 krad irradiation, and extended the storage-life 2 to 3 times. When irradiated with a dose of 500 krad, the number of microorganisms was not increased for 9 to 14 days on storage at 10/sup 0/C.
Kleiman, Robin J; Chapin, Douglas S; Christoffersen, Curt; Freeman, Jody; Fonseca, Kari R; Geoghegan, Kieran F; Grimwood, Sarah; Guanowsky, Victor; Hajós, Mihály; Harms, John F; Helal, Christopher J; Hoffmann, William E; Kocan, Geralyn P; Majchrzak, Mark J; McGinnis, Dina; McLean, Stafford; Menniti, Frank S; Nelson, Fredrick; Roof, Robin; Schmidt, Anne W; Seymour, Patricia A; Stephenson, Diane T; Tingley, Francis David; Vanase-Frawley, Michelle; Verhoest, Patrick R; Schmidt, Christopher J
2012-05-01
Cyclic nucleotides are critical regulators of synaptic plasticity and participate in requisite signaling cascades implicated across multiple neurotransmitter systems. Phosphodiesterase 9A (PDE9A) is a high-affinity, cGMP-specific enzyme widely expressed in the rodent central nervous system. In the current study, we observed neuronal staining with antibodies raised against PDE9A protein in human cortex, cerebellum, and subiculum. We have also developed several potent, selective, and brain-penetrant PDE9A inhibitors and used them to probe the function of PDE9A in vivo. Administration of these compounds to animals led to dose-dependent accumulation of cGMP in brain tissue and cerebrospinal fluid, producing a range of biological effects that implied functional significance for PDE9A-regulated cGMP in dopaminergic, cholinergic, and serotonergic neurotransmission and were consistent with the widespread distribution of PDE9A. In vivo effects of PDE9A inhibition included reversal of the respective disruptions of working memory by ketamine, episodic and spatial memory by scopolamine, and auditory gating by amphetamine, as well as potentiation of risperidone-induced improvements in sensorimotor gating and reversal of the stereotypic scratching response to the hallucinogenic 5-hydroxytryptamine 2A agonist mescaline. The results suggested a role for PDE9A in the regulation of monoaminergic circuitry associated with sensory processing and memory. Thus, PDE9A activity regulates neuronal cGMP signaling downstream of multiple neurotransmitter systems, and inhibition of PDE9A may provide therapeutic benefits in psychiatric and neurodegenerative diseases promoted by the dysfunction of these diverse neurotransmitter systems.
48 CFR 252.235-7001 - Indemnification under 10 U.S.C. 2354-cost reimbursement.
2010-10-01
....S.C. 2354-cost reimbursement. 252.235-7001 Section 252.235-7001 Federal Acquisition Regulations.... 2354—cost reimbursement. As prescribed in 235.070-3, use the following clause: Indemnification Under 10 U.S.C. 2354—Cost Reimbursement (DEC 1991) (a) This clause provides for indemnification under 10 U.S...
Synthesis of [21-14C]-fusarin C by enzymic demethylation and remethylation with [14C]-diazomethane
International Nuclear Information System (INIS)
Lu, S.-J.; Li, M.H.
1989-01-01
Fusarin C, a potent mutagen isolated from Fusarium moniliforme culture extracts, has been prepared radiolabeled in two steps by enzymic hydrolysis of the 21-methyl ester group, using phenobarbital induced microsomal preparations, followed by remethylation using [ 14 F]-diazomethane. Yields, based upon fusarin C, were essentially quantitative and approximately 10% of the [ 14 C]-methyl-nitrosourea, converted to diazomethane, reacted to yield [ 14 C]-fusarin C. (author)
Caffeine-11C, ephedrine-11C and methylephedrine-11C: synthesis and distribution in mice
International Nuclear Information System (INIS)
Saji, Hideo; Ido, Tatsuo; Iwata, Ren; Suzuki, Kazutoshi; Tamate, Kazuhiko
1978-01-01
Caffeine, ephedrine and methylephedrine were labeled with carbon-11 by the action of methyliodide- 11 C on theophylline, norephedrine and ephedrine, respectively. Caffeine- 11 C was prepared in 44 min. with a radiochemical yield of 40%, ephedrine- 11 C in 45 min. with a 11% radiochemical yield and methylephedrine- 11 C in 36 min. with a 43% radiochemical yield. When injected in mice intravenously, these products show a high uptake in the liver, the kidney and the blood for caffeine- 11 C and in the liver and the kidney for ephedrine- 11 C and methylephedrine- 11 C. The brain uptake for these products was found to be 2.4 to 3.9% of the injected dose per gram at 5 min. after injection. These studies in mice have demonstrated that these products are potentially useful agents for the dynamic studies of the brain. (auth.)
Atmospheric chemistry of C4F9O(CH2)3OC4F9 and CF3CFHCF2O (CH2)3OCF3CFHCF2
DEFF Research Database (Denmark)
Toft, A. M.; Hurley, M. D.; Wallington, T. J.
2006-01-01
FTIR smog chamber techniques were used to measure k(Cl + CF3CFHCF2O(CH2)(3)OCF2CFHCF3) = (2.97 +/- 0.17) x 10(-12) k(OH + CF3CFHCF2O(CH2)(3)OCF2CFHCF3) = (2.45 +/- 0.14) x 10(-13), k(Cl + C4F9O(CH2)(3)OC4F9) = (1.45 +/- 0.16) x 10(-12), and k(OH + C4F9O(CH2)(3)OC4F9) = (1.44 +/- 0.10) x 10(-13) c...
PIE of nuclear grade SiC/SiC flexural coupons irradiated to 10 dpa at LWR temperature
Energy Technology Data Exchange (ETDEWEB)
Koyanagi, Takaaki [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Katoh, Yutai [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-03-01
Silicon carbide fiber-reinforced SiC matrix (SiC/SiC) composites are being actively investigated for accident-tolerant core structures of light water reactors (LWRs). Owing to the limited number of irradiation studies previously conducted at LWR-coolant temperature, this study examined SiC/SiC composites following neutron irradiation at 230–340°C to 2.0 and 11.8 dpa in the High Flux Isotope Reactor. The investigated materials are chemical vapor infiltrated (CVI) SiC/SiC composites with three different reinforcement fibers. The fiber materials were monolayer pyrolytic carbon (PyC)-coated Hi-NicalonTM Type-S (HNS), TyrannoTM SA3 (SA3), and SCS-UltraTM (SCS) SiC fibers. The irradiation resistance of these composites was investigated based on flexural behavior, dynamic Young’s modulus, swelling, and microstructures. There was no notable mechanical properties degradation of the irradiated HNS and SA3 SiC/SiC composites except for reduction of the Young’s moduli by up to 18%. The microstructural stability of these composites supported the absence of degradation. In addition, no progressive swelling from 2.0 to 11.8 dpa was confirmed for these composites. On the other hand, the SCS composite showed significant mechanical degradation associated with cracking within the fiber. This study determined that SiC/SiC composites with HNS or SA3 SiC/SiC fibers, a PyC interphase, and a CVI SiC matrix retain their properties beyond the lifetime dose for LWR fuel cladding at the relevant temperature.
Directory of Open Access Journals (Sweden)
Seljeflot Ingebjørg
2008-06-01
Full Text Available Abstract Background Warfarin treatment has a narrow therapeutic range, requiring meticulous monitoring and dosage titration. Individual dosage requirement has recently partly been explained by genetic variation of the warfarin metabolizing enzyme CYP2C9 and the Vitamin K-activating enzyme VKORC1. In the WARIS-II study, comparing three different antithrombotic regimens after myocardial infarction, warfarin treatment reduced thrombotic events, but was associated with more frequent bleeding than use of acetylsalisylic acid (ASA alone. Aims The primary aim of the present study was to investigate the relation between genotypes of CYP2C9 and VKORC1 and warfarin maintenance dose in myocardial infarction. The secondary aim was to relate the genotypes to international normalized ratio (INR. Methods Genotyping was performed in 212 myocardial infarction patients from the WARIS-II study by robotic isolation of DNA from EDTA whole blood (MagNa Pure LC before PCR amplification (LightCycler and melting point analysis. Results The 420 C>T substitution of CYP2C9*2, the 1075 A>C substitution of CYP2C9*3 and the 1173 C>T substitution of VKORC1 had minor allele frequencies of, 11.3%, 5.7% and 36.6% respectively. Warfarin weekly dose varied between 17 mg and 74 mg among the patients. INR did not vary between genotypes. Warfarin dosage requirement was significantly associated with CYP2C9 and VKORC1 genotypes, treatment group and age. The VKORC1 genotype contributed 24.5% to the interindividual variation in warfarin dosage, whereas the combined CYP2C9 genotypes were only responsible for 7.2% of the dose variation. Conclusion CYP2C9 and VKORC1 genotype frequencies in myocardial infarction patients appear similar to other patient groups and have similar impact on warfarin maintenance dose.
Autophagy plays an important role in Sunitinib-mediated cell death in H9c2 cardiac muscle cells
International Nuclear Information System (INIS)
Zhao Yuqin; Xue Tao; Yang Xiaochun; Zhu Hong; Ding Xiaofei; Lou Liming; Lu Wei; Yang Bo; He Qiaojun
2010-01-01
Sunitinib, which is a multitargeted tyrosine-kinase inhibitor, exhibits antiangiogenic and antitumor activity, and extends survival of patients with metastatic renal-cell carcinoma (mRCC) and gastrointestinal stromal tumors (GIST). This molecule has also been reported to be associated with cardiotoxicity at a high frequency, but the mechanism is still unknown. In the present study, we observed that Sunitinib showed high anti-proliferative effect on H9c2 cardiac muscle cells measured by PI staining and the MTT assay. But apoptotic markers (PARP cleavage, caspase 3 cleavage and chromatin condensation) were uniformly negative in H9c2 cells after Sunitinib treatment for 48 h, indicating that another cell death pathway may be involved in Sunitinib-induced cardiotoxicity. Here we found Sunitinib dramatically increased autophagic flux in H9c2 cells. Acidic vesicle fluorescence and high expression of LC3-II in H9c2 cells identified autophagy as a Sunitinib-induced process that might be associated with cytotoxicity. Furthermore, knocking down Beclin 1 by RNA-interference to block autophagy in H9c2 cells revealed that the death rate was decreased when treated with Sunitinib in comparison to control cells. These results confirmed that autophagy plays an important role in Sunitinib-mediated H9c2 cells cytotoxicity. Taken together, the data presented here strongly suggest that autophagy is associated with Sunitinib-induced cardiotoxicity, and that inhibition of autophagy constitutes a viable strategy for reducing Sunitinib-induced cardiomyocyte death thereby alleviating Sunitinib cardiotoxicity.
Hot pressing of B4C/SiC composites
International Nuclear Information System (INIS)
Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O.
2005-01-01
B 4 C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B 4 C/SiC composite samples were lower than monolithic B 4 C in all experimental conditions. (authors)
Dicty_cDB: Contig-U05312-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 246 ) PDUts1124F05 Porcine testis cDNA library I Sus sc... 48 0.32 1 ( CT631096 ) Danio rerio EST, clone ZF_mu... 46 1.2 1 ( CV877151 ) PDUts1160G12 Porcine testis cDNA library I Sus sc... 46 1.2 1 ( CT729188 ) Danio rerio EST, clone ZF_mu... 44 4.9 1 ( CV865498 ) PDUts1018G06 Porcine testis cDNA library I Sus sc... 44 4.9 1 ( CT735187 ) Danio rerio EST, clone ZF_mu...774433 ) McClintock41_B07.ab1 Homarus EST library project ... 54 0.005 1 ( AU269391 ) Dictyostelium discoideum vegetati...1 3'. 46 1.2 1 ( CK415565 ) AUF_IpPit_32_p21 Pituitary cDNA library Ictalurus...
Two human homeobox genes, c1 and c8: structure analysis and expression in embryonic development.
Simeone, A; Mavilio, F; Acampora, D; Giampaolo, A; Faiella, A; Zappavigna, V; D'Esposito, M; Pannese, M; Russo, G; Boncinelli, E
1987-07-01
Two human cDNA clones (HHO.c1.95 and HHO.c8.5111) containing a homeobox region have been characterized, and the respective genomic regions have been partially analyzed. Expression of the corresponding genes, termed c1 and c8, was evaluated in different organs and body parts during human embryonic/fetal development. HHO.c1.95 apparently encodes a 217-amino acid protein containing a class I homeodomain that shares 60 out of 61 amino acid residues with the Antennapedia homeodomain of Drosophila melanogaster. HHO.c8.5111 encodes a 153-amino acid protein containing a homeodomain identical to that of the frog AC1 gene. Clones HHO.c1 and HHO.c8 detect by blot-hydridization one and two specific polyadenylylated transcripts, respectively. These are differentially expressed in spinal cord, backbone rudiments, limb buds (or limbs), heart, and skin of human embryos and early fetuses in the 5- to 9-week postfertilization period, thus suggesting that the c1 and c8 genes play a key role in a variety of developmental processes. Together, the results of the embryonic/fetal expression of c1 and c8 and those of two previously analyzed genes (c10 and c13) indicate a coherent pattern of expression of these genes in early human ontogeny.
Two human homeobox genes, c1 and c8: structure analysis and expression in embryonic development
International Nuclear Information System (INIS)
Simeone, A.; Mavilio, F.; Acampora, D.
1987-01-01
Two human cDNA clones (HHO.c1.95 and HHO.c8.5111) containing a homeobox region have been characterized, and the respective genomic regions have been partially analyzed. Expression of the corresponding genes, termed c1 and c8, was evaluated in different organs and body parts during human embryonic/fetal development. HHO.c1.95 apparently encodes a 217-amino acid protein containing a class I homeodomain that shares 60 out of 61 amino acid residues with the Antennapedia homeodomain of Drosophila melanogaster. HHO.c8.5111 encodes a 153-amino acid protein containing a homeodomains identical to that of the frog AC1 gene. Clones HHO.c1 and HHO.c8 detect by blot-hybridization one and two specific polyadenylylated transcripts, respectively. These are differentially expressed in spinal cord, backbone rudiments, limb buds (or limbs), heart, and skin of human embryos and early fetuses in the 5- to 9-week postfertilization period, thus suggesting that the c1 and c8 genes play a key role in a variety of developmental processes. Together, the results of the embryonic/fetal expression of c1 and c8 and those of two previously analyzed genes (c10 and c13) indicate a coherent pattern of expression of these genes in early human ontogeny
C isotope fractionation during heterotrophic activity driven carbonate precipitation
Balci, Nurgul; Demirel, Cansu
2016-04-01
Stable carbon isotopic fractionation during carbonate precipitation induced by environmentally enriched heterotrophic halophilic microorganims was experimentally investigated under various salinity (% 4.5, %8, %15) conditions at 30 °C. Halophilic heterotrophic microorganims were enriched from a hypersaline Lake Acigöl located in SW Turkey (Balci et al.,2015) and later used for the precipitation experiments (solid and liquid medium). The carbonate precipitates had relatively high δ13C values (-4.3 to -16.9 ‰) compared to the δ13C values of the organic compounds that ranged from -27.5 to -25.4 ‰. At salinity of 4.5 % δ13C values of carbonate ranged from -4.9 ‰ to -10.9 ‰ with a 13C-enrichment factor of +20 to +16 ‰ higher than the δ13C values of the associated DOC (-27.5) . At salinity 8 % δ13C values of carbonate ranged from -16.3 ‰ to -11.7 ‰ with a 13C-enrichment factor of+11.3 to+15.9 ‰ higher than the δ13C values of the associated DOC. The respected values for 15 % salinity ranged from -12.3 ‰ to -9.7 ‰ with a 13C-enrichment factor of +15.2 to+16.8 ‰ higher than the δ13C values of the associated DOC. The carbonate precipitates produced in the solid medium are more enriched in 13C relative to liquid culture experiments. These results suggest that the carbon in the solid was derived from both the bacterial oxidation of organic compounds in the medium and from the atmospheric CO2. A solid medium used in the experiments may have suppressed convective and advective mass transport favouring diffusion-controlled system. This determination suggests that the rate and equilibration of CO2 exchange with the atmosphere is the major control on C isotope composition of carbonate minerals precipitated in the experiments. Key words: Lake Acıgöl, halophilic bacteria, carbonate biomineralization, C isotopes References Nurgul Balci, Meryem Menekşe, Nevin Gül Karagüler, M. Şeref Sönmez,Patrick Meister 2015.Reproducing authigenic carbonate
2H isotope effect on 13C chemical shifts of Nitro-Benzo-9-Crown-3
International Nuclear Information System (INIS)
Moghimi, A.; Rastegar, M.; Ghandi, M.; Bijanzadeh, H. R.
2002-01-01
Deuterium substitution on two ortho-substituted-OCH 2 fragments in Nitro-Benzo-9 Crown-3 induces low frequency shifts, positive m ''nΔC j, in all 13 C NMR resonances which is an indication of the increased shielding in this crown ether. The magnitude of these shifts vary from 15 ΔC 7=716 to 54 ΔC 3=15 ppb for C 7 and C 3 carbons directly attached to 2 H, respectively. The influences of concentration and solvent, CDCl 3 CD 3 COCD 3 , and C 6 D 6 , on mn ΔC j values were investigated. The mn ΔC j values depended more on the nature of the solvent than on the concentration. The order of induced isotope shifts is 15 Δ, 51 Δ > 24 Δ, 42 Δ> 34 Δ, 43 Δ > 56 Δ, 65 Δ> 45 Δ, 54 Δ. The isotope shifts observed are suggested to be a sum of contributions from low frequency shift due to inductive-type and negative hyperconjugation perturbations. The C-D bond, as a poorer electron acceptor than a C-H bond induced less positive charge on directly attached oxygens O 1 and O 2. This, in turn, causes shielding of C 1 and C 2 in C1O1CD 2 and C 2 0 2 CD 2 fragments. The difference in 34 ΔC 1 and 43 ΔC 2 values is attributed to the conformational dependence of the negative hyperconjugation. The C 1 and C 2, are in fact, not equally affected by the two CD 2 groups by negative hyperconjugation because of the existence of NO 2 group attached to the benzene ring
Relationship between IL-10 gene -819C/T polymorphism and the ...
African Journals Online (AJOL)
Background: The -819C/T polymorphism in interleukin 10 (IL-10) gene has been reported to be associated with inflammatory bowel disease (IBD) ,but the previous results are conflicting. Materials and methods: The present study aimed at investigating the association between this polymorphism and risk of IBD using a ...
Dicty_cDB: Contig-U04737-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available se I (COI) gen... 44 5.8 1 ( AY225873 ) Lasius austriacus isolate Laus5COI cytoch...rome c o... 44 5.8 1 ( AY225872 ) Lasius austriacus isolate Laus4COI cytochrome c o... 44 5.8 1 ( AY225871 ) Lasius austria...cus isolate Laus3COI cytochrome c o... 44 5.8 1 ( AY225870 ) Lasius austriacus isolate Laus2C...OI cytochrome c o... 44 5.8 1 ( AY225869 ) Lasius austriacus isolate Laus1COI cytochrome c o... 44 5.8 1 ( A...9 ) Prenolepis imparis mitochondrial COI gene for cyt... 44 5.8 1 ( AB371009 ) Lasius austriacus mitochondri
Pantoea vagans strain C9-1 is an effective biological control agent for fire blight of pear and apple. C9-1 carries three circular plasmids: pPag1 (168 kb), pPag2 (166 kb), and pPag3 (530 kb). Of these, pPag3, a member of the large Pantoea plasmid family, was proposed to contribute to epiphytic fitn...
International Nuclear Information System (INIS)
Kaga, Motoaki; Iwata, Tomoyuki; Nakano, Hiromi; Fukuda, Koichiro
2010-01-01
A new quaternary layered oxycarbide, [Al 4.39(5) Si 0.61(5) ] Σ5 [O 1.00(2) C 2.00(2) ] Σ3 C, has been synthesized and characterized by X-ray powder diffraction, transmission electron microscopy and energy dispersive X-ray spectroscopy (EDX). The title compound was found to be hexagonal with space group P6 3 /mmc, Z=2, and unit-cell dimensions a=0.32783(1) nm, c=2.16674(7) nm and V=0.20167(1) nm 3 . The atom ratios Al:Si were determined by EDX, and the initial structural model was derived by the direct methods. The final structural model showed the positional disordering of one of the three types of Al/Si sites. The maximum-entropy methods-based pattern fitting (MPF) method was used to confirm the validity of the split-atom model, in which conventional structure bias caused by assuming intensity partitioning was minimized. The reliability indices calculated from the MPF were R wp =3.73% (S=1.20), R p =2.94%, R B =1.04% and R F =0.81%. The crystal was an inversion twin. Each twin-related individual was isostructural with Al 4 SiC 4 (space group P6 3 mc, Z=2). - Graphical abstract: A new oxycarbide discovered in the Al-Si-O-C system, Al 4 SiC 4 -homeotypic [Al 4.4 Si 0.6 ][O 1.0 C 2.0 ]C. The crystal is an inversion twin, and hence the structure is represented by a split-atom model. The three-dimensional electron density distributions are determined by the maximum-entropy methods-based pattern fitting, being consistent with the disordered structural model.
Effects of micro-water on decomposition of the environment-friendly insulating medium C5F10O
Directory of Open Access Journals (Sweden)
Song Xiao
2017-06-01
Full Text Available SF6 is widely used in all kinds of high-voltage electrical equipment because of its excellent insulation and arc-extinguishing performance. However, this compound leads to serious greenhouse effect, which harms the environment. Many research institutions are now actively in search of SF6 alternative gas. C5F10O has attracted much attention as an alternative gas with low global warming potential (GWP and excellent dielectric strength. In this paper, we analyzed the possible decomposition paths of C5F10O under micro-water environment through density functional theory. We also evaluated the ionization parameters and toxicity of the decomposition products. The results show that OH• and H• produced by H2O exhibited a catalytic effect on the decomposition of C5F10O. CF4, C2F6, C3F6, C3F8, C4F10, C5F12, C6F14, C3F7COH, C3F7OH, CF3COH, C3F7H, and CF3OH were produced in the micro-water environment. Based on molecular configuration calculation, the ionization parameters of these products were inferior to perfluorocarbons, such as C3F8, leading to reduced insulation performance of the system. Moreover, CF2O and HF are hazardous to human health and equipment safety. Results will provide a basis for further study of the insulation characteristic of the C5F10O gas mixture under micro-water condition to guide the formulation of their relevant international standards prior to engineering applications.
Effects of micro-water on decomposition of the environment-friendly insulating medium C5F10O
Xiao, Song; Li, Yi; Zhang, Xiaoxing; Tian, Shuangshuang; Deng, Zaitao; Tang, Ju
2017-06-01
SF6 is widely used in all kinds of high-voltage electrical equipment because of its excellent insulation and arc-extinguishing performance. However, this compound leads to serious greenhouse effect, which harms the environment. Many research institutions are now actively in search of SF6 alternative gas. C5F10O has attracted much attention as an alternative gas with low global warming potential (GWP) and excellent dielectric strength. In this paper, we analyzed the possible decomposition paths of C5F10O under micro-water environment through density functional theory. We also evaluated the ionization parameters and toxicity of the decomposition products. The results show that OH• and H• produced by H2O exhibited a catalytic effect on the decomposition of C5F10O. CF4, C2F6, C3F6, C3F8, C4F10, C5F12, C6F14, C3F7COH, C3F7OH, CF3COH, C3F7H, and CF3OH were produced in the micro-water environment. Based on molecular configuration calculation, the ionization parameters of these products were inferior to perfluorocarbons, such as C3F8, leading to reduced insulation performance of the system. Moreover, CF2O and HF are hazardous to human health and equipment safety. Results will provide a basis for further study of the insulation characteristic of the C5F10O gas mixture under micro-water condition to guide the formulation of their relevant international standards prior to engineering applications.
Gu, Wenpeng; Wang, Xin; Qiu, Haiyan; Cui, Buyun; Zhao, Shiwen; Zheng, Han; Xiao, Yuchun; Liang, Junrong; Duan, Ran; Jing, Huaiqi
2013-12-01
Brucella abortus and Yersinia enterocolitica serotype O:9 serologically cross-react in the immune response with the host; therefore, our aim was to compare the immune responses to these two pathogens. We selected typical B. abortus and Y. enterocolitica O:9 strains to study the cytokine immune response and the histopathological changes in livers and spleens of BALB/c mice. The data showed the cytokine responses to the two strains of pathogens were different, where the average levels of granulocyte-macrophage colony-stimulating factor (GM-CSF), gamma interferon (IFN-γ), interleukin-12 (IL-12), and tumor necrosis factor alpha (TNF-α) were higher with B. abortus infections than with Y. enterocolitica O:9 infections, especially for IFN-γ, while the IL-10 level was lower and the levels of IL-1β, IL-4, IL-5, and IL-6 were similar. The histopathological effects in the livers and spleens of the BALB/c mice with B. abortus and Y. enterocolitica O:9 infections were similar; however, the pathological changes in the liver were greater with B. abortus infections, while damage in the spleen was greater with Y. enterocolitica O:9 infections. These observations show that different cytokine responses and histopathological changes occur with B. abortus and Y. enterocolitica O:9 infections.
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Illustration of the Slope and Intercept Limits for Class II and Class III PM10â2.5 Candidate Equivalent Methods C Figure C-3 to Subpart C of Part... Candidate Methods and Reference Methods Pt. 53, Subpt. C, Fig. C-3 Figure C-3 to Subpart C of Part 53...
Dicty_cDB: Contig-U16395-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available virus 241ext gene for puta... 41 0.060 C72174( C72174 ) D8R protein - variola minor virus (strain Garcia...rio proteasome (prosome, m... 40 0.10 C72175( C72175 ) G1R protein - variola minor virus (strain Garcia-...
Poly[tetraaqua(μ6-9,10-dioxo-9,10-dihydroanthracene-1,4,5,8-tetracarboxylatodimanganese(II
Directory of Open Access Journals (Sweden)
Rui Xu
2012-07-01
Full Text Available The title complex, [Mn2(C18H4O10(H2O4]n, was synthesized from manganese(II chloride tetrahydrate and 9,10-dioxo-9,10-dihydroanthracene-1,4,5,8-tetracarboxylic acid (H4AQTC in water. The anthraquinone unit is located about a crystallographic center of inversion. Each asymmetric unit therefore contains one MnII atom, two water ligands and one half AQTC4− anion. The MnII atom is coordinated in a distorted octahedral geometry by four O atoms from three AQTC4− ligands and two water O atoms. Two of the carboxylate groups coordinate one MnII atom in a chelating mode, whereas the others each coordinate two MnII atoms. Each AQTC4− tetra-anion therefore coordinates six different MnII ions and, as a result, a three-dimensional coordination polymer is formed. O—H...O hydrogen bonds, some of them bifurcated, between water ligands and neighboring water or anthraquinone ligands are observed in the crystal structure.
Mitochondrial dysfunction in H9c2 cells during ischemia and amelioration with Tribulus terrestris L.
Reshma, P L; Sainu, Neethu S; Mathew, Anil K; Raghu, K G
2016-05-01
The present study investigates the protective effect of partially characterized Tribulus terrestris L. fruit methanol extract against mitochondrial dysfunction in cell based (H9c2) myocardial ischemia model. To induce ischemia, the cells were maintained in an ischemic buffer (composition in mM -137 NaCl, 12 KCl, 0.5 MgCl2, 0.9 CaCl2, 20 HEPES, 20 2-deoxy-d-glucose, pH-6.2) at 37°C with 0.1% O2, 5% CO2, and 95% N2 in a hypoxia incubator for 1h. Cells were pretreated with various concentrations of T. terrestris L. fruit methanol extract (10 and 25μg/ml) and Cyclosporin A (1μM) for 24h prior to the induction of ischemia. Different parameters like lactate dehydrogenase release, total antioxidant capacity, glutathione content and antioxidant enzymes were investigated. Studies were conducted on mitochondria by analyzing alterations in mitochondrial membrane potential, integrity, and dynamics (fission and fusion proteins - Mfn1, Mfn2, OPA1, Drp1 and Fis1). Various biochemical processes in mitochondria like activity of electron transport chain (ETC) complexes, oxygen consumption and ATP production was measured. Ischemia for 1h caused a significant (p≤0.05) increase in LDH leakage, decrease in antioxidant activity and caused mitochondrial dysfunction. T. terrestris L. fruit methanol extract pretreatment was found effective in safeguarding mitochondria via its antioxidant potential, mediated through various bioactives. HPLC of T. terrestris L. fruit methanol extract revealed the presence of ferulic acid, phloridzin and diosgenin. T. terrestris L. fruit ameliorate ischemic insult in H9c2 cells by safeguarding mitochondrial function. This validates the use of T. terrestris L. against heart disorders. Copyright © 2016 Elsevier Inc. All rights reserved.
Kinetics of reaction of 1,10- decanedioland dimeric fatty acid C36
International Nuclear Information System (INIS)
Falah, A.
2013-01-01
Kinetic studies were carried out on the reaction between 1,10- Decanedioland dimeric fatty acid C 3 6 in melt phase. The reaction was performed at 140, 150, 160, 170, and 185 o C and followed by determining the acid value of the product. The polyesterfication reaction was found to be of overall second order with an activation energy of 39,91kj/mol up to (50, 44, 55,42, 63)% conversion at (140, 150, 160, 170, 185) o C and overall third order with an activation energy of 71.17 k j/ mol above (50, 44, 55, 42, 63)% conversion at (140, 150, 160, 170, 185) o C. The Degree of Polymerization, number average molecular weight and weight average molecular weight have been calculated during different times, the relationships between Degree of Polymerization, number average molecular weight, weight average molecular weight and the times is linear until, (50, 44, 55, 42, 63)%conversion at (140, 150, 160, 170, 185) o C. (author)
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSK476 (Link to dictyBase) - - - Contig-U07114-1 VSK476Z (Link... to Original site) - - VSK476Z 291 - - - - Show VSK476 Library VS (Link to library) Clone ID VSK476 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07114-1 Original site URL http://dict...239C9 in linkage group 3. 46 0.24 1 BM495069 |BM495069.1 IpCGBr1_4_C04_22 Ictalur...us punctatus Brain1 primary library Ictalurus punctatus cDNA clone IpCGBr1_4_C04_22_07Mar00_034 3', mRNA seq
C2-C10 hydrocarbon emissions from a boreal wetland and forest floor
Directory of Open Access Journals (Sweden)
H. Hellén
2006-01-01
Full Text Available Emissions of various C2-C10 hydrocarbons (VOCs and halogenated hydrocarbons (VHOCs from a boreal wetland and a Scots pine forest floor in south-western Finland were measured by the static chamber technique. Isoprene was the main non-methane hydrocarbon emitted by the wetland, but small emissions of ethene, propane, propene, 1-butene, 2-methylpropene, butane, pentane and hexane were also detected. The isoprene emission from the wetland was observed to follow the commonly-used isoprene emission algorithm. The mean emission potential of isoprene was 224 µg m-2 h-1 for the whole season. This is lower than the emission potentials published earlier; that is probably at least partly due to the cold and cloudy weather during the measurements. No emissions were detected of monoterpenes or halogenated hydrocarbons from the wetland. The highest hydrocarbon emissions from the Scots pine forest floor were measured in spring and autumn. However, only a few measurements were conducted during summer. The main compounds emitted were monoterpenes. Isoprene emissions were negligible. The total monoterpene emission rates varied from zero to 373 µg m-2 h-1. The results indicated that decaying plant litter may be the source for these emissions. Small emissions of chloroform (100-800 ng m-2 h-1, ethene, propane, propene, 2-methylpropene, cis-2-butene, pentane, hexane and heptane were detected. Comparison with Scots pine emissions showed that the forest floor may be an important monoterpene source, especially in spring.
Dicty_cDB: Contig-U15849-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s8-b09 She01 Saruma henryi cDNA clone sh... 44 6e-06 4 ( FL643435 ) TS24-B1 Reticulitermes flavipes symbiont library...m root (H) Panicum... 34 0.21 2 ( BU887392 ) R058G12 Populus root cDNA library Populus tremul...rium in... 44 0.41 2 ( ED537812 ) KBrB131C18F KBrB, Brassica rapa BamHI BAC library... 44 0.42 2 ( CJ458666 ) Macaca fascicul... Pop... 44 0.001 2 ( BU886436 ) R045D12 Populus root cDNA library Populus tremula... 44 0.001 2 ( CV131402 ) L2P05c10 Popul...us flower cDNA library Populus tric... 44 3e-10 4 ( DN774213 )
DEFF Research Database (Denmark)
Kaur-Knudsen, D.; Bojesen, S.E.; Nordestgaard, Børge
2009-01-01
% power. In conclusion, in three independent studies totaling more than 52 000 individuals, we found no association between CYP2C9*2 and CYP2C9*3 polymorphisms and risk of subclinical atherosclerosis, ischemic vascular disease or death after ischemic heart disease. The Pharmacogenomics Journal (2009) 9...
Association SOD2 Polymorphism(-9C/T and Senile Cataract
Directory of Open Access Journals (Sweden)
A.R. Nakhaee
2017-01-01
Full Text Available Introduction: One of the most common causes of blindness around the world is cataract, which is a multifactorial eye disease and a major cause the loss lens transparency in the aging population. Oxidative stress is a major factor that often leads to cataract formation. Oxidative stress is defined as a disturbance in the balance of reactive oxygen species (ROS production and antioxidant defenses, including enzymatic and non-enzymatic systems. One of the defense systems against free radicals is superoxide dismutase II (Mn SOD enzyme. SOD enzyme catalyses the dismutation of superoxide anion to O2 and H2O2. Several polymorphism have been found associated with SOD2 gene. Present study has been done to evaluaet effects of genetic polymorphism, including SOD2 C/T polymorphism in the -9 position in senile cataract patiens and normal individuals. Material and methods: in this case- control study, there are 120 patients with senile cataract and 104 healthy people. We collected 2ml of whole blood in tubes containing EDTA, and then DNA extraction was performed. Polymorphisms were detected by PCR–RFLP technique. Findings: The distribution of CC, CT, TT genotypes of SOD2 gene were 28.3%, 43.3% and 28.3% in the patient group and 24%, 48.1% and 27.9% in the healthy group, respectively. Conclusion: No significant difference in the distribution SOD2 C/T polymorphism was observed between cases and controls.
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. C P Gopalakrishnan. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 6 June 2004 pp 74-85 Classroom. The Real Effects of Pseudo Forces · P Chaitanya Das G Srinivasa Murthy C P Gopalakrishnan P C Deshmukh · More Details ...
Dicty_cDB: Contig-U16598-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available m_3 Zea mays cDNA, mRNA se... 48 3e-10 4 ( FG288275 ) 1108793266181 New World Scr...se... 42 2e-05 3 ( GE557956 ) CCHT16070.b1_L10.ab1 CCHT Niger Seed Guizotia aby... 44 3e-05 3 ( FG284795 ) 1108770681787 New World... Screwworm Egg 9261 ESTs C... 46 5e-05 5 ( FG291287 ) 1108793338890 New World... Screwworm Egg 9261 ESTs C... 46 6e-05 5 ( FG283860 ) 1108770639778 New World Screwworm Eg...g 9261 ESTs C... 46 6e-05 5 ( FG290818 ) 1108793326675 New World Screwworm Egg 9261 ESTs C... 46 7e-05 5 ( F
Efficient detection of dangling pointer error for C/C++ programs
Zhang, Wenzhe
2017-08-01
Dangling pointer error is pervasive in C/C++ programs and it is very hard to detect. This paper introduces an efficient detector to detect dangling pointer error in C/C++ programs. By selectively leave some memory accesses unmonitored, our method could reduce the memory monitoring overhead and thus achieves better performance over previous methods. Experiments show that our method could achieve an average speed up of 9% over previous compiler instrumentation based method and more than 50% over previous page protection based method.
Dicty_cDB: Contig-U04229-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 ) HAE00002983 Home-made, regular (lib1_ha) Histiona... 44 0.001 2 ( CK888692 ) SGP160684 Atlantic salmon Liver cDNA library...2 ( DE224908 ) Trifolium pratense DNA, clone:RCG16896. 42 4e-04 2 ( CK888010 ) SGP149211 Atlantic salmon Liver cDNA library...A for TCP1 protein. 46 6e-04 2 ( CK887535 ) SGP164401 Atlantic salmon Kidney cDNA library Sal... 44 6e-04 2 ...mo salar cDNA, mRNA sequence. 44 0.001 2 ( CK889382 ) SGP161400 Atlantic salmon Liver cDNA library Salm... 4... salmon Liver cDNA library Salm... 44 0.001 2 ( CK888710 ) SGP160704 Atlantic salmon Liver cDNA library
Poly-dipeptides encoded by the C9ORF72 repeats block global protein translation.
Kanekura, Kohsuke; Yagi, Takuya; Cammack, Alexander J; Mahadevan, Jana; Kuroda, Masahiko; Harms, Matthew B; Miller, Timothy M; Urano, Fumihiko
2016-05-01
The expansion of the GGGGCC hexanucleotide repeat in the non-coding region of the Chromosome 9 open-reading frame 72 (C9orf72) gene is the most common genetic cause of frontotemporal dementia (FTD) and amyotrophic lateral sclerosis (ALS). This genetic alteration leads to the accumulation of five types of poly-dipeptides translated from the GGGGCC hexanucleotide repeat. Among these, poly-proline-arginine (poly-PR) and poly-glycine-arginine (poly-GR) peptides are known to be neurotoxic. However, the mechanisms of neurotoxicity associated with these poly-dipeptides are not clear. A proteomics approach identified a number of interacting proteins with poly-PR peptide, including mRNA-binding proteins, ribosomal proteins, translation initiation factors and translation elongation factors. Immunostaining of brain sections from patients with C9orf72 ALS showed that poly-GR was colocalized with a mRNA-binding protein, hnRNPA1. In vitro translation assays showed that poly-PR and poly-GR peptides made insoluble complexes with mRNA, restrained the access of translation factors to mRNA, and blocked protein translation. Our results demonstrate that impaired protein translation mediated by poly-PR and poly-GR peptides plays a role in neurotoxicity and reveal that the pathways altered by the poly-dipeptides-mRNA complexes are potential therapeutic targets for treatment of C9orf72 FTD/ALS. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
International Nuclear Information System (INIS)
Slovinskij, B.; Mulas, Eh.
1981-01-01
The energy spectra of protons (ESP) emitted in reactions p+Xe→kp+... at 2.34 GeV/c (k=1-9) and π - +Xe→kp+... at 9 GeV/c (k=1-17) have been studied. An evidence has been obtained for a unified description of those spectra by an exponential dependence of the invariant cross sections upon the kinetic energy independently of the proton emission angle. It is found that the ESP temperature becomes independent of the proton emission frequency when the energy of the interaction induced hadron is greater than approximately 3 GeV [ru
Oliveira Santos, Miguel; Caldeira, Inês; Gromicho, Marta; Pronto-Laborinho, Ana; de Carvalho, Mamede
2017-10-01
A hexanucleotide repeat expansion in the C9orf72 gene is associated with amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration. It has been described before four patients with multiple sclerosis (MS) and C9orf72-ALS. However, C9orf72 positivity is not associated with increased risk of MS. Inflammatory pathways related to NF-κB have been linked to ALS and MS, and appear to be important in C9orf72-ALS patients. A 42-year-old woman presented with progressive bulbar symptoms for 9 months. Neurological examination disclosed spastic dysarthria, atrophic tongue with fasciculations, brisk jaw and limb tendon reflexes, and bilateral Hoffman sign. Electrophysiological assessment confirmed ALS. Brain MRI revealed multiple and bilateral juxtacortical and periventricular inflammatory changes, some with gadolinium-enhancement, configuring a probable MS-like pattern. CSF evaluation was unremarkable, with no oligoclonal bands. Visual and somatosensory evoked potentials were normal. Follow-up brain MRI 6 months later showed two new lesions in two relatively characteristic locations of MS, with no gadolinium-enhancement. Genetic screening revealed a C9orf72 expansion. As patient had no clinical manifestation of MS, a diagnosis of radiologically isolated syndrome was considered. We speculate that these demyelinating lesions might facilitate expressivity of C9orf72 expansion, through NF-κB activation. This plausible association may lead to the identification of a therapeutic target in this subgroup of C9orf72-ALS patients. Copyright © 2017 Elsevier B.V. All rights reserved.
Insulin and C peptide response, and antibody levels in hepatitis C related chronic liver disease
International Nuclear Information System (INIS)
Abbas, Z.; Tariq, N.; Iqbal, M.; Shah, M.A.
2002-01-01
Objective: Patients with cirrhosis due to hepatitis C (HC) have an increased prevalence of diabetes mellitus. The pathogenic mechanism by which HC predisposes to DM is not clear. The objective of this study was to determine the insulin and C-peptide response to 75 gram oral glucose load and measure anti phospholipid antibody levels in patients with chronic liver disease due to HC. Design: a prospective study. Place and duration of study: This study was conducted at the department of medicine, Jinnah postgraduate medical centre over period of three months. Subjects and methods: An analytical case control study was carried out on 37 patients (m-18,f=19); none of these patients had received interferon. They were divided into four groups: (a) HC cirrhosis with DM (n=9 ), (b) HC cirrhosis without DM (n=11), (c) hepatitis B (HB) cirrhosis without DM (n=7), (d) chronic hepatitis C without DM (n=10). Group C and D were taken as controls. Fasting blood samples were taken and repeated after 2 hours of 75 gram oral glucose load (2 h PG). Result: mean ages of group A,B,C and D were (yr +- SD) 51.3 +- 7.6,48.9 +- 2.4, 33.7 +-10.8 and 31.7 +- 8.8 respectively. There was no statistically significant difference in the age, Pugh score and body mass index of HC cirrhotic patients with and without DM. Patients of group A had higher fasting and 2 h PG glucose levels (P=0.003 and 0.000) and higher fasting insulin level (p=0.045). However, increments in insulin and c peptide levels 2 h PG were much less (p=0.048 and 0.003). HB cirrhotics without diabetes (group C behaved just like HC cirrhotic without diabetes (group B). Patients of group D had normal glucose tolerance and insulin and C peptide levels. All four groups had normal anti phospholipid antibody levels. Conclusion: Patients with cirrhosis due to HC nd HB show evidence of glucose intolerance in spite of hyperinsulinaemia probably due to insulin resistance. HC cirrhotics with diabetes have fasting hyperglycemia in spite of
Directory of Open Access Journals (Sweden)
Omid Yaghobizadeh
2017-03-01
Full Text Available The material Cf-C-SiC-Ti3SiC2 is promising for high temperature application. Due to the laminated structure and special properties, the Ti3SiC2 is one of the best reinforcements for Cf-C-SiC composites. In this paper, Cf-C-SiC-Ti3SiC2 composites were fabricated by liquid silicon infiltration (LSI method; the effect of the TiC amount on the various composites properties were studied. For samples with 0, 50 and 90 vol.% of TiC, the results show that bending strength are 168, 190, and 181 MPa; porosities are 3.2, 4.7, and 9%; the fracture toughness are 6.1, 8.9, and 7.8 MPa∙m1/2; interlaminar shear strength are 27, 36, and 30 MPa; the amount of the MAX phase are 0, 8.5, and 5.6 vol.%, respectively. These results show that amount of TiC is not the main effective parameter in synthesis of Ti3SiC2. The existence of carbon promotes the synthesis of Ti3SiC2 indicating that only sufficient carbon content can lead to the appearance of Ti3SiC2 in the LSI process.
Energy Technology Data Exchange (ETDEWEB)
Serne, R. Jeffrey; Bjornstad, Bruce N.; Horton, Duane G.; Lanigan, David C.; Lindenmeier, Clark W.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Orr, Robert D.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.
2008-09-11
This report was revised in September 2008 to remove acid-extractable sodium data from Tables 4.8, 4.28,4.43, and 4.59. The sodium data was removed due to potential contamination introduced during the acid extraction process. The rest of the text remains unchanged from the original report issued in April 2004. The overall goal of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., is to define risks from past and future single-shell tank farm activities at Hanford. To meet this goal, CH2M HILL Hanford Group, Inc. tasked scientists from Pacific Northwest National Laboratory to perform detailed analyses on vadose zone sediments from within Waste Management Area (WMA) T-TX-TY. This report is the first of two reports written to present the results of these analyses. Specifically, this report contains all the geologic, geochemical, and selected physical characterization data collected on vadose zone sediment recovered from boreholes C3830, C3831, and C3832 in the TX Tank Farm, and from borehole 299-W-10-27 installed northeast of the TY Tank Farm.
Activation of c-MET induces a stem-like phenotype in human prostate cancer.
Directory of Open Access Journals (Sweden)
Geert J L H van Leenders
Full Text Available Prostate cancer consists of secretory cells and a population of immature cells. The function of immature cells and their mutual relation with secretory cells are still poorly understood. Immature cells either have a hierarchical relation to secretory cells (stem cell model or represent an inducible population emerging upon appropriate stimulation of differentiated cells. Hepatocyte Growth Factor (HGF receptor c-MET is specifically expressed in immature prostate cells. Our objective is to determine the role of immature cells in prostate cancer by analysis of the HGF/c-MET pathway.Gene-expression profiling of DU145 prostate cancer cells stimulated with HGF revealed induction of a molecular signature associated with stem cells, characterized by up-regulation of CD49b, CD49f, CD44 and SOX9, and down-regulation of CD24 ('stem-like signature'. We confirmed the acquisition of a stem-like phenotype by quantitative PCR, FACS analysis and Western blotting. Further, HGF led to activation of the stem cell related Notch pathway by up-regulation of its ligands Jagged-1 and Delta-like 4. Small molecules SU11274 and PHA665752 targeting c-MET activity were both able to block the molecular and biologic effects of HGF. Knock-down of c-MET by shRNA infection resulted in significant reduction and delay of orthotopic tumour-formation in male NMRI mice. Immunohistochemical analysis in prostatectomies revealed significant enrichment of c-MET positive cells at the invasive front, and demonstrated co-expression of c-MET with stem-like markers CD49b and CD49f.In conclusion, activation of c-MET in prostate cancer cells induced a stem-like phenotype, indicating a dynamic relation between differentiated and stem-like cells in this malignancy. Its mediation of efficient tumour-formation in vivo and predominant receptor expression at the invasive front implicate that c-MET regulates tumour infiltration in surrounding tissues putatively by acquisition of a stem-like phenotype.
Nanosized f.c.c. thallium inclusions in aluminium
International Nuclear Information System (INIS)
Johnson, E.; Johansen, A.; Thoft, N.B.; Andersen, H.H.; Sarholt-Kristensen, L.
1993-01-01
Ion implantation of pure aluminium with thallium induces the formation of nanosized crystalline inclusions of thallium with a f.c.c. structure. The size of the inclusions depends on the implantation conditions and subsequent annealing treatments and is typically in the range from 1 to 10 nm. The inclusions are aligned topotactically with the aluminium matrix with a cube-cube orientation relationship and they have a truncated octahedral shape bounded by {111} and {001} planes. The lattice parameter of the f.c.c. thallium inclusions is 0.484 ± 0.002 nm, which is slightly but significantly larger than in the high-pressure f.c.c. thallium phase known to be stable above 3.8 GPa. (Author)
Lifescience Database Archive (English)
Full Text Available one UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.4 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent Washington ...72513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl... Populus trichocarpa clone Pop1-11B14, complete sequence. 38 0.30 5 CX072513 |CX0
Lifescience Database Archive (English)
Full Text Available ne UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 0.96 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent Washington ...2513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA clo...e RP86-222L20, WORKING DRAFT SEQUENCE, 2 ordered pieces. 38 0.91 3 CX072513 |CX07
Levine, Timothy P; Daniels, Rachel D; Gatta, Alberto T; Wong, Louise H; Hayes, Matthew J
2013-02-15
Fronto-temporal dementia (FTD) and amyotrophic lateral sclerosis (ALS, also called motor neuron disease, MND) are severe neurodegenerative diseases that show considerable overlap at the clinical and cellular level. The most common single mutation in families with FTD or ALS has recently been mapped to a non-coding repeat expansion in the uncharacterized gene C9ORF72. Although a plausible mechanism for disease is that aberrant C9ORF72 mRNA poisons splicing, it is important to determine the cellular function of C9ORF72, about which nothing is known. Sensitive homology searches showed that C9ORF72 is a full-length distant homologue of proteins related to Differentially Expressed in Normal and Neoplasia (DENN), which is a GDP/GTP exchange factor (GEF) that activates Rab-GTPases. Our results suggest that C9ORF72 is likely to regulate membrane traffic in conjunction with Rab-GTPase switches, and we propose to name the gene and its product DENN-like 72 (DENNL72).
MicroRNA-145 Aggravates Hypoxia-Induced Injury by Targeting Rac1 in H9c2 Cells.
Wang, Ximing; Zhang, Yanxia; Wang, Hongshan; Zhao, Genshang; Fa, Xianen
2017-01-01
Myocardial infarction (MI) is a leading cause of morbidity and mortality. Here, we sought to explore the potential role and underlying mechanism of miR-145 in MI. H9c2 cells were cultured under persistent hypoxia to simulate MI. The hypoxia-induced injury was assessed on the basis of cell viability, migration, invasion and apoptosis. The expression of miR-145 was evaluated by qRT-PCR and the influence of aberrantly expressed miR-145 on H9c2 cells under hypoxia was also estimated. Utilizing bioinformatics methods, the target genes of miR-145 were verified by luciferase reporter assay. Then, effects of abnormally expressed target gene on miR-145 silenced H9c2 cells were assessed. Finally, the phosphorylation levels of key kinases in the phosphatidylinositol-3-kinase (PI3K)/AKT and the mitogen-activated protein kinase (MAPK)/extracellular signal-regulated kinase (ERK) pathways were detected by Western blot analysis. Hypoxia remarkably lowered viability, migration and invasion but promoted cell apoptosis. Meantime, the miR-145 level was up-regulated in H9c2 cells under hypoxia. Following experiments suggested that hypoxia-induced injury was exacerbated by miR-145 overexpression while was alleviated by miR-145 silence. Rac1 was predicted and further validated to be a target gene of miR-145. The influence of miR-145 silencing on H9c2 cells under hypoxia could be reversed by down-regulation of Rac1. Additionally, the phosphorylation levels of PI3K, AKT, MAPK and ERK were all elevated in miR-145 silenced cells and these alterations were reversed by down-regulation of Rac1. miR-145 silencing could protect H9c2 cells against hypoxia-induced injury by targeting Rac1, in which PI3K/AKT and MAPK/ERK pathways might be involved. © 2017 The Author(s). Published by S. Karger AG, Basel.
KEPLER-10 c: A 2.2 EARTH RADIUS TRANSITING PLANET IN A MULTIPLE SYSTEM
International Nuclear Information System (INIS)
Fressin, Francois; Torres, Guillermo; Desert, Jean-Michel; Charbonneau, David; Holman, Matthew J.; Batalha, Natalie M.; Fortney, Jonathan J.; Fabrycky, Daniel C.; Rowe, Jason F.; Allen, Christopher; Borucki, William J.; Bryson, Stephen T.; Henze, Christopher E.; Brown, Timothy M.; Ciardi, David R.; Cochran, William D.; Deming, Drake; Dunham, Edward W.; Gautier III, Thomas N.; Gilliland, Ronald L.
2011-01-01
The Kepler mission has recently announced the discovery of Kepler-10 b, the smallest exoplanet discovered to date and the first rocky planet found by the spacecraft. A second, 45 day period transit-like signal present in the photometry from the first eight months of data could not be confirmed as being caused by a planet at the time of that announcement. Here we apply the light curve modeling technique known as BLENDER to explore the possibility that the signal might be due to an astrophysical false positive (blend). To aid in this analysis we report the observation of two transits with the Spitzer Space Telescope at 4.5 μm. When combined, they yield a transit depth of 344 ± 85 ppm that is consistent with the depth in the Kepler passband (376 ± 9 ppm, ignoring limb darkening), which rules out blends with an eclipsing binary of a significantly different color than the target. Using these observations along with other constraints from high-resolution imaging and spectroscopy, we are able to exclude the vast majority of possible false positives. We assess the likelihood of the remaining blends, and arrive conservatively at a false alarm rate of 1.6 x 10 -5 that is small enough to validate the candidate as a planet (designated Kepler-10 c) with a very high level of confidence. The radius of this object is measured to be R p = 2.227 +0.052 -0.057 R + (in which the error includes the uncertainty in the stellar properties), but currently available radial-velocity measurements only place an upper limit on its mass of about 20 M + . Kepler-10 c represents another example (with Kepler-9 d and Kepler-11 g) of statistical 'validation' of a transiting exoplanet, as opposed to the usual 'confirmation' that can take place when the Doppler signal is detected or transit timing variations are measured. It is anticipated that many of Kepler's smaller candidates will receive a similar treatment since dynamical confirmation may be difficult or impractical with the sensitivity of
Suicide Risk Assessment in Adolescents - C-SSRS, K10, and READ
DEFF Research Database (Denmark)
Jakobsen, Ida Skytte; Larsen, Kim Juul; Horwood, John L
2017-01-01
BACKGROUND: Assessment and screening are often the first step in planning interventions to help adolescents at risk of suicide. Causes of suicidal thoughts and behavior are multifaceted and it is important for clinical work that assessment reflects this complexity. AIMS: To investigate whether...... a general psychological Resilience Scale for Adolescents (READ) is associated with a validated suicide rating scale (C-SSRS). METHOD: An observational study of self-reported suicidality (C-SSRS), psychological distress (K10), and resiliency (READ) in three adolescent samples: suicide clinic (N = 147...... was significantly lower in the suicide clinic sample. READ was predictive of levels of suicidality within all samples independently of general psychological distress (K10). LIMITATIONS: The study did not examine other early childhood factors that may contribute to individual resiliency or suicidality. CONCLUSION...
Koutsis, Georgios; Karadima, Georgia; Kartanou, Chrisoula; Kladi, Athina; Panas, Marios
2015-01-01
An expanded hexanucleotide repeat in C9ORF72 has been identified as the most common genetic cause of amyotrophic lateral sclerosis and/or frontotemporal dementia in many populations, including the Greek. Recently, C9ORF72 expansions were reported as the most common genetic cause of Huntington disease (HD) phenocopies in a UK population. In the present study, we screened a selected cohort of 40 Greek patients with HD phenocopies for C9ORF72 hexanucleotide repeat expansions using repeat-primed polymerase chain reaction. We identified 2 patients (5%) with pathologic expansions. The first patient had chorea, behavioral-psychiatric disturbance, cognitive impairment, and a positive family history, fulfilling the strictest criteria for HD phenocopy. The second patient was sporadic and had parkinsonism, behavioral-psychiatric disturbance, and cognitive impairment, corresponding to a broader definition of HD phenocopy. These findings identify C9ORF72 expansions as a frequent cause of HD phenocopies in the Greek population, confirming recent findings in other populations and supporting proposed diagnostic testing for C9ORF72 expansions in patients with HD-like syndromes. Copyright © 2015 Elsevier Inc. All rights reserved.
Occurrence of C35-C45 polyprenols in filamentous and unicellular cyanobacteria
Bauersachs, T.; Schouten, S.; Compaoré, J.; Stal, L.J.; Sinninghe Damsté, J.S.
2010-01-01
Polyprenols, regular (head-to-tail) isoprenoid alcohols with 7-9 prenyl units, were tentatively identified in several cultivated cyanobacteria Heptaprenol (C35), octaprenol (C40) and a suite of nonaprenols (C45) were present in unicellular and filamentous non-heterocystous cyanobacteria, while they
Mono- and polyadducts of C60 with anthracenes by Diels-Alder-reactions
International Nuclear Information System (INIS)
Duarte-Ruiz, A.
2000-09-01
This work describes the synthesis and characterization of seven new mono-adducts of 9-methylanthracene, 9,10-dimethylanthracene, 9-bromoanthracene. 2,3,6,7-tetramethylanthracene, 1-methylanthracene, 2,6-di-tert-butylanthracen, as well as 2-methylanthracene to fullerene C60 in solution at r.t. by means of [4+2] Diels-Alder reactions. It could be shown that the mono-adducts with 9-methylanthracene, 9,10-dimethylanthracene, and 1-methylanthracene form the corresponding antipodal bis-adduct 'trans-1' on heating the solid to 180 o C. Furthermore the functionalization of fullerene C60 anthracene mono-adduct (C60C14H10) with anthracene through [4+2] Diels-Alder reactions was investigated which made it possible to separate and to characterize the five possible bis-adducts ('trans-1', 'trans-2', 'trans-3', 'trans-4', and 'e') that can form when the second anthracene adds either 'trans' to the opposite hemisphere (compared to the first addition of anthracene) or to an equatorial position. An exact identification of the bis-adducts 'trans-2' and 'trans-4' could only be acquired with spectroscopic methods, fortunately the bis-adducts 'trans-4', 'trans-3', and 'e' could also be examined by x-ray, thus all five could be fully characterized. No bis-adducts on the same hemisphere ('cis') were found. UV/VIS-spectra of the bis-adducts opened up the possibility to identify other [4+2] Diels-Alder products in the future. It has been noticed that the eluation sequence of the bis-adducts ('trans-1' before 'trans-2' before 'trans-4' before 'trans-3' before 'e') doesn't strictly correlate with the dipole moments. Furthermore six new tris-adducts ('t4t4t2', 't3t3t3', 't3t3t4', 'et3t2', 'et3t4', and 'eee') and one tetra-adduct ('eeet3') were separated and characterized. The tris-adduct 't3t3t3' was additionally characterized by x-ray which showed that the crystal contains only one enatiomer. All bis- and tris-adducts form the antipodal bis-adduct 'trans-1' on heating to 180 o C for 10 min
Lattante, Serena; Le Ber, Isabelle; Galimberti, Daniela; Serpente, Maria; Rivaud-Péchoux, Sophie; Camuzat, Agnès; Clot, Fabienne; Fenoglio, Chiara; Scarpini, Elio; Brice, Alexis; Kabashi, Edor
2014-11-01
TMEM106B was identified as a risk factor for frontotemporal lobar degeneration (FTD) with TAR DNA-binding protein 43 kDa inclusions. It has been reported that variants in this gene are genetic modifiers of the disease and that this association is stronger in patients carrying a GRN mutation or a pathogenic expansion in chromosome 9 open reading frame 72 (C9orf72) gene. Here, we investigated the contribution of TMEM106B polymorphisms in cohorts of FTD and FTD with amyotrophic lateral sclerosis patients from France and Italy. Patients carrying the C9orf72 expansion (n = 145) and patients with GRN mutations (n = 76) were compared with a group of FTD patients (n = 384) negative for mutations and to a group of healthy controls (n = 552). In our cohorts, the presence of the C9orf72 expansion did not correlate with TMEM106B genotypes but the association was very strong in individuals with pathogenic GRN mutations (p = 9.54 × 10(-6)). Our data suggest that TMEM106B genotypes differ in FTD patient cohorts and strengthen the protective role of TMEM106B in GRN carriers. Further studies are needed to determine whether TMEM106B polymorphisms are associated with other genetic causes for FTD, including C9orf72 repeat expansions. Copyright © 2014 Elsevier Inc. All rights reserved.
Constraining processes of landscape change with combined in situ cosmogenic 14C-10Be analysis
Hippe, Kristina
2017-10-01
Reconstructing Quaternary landscape evolution today frequently builds upon cosmogenic-nuclide surface exposure dating. However, the study of complex surface exposure chronologies on the 102-104 years' timescale remains challenging with the commonly used long-lived radionuclides (10Be, 26Al, 36Cl). In glacial settings, key points are the inheritance of nuclides accumulated in a rock surface during a previous exposure episode and (partial) shielding of a rock surface after the main deglaciation event, e.g. during phases of glacier readvance. Combining the short-lived in situ cosmogenic 14C isotope with 10Be dating provides a valuable approach to resolve and quantify complex exposure histories and burial episodes within Lateglacial and Holocene timescales. The first studies applying the in situ14C-10Be pair have demonstrated the great benefit from in situ14C analysis for unravelling complex glacier chronologies in various glacial environments worldwide. Moreover, emerging research on in situ14C in sedimentary systems highlights the capacity of combined in situ14C-10Be analysis to quantify sediment transfer times in fluvial catchments or to constrain changes in surface erosion rates. Nevertheless, further methodological advances are needed to obtain truly routine and widely available in situ14C analysis. Future development in analytical techniques has to focus on improving the analytical reproducibility, reducing the background level and determining more accurate muonic production rates. These improvements should allow extending the field of applications for combined in situ14C-10Be analysis in Earth surface sciences and open up a number of promising applications for dating young sedimentary deposits and the quantification of recent changes in surface erosion dynamics.
Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections
Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.
2012-01-01
The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.
9,10-Dioxoanthracene-1,4-diyl bis(4-methylbenzenesulfonate
Directory of Open Access Journals (Sweden)
Sirirat Kokpol
2012-05-01
Full Text Available The title molecule, C28H20O8S2, has a T-shaped conformation. The central 9,10-anthraquinone moiety is bow-shaped with the two outer aromatic rings being inclined to one another by 13.99 (11°. The benzenesulfonate rings are inclined to one another by 47.35 (12°, and by 34.51 (11 and 17.88 (11° to the bridging aromatic ring of the 9,10-anthraquinone moiety. In the crystal, C—H...O interactions link the molecules into ribbons in [100].
Dicty_cDB: Contig-U06794-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available opus laevis N-acetyltransferase... 179 7e-44 ( P41227 ) RecName: Full=N-terminal acetyltransferase compl...P2... 178 1e-43 (Q9QY36) RecName: Full=N-terminal acetyltransferase complex ARD1... 178 1e-43 AK009697_1( AK...3 (Q9UTI3) RecName: Full=N-terminal acetyltransferase A complex ca... 174 2e-42 D...( AL672002 |pid:none) Mouse DNA sequence from clone RP2... 152 6e-36 ( P07347 ) RecName: Full=N-terminal acetyltransferase A compl...867 |pid:none) Methanococcus maripaludis C6, c... 55 2e-06 ( Q03503 ) RecName: Full=N-terminal acetyltransferase C compl
Proton spectra from 6.3 GeV/c deuteron break-up on H, D, C, Al and Bi nuclei
International Nuclear Information System (INIS)
Azhgirey, L.S.; Ignatenko, M.A.; Ivanov, V.V.; Kuznetsov, A.S.; Mescheryakov, M.G.; Razin, S.V.; Stoletov, G.D.; Vzorov, I.K.; Zhmyrov, V.N.
1977-01-01
The proton spectra from deuteron break-up on H, D, 12 C, 27 Al and 209 Bi nuclei were measured at an angle of 103 mrad (lab. system) in the momentum interval from 2.6 to 3.6 GeV/c. The measurements were made at the JINR synchrophasotron by one-arm magnetic spectrometer on-line with a computer. The extracted 6.3 GeV/c deuteron beam was incident on targets of CH 2 , CD 2 , C, Al and Bi at the thickness from 0.8 to 2 g/cm 2 . The flux of deuteron beam was equal to 5x10 8 -5x10 9 particles/pulse with a typical pulse length of 300 ms. The repetition rate was one pulse every 10 s. Proton peaks with the maximum at about 3.1 GeV/c and 280-300 MeV/c FWHM dominate in all the measured spectra. Experimental proton spectra are compared with calculations with the Reid, the Moravcsik Gartenhaus, the Hulten and the Gauss wave functions. The results, on the whole, are reasonably reproduced in the framework of the Glauber multiple scattering model taking into account the relativistic deformation of the deuteron wave function
Energy Technology Data Exchange (ETDEWEB)
Porwoll, J P; Leete, E [Minnesota Univ., Minneapolis (USA). Dept. of Chemistry
1985-03-01
Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.
Deuterium isotope effects on 13C chemical shifts of 10-Hydroxybenzo[h]quinolines
DEFF Research Database (Denmark)
Hansen, Poul Erik; Kamounah, Fadhil S.; Gryko, Daniel T.
2013-01-01
Deuterium isotope effects on 13C-NMR chemical shifts are investigated in a series of 10-hydroxybenzo[h]quinolines (HBQ’s) The OH proton is deuteriated. The isotope effects on 13C chemical shifts in these hydrogen bonded systems are rather unusual. The formal four-bond effects are found to be nega...
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFE801 (Link to dictyBase) - - - Contig-U12894-1 CFE801Z (Link... to Original site) - - CFE801Z 690 - - - - Show CFE801 Library CF (Link to library) Clone ID CFE801 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12894-1 Original site URL http://dict...6e1 5', mRNA sequence. 36 5.4 2 CK426247 |CK426247.1 AUF_IpTes_24_l09 Testis cDNA library Ict...A26838 )prestalk protein precursor - slime mold (Dictyoste... 66 9e-10 AC117072_6
Somatomedin-C stimulates glycogen synthesis in fetal rat hepatocytes
International Nuclear Information System (INIS)
Freemark, M.; D'Ercole, A.J.; Handwerger, S.
1985-01-01
The effects of somatomedin-C/insulin-like growth factor I (Sm-C) on glycogen metabolism in cultured hepatocytes from 20-day-old rat fetuses have been examined and compared with the effects of insulin. Sm-C (25-375 ng/ml; 3.25-50 nM) stimulated dose-dependent increases in [ 14 C]glucose incorporation into glycogen (14.4-72.9% and total cell glycogen content (10.6-34.3%. Maximal stimulation of glycogen synthesis by Sm-C occurred at 2-4 h of incubation. Insulin (10 nM to 10 microM) also stimulated [ 14 C]glucose incorporation but its potency was only 1/20th that of Sm-C. The time course of stimulation of glucose incorporation by insulin was identical to that of Sm-C, the dose-response curves of the two hormones were parallel, and the maximal effects of insulin were not enhanced by simultaneous exposure of cells to Sm-C. These findings suggest that Sm-C and insulin stimulate glycogenesis in fetal liver through similar or identical mechanisms. Since the potency of Sm-C was 20 times greater than that of insulin, the glycogenic action of insulin in fetal liver may be mediated through binding to a hepatic receptor which also binds Sm-C. In addition to having mitogenic effects on fetal tissues, Sm-C may have direct anabolic effects on fetal carbohydrate metabolism
Occurrence of C35-C45 polyprenols in filamentous and unicellular cyanobacteria
Bauersachs, T.; Schouten, S.; Compaore, J.; Stal, L.J.; Sinninghe Damsté, J.S.
2010-01-01
Polyprenols, regular (head-to-tail) isoprenoid alcohols with 7–9 prenyl units, were tentatively identified in several cultivated cyanobacteria. Heptaprenol (C35), octaprenol (C40) and a suite of nonaprenols (C45) were present in unicellular and filamentous non-heterocystous cyanobacteria, while they
Indian Academy of Sciences (India)
2012-03-09
Mar 9, 2012 ... A novel approach to the fabrication of vanadium carbide encapsulated into carbon nanotube (VC@C) core-shell .... mixed solution was transferred into a 600 mL stainless steel autoclave after the solution became suspension. An auto- clave was sealed and maintained at 180. ◦. C for 48 h and then cooled to ...
Cheng, Z.; Shi, J.; Zhang, J.; Kistler, L. M.
2017-12-01
The influence of the interplanetary magnetic field (IMF) cone angle θ (the angle between the IMF direction and the Sun-Earth line) on the invariant latitudes (ILATs) of the footprints of the field-aligned currents (FACs) in the magnetotail has been investigated. We performed a statistic study of 542 FAC cases observed by the four Cluster spacecraft in the northern hemisphere. The results show that the large FAC (>10 nA/m2) cases occur at the low ILATs (60º, which implies the footprints of the large FACs mainly expand equatorward with large IMF cone angle. The equatorward boundary of the FAC footprints in the polar region decreases with the IMF cone angle especially when IMF Bz is positive. There is almost no correlation or a weak positive correlation of the poleward boundary and IMF cone angle no matter IMF is northward or southward. The equatorward boundary is more responsive to the IMF cone angle. Compared to the equatorward boundary, the center of the FAC projected location changes very little. This is the first time a correlation between FAC projected location and IMF cone angle has been determined.
Yildirim, Vildan; Baltaci, Mustafa Ozkan; Ozgencli, Ilknur; Sisecioglu, Melda; Adiguzel, Ahmet; Adiguzel, Gulsah
2017-12-01
An extracellular thermostable alkaline serine protease enzyme from Aeribacillus pallidus C10 (GenBank No: KC333049), was purified 4.85 and 17. 32-fold with a yield of 26.9 and 19.56%, respectively, through DE52 anion exchange and Probond affinity chromatography. The molecular mass of the enzyme was determined through sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), with approximately 38.35 kDa. The enzyme exhibited optimum activity at pH 9 and at temperature 60 °C. It was determined that the enzyme had remained stable at the range of pH 7.0-10.0, and that it had preserved more than 80% of its activity at a broad temperature range (20-80 °C). The enzyme activity was found to retain more than 70% and 55% in the presence of organic solvents and commercial detergents, respectively. In addition, it was observed that the enzyme activity had increased in the presence of 5% SDS. K M and V max values were calculated as 0.197 mg/mL and 7.29 μmol.mL - 1 .min - 1 , respectively.
Dicty_cDB: Contig-U16461-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available c... 50 0.22 1 ( FG297572 ) 1108793288739 New World Screwworm Larvae 9387 EST... 50 0.22 1 ( FG296279 ) 1108770747330 New World... Screwworm Larvae 9387 EST... 50 0.22 1 ( FG290052 ) 1108793314234 New World Screwworm Eg...g 9261 ESTs C... 50 0.22 1 ( FG289324 ) 1108793295697 New World Screwworm Egg 926...1 ESTs C... 50 0.22 1 ( FG287245 ) 1108770736013 New World Screwworm Egg 9261 ESTs C... 50 0.22 1 ( FG284095 ) 1108770655912 New Worl...JBVS8_S9... 38 4.2 2 ( FG286198 ) 1108770714057 New World Screwworm Egg 9261 ESTs C... 40 4.3 2 ( DQ249178 )
International Nuclear Information System (INIS)
Vincent, D.; Venot, J.; Catanzano, G.; Clement, M.N.; Piquet, M.F.; Veyriras, E.; Beck, C.
1985-01-01
A radio-immunological assay with monoclonal antibodies was used to measure the C 19-9 antigen in 51 patients to determine its diagnostic value in cancer of the pancreas. The results show that the C 19-9 antigen is a good marker for carcinoma of the pancreas and that it can be commonly used [fr
Synthesis of [3-14C]- and [phenyl-U-14C] olaquindox
International Nuclear Information System (INIS)
Maul, W.; Scherling, D.; Seng, F.
1981-01-01
Olaquindox is a new feed additive. [ 14 C]Olaquindox, labelled in different positions, was needed for tracer-studies of pharmacokinetics, biotransformation and residues in several species of animals. 2-[N-(2-hydroxethyl)-carbamoyl]-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide([3- 14 C]Olaquindox) was synthesized from barium[ 14 C]carbonate (22 mmoles; 1.15 Ci) via [1- 14 C]acetic acid, sodium[1- 14 C]acetate, [1- 14 C]acetylchloride, ethyl[3- 14 C]acetoacetate and 2-carbethoxy-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide with an overall yield of 10%, based on barium[ 14 C]carbonate. The radiochemical purity was better than 98% (tlc). The specific activities of three preparations were 10.5, 8.4 and 5.45 μCi/mg respectively. [phenyl-U- 14 C]Olaquindox was synthesized starting from [U- 14 C]aniline (19.8 mmoles; 284.4 mCi). Intermediate products were N-acetyl[U- 14 C]aniline, 2-nitro-N-acetyl[U- 14 C]aniline, 2-nitro[U- 14 C]aniline and [U- 14 C]benzofurazanoxide. The total yield was 50% as calculated for [U- 14 C]aniline. At calibration samples of two preparations showed specific activities of 49.5 and 11.1 μCi/mg respectively. The radiochemical purity was checked by tlc and exceeded 98%. (author)
Silva, Carlos A; Portaro, Fernanda C V; Fernandes, Beatriz L; Ianzer, Danielle A; Guerreiro, Juliano R; Gomes, Claudiana L; Konno, Katsuhiro; Serrano, Solange M T; Nascimento, Nanci; Camargo, Antonio C M
2008-03-15
The snake venom proline-rich peptide BPP 10c is an active somatic angiotensin-converting enzyme (sACE) inhibitors. Recently we demonstrated that the anti-hypertensive effect of BPP 10c is not related to the inhibition of sACE alone, thus suggesting that this enzyme is not its only target for blood pressure reduction. In the present work, a biodistribution study in Swiss mice of [(125)I]-BPP 10c in the absence or in the presence of a saturating concentration of captopril, a selective active-site inhibitor of sACE, demonstrated that: (1) [(125)I]-BPP 10c was present in several organs and the renal absorption was significantly high; (2) [(125)I]-BPP 10c showed a clear preference for the kidney, maintaining a high concentration in this organ in the presence of captopril for at least 3h; (3) The residual amount of [(125)I]-BPP 10c in the kidney of animals simultaneously treated with captopril suggest that the peptide can interact with other targets different from sACE in this organ. We also showed that Cy3-labeled BPP 10c was internalized by human embryonic kidney cells (HEK-293T). Taken together, these results suggest that sACE inhibition by captopril affects the tissue distribution of [(125)I]-BPP 10c and that the anti-hypertensive effects of BPP 10c are not only dependent on sACE inhibition.
Rapid radioimmunoassay of human apolipoproteins C-II and C-III
Energy Technology Data Exchange (ETDEWEB)
Gustafson, S; Oestlund-Lindqvist, A M; Vessby, B [Uppsala Univ. (Sweden)
1984-06-01
Apolipoprotein (apo) C-II is an activator of lipoprotein lipase, while apo C-III has the ability to inhibit apo C-II activated lipolysis. In order to study further the relationship between lipoprotein lipase mediated hydrolysis and the serum concentrations of apo C-II and apo C-III radioimmunoassays for these apolipoproteins have been developed. Formalin-treated Staphylococcus aureus Cowan I was used for immunoprecipitation and were shown to give rapid uptake of immune complexes that could easily be harvested by centrifugation. The assays were shown to be sensitive (10 ..mu..g/1), specific, precise (inter- and intra-assay coefficients of variation below 10%), rapid (completed in less than 6 h) and simple to perform. Delipidation of serum and lipoproteins had no effect on the results, indicating that the immunologically active sites of apo C-II and apo C-III are exposed to the aqueous environment under assay conditions. Serum apo C-II and apo C-III levels of normolipidaemic subjects were approximately 25 mg/1 and 110 mg/1, respectively. Highly significant positive correlations were found between VLDL apo C-II and VLDL apo C-III, respectively, and VLDL triglycerides, VLDL cholesterol and total serum TG. There was also a highly significant correlation between the HDL cholesterol concentration and the HDL apo C-III concentration.
Zhong, Ping; Qiu, Min; Zhang, Jian; Sun, Huanli; Cheng, Ru; Deng, Chao; Meng, Fenghua; Zhong, Zhiyuan
2017-07-01
Combinatorial chemotherapy, which has emerged as a promising treatment modality for intractable cancers, is challenged by a lack of tumor-targeting, robust and ratiometric dual drug release systems. Here, docetaxel-loaded cRGD peptide-decorated redox-activable micellar mertansine prodrug (DTX-cRGD-MMP) was developed for targeted and synergistic treatment of B16F10 melanoma-bearing C57BL/6 mice. DTX-cRGD-MMP exhibited a small size of ca. 49 nm, high DTX and DM1 loading, low drug leakage under physiological conditions, with rapid release of both DTX and DM1 under a cytoplasmic reductive environment. Notably, MTT and flow cytometry assays showed that DTX-cRGD-MMP brought about a synergistic antitumor effect to B16F10 cancer cells, with a combination index of 0.37 and an IC50 over 3- and 13-fold lower than cRGD-MMP (w/o DTX) and DTX-cRGD-Ms (w/o DM1) controls, respectively. In vivo studies revealed that DTX-cRGD-MMP had a long circulation time and a markedly improved accumulation in the B16F10 tumor compared with the non-targeting DTX-MMP control (9.15 versus 3.13% ID/g at 12 h post-injection). Interestingly, mice treated with DTX-cRGD-MMP showed almost complete growth inhibition of B16F10 melanoma, with tumor inhibition efficacy following an order of DTX-cRGD-MMP > DTX-MMP (w/o cRGD) > cRGD-MMP (w/o DTX) > DTX-cRGD-Ms (w/o DM1) > free DTX. Consequently, DTX-cRGD-MMP significantly improved the survival rates of B16F10 melanoma-bearing mice. Importantly, DTX-cRGD-MMP caused little adverse effects as revealed by mice body weights and histological analyses. The combination of two mitotic inhibitors, DTX and DM1, appears to be an interesting approach for effective cancer therapy.
The effect of SiC particle size on the properties of Cu–SiC composites
International Nuclear Information System (INIS)
Celebi Efe, G.; Zeytin, S.; Bindal, C.
2012-01-01
Graphical abstract: The relative densities of Cu–SiC composites sintered at 700 °C for 2 h are ranged from 97.3% to 91.8% for SiC with 1 μm particle size and 97.5% to 95.2% for SiC with 5 μm particle size, microhardness of composites ranged from 143 to 167 HV for SiC having 1 μm particle size and 156–182 HVN for SiC having 5 μm particle size and the electrical conductivity of composites changed between 85.9% IACS and 55.7% IACS for SiC with 1 μm particle size, 87.9% IACS and 65.2%IACS for SiC with 5 μm particle size. It was found that electrical conductivity of composites containing SiC with 5 μm particle size is better than that of Cu–SiC composites containing SiC with particle size of 1 μm. Highlights: ► In this research, the effect of SiC particle size on some properties of Cu–SiC composites were investigated. ► The mechanical properties were improved. ► The electrical properties were obtained at desirable level. -- Abstract: SiC particulate-reinforced copper composites were prepared by powder metallurgy (PM) method and conventional atmospheric sintering. Scanning electron microscope (SEM), X-ray diffraction (XRD) techniques were used to characterize the sintered composites. The effect of SiC content and particle size on the relative density, hardness and electrical conductivity of composites were investigated. The relative densities of Cu–SiC composites sintered at 700 °C for 2 h are ranged from 97.3% to 91.8% for SiC with 1 μm particle size and from 97.5% to 95.2% for SiC with 5 μm particle size. Microhardness of composites ranged from 143 to 167 HV for SiC having 1 μm particle size and from 156 to 182 HV for SiC having 5 μm particle size. The electrical conductivity of composites changed between 85.9% IACS and 55.7% IACS for SiC with 1 μm particle size, between 87.9% IACS and 65.2% IACS for SiC with 5 μm particle size.
Investigation of low spin resonances in the 12C+12C and 16O+12C systems
International Nuclear Information System (INIS)
Uzureau, J.L.; Fieni, J.M.; Cocu, F.; Michaudon, A.
1979-01-01
The excitation functions of the 12 C( 12 C,α) 20 Ne and 12 C( 16 O,α) 24 Mg reactions were measured at different angles below the Coulomb barrier. Resonant structures were found at Esub(cm)=5.80 MeV in the 12 C+ 12 C system and at Esub(cm)=6.10 MeV in the 16 O+ 12 C system. From the analysis of angular distributions measured at the previous resonant energies, values of respectively Jsup(π)=0 + and 2 + have been deduced [fr
Nano-Pt/C electrocatalysts: synthesis and activity for alcohol oxidation
International Nuclear Information System (INIS)
Huong Nguyen, Thi Giang; Anh Pham, Thi Van; Phuong, Thi Xuan; Binh Lam, Thi Xuan; Tran, Van Man; Thoa Nguyen, Thi Phuong
2013-01-01
Nano-sized platinum electrocatalysts on a carbon support (Pt/C) have been synthesized by the polyol reduction method under microwave irradiation using ethylene glycol (EG) as the reductant and carbon vulcan XC-72R as the support material. The physical characteristics of the Pt/C materials were analyzed using transmission electron microscopy and Brunauer–Emmet–Teller nitrogen adsorption theory. The glycerol and EG electro-oxidation in alkaline media on the Pt/C catalysts was investigated with cyclic voltammetry and chronoamperometry. The particle size of Pt on carbon was about 3.0 nm. The catalytic activity for the alcohol electro-oxidation of Pt/C materials synthesized in various pH values (7.9–9.5) was found to be significantly higher than that of commercial Pt/C (Aldrich Sigma, 10 wt% Pt/activated carbon). The Pt/C catalyst synthesized in pH 9.5 showed the best electrochemical behavior. At all the synthesized Pt/C electrodes, compared with glycerol, the oxidation rate of EG was about ten times higher. (paper)
Lee, Soo Youn; Nam, Myung Hyun; Kim, June Soo; Kim, Jong Won
2007-06-01
We report a case of intolerance to warfarin dosing due to impaired drug metabolism in a patient with CYP2C9*3/*4. A 73-yr-old woman with atrial fibrilation was taking warfarin. She attained a high prothrombin time international normalized ratio (INR) at the standard doses during the induction of anticoagulation and extremely low dose of warfarin (6.5 mg/week) was finally chosen to reach the target INR. Genotyping for CYP2C9 revealed that this patient had a genotype CYP2C9*3/*4. This is the first Korean compound heterozygote for CYP2C9*3 and *4. This case suggests the clinical usefulness of pharmacogenetic testing for individualized dosage adjustments of warfarin.
Study on "1"4C content in post-irradiation graphite spheres of HTR-10
International Nuclear Information System (INIS)
Wang Shouang; Pi Yue; Xie Feng; Li Hong; Cao Jianzhu
2014-01-01
Since the production mechanism of the "1"4C in spherical fuel elements was similar to that of fuel-free graphite spheres, in order to obtain the amount of "1"4C in fuel elements and graphite spheres of HTR-10, the production mechanism of the "1"4C in graphite spheres was studied. The production sources of the "1"4C in graphite spheres and fuel elements were summarized, the amount of "1"4C in the post-irradiation graphite spheres was calculated, the decomposition techniques of graphite spheres were compared, and experimental methods for decomposing the graphite spheres and preparing the "1"4C sample were proposed. The results can lay the foundation for further experimental research and provide theoretical calculations for comparison. (authors)
Hot pressing of B{sub 4}C/SiC composites
Energy Technology Data Exchange (ETDEWEB)
Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O. [Ystanbul Technical University, Faculty of Chemistry and Metallurgy, Materials and Metallurgical Engineering Dept., Maslak-Ystanbul (Turkey)
2005-07-01
B{sub 4}C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B{sub 4}C/SiC composite samples were lower than monolithic B{sub 4}C in all experimental conditions. (authors)
Production and Extraction of [10C]-CO2 From Proton Bombardment of Molten 10B2O3
International Nuclear Information System (INIS)
Schueller, M.J.; Nickles, R.J.; Roberts, A.D.; Jensen, M.
2003-01-01
This work describes the production of 10C (t (1/2) = 19 s) from an enriched 10B2O3 target using a CTI RDS-112 11 MeV proton cyclotron. Proton beam heating is used to raise the target to a molten state (∼ 1300 deg. C), enabling the activity to diffuse to the surface of the melt. An infrared thermocouple monitors the melt temperature. Helium sweep gas then transports the activity to flow-through chemistry processing for human inhalation of 10CO2 for blood flow imaging with Positron Emission Tomography. The temperature-related diffusion of activity out of the white-hot molten glass target is discussed
Elimination of the 12 C and 16 O in the elastic scattering of 14 C by polarized protons
International Nuclear Information System (INIS)
Avila A, O.L.; Ramirez T, J.J.; Murillo O, G.; Fernandez B, M.
1991-04-01
The study of the elastic scattering of 14 C for polarized protons it provides information on the nuclear structure of 15 N. In the Tandem accelerator of the Nuclear Center in collaboration with the University of Notre Dame is carrying out this study to energy between 5.0 and 9.0 MeV in steps of 10 keV. The measures of differential section and vectorial analyzer power are subjected to shift analysis of phase being able to determine the parameters of the excited levels of 15 N that are it angular momentum, parity, level width and elastic width. The details of this experiment are presented in the ACEL-9102 technical report while in this work it was discussed the way in that contributions of 12 C and 16 O are eliminated that are present as impurities in our target of 14 C. At small angles the elastic components of these impurities are shoveled with the elastic of 14 C. In the experiment carried out in the Nuclear Center were take measures of differential section for 6 angles; 35, 45, 55, 65, 145 and 165 using surface barrier detectors. It is observed that it exists shovels at 35, 45, 55 and 65 while at 145 and 165 the 12 C, the 14 C and the 16 O are totally separate. With the purpose of being able to subtract of the elastic of 14 C the proportion of 12 C, it was decided to bombard a target of 12 C leaving the same geometry that had been used to bombard 14 C. With this also carried out the reaction 12 C (p,p) 12 C between 5.0 and 9.0 MeV in steps of 50 keV. Starting from these spectra are the integration (yield) of the elastic of 12 C. (Author)
Geometric factors in f.c.c. and b.c.c. metal-on-metal epitaxy
International Nuclear Information System (INIS)
Bruce, L.A.; Jaeger, H.
1978-01-01
Deposits of Ni, Au and Ag formed by condensing metal vapour in U.H.V. onto (001)W, held at a temperature Tsub(s) in the range 300K< Tsub(s)<1200 K, always form epitaxial layers. However, while Au and Ag form (001) epitaxial layers of f.c.c. single crystals, (001)d parallel to (001)s with, say, [110]d parallel to [010]s, Ni and Cu occur in two orthogonal domains, each characterized by an exclusive set of fault (or twin) planes. Within a fault plane, atoms are hexagonally close-packed and, within a domain, fault planes are normal to either [1-1-0]s or [1-10]s and a close-packed direction in the planes is normal to the substrate. The lateral stacking of the fault planes may range from random at low values of Tsub(s) to that of, say, (11-1-) planes in heavily faulted and/or twinned (110) epitaxed f.c.c. material, or of basal planes in (110) epitaxed h.c.p. material at high values of Tsub(s). The results are readily explained on the basis of a growth model developed for deposits of Ni and Cu on (001) Ag. (author)
Production and characterization of a murine monoclonal IgM antibody to human C1q receptor (C1qR)
International Nuclear Information System (INIS)
Ghebrehiwet, B.
1986-01-01
A hybridoma cell line that produces a monoclonal antibody (MAb) to cell surface C1q receptor (C1qr) has been produced by fusion of the P3 x 63-Ag8.653 mouse myeloma cell line with the spleen cells of a CD-1 mouse that had been hyperimmunized with viable Raji cell suspensions (5 x 10 7 cells/inoculum). This MAb, designated II1/D1, is an IgM antibody with lambda-light chain specificity. Radiolabeled or unlabeled, highly purified II1/D1 was used to determine that: a) this antibody competes for C1q binding sites on C1qR-bearing cells; b) the molecule recognized by this MAb is the C1qR; and c) cells that are known to bind C1q also bind II1/D1 in a specific manner. Western blot analysis of solubilized Raji, or U937 cell membranes, showed that the 125 I-MAb detected a major protein band of approximately 85000 m.w. in its unreduced state, indicating that the C1qR is similar, if not identical, in both types of cells. Analyses of 125 I-II/D1 binding experiments revealed that the antibody bound to Raji cells or u937 cells in a specific manner. Uptake of the antibody was saturable, with equilibrium virtually attained within 35 min. Scatchard analysis of the binding data using the intact MAb suggests that the affinity constant K/sub D/ is 2.9 x 10 -10 M, and at apparent saturation, 24.6 ng of the antibody were bound per 2 x 10 6 cells, giving an estimated 7.8 x 10 3 antibody molecules bound per cell. That the II1/D1 antibody is specifically directed to the C1q was further evidenced by an ELISA in which the ability of C1qR-bearing cells to bind the MAb was abrogated by c-C1q in a specific dose-dependent manner
Physical Properties of Yoghurt During Storage at 4ºC
Directory of Open Access Journals (Sweden)
Abdul Manab
2012-02-01
Full Text Available The purpose of this research was to find out physical properties of yogurt during storage at 4ºC. Yoghurt starters were using Lactobacillus bulgaricus FNCC 0041 and Streptococcus thermophilus FNCC 0040 (1:1. Yoghurt starter was inoculated on 10% (w/v of skim milk and 10% (w/v of skim milk which contained 5% (w/v of sucrose, incubated at 42ºC for 6 hours then storage at 4ºC for 30 days. The result showed that posacidification until 6 days storage, pH tend constant between 6 days and 30 days. Until 9 days texture tend constant, but after 9 days storage texture tend decreasing. Storage yogurt at 10˚C for 12 hours before 4˚C gave higher viscosity, viscosity tend constant until 30 days storage. Water Holding Capacity increasing until 6 days storage, after 6 days tend constant. Sineresis increasing until 6 days storage, after 6 days tend constant. It concluded that physical properties of yogurt gave a little changes on first week storage, after that tend constant until 30 days storage. Keywords: yogurt, pH, Texture, Viscosity, Water Holding Capacity, Sineresis
Directory of Open Access Journals (Sweden)
Concepción López
2014-11-01
Full Text Available The study of the reactivity of the enantiopure ferrocenyl Schiff base (SC-[FcCH=N–CH(Me(C6H5] (1 (Fc = (η5-C5H5Fe(η5-C5H4 with cis-[PtCl2(dmso2] under different experimental conditions is reported. Four different types of chiral Pt(II have been isolated and characterized. One of them is the enantiomerically pure trans-(SC-[Pt{κ1-N[FcCH=N–CH(Me(C6H5]}Cl2(dmso] (2a in which the imine acts as a neutral N-donor ligand; while the other three are the cycloplatinated complexes: [Pt{κ2-C,N [(C6H4–N=CHFc]}Cl(dmso] (7a and the two diastereomers {(Sp,SC and (Rp,SC} of [Pt{κ2-C,N[(η5-C5H3–CH=N–{CH(Me(C6H5}]Fe(η5-C5H5}Cl(dmso] (8a and 9a, respectively. Isomers 7a-9a, differ in the nature of the metallated carbon atom [CPh (in 7a or CFc (in 8a and 9a] or the planar chirality of the 1,2-disubstituted ferrocenyl unit (8a and 9a. Reactions of 7a–9a with PPh3 gave [Pt{κ2-C,N[(C6H4–N=CHFc]}Cl(PPh3] (in 7b and the diastereomers (Sp,SC and (Rp,SC of [Pt{κ2-C,N[(η5-C5H3–CH=N–{CH(Me(C6H5}] Fe(η5-C5H5}Cl(PPh3] (8b and 9b, respectively. Comparative studies of the electrochemical properties and cytotoxic activities on MCF7 and MDA-MB231 breast cancer cell lines of 2a and cycloplatinated complexes 7b-9b are also reported. Theoretical studies based on DFT calculations have also been carried out in order to rationalize the results obtained from the cycloplatination of 1, the stability of the Pt(II complexes and their electrochemical properties.
International Nuclear Information System (INIS)
Melamud, G.; Breskin, A.; Chechik, R.; Pansky, A.
1992-10-01
Specific primary ionization induced by minimum ionizing electrons has been measured in several gases and vapors. Charges deposited by β-electrons in a low pressure gas, were collected, amplified by a multistep gaseous electron multiplier and counted. The high counting efficiency of the multiplier provided results of systematically higher values as compared to existing data. The respective values of the specific primary ionization in CH 4 C 2 H 6 , C 3 H 8 ,i-C 4 H 10 , Argon, Dimethylether, Triethylamine and Tetrakis(dimethylamino) ethylene are: 0.034, 0.065, 0.095, 0.12, 0.03, 0.082, 0.0195 and 0.370 clusters/cm*Torr. We present the experimental method and discuss the results and their accuracy. (authors)
Oh, Juwon; Alkhalifah, Tariq Ali
2017-01-01
-off analysis supports that the parameter set that includes deviation parameters offers the best choice for a 9C data set. Compared to the data from an explosive source, using the 9C land data, ORT parameters show different trade-off patterns for the different
Energy Technology Data Exchange (ETDEWEB)
Porwoll, J.P.; Leete, E. (Minnesota Univ., Minneapolis (USA). Dept. of Chemistry)
1985-03-01
Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.
Cardiomyocyte H9c2 cells present a valuable alternative to fish lethal testing for azoxystrobin
International Nuclear Information System (INIS)
Rodrigues, Elsa T.; Pardal, Miguel Â.; Laizé, Vincent; Cancela, M. Leonor; Oliveira, Paulo J.; Serafim, Teresa L.
2015-01-01
The present study aims at identifying, among six mammalian and fish cell lines, a sensitive cell line whose in vitro median inhibitory concentration (IC_5_0) better matches the in vivo short-term Sparus aurata median lethal concentration (LC_5_0). IC_5_0_s and LC_5_0 were assessed after exposure to the widely used fungicide azoxystrobin (AZX). Statistical results were relevant for most cell lines after 48 h of AZX exposure, being H9c2 the most sensitive cells, as well as the ones which provided the best prediction of fish toxicity, with a LC_5_0_,_9_6_h/IC_5_0_,_4_8_h = 0.581. H9c2 cell proliferation upon 72 h of AZX exposure revealed a LC_5_0_,_9_6_h/IC_5_0_,_7_2_h = 0.998. Therefore, identical absolute sensitivities were attained for both in vitro and in vivo assays. To conclude, the H9c2 cell-based assay is reliable and represents a suitable ethical alternative to conventional fish assays for AZX, and could be used to get valuable insights into the toxic effects of other pesticides. - Highlights: • Fish toxicity data are still considered standard information in ecotoxicology. • Alternatives to animal testing have become an important topic of research. • Cell-based assays are currently a promising in vitro alternative. • Comparative studies to accelerate the validation of cell-based methods are required. • H9c2 cell line proved to produce in vitro reliable toxicity results for azoxystrobin. - The application of cell-based assays for environmental toxicity studies would greatly reduce the number of fish needed for toxicity testing without any loss of reliability.
Dicty_cDB: Contig-U05360-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ent library ... 74 1e-08 1 ( DY584577 ) C014-F9 Acropora millepora presettlement li...-08 1 ( EK287310 ) 1095462317178 Global-Ocean-Sampling_GS-31-01-01-1... 74 1e-08 1 ( DY585529 ) C009-D1 Acropora millepora presettlem
Oh, Juwon
2017-08-17
To examine the feasibility of elastic full waveform inversion (FWI) for azimuthally rotated orthorhombic (rORT) media, we analyze the sensitivity of the 9-component (9C) land data set acquired on the surface on each of the ORT parameters. The trade-off analysis supports that the parameter set that includes deviation parameters offers the best choice for a 9C data set. Compared to the data from an explosive source, using the 9C land data, ORT parameters show different trade-off patterns for the different source and receiver components. For this reason, finding an optimal component considering trade-offs is another important issue to better recover subsurface rotated orthorhombic anisotropy.
Electrical activation of nitrogen heavily implanted 3C-SiC(1 0 0)
Energy Technology Data Exchange (ETDEWEB)
Li, Fan, E-mail: f.li.1@warwick.ac.uk [School of Engineering, University of Warwick, Coventry CV4 7AL (United Kingdom); Sharma, Yogesh; Shah, Vishal; Jennings, Mike [School of Engineering, University of Warwick, Coventry CV4 7AL (United Kingdom); Pérez-Tomás, Amador [ICN2 – Institut Catala de Nanociència i Nanotecnologia, Campus UAB, 08193 Bellaterra, Barcelona (Spain); Myronov, Maksym [Physics Department, University of Warwick, Coventry CV4 7AL (United Kingdom); Fisher, Craig [School of Engineering, University of Warwick, Coventry CV4 7AL (United Kingdom); Leadley, David [Physics Department, University of Warwick, Coventry CV4 7AL (United Kingdom); Mawby, Phil [School of Engineering, University of Warwick, Coventry CV4 7AL (United Kingdom)
2015-10-30
Highlights: • Nitrogen is fully activated by 1175 °C annealing for 1.5 × 10{sup 19} cm{sup −3} doped 3C-SiC. • Free donor concentration is found to readily saturate in 3C-SiC at ∼7 × 10{sup 19} cm{sup −3}. • 3C-SiC is found to have complete donor thermal ionization above 150 K. • Donor in 1.5 × 10{sup 19} cm{sup −3} nitrogen implanted 3C-SiC has an energy level ∼15 meV. • The SiO{sub 2} cap is found to have a bigger influence on low and medium doped samples. - Abstract: A degenerated wide bandgap semiconductor is a rare system. In general, implant levels lie deeper in the band-gap and carrier freeze-out usually takes place at room temperature. Nevertheless, we have observed that heavily doped n-type degenerated 3C-SiC films are achieved by nitrogen implantation level of ∼6 × 10{sup 20} cm{sup −3} at 20 K. According to temperature dependent Hall measurements, nitrogen activation rates decrease with the doping level from almost 100% (1.5 × 10{sup 19} cm{sup −3}, donor level 15 meV) to ∼12% for 6 × 10{sup 20} cm{sup −3}. Free donors are found to saturate in 3C-SiC at ∼7 × 10{sup 19} cm{sup −3}. The implanted film electrical performances are characterized as a function of the dopant doses and post implantation annealing (PIA) conditions by fabricating Van der Pauw structures. A deposited SiO{sub 2} layer was used as the surface capping layer during the PIA process to study its effect on the resultant film properties. From the device design point of view, the lowest sheet resistivity (∼1.4 mΩ cm) has been observed for medium doped (4 × 10{sup 19} cm{sup −3}) sample with PIA 1375 °C 2 h without a SiO{sub 2} cap.
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Illustration of the Minimum Limits for Correlation Coefficient for PM2.5 and PM10â2.5 Class II and III Methods C Figure C-4 to Subpart C of Part 53... Methods and Reference Methods Pt. 53, Subpt. C, Fig. C-4 Figure C-4 to Subpart C of Part 53—Illustration...
(1S,3S,8R,9S,10R-9,10-Epoxy-3,7,7,10-tetramethyltricyclo[6.4.0.01,3]dodecane
Directory of Open Access Journals (Sweden)
Abdoullah Bimoussa
2014-04-01
Full Text Available The title compound, C16H26O, was synthesized by treating (1S,3S,8R-3,7,7,10-tetramethyltricyclo[6.4.0.01,3]dodec-9-ene with metachloroperbenzoic acid. The molecule is built up from two fused six- and seven-membered rings. The six-membered ring has a half-chair conformation, whereas the seven-membered ring displays a boat conformation. In the crystal, there are no significant intermolecular interactions present.
Comparative Genetic Analyses of Human Rhinovirus C (HRV-C) Complete Genome from Malaysia
Khaw, Yam Sim; Chan, Yoke Fun; Jafar, Faizatul Lela; Othman, Norlijah; Chee, Hui Yee
2016-01-01
Human rhinovirus-C (HRV-C) has been implicated in more severe illnesses than HRV-A and HRV-B, however, the limited number of HRV-C complete genomes (complete 5′ and 3′ non-coding region and open reading frame sequences) has hindered the in-depth genetic study of this virus. This study aimed to sequence seven complete HRV-C genomes from Malaysia and compare their genetic characteristics with the 18 published HRV-Cs. Seven Malaysian HRV-C complete genomes were obtained with newly redesigned primers. The seven genomes were classified as HRV-C6, C12, C22, C23, C26, C42, and pat16 based on the VP4/VP2 and VP1 pairwise distance threshold classification. Five of the seven Malaysian isolates, namely, 3430-MY-10/C22, 8713-MY-10/C23, 8097-MY-11/C26, 1570-MY-10/C42, and 7383-MY-10/pat16 are the first newly sequenced complete HRV-C genomes. All seven Malaysian isolates genomes displayed nucleotide similarity of 63–81% among themselves and 63–96% with other HRV-Cs. Malaysian HRV-Cs had similar putative immunogenic sites, putative receptor utilization and potential antiviral sites as other HRV-Cs. The genomic features of Malaysian isolates were similar to those of other HRV-Cs. Negative selections were frequently detected in HRV-Cs complete coding sequences indicating that these sequences were under functional constraint. The present study showed that HRV-Cs from Malaysia have diverse genetic sequences but share conserved genomic features with other HRV-Cs. This genetic information could provide further aid in the understanding of HRV-C infection. PMID:27199901
Anaphylatoxin C3a induced mediator release from mast cells
International Nuclear Information System (INIS)
Herrscher, R.; Hugli, T.E.; Sullivan, T.J.
1986-01-01
The authors investigated the biochemical and functional consequences of the binding of highly purified human C3a to isolated rat serosal mast cells. C3a caused a dose-dependent (1-30 μM), noncytotoxic release of up to 64% (+/- 7 SEM) of the mast cell histamine content. C3a (10μM) increased 45 Ca ++ uptake 8.2- fold (+/- 2.2 SEM) above unstimulated control values within 10 minutes. Arachidonyl-diacylglycerol and arachidonyl-monoacylglycerol levels increased significantly within 2 minutes after C3a (10 μM) stimulation. Turnover of phosphatidylinositol, phosphatidic acid, and phosphatidylcholine were increased within 15 minutes. In contrast to antigen, C3a stimulation (10 μM) was not enhanced by exogenous phosphatidylserine, and was not inhibited by ethanol (100 μmM). C3a suppressed arachidonic acid (AA) release to 38% (+/- 9 SEM) below baseline, and did not cause PGD 2 formation. C3a and the desarginine form of C3a caused identical responses in all experiments. These studies indicate that C3a stimulation activates mast cell preformed mediator release in a manner very similar to antigen-IgE stimulation, but C3a suppresses free AA levels and does not stimulate PGD 2 synthesis
A new FACS approach isolates hESC derived endoderm using transcription factors.
Directory of Open Access Journals (Sweden)
Yuqiong Pan
2011-03-01
Full Text Available We show that high quality microarray gene expression profiles can be obtained following FACS sorting of cells using combinations of transcription factors. We use this transcription factor FACS (tfFACS methodology to perform a genomic analysis of hESC-derived endodermal lineages marked by combinations of SOX17, GATA4, and CXCR4, and find that triple positive cells have a much stronger definitive endoderm signature than other combinations of these markers. Additionally, SOX17(+ GATA4(+ cells can be obtained at a much earlier stage of differentiation, prior to expression of CXCR4(+ cells, providing an important new tool to isolate this earlier definitive endoderm subtype. Overall, tfFACS represents an advancement in FACS technology which broadly crosses multiple disciplines, most notably in regenerative medicine to redefine cellular populations.
Observation of $B^+_c \\rightarrow J/\\psi D_s^+$ and $B^+_c \\rightarrow J/\\psi D_s^{*+}$ decays
Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-01-01
The decays $B^+_c \\rightarrow J/\\psi D_s^+$ and $B^+_c \\rightarrow J/\\psi D_s^{*+}$ are observed for the first time using a dataset, corresponding to an integrated luminosity of 3$fb^{-1}$, collected by the LHCb experiment in proton-proton collisions at centre-of-mass energies of $\\sqrt{s}$=7 and 8 TeV. The statistical significance for both signals is in excess of 9 standard deviations. The following ratios of branching fractions are measured to be \\begin{equation*}BR( B^+_c \\rightarrow J/\\psi D_s^+)/BR( B^+_c \\rightarrow J/\\psi \\pi+ ) = 2.90 \\pm 0.57 \\pm 0.24$,\\end{equation*} \\begin{equation*}BR( B^+_c \\rightarrow J/\\psi D_s^{*+} ) / BR ( B^+_c \\rightarrow J/\\psi D_s^+ ) = 2.37 \\pm 0.56 \\pm 0.10, \\end{equation*} where the first uncertainties are statistical and the second systematic. The mass of the $B^+_c$ meson is measured to be \\begin{equation*}m_{B^+_c} = 6276.28 \\pm 1.44 (stat) \\pm 0.36(syst) MeV/c^2,\\end{equation*} using the $B^+_c \\rightarrow J/\\psi D_...
Nuclear molecules in the systems 12C+12C and 16O+16O
International Nuclear Information System (INIS)
Tiereth, W.
1986-01-01
For the two heavy ion systems 12 C+ 12 C and 16 O+ 16 O by means of scattering experiments studies on the phenomena of nuclear molecules were performed. For the 12 C+ 12 C system in the range of the Coulomb wall precision measurements of the elastic scattering were performed. In the two energy ranges of 5.5 ≤ E c.m. ≤ 6.65 MeV and 6.95 ≤ E c.m ≤ 7.375 MeV where the existence of many quasimolecular resonances is known in energy steps of ΔE c.m. = 25 keV angular distributions in the range 10 0 ≤ θ c.m. ≤ 90 0 with Δθ c.m. = 1 0 were measured. For several of the found quasimolecular resonances the spin and the carbon width could be uniquely determined. This was reached by a partial wave analysis of the obtained data. Supplemented were the measurements of the elastic scattering by measurements of the excitation function of the θ 0 exit channel of the reaction 12 ( 12 C, θ) 20 Ne in the energy range from 5.2 ≤ E c.m. ≤ 6.1 MeV. At some known resonances in the 16 O+ 16 O system in the energy range from 15.5 MeV to 18 MeV the spin and the elastic width of these structures could be determined. For this a constrained partial wave analysis on complete angular distributions of the elastic scattering (9 0 ≤ θ c.m. ≤ 90 0 ) which were measured in energy steps of ΔE c.m. = 50 keV was performed. In the 16 O+ 16 O system besides the proof for the existence of a nuclear glory scattering was given. (orig.) [de
Dicty_cDB: Contig-U15854-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 737759 ) Osmo01894 F. cylindrus osmotic stress library Fra... 42 9e-06 3 ( CX582318 ) TTE00021703 Amplicon Express - Conjugati...lone:XL459m21ex, 5' end. 42 0.11 2 ( CK275852 ) EST721930 potato abiotic stress cDNA library Sola... 40 0.12...HD_XGC_Emb4 Xenopus laevis c... 42 0.12 2 ( CK272208 ) EST718286 potato abiotic stress cDNA library Sola... ...12 2 ( CK265018 ) EST711096 potato abiotic stress cDNA library Sola... 40 0.12 2 ( DV607474 ) EST1210470 Glo... Xenopus l... 42 0.13 2 ( CK278382 ) EST724460 potato abiotic stress cDNA library Sola... 40 0.14 2 ( DV6190
Dicty_cDB: Contig-U10212-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us ... 42 0.005 2 ( EX063191 ) BR047835 etiolated mature leaf cDNA library KBLW ... 42 0.005 2 ( FG881990 ) ...l-length cDNA 5PRIM end o... 30 0.012 3 ( CK263215 ) EST709293 potato abiotic stress cDNA library...g DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 7e-04 2 ( EX110286 ) BR096576 whole plant cDNA library KFYP Brassic...on - dark Br... 42 0.005 2 ( EX128231 ) BR112061 ovule and silique cDNA library KHOS Bras... 42 0.005 2 ( ...5e-61 AM114193_1989( AM114193 |pid:none) Uncultured methanogenic archaeo... 237 7e-61 (Q9HL27) RecName: Full
Dicty_cDB: Contig-U15206-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 19 3 ( CX096670 ) EHAGV80TR E. histolytica Normalized cDNA library ... 74 3e-16 3 ( CX095471 ) EHAGE20TR E. histolytic...a Normalized cDNA library ... 74 5e-16 3 ( CX080250 ) EHAA560TR E. histolytica Normalized cDNA library... ... 74 6e-16 3 ( CX087623 ) EHAD283TR E. histolytica Normalized cDNA library... ... 74 6e-16 3 ( CX080249 ) EHAA560TF E. histolytica Normalized cDNA library ... 74 4e-15 2 ( CX082272 ) EHAAU14TR E. histolytic...-27 AJ627421_7( AJ627421 |pid:none) Uncultured crenarchaeote genomic f... 122 1e-26 (Q9YD27) RecName: Full=Translation initiati
Dicty_cDB: Contig-U16414-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( CB282081 ) BT0047 Blomia tropicalis cDNA library Blomia trop... 52 9e-19 4 ( EX370580 ) GQ03219.B7_O07 GQ032 - Shoot ti...on of useful proteins deri... 72 1e-29 5 ( DR930447 ) EST1121986 Aquilegia cDNA library...63 ) EST1191412 Aquilegia cDNA library Aquilegia formo... 88 5e-26 2 ( DB657321 ) Saccharomyces cere... 64 1e-21 4 ( DT739515 ) EST1173364 Aquilegia cDNA library Aquilegia formo... 70 1e-21 3 ( CF609239 ) INFIO01_000017 Grape Inflore... ( DT733254 ) EST1167104 Aquilegia cDNA library Aquilegia formo... 68 8e-21 5 ( FF717444 ) XABT35772.fwd Gateway compati
Kirchheiner, Julia; Meineke, Ingolf; Steinbach, Nadine; Meisel, Christian; Roots, Ivar; Brockmöller, Jürgen
2003-01-01
Aims The cytochrome P450 enzyme CYP2C9 catalyses the 4′-hydroxylation of the nonsteroidal analgesic drug diclofenac in humans. We studied the influences of the known amino acid variants, CYP2C9*2 (Arg144Cys) and CYP2C9*3 (Ile359Leu), on diclofenac pharmacokinetics after a 50-mg oral dose of diclofenac in healthy volunteers. As a surrogate marker of diclofenac activity, the ex vivo formation of prostaglandin E2 and thromboxane B2, which reflects COX-2 and COX-1 activity, was measured. Methods Genotyping was performed in 516 healthy volunteers to obtain 20 participants with all allelic combinations of the two CYP2C9 variants Arg144Cys (*2) and Ile359Leu (*3). Diclofenac and 4′-hydroxydiclofenac were quantified in plasma by reversed phase h.p.l.c. after oral intake of 50 mg diclofenac. Concentrations of thromboxane B2 (TxB2) and prostaglandin E2 (PGE2) were measured by immunoassays. Results There was no evidence of impaired metabolism of oral diclofenac in heterozygous and homozygous carriers of the CYP2C9 alleles *2 and *3 compared with the wild type (mean CL/F (95% CI) 20.5 (11, 30) l h−1 for *1/*1, 29.9 (19, 40) l h−1 for *1/*2, 30.0 (4, 56) l h−1 for *2/*2, 22.6 (12, 33) l h−1 for *1/*3, 23.5 (11, 37) l h−1 for *3/*3 and 37.3 (−15, 89) l h−1 in *2/*3). Furthermore, plasma concentrations of the metabolite 4′-hydroxydiclofenac were not lower in carriers of the CYP2C9 low-activity alleles *2 and *3 compared with carriers of the CYP2C9*1/*1 genotype. Marked diclofenac mediated inhibition of COX-1- and COX-2 activity was detected in all individuals independent of CYP2C9 genotype. Conclusions Polymorphisms of the CYP2C9 gene had no discernible effect on the pharmacokinetics and pharmacodynamics of diclofenac. The question of whether enzymes other than CYP2C9 play a major role in diclofenac 4′-hydroxylation in vivo or whether 4′-hydroxylation is not a rate-limiting step in diclofenac elimination in vivo, or whether the effect of the CYP2C9
Teratogenic interactions between methylmercury and mitomycin-C in mice
Energy Technology Data Exchange (ETDEWEB)
Inouye, Minoru; Kajiwara, Yuji
1988-01-01
Pregnant mice were given p.o. various nonteratogenic doses (0, 2.5 and 10 mg/kg) of methylmercuric chloride on day 9 of pregnancy, and then injected i.p. with a teratogenic dose (4 mg/kg) of mitomycin-C on day 10. Major malformations produced by mitomycin-C alone were cervical rib and vertebral anomaly, polydactyly of the hindlimb and tail anomaly. Combined treatment significantly increased the incidence of these malformations, showing the dose-effect relationship of methylmercury, whereas methylmercury alone is known not to produce such malformations. When mitomycin-C treatment alone was performed on day 9.5 of pregnancy, only vertebral anomalies increased in incidence. Therefore, mitomycin-C teratogenicity in terms of the manifestation of cervical rib, polydactyly and tail anomaly, but not vertebral anomaly, was suggested to be enhanced by methylmercury. A considerable number of foetuses showed cleft palate involvement following combined treatments, but not by either chemical alone. Cleft palate is known to be a major malformation in mice that is caused by methylmercury, and mitomycin-C also induces cleft palate. Therefore, the two chemicals might have affected foetuses additively and thereby induced cleft palate. (orig.)
Dicty_cDB: Contig-U06890-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2 ) CLLX1301.b1_J13.ab1 CLL(XYZ) lettuce saligna Lact... 38 0.056 2 ( CX084866 ) EHABX22TR E. histolytica Normalized cDNA library...4-storage roo... 50 0.071 1 ( CX089593 ) EHAE127TR E. histolytica Normalized cDNA library...09.T7.185889.ab1 non-sporulating culture o... 54 0.005 1 ( EL926280 ) NY4ThAmp1_1...EST2947 Zea mays sperm cell cDNA library Zea mays... 38 0.21 2 ( BG320461 ) Zm03_10d10_A Zm03_AAFC_ECORC_cold_stre... ( AI438501 ) 486006A05.x4 486 - leaf primordia cDNA library fr... 38 0.21 2 ( AI861145 ) 603012G11.x1 603 - stressed root cDNA libra
Dicty_cDB: Contig-U04690-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available scauevk mixed_tissue Sebastes... 34 9.9 2 >( AU071707 ) Dictyostelium discoideum slug cDNA, clone SSC319. L... ( AP006852 ) Candida albicans genomic DNA, chromosome 7, compl... 32 9.3 2 ( GE799624 ) EST_scau_evk_888927
Solution and solid state NMR studies of the structure and dynamics of C60 and C70
International Nuclear Information System (INIS)
Johnson, R.D.; Yannoni, C.S.; Salem, J.; Meijer, G.; Bethune, D.S.
1991-01-01
This paper investigates the structure and dynamics of C 60 and C 70 with 13 C NMR spectroscopy. In solution, high-resolution spectra reveal that C 60 has a single resonance at 143 ppm, indicating a strained, aromatic system with high symmetry. This is strong evidence for a C 60 soccer ball geometry. A 2D NMR INADEQUATE experiment on 13 C-enriched C 70 reveals the bonding connectivity to be a linear string, in firm support of the proposed rugby ball structure with D 5h symmetry, and furnishes resonance assignments. Solid state NMR spectra of C 60 at ambient temperatures yield a narrow resonance, indicative of rapid molecular reorientation. Variable temperature T 1 measurements show that the rotational correlation time is ∼ 10 - 9 s at 230 K. At 77 K, this time increases to more than 1 ms, and the 13 C NMR spectrum of C 60 is a powder pattern due to chemical shift anisotropy (tensor components 220, 186, 40 ppm). At intermediate temperatures a narrow peak is superimposed on the powder pattern, suggesting a distribution of barriers to molecular motion in the sample, or the presence of an additional phase in the solid state. A Carr-Purcell dipolar experiment on C 60 in the solid state allows the first precise determination of the C 60 bond lengths: 1.45 and 1.40 Angstrom
Corticobasal and ataxia syndromes widen the spectrum of C9ORF72 hexanucleotide expansion disease
DEFF Research Database (Denmark)
Lindquist, S. G.; Duno, M.; Batbayli, M.
2013-01-01
Recently, a hexanucleotide (GGGGCC) repeat expansion in the first intron of C9ORF72 was reported as the cause of chromosome 9p21-linked frontotemporal dementia-amyotrophic lateral sclerosis (FTD-ALS). We here report the prevalence of the expansion in a hospital-based cohort and associated clinical...
Calculation of thermodynamic properties and transport coefficients of C5F10O-CO2 thermal plasmas
Li, Xingwen; Guo, Xiaoxue; Murphy, Anthony B.; Zhao, Hu; Wu, Jian; Guo, Ze
2017-10-01
The thermodynamic properties and transport coefficients of C5F10O-CO2 gas mixtures, which are being considered as substitutes for SF6 in circuit breaker applications, are calculated for the temperature range from 300 K to 30 000 K and the pressure range from 0.05 MPa to 1.6 MPa. Special attention is paid on investigating the evolution of thermophysical properties of C5F10O-CO2 mixtures with different mixing ratios and with different pressures; both the mixing ratio and pressure significantly affect the properties. This is explained mainly in terms of the changes in the temperatures at which the dissociation and ionization reactions take place. Comparisons of different thermophysical properties of C5F10O-CO2 mixtures with those of SF6 are also carried out. It is found that most of the thermophysical properties of the C5F10O-CO2 mixtures, such as thermal conductivity, viscosity, and electrical conductivity, become closer to those of SF6 as the C5F10O concentration increases. The composition and thermophysical properties of pure C5F10O in the temperature range from 300 K to 2000 K based on the decomposition pathway are also given. The calculation results provide a basis for further study of the insulation and arc-quenching capability of C5F10O-CO2 gas mixtures as substitutes for SF6.
Directory of Open Access Journals (Sweden)
Ina Maria Schießl
Full Text Available Multiphoton microscopy (MPM offers a unique approach for addressing both the function and structure of an organ in near-real time in the live animal. The method however is limited by the tissue-specific penetration depth of the excitation laser. In the kidney, structures in the range of 100 µm from the surface are accessible for MPM. This limitation of MPM aggravates the investigation of the function of structures located deeper in the renal cortex, like the glomerulus and the juxtaglomerular apparatus. In view of the relevance of gene-targeted mice for investigating the function of these structures, we aimed to identify a mouse strain with a high percentage of superficially located glomeruli. The mean distance of the 30 most superficial glomeruli from the kidney surface was determined in 10 commonly used mouse strains. The mean depth of glomeruli was 118.4±3.4, 123.0±2.7, 133.7±3.0, 132.3±2.6, 141.0±4.0, 145.3±4.3, 148.9±4.2, 151.6±2.7, 167.7±3.9, and 207.8±3.2 µm in kidney sections from 4-week-old C3H/HeN, BALB/cAnN, SJL/J, C57BL/6N, DBA/2N, CD1 (CRI, 129S2/SvPas, CB6F1, FVB/N and NMRI (Han mice, respectively (n = 5 animals from each strain. The mean distance from the kidney surface of the most superficial glomeruli was significantly lower in the strains C3H/HeN Crl, BALB/cAnN, DBA/2NCrl, and C57BL/6N when compared to a peer group consisting of all the other strains (p<.0001. In 10-week-old mice, the most superficial glomeruli were located deeper in the cortex when compared to 4-week-old animals, with BALB/cAnN and C57BL/6N being the strains with the highest percentage of superficial glomeruli (25% percentile 116.7 and 121.9 µm, respectively. In summary, due to significantly more superficial glomeruli compared to other commonly used strains, BALB/cAnN and C57BL/6N mice appear to be particularly suitable for the investigation of glomerular function using MPM.
Directory of Open Access Journals (Sweden)
David M. Morris
2015-04-01
Full Text Available A reaction between [(CODIrCl]2 (COD is cycloocta-1,5-diene, HCl and indene failed to provide the hoped for chloridoindenyliridium dimer, but instead produced the title compound, [IrCl3(CH3CN(C8H12], which is an octahedral complex of iridium(III with a chelating cycloocta-1,5-diene ligand, three chloride ligands in a fac arrangement, and one acetonitrile ligand. Attempts to devise a rational synthesis for the title compound were unsuccessful.
Structure and dynamics of mica-confined films of [C10C1Pyrr][NTf2] ionic liquid
Freitas, Adilson Alves de; Shimizu, Karina; Smith, Alexander M.; Perkin, Susan; Canongia Lopes, José Nuno
2018-05-01
The structure of the ionic liquid 1-decyl-1-methylpyrrolidinium bis[(trifluoromethane)sulfonyl]imide, [C10C1Pyrr][NTf2], has been probed using Molecular Dynamics (MD) simulations. The simulations endeavour to model the behaviour of the ionic liquid in bulk isotropic conditions and also at interfaces and in confinement. The MD results have been confronted and validated with scattering and surface force experiments reported in the literature. The calculated structure factors, distribution functions, and density profiles were able to provide molecular and mechanistic insights into the properties of these long chain ionic liquids under different conditions, in particular those that lead to the formation of multi-layered ionic liquid films in confinement. Other properties inaccessible to experiment such as in-plane structures and relaxation rates within the films have also been analysed. Overall the work contributes structural and dynamic information relevant to many applications of ionic liquids with long alkyl chains, ranging from nanoparticle synthesis to lubrication.
Johnson, JA; Gong, L; Whirl-Carrillo, M; Gage, BF; Scott, SA; Stein, CM; Anderson, JL; Kimmel, SE; Lee, MTM; Pirmohamed, M; Wadelius, M; Klein, TE; Altman, RB
2011-01-01
Warfarin is a widely used anticoagulant with a narrow therapeutic index and large interpatient variability in the dose required to achieve target anticoagulation. Common genetic variants in the cytochrome P450-2C9 (CYP2C9) and vitamin K–epoxide reductase complex (VKORC1) enzymes, in addition to known nongenetic factors, account for ~50% of warfarin dose variability. The purpose of this article is to assist in the interpretation and use of CYP2C9 and VKORC1 geno-type data for estimating therapeutic warfarin dose to achieve an INR of 2–3, should genotype results be available to the clinician. The Clinical Pharmacogenetics Implementation Consortium (CPIC) of the National Institutes of Health Pharmacogenomics Research Network develops peer-reviewed gene–drug guidelines that are published and updated periodically on http://www.pharmgkb.org based on new developments in the field.1 PMID:21900891
[Protective effect of taxifolin on H2O2-induced H9C2 cell pyroptosis].
Ye, Yanqiong; Wang, Xiaoli; Cai, Qian; Zhuang, Jian; Tan, Xiaohua; He, Wei; Zhao, Mingyi
2017-12-28
To explore the effect of taxifolin on H2O2-induced pyroptosis in H9C2 cells and the possible mechanisms. Methods: The H9C2 cells was divided into 3 groups: a control group, a hydrogen peroxide (H2O2)group and a taxifolin group. The morphology of H9C2 cells was observed by inverted phase contrast microscope. The mitochondrial membrane potential was measured by JC-1 staining and flow cytometry. The alteration of the level of reactive oxygen species (ROS) was detected by specific mitochondrial probe. The protein levels of cysteinyl aspartate specific proteinase-1 (caspase-1)was determined by Western blot. The mRNA levels of interleukin-18 (IL-18), interleukin-1a (IL-1a), interleukin-1b (IL-1b), absent in melanoma 2 (AIM2), apoptosis-associated apeck-like protein (ASC), nucleotide-binding oligomerization domain-like receptor protein 3 (NLRP3)and nucleotide-binding oligomerization domain-like receptor family caspase recruitment domain-containing protein 4 (NLRC4) were determined by reverse transcription-polymerase chain reaction (RT-PCR). Results: Compared with the control group, the morphology of H9C2 cells obviously changed in the H2O2-treated group, which was guadually improved in the presence of taxifolin. Compared with the control group, the mitochondrial membrane potential was markedly decreased in the H2O2-treated cells, accompanied by the increase ofROS (both PH2O2 group, the mitochondrial membrane potential changes in the taxifolin group was increased while the ROS was decreased, with significant difference (both PH2O2-treated group were significantly increased (all PH2O2-induced H9C2 cell pyroptosis through inhibition of AIM2, NLRP3 and NLRC4 in flammasome.
Buchman, Vladimir L; Cooper-Knock, Johnathan; Connor-Robson, Natalie; Higginbottom, Adrian; Kirby, Janine; Razinskaya, Olga D; Ninkina, Natalia; Shaw, Pamela J
2013-04-08
Sizing of GGGGCC hexanucleotide repeat expansions within the C9ORF72 locus, which account for approximately 10% of all amyotrophic lateral sclerosis (ALS) cases, is urgently required to answer fundamental questions about mechanisms of pathogenesis in this important genetic variant. Currently employed PCR protocols are limited to discrimination between the presence and absence of a modified allele with more than 30 copies of the repeat, while Southern hybridisation-based methods are confounded by the somatic heterogeneity commonly present in blood samples, which might cause false-negative or ambiguous results. We describe an optimised Southern hybridisation-based protocol that allows confident detection of the presence of a C9ORF72 repeat expansion alongside independent assessment of its heterogeneity and the number of repeat units. The protocol can be used with either a radiolabeled or non-radiolabeled probe. Using this method we have successfully sized the C9ORF72 repeat expansion in lymphoblastoid cells, peripheral blood, and post-mortem central nervous system (CNS) tissue from ALS patients. It was also possible to confidently demonstrate the presence of repeat expansion, although of different magnitude, in both C9ORF72 alleles of the genome of one patient. The suggested protocol has sufficient advantages to warrant adoption as a standard for Southern blot hybridisation analysis of GGGGCC repeat expansions in the C9ORF72 locus.
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. C V R Murty. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 8 August 2004 pp 75-78 Classroom. Learning Earthquake Design and Construction – 1. What causes Earthquakes? C V R Murty · More Details Fulltext PDF. Volume 9 ...
Preparation and characterization of organic-inorganic hybrid perovskite (C4H9NH3)2CuCl4
International Nuclear Information System (INIS)
Xiao Zelong; Chen Hongzheng; Shi Minmin; Wu Gang; Zhou Renjia; Yang Zhisheng; Wang Mang; Tang Benzhong
2005-01-01
Organic-inorganic hybrid perovskite (C 4 H 9 NH 3 ) 2 CuCl 4 was prepared via the reaction between copper chloride and butylammonium chloride. Its chemical structure was characterized by FT-IR and elemental analysis. Its thin film was obtained by spin-coating, and X-ray diffraction (XRD) measurements indicated the formation of two-dimensional layered perovskites structure, with the c-axis perpendicular to the substrate surface. The electronic structure, thermal properties and electrical properties of the hybrid perovskite (C 4 H 9 NH 3 ) 2 CuCl 4 were also studied by UV-vis, photoluminescience (PL), TGA, DSC, and Hall measurement
Dicty_cDB: Contig-U03072-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available verselong Onychiurus arcticus d... 38 0.010 2 ( CF439672 ) EST676017 normalized cDNA library of ...ornis cDN... 68 8e-07 1 ( BU884919 ) R017H10 Populus root cDNA library Populus tremula... 68 8e-07 1 ( ...us dormant bud cDNA library Populus ... 60 2e-04 1 ( CK110478 ) N067A08 Populus bark cDNA library Populus tremul...04 1 ( BU887484 ) R062A08 Populus root cDNA library Populus tremula... 60 2e-04 1 ( BU880608 ) UM52TC12 Populus flower cDNA library...us tremula cambium cDNA library Po... 60 2e-04 1 ( BU819297 ) UA42BPA08 Populus tremula cambium cDNA library
Lifescience Database Archive (English)
Full Text Available ydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179.... patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte reh
Lifescience Database Archive (English)
Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 4e-10 1 BM398179 |BM398179.... patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy
Lifescience Database Archive (English)
Full Text Available 6669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 CN597971 |CN5...ila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration
Lifescience Database Archive (English)
Full Text Available |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 3e-10 1 CN59146...NA sequence. 70 7e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, m
Lifescience Database Archive (English)
Full Text Available ashington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa...10, mRNA sequence. 54 0.003 1 CB292489 |CB292489.1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated
International Nuclear Information System (INIS)
Viswanatha, V.; Larsen, B.; Hruby, V.J.
1979-01-01
DL-[2- 13 C]Leucine was prepared by condensing the sodium salt of ethyl acetamido-[2- 13 C]cyanoacetate with isobutylbromide in hexamethylphosphoroustriamide followed by acid hydrolysis. N-BOC-DL-[2- 13 C]Leucine was prepared and incorporated into [8-DL-[2- 13 C]leucine]oxytocin by total synthesis. The 13 C-labeled hormone derivative [8-[2- 13 C]leucine]oxytocin was separated from its 8-position diastereoisomer by partition chromatography. The specifically 13 C-labeled peptide hormone diastereoisomeric analog [3-DL-[2- 13 C]leucine]oxytocin also was prepared by solid phase peptide synthesis. No suitable solvent system for partition chromatography separation of the latter diastereoisomeric peptide mixture could be found. However an excellent preparative separation of the diastereoisomers could be obtained by reverse phase high pressure liquid chromatography on a partisil 10 M9 ODS column using the solvent system 0.05 M ammonium acetate (pH 4.0), acetonitrile (81:19, v/v) to give pure [3-[2- 13 C]leucine]oxytocin and [3-D-[2- 13 C]leucine]oxytocin. An excellent separation of [8-[2- 13 C]leucine]oxytocin and the corresponding delata-D-leucine diastereoisomer derivative could also be accomplished by high pressure liquid chromatography. (author)
Lifescience Database Archive (English)
Full Text Available s) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 99 2e-19... BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 97 6e-19 (Q9JLC8) RecName: Full=Sacsi
Vitamin C induces specific demethylation of H3K9me2 in mouse embryonic stem cells via Kdm3a/b.
Ebata, Kevin T; Mesh, Kathryn; Liu, Shichong; Bilenky, Misha; Fekete, Alexander; Acker, Michael G; Hirst, Martin; Garcia, Benjamin A; Ramalho-Santos, Miguel
2017-01-01
Histone methylation patterns regulate gene expression and are highly dynamic during development. The erasure of histone methylation is carried out by histone demethylase enzymes. We had previously shown that vitamin C enhances the activity of Tet enzymes in embryonic stem (ES) cells, leading to DNA demethylation and activation of germline genes. We report here that vitamin C induces a remarkably specific demethylation of histone H3 lysine 9 dimethylation (H3K9me2) in naïve ES cells. Vitamin C treatment reduces global levels of H3K9me2, but not other histone methylation marks analyzed, as measured by western blot, immunofluorescence and mass spectrometry. Vitamin C leads to widespread loss of H3K9me2 at large chromosomal domains as well as gene promoters and repeat elements. Vitamin C-induced loss of H3K9me2 occurs rapidly within 24 h and is reversible. Importantly, we found that the histone demethylases Kdm3a and Kdm3b are required for vitamin C-induced demethylation of H3K9me2. Moreover, we show that vitamin C-induced Kdm3a/b-mediated H3K9me2 demethylation and Tet-mediated DNA demethylation are independent processes at specific loci. Lastly, we document Kdm3a/b are partially required for the upregulation of germline genes by vitamin C. These results reveal a specific role for vitamin C in histone demethylation in ES cells and document that DNA methylation and H3K9me2 cooperate to silence germline genes in pluripotent cells.
Energy Technology Data Exchange (ETDEWEB)
Aberle, J.; Schleisiek, K.; Schmuck, I.; Schmidt, L.; Romer, O.; Weih, G.
1995-08-01
The Mol 7C/6 coolant blockage experiment in the Belgian BR2 reactor yielded results different from Mol 7C experiments with low burnup pins: At 10% burnup local failure is not self-limiting, but requires active systems for detection and scram. The Mol 7C series was finished in 1991. In each of the test bundles Mol 7C/4, /5 and /6, 30 Mk I pins pre-irradiated in KNK II were used. The central blockage consisted of enriched UO{sub 2} covering 30 percent of the bundle cross-section, with a height of 40 mm. The most important system for timely detection of coolant blockages of the type studied in Mol 7C/6 is based on DND. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Chen, Yung-Chang; Lin, Chih-Lung; Chao, Chuen-Guang; Liu, Tzeng-Feng, E-mail: Lewischen815@gmail.com
2015-06-05
Highlights: • The FeAlMnC alloy was gas-nitrided to simultaneously achieve the aging effect. • Anti-corrosion components AlN, Fe{sub 3}N and Fe{sub 4}N were identified by using GIXRD method. • The present nitrided alloy showed a great improvement in corrosion resistance. • The nitrided sample showed an excellent coherence between nitrided layer and matrix. • The nitrided and then stretched sample maintained satisfactory corrosion behavior. - Abstract: The as-quenched Fe–9.0Al–30Mn–1.8C (in wt.%) alloy gas nitrided at 550 °C for 4 h show excellent corrosion resistance investigated in 3.5% NaCl and 10% HCl solutions. Owing to the high corrosion resistance components, the gas-nitrided layer consists mainly of AlN with a slight amount of Fe{sub 3}N and Fe{sub 4}N identified by grazing incidence X-ray diffraction technique. Therefore, the pitting potential and corrosion potential of the nitrided sample are +1860 mV and +30 mV, respectively. Surprisingly, it is worthy to be pointed out that the nitrided and then tensile-tested alloy reveals very shallow in fracture depth and the excellent lattice coherence is shown between the nitrided layer and the substrate. Moreover, due to the extremely high nitrogen concentration (about 17–18 wt.%) at stretched surface, the corrosion resistance of present gas-nitrided and then tensile-tested alloy is superior to those optimally gas-nitrided or plasma-nitrided high-strength alloy steels, as well as martensitic stainless steels. The nitrided and then stretched alloy still retains a satisfactory corrosion resistance (E{sub pit} = +890 mV; E{sub corr} = +10 mV). Furthermore, only nanoscale-size pits were observed on the corroded surface after being immersed in 10% HCl for 24 h.
Gao, Yang; Jia, Pengyu; Shu, WenQi; Jia, Dalin
2016-03-05
Nowadays, drugs protecting ischemia/reperfusion (I/R) myocardium become more suitable for clinic. It has been confirmed lycopene has various protections, but lacking the observation of its effect on endoplasmic reticulum stress (ERS)-mediated apoptosis caused by hypoxia/reoxygenation (H/R). This study aims to clarify the protective effect of lycopene on ERS induced by H/R in H9C2 cardiomyocytes. Detect the survival rate, lactic dehydrogenase (LDH) activity, apoptosis ratio, glucose-regulated proteins 78 (GRP78), C/EBP homologous protein (CHOP), c-Jun-N-terminal protein Kinase (JNK) and Caspase-12 mRNA and protein expression and phosphorylation of JNK (p-JNK) protein expression. LDH activity, apoptosis ratio and GRP78 protein expression increase in the H/R group, reduced by lycopene. The survival rate reduces in the H/R and thapsigargin (TG) groups; lycopene and 4-phenyl butyric acid (4-PBA) can improve it caused by H/R, lycopene also can improve it caused by TG. The apoptosis ratio, the expression of GRP78, CHOP and Caspase-12 mRNA and protein and p-JNK protein increase in the H/R and TG groups, weaken in the lycopene+H/R, 4-PBA+H/R and lycopene+TG groups. There is no obvious change in the expression of JNK mRNA or protein. Hence, our results provide the evidence that 10 μM lycopene plays an obviously protective effect on H/R H9C2 cardiomyocytes, realized through reducing ERS and apoptosis. The possible mechanism may be related to CHOP, p-JNK and Caspase-12 pathways. Copyright © 2016. Published by Elsevier B.V.