International Nuclear Information System (INIS)
Dantas, Ana Leticia Almeida; Valente, Ligia Maria Marino; Morais, Lilia Aparecida Salgado de; Feliciano, Glaucio; Bernardo-Filho, Mario
2005-01-01
Vellozia pusilla Pohl is a species of the botanic family Velloziaceae that occurs in the subtropical regions of South America and, although it lives under conditions of high solar irradiation and low water availability, shows great longevity. The methanol extract of roots, stem and leaf sheaths of this species showed an anti tumoral activity through the inhibition of the enzyme Topoisomerase I when analyzed by an in vitro bioassay employing DNA repair or recombination deficient mutants of the yeast Saccharomyces cerevisiae. In the evaluation of the effect of Vellozia pusilla methanol extract on the labeling of RBC, blood of mice was treated with 99m Tc tracer solutions. The percentage of radioactivity (% ATI) bound to plasma (P) and blood cells (BC) was determined. The %ATI in the insoluble fraction of plasma (IF) was also evaluate, and the results showed that there was a decrease in %ATI in this fraction that represents the plasmatic proteins. (author)
Directory of Open Access Journals (Sweden)
Honara Morgana da Silva
Full Text Available The present paper reports the occurrence of Microlynchia pusilla in the state of Rio Grande do Norte (RN on Leptotila verreauxi approximans from a deciduous forest fragment located in the municipality of Macaíba. A specimen of L. v. approximans was collected in June 2012, wrapped in paper towels and kept under refrigeration in a plastic bag for later analysis of parasite fauna, taxidermy, and eventual storage in the Ornithological Collection of the Federal University of Rio Grande do Norte (UFRN. During the search for ectoparasites, a specimen of M. pusilla was found among feathers of the ventral region; it was collected and stored in the Entomological Collection ‘Adalberto Antônio Varela-Freire’ of the same university. This report extends the knowledge about geographical distribution and confirms the association of M. pusilla with hosts Columbiformes, contributing to the knowledge of the family Hippoboscidae in the country.Este trabalho registra a ocorrência de Microlynchia pusilla no estado do Rio Grande do Norte em Leptotila verreauxi approximans oriunda de um fragmento de floresta estacional decidual localizado no município de Macaíba. Um espécime de L. v. approximans foi coletado em junho de 2012, envolvido em papel toalha e conservado sob refrigeração em saco plástico para posterior análise da fauna parasitária, taxidermia e depósito na Coleção Ornitológica da Universidade Federal do Rio Grande do Norte (UFRN. Durante a busca por ectoparasitos foi encontrado um espécime de M. pusilla nas penas da região ventral, o qual foi coletado e depositado na Coleção Entomológica Adalberto Antônio Varela-Freire da mesma universidade. Este relato amplia o conhecimento sobre a distribuição geográfica de M. pusilla e confirma sua associação com hospedeiros Columbiformes, contribuindo para o conhecimento da família Hippoboscidae no país.
Growth on ATP Elicits a P-Stress Response in the Picoeukaryote Micromonas pusilla.
Directory of Open Access Journals (Sweden)
LeAnn P Whitney
Full Text Available The surface waters of oligotrophic oceans have chronically low phosphate (Pi concentrations, which renders dissolved organic phosphorus (DOP an important nutrient source. In the subtropical North Atlantic, cyanobacteria are often numerically dominant, but picoeukaryotes can dominate autotrophic biomass and productivity making them important contributors to the ocean carbon cycle. Despite their importance, little is known regarding the metabolic response of picoeukaryotes to changes in phosphorus (P source and availability. To understand the molecular mechanisms that regulate P utilization in oligotrophic environments, we evaluated transcriptomes of the picoeukaryote Micromonas pusilla grown under Pi-replete and -deficient conditions, with an additional investigation of growth on DOP in replete conditions. Genes that function in sulfolipid substitution and Pi uptake increased in expression with Pi-deficiency, suggesting cells were reallocating cellular P and increasing P acquisition capabilities. Pi-deficient M. pusilla cells also increased alkaline phosphatase activity and reduced their cellular P content. Cells grown with DOP were able to maintain relatively high growth rates, however the transcriptomic response was more similar to the Pi-deficient response than that seen in cells grown under Pi-replete conditions. The results demonstrate that not all P sources are the same for growth; while M. pusilla, a model picoeukaryote, may grow well on DOP, the metabolic demand is greater than growth on Pi. These findings provide insight into the cellular strategies which may be used to support growth in a stratified future ocean predicted to favor picoeukaryotes.
Phenology and abundance of Enoicyla pusilla in conifer stands
Directory of Open Access Journals (Sweden)
M. J. Lombardero
2013-07-01
Full Text Available Aim of Study. We study the abundance of Enoicyla pusilla (Burmeister in pine plantations and the effects of silvicultural thinning on insect population. This species is considered a rare member of the order Trichoptera, reported as absent or occasional in conifer forests. It has been suggested that the proliferation of conifer plantations may be a threat for this species by favoring population isolation. Area of study. Plantations of native and non-native pines in Galicia (NW of Spain.Material and Methods. We used different traps systems, including 28 pitfall traps, to compared populations of insects in 14 thinned and unthinned plots of Pinus pinaster and P. radiata distributed across 3 forest stands. Traps were checked every 15 days during one year.Main results. We caught 1.219 larvae of E. pusilla. It was the third most abundant species captured in pitfall traps. Larval activity extended from January to late July. They were more abundant in the stands of P. radiata, probably because the denser foliage produced limits sunlight and helped to maintain litter moisture. Additionally needles of P. radiata had lower toughness and higher nitrogen content, which probably makes it a higher quality resource for the detritivorous larvae. Thinning did not affect larvae population.Research highlights: Although managed forests cannot match the biodiversity value of native mixed species stands, if managed appropriately, they may provide habitat for native fauna while also allowing for forest productionKey words: caddisfly; Pinus pinaster; Pinus radiate; plantations; thinning.
Yeh, Hsuan Yu; Lin, Choun Sea; Jong, de Hans; Chang, Song-Bin
2017-01-01
Each species is characterized by a specific set of chromosomes, which is described as the chromosome portrait or karyotype. In general, such a karyotype is the same for all individuals in the population. An exception to that rule has recently been found in the orchid Erycina pusilla, which has
Biosynthesis and Total Synthesis of Pyrronazol B: a Secondary Metabolite from Nannocystis pusilla.
Witte, Swjatoslaw N R; Hug, Joachim J; Géraldy, Magalie N E; Müller, Rolf; Kalesse, Markus
2017-11-13
The first stereoselective total synthesis of the natural product pyrronazol B, which contains a chlorinated pyrrole-oxazole-pyrone framework, has been achieved. Genome sequencing of the myxobacterial producer strain Nannocystis pusilla Ari7 led to the identification of the putative biosynthetic gene cluster. The proposed biosynthetic pathway was supported by feeding experiments with stable isotopes of three biosynthetic building blocks, namely l-proline, l-serine, and l-methionine. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Hippocampal Astrocytes in Migrating and Wintering Semipalmated Sandpiper Calidris pusilla.
Carvalho-Paulo, Dario; de Morais Magalhães, Nara G; de Almeida Miranda, Diego; Diniz, Daniel G; Henrique, Ediely P; Moraes, Isis A M; Pereira, Patrick D C; de Melo, Mauro A D; de Lima, Camila M; de Oliveira, Marcus A; Guerreiro-Diniz, Cristovam; Sherry, David F; Diniz, Cristovam W P
2017-01-01
Seasonal migratory birds return to the same breeding and wintering grounds year after year, and migratory long-distance shorebirds are good examples of this. These tasks require learning and long-term spatial memory abilities that are integrated into a navigational system for repeatedly locating breeding, wintering, and stopover sites. Previous investigations focused on the neurobiological basis of hippocampal plasticity and numerical estimates of hippocampal neurogenesis in birds but only a few studies investigated potential contributions of glial cells to hippocampal-dependent tasks related to migration. Here we hypothesized that the astrocytes of migrating and wintering birds may exhibit significant morphological and numerical differences connected to the long-distance flight. We used as a model the semipalmated sandpiper Calidris pusilla , that migrates from northern Canada and Alaska to South America. Before the transatlantic non-stop long-distance component of their flight, the birds make a stopover at the Bay of Fundy in Canada. To test our hypothesis, we estimated total numbers and compared the three-dimensional (3-D) morphological features of adult C. pusilla astrocytes captured in the Bay of Fundy ( n = 249 cells) with those from birds captured in the coastal region of Bragança, Brazil, during the wintering period ( n = 250 cells). Optical fractionator was used to estimate the number of astrocytes and for 3-D reconstructions we used hierarchical cluster analysis. Both morphological phenotypes showed reduced morphological complexity after the long-distance non-stop flight, but the reduction in complexity was much greater in Type I than in Type II astrocytes. Coherently, we also found a significant reduction in the total number of astrocytes after the transatlantic flight. Taken together these findings suggest that the long-distance non-stop flight altered significantly the astrocytes population and that morphologically distinct astrocytes may play
Hippocampal Astrocytes in Migrating and Wintering Semipalmated Sandpiper Calidris pusilla
Directory of Open Access Journals (Sweden)
Dario Carvalho-Paulo
2018-01-01
Full Text Available Seasonal migratory birds return to the same breeding and wintering grounds year after year, and migratory long-distance shorebirds are good examples of this. These tasks require learning and long-term spatial memory abilities that are integrated into a navigational system for repeatedly locating breeding, wintering, and stopover sites. Previous investigations focused on the neurobiological basis of hippocampal plasticity and numerical estimates of hippocampal neurogenesis in birds but only a few studies investigated potential contributions of glial cells to hippocampal-dependent tasks related to migration. Here we hypothesized that the astrocytes of migrating and wintering birds may exhibit significant morphological and numerical differences connected to the long-distance flight. We used as a model the semipalmated sandpiper Calidris pusilla, that migrates from northern Canada and Alaska to South America. Before the transatlantic non-stop long-distance component of their flight, the birds make a stopover at the Bay of Fundy in Canada. To test our hypothesis, we estimated total numbers and compared the three-dimensional (3-D morphological features of adult C. pusilla astrocytes captured in the Bay of Fundy (n = 249 cells with those from birds captured in the coastal region of Bragança, Brazil, during the wintering period (n = 250 cells. Optical fractionator was used to estimate the number of astrocytes and for 3-D reconstructions we used hierarchical cluster analysis. Both morphological phenotypes showed reduced morphological complexity after the long-distance non-stop flight, but the reduction in complexity was much greater in Type I than in Type II astrocytes. Coherently, we also found a significant reduction in the total number of astrocytes after the transatlantic flight. Taken together these findings suggest that the long-distance non-stop flight altered significantly the astrocytes population and that morphologically distinct astrocytes
Chen, Peng; Han, Yuqing; Zhu, Chaoying; Gao, Bin; Ruan, Luzhang
2017-12-01
The complete mitochondrial genome sequences of Porzana fusca and Porzana pusilla were determined. The two avian species share a high degree of homology in terms of mitochondrial genome organization and gene arrangement. Their corresponding mitochondrial genomes are 16,935 and 16,978 bp and consist of 37 genes and a control region. Their PCGs were both 11,365 bp long and have similar structure. Their tRNA gene sequences could be folded into canonical cloverleaf secondary structure, except for tRNA Ser (AGY) , which lost its "DHU" arm. Based on the concatenated nucleotide sequences of the complete mitochondrial DNA genes of 16 Rallidae species, reconstruction of phylogenetic trees and analysis of the molecular clock of P. fusca and P. pusilla indicated that these species from a sister group, which in turn are sister group to Rallina eurizonoides. The genus Gallirallus is a sister group to genus Lewinia, and these groups in turn are sister groups to genus Porphyrio. Moreover, molecular clock analyses suggested that the basal divergence of Rallidae could be traced back to 40.47 (41.46‒39.45) million years ago (Mya), and the divergence of Porzana occurred approximately 5.80 (15.16‒0.79) Mya.
Directory of Open Access Journals (Sweden)
Rafael Borges da Silva Valadares
2015-03-01
Full Text Available In Orchidaceae, association with symbiotic fungi is required for seed germination and seedling development, thereby being the main energy source during the first steps of germination. Colombia is one of the countries with the greatest biodiversity of orchids, with an estimated 3,200 species, but few studies on orchid mycorrhiza have been conducted. In our study, we isolated and sequenced the internal transcribed spacer rDNA region of fungi from two co-occurring Colombian epiphytic orchids, I. utricularioides and P. pusilla, both belonging to the subtribe Oncidiinae. All sequences were recognized as belonging to the genus Ceratobasidium, known to be a common orchid mycorrhizal fungus in both tropical and temperate orchids. One sequence was 100% similar to fungi isolated from I. utricularioides in Costa Rica in a previous study. I. utricularioides was confirmed to be a specialist, associating with only one clade of mycorrhizal fungi. However, P. pusilla was shown to be a generalist, associating with three clades. This finding indicates that the variation in mycorrhizal specificity could be an important factor in the co-existence of orchids. The high affinity between the subtribe Oncidiinae and Ceratobasidium was also reinforced.
Maat, D. S.; Bale, N. J.; Hopmans, E. C.; Sinninghe Damsté, J. S.; Schouten, S.; Brussaard, C. P. D.
2015-09-01
The intact polar lipid (IPL) composition of phytoplankton is plastic and dependent on environmental factors. Previous studies have shown that phytoplankton under phosphorus (P)-stress substitute phosphatidylglycerols (PGs) with sulphoquinovosyldiacylglycerols (SQDGs) and digalactosyldiacylglycerols (DGDGs). However, these studies focused merely on P-depletion, while phytoplankton in the natural environment often experience P-limitation whereby the degree of limitation depends on the supply rate of the limiting nutrient. Here we demonstrate a linear increase in SQDG : PG and DGDG : PG ratios with increasing cellular P-stress in the picophotoeukaryote Micromonas pusilla, obtained by P-replete, P-limited (chemostat) and P-starved (no supply of P) culturing conditions. These ratios were not affected by the degree of the P-limiting conditions itself (i.e. 0.97 and 0.32 μmax chemostats), suggesting there is a minimum requirement of PGs for the maintenance of cell growth. Viral infection reduced the increase in SQDG : PG and DGDG : PG ratios in P-starved cells, but the extent did depend on the growth rate of the cultures before infection. The membrane of M. pusilla virus MpV itself was lacking some IPLs compared to the host as, e.g. no monogalactosyldiacylglycerols could be detected. Growth of the phytoplankton cultures under enhanced CO2 concentration did not affect the lipid remodeling results. The present study provides new insights into how the P-related trophic state of an ecosystem as well as viral infection can affect phytoplankton IPL composition, and therefore influence food web dynamics and biogeochemical cycling.
Energy Technology Data Exchange (ETDEWEB)
Waltman, Peter H.; Guo, Jian; Reistetter, Emily Nahas; Purvine, Samuel; Ansong, Charles K.; van Baren, Marijke J.; Wong, Chee-Hong; Wei, Chia-Lin; Smith, Richard D.; Callister, Stephen J.; Stuart, Joshua M.; Worden, Alexandra Z.; Mills, Ken
2016-07-19
Micromonas is a unicellular green alga that belongs to the prasinophytes, a sister lineage to land plants. This picoeukaryotic (<2 μm diameter) alga is widespread in the marine environment but still not understood at the cellular level. Here, we examine the mRNA and protein level changes that take place over the course of the day-night cycle using mid-exponential nutrient replete cultures of Micromonas pusilla CCMP1545 grown and analyzed in biological triplicate. During the experiment, samples were collected at key transition points during the diel for evaluation using high-throughput LC-MS proteomics. We also sequenced matched mRNA samples from the same time points, using pair-ended directional Illumina RNA-Seq to investigate the dynamics and relationship between the mRNA and protein expression programs of M. pusilla. Similar to a prior study of the marine cyanobacterium Prochlorococcus, we found significant divergence in the mRNA and proteomics expression dynamics in response to the light:dark cycle. Additionally, expressional responses of genes and the proteins they encoded could also be variable within the same metabolic pathway, such as the oxygenic photosynthesis pathway. A regression framework was used to predict protein levels using both mRNA expression and gene-specific sequence-based features. Several features in the genome sequence were found to influence protein abundance including the codon usage and the length of the 3’ UTR. Collectively, our studies provide insights into the regulation of the proteome over a diel as relationships between the transcriptional and translational programs in the widespread marine green alga Micromonas.
Directory of Open Access Journals (Sweden)
Peter H Waltman
Full Text Available Micromonas is a unicellular motile alga within the Prasinophyceae, a green algal group that is related to land plants. This picoeukaryote (<2 μm diameter is widespread in the marine environment but is not well understood at the cellular level. Here, we examine shifts in mRNA and protein expression over the course of the day-night cycle using triplicated mid-exponential, nutrient replete cultures of Micromonas pusilla CCMP1545. Samples were collected at key transition points during the diel cycle for evaluation using high-throughput LC-MS proteomics. In conjunction, matched mRNA samples from the same time points were sequenced using pair-ended directional Illumina RNA-Seq to investigate the dynamics and relationship between the mRNA and protein expression programs of M. pusilla. Similar to a prior study of the marine cyanobacterium Prochlorococcus, we found significant divergence in the mRNA and proteomics expression dynamics in response to the light:dark cycle. Additionally, expressional responses of genes and the proteins they encoded could also be variable within the same metabolic pathway, such as we observed in the oxygenic photosynthesis pathway. A regression framework was used to predict protein levels from both mRNA expression and gene-specific sequence-based features. Several features in the genome sequence were found to influence protein abundance including codon usage as well as 3' UTR length and structure. Collectively, our studies provide insights into the regulation of the proteome over a diel cycle as well as the relationships between transcriptional and translational programs in the widespread marine green alga Micromonas.
Diel Variations in Optical Properties of Micromonas pusilla, a Prasinophyte
DuRand, Michele D.; Green, Rebecca E.; Sosik, Heidi M.; Olson, Robert J.
2001-01-01
A laboratory experiment was conducted on cultures of Micromonas pusilla, a marine prasinophyte, to investigate how cell growth and division affect the optical properties over the light:dark cycle. Measurements were made of cell size and concentration, attenuation and absorption coefficients, flow cytometric light scattering (in forward and side directions), chlorophyll and carbon content. Refractive index was calculated using the anomalous diffraction approximation Cells were about 1.5 micrometers in diameter and exhibited phased division, with the major division burst occurring during the night. Typical diel variations were observed, with cells increasing in size and light scattering during the day as they photosynthesize and decreasing at night upon division. The cells were in ultradian growth, with more than one division per day, at a light level of 120 Mu-mol photons m/sq/sec. Since these cells are similar in size to small phytoplankton that are typically abundant in field samples, these results can be used in the interpretation of diel variations in light scattering in natural populations of phytoplankton.
Digital Repository Service at National Institute of Oceanography (India)
Biju, A.
'un projet de recherche marine multidisciplinaire sur le programme d'évaluation des ressources du vivant . P. pusilla présente une large gamme de variations dans la dynamique des populations de la zone d'étude et leur densité de population sur l'ensemble de... la zone d'étude variait de 0 à 12000 ind.1000 m-3. La plus forte abondance durant la mousson du sud-ouest (SWM) de 2004 (43,4% de la population totale de l'échantillonnage), suivie par l'inter mousson (IM) de 2005 (37,0%) et le Nord- mousson (NEM...
2010-04-01
... Engineering Division, Including B&C Distribution Center, Including On-Site Leased Workers From B&C Services... occurred during the relevant time period at the B&C Distribution Center, Inc. of the B&C Corporation, JR Engineering Division, Barberton, Ohio. The B&C Distribution Center provides distribution and logistical...
Observation of the decay Bc+/--->J/psipi+/- and measurement of the Bc+/- mass.
Aaltonen, T; Adelman, J; Akimoto, T; Albrow, M G; Alvarez González, B; Amerio, S; Amidei, D; Anastassov, A; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Apresyan, A; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Beauchemin, P-H; Bedeschi, F; Bednar, P; Behari, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Bridgeman, A; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carrillo, S; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Dagenhart, D; Datta, M; Davies, T; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; De Lorenzo, G; Dell'Orso, M; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Donati, S; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Ferrazza, C; Field, R; Flanagan, G; Forrest, R; Forrester, S; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garberson, F; Garcia, J E; Garfinkel, A F; Genser, K; Gerberich, H; Gerdes, D; Giagu, S; Giakoumopolou, V; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C M; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, D; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Hays, C; Heck, M; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hewamanage, S; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; Iyutin, B; James, E; Jayatilaka, B; Jeans, D; Jeon, E J; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Kar, D; Karchin, P E; Kato, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Koay, S A; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kraus, J; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kulkarni, N P; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Linacre, J; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Lovas, L; Lu, R-S; Lucchesi, D; Lueck, J; Luci, C; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; Macqueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Malik, S; Manca, G; Manousakis, A; Margaroli, F; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Martínez-Ballarín, R; Maruyama, T; Mastrandrea, P; Masubuchi, T; Mattson, M E; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyake, H; Moed, S; Moggi, N; Moon, C S; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagai, Y; Nagano, A; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nodulman, L; Norman, M; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagan Griso, S; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M A; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyria, A; Shalhout, S Z; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suslov, I; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thompson, G A; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tu, Y; Turini, N; Ukegawa, F; Uozumi, S; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Vellidis, C; Veszpremi, V; Vidal, M; Vidal, R; Vila, I; Vilar, R; Vine, T; Vogel, M; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner-Kuhr, J; Wagner, W; Wakisaka, T; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zheng, Y; Zucchelli, S
2008-05-09
The Bc+/- meson is observed through the decay Bc+/--->J/psipi+/-, in data corresponding to an integrated luminosity of 2.4 fb(-1) recorded by the Collider Detector at Fermilab II detector at the Fermilab Tevatron. A signal of 108+/-15 candidates is observed, with a significance that exceeds 8sigma. The mass of the Bc+/- meson is measured to be 6275.6+/-2.9(stat)+/-2.5(syst) MeV/c2.
Antihyperglycemic activity of Arbutus unedo, Ammoides pusilla and Thymelaea hirsuta.
Bnouham, M; Merhfour, F Z; Legssyer, A; Mekhfi, H; Maâllem, S; Ziyyat, A
2007-08-01
The effect of the water extract (WE) of three medicinal plants used as antidiabetic medication in Eastern Morocco (Arbutus unedo: Au, Ammoides pusilla: Ap and Thymelaea hirsuta: Th) was tested in rats with the Oral Glucose Tolerance Test (OGTT) and Intravenous Glucose Tolerance Test (IVGTT). In the OGTT the rats received water, glibenclamide (2 mg/kg) or WE (500 mg/kg for Au and 250 mg/kg for Th and Ap) 30 min before glucose loading (glucose: 1 g/kg). The WE of Au, Ap and Th produced a significant decrease in glycemia after glucose loading. In the IVGTT the WE of Ap and Th produced a significant decrease in glycemia 60 min after i.v. glucose loading (0.5 g/kg). The addition of the WE of Au (500 mg/kg), Ap or Th (250 mg/kg) induced a significant inhibition of jejunal glucose absorption, (31.6%, 28.5% and 40.5% respectively). This effect could explain in part the significant antihyperglycemic effect observed in the OGTT model but it does not exclude other effects on glucose homeostasis, particularly for Ap and Th. Toxicity tests (high LD50 value) suggest no adverse effect of the use of these plants.
Petetin, H.; Beekmann, M.; Colomb, A.; Denier van der Gon, H.A.C.; Dupont, J.C.; Honoré, C.; Michoud, V.; Morille, Y.; Perrussel, O.; Schwarzenboeck, A.; Sciare, J.; Wiedensohler, A.; Zhang, Q.J.
2015-01-01
High uncertainties affect black carbon (BC) emissions, and, despite its important impact on air pollution and climate, very few BC emissions evaluations are found in the literature. This paper presents a novel approach, based on airborne measurements across the Paris, France, plume, developed in
Observation of $B^+_c \\rightarrow J/\\psi D_s^+$ and $B^+_c \\rightarrow J/\\psi D_s^{*+}$ decays
Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-01-01
The decays $B^+_c \\rightarrow J/\\psi D_s^+$ and $B^+_c \\rightarrow J/\\psi D_s^{*+}$ are observed for the first time using a dataset, corresponding to an integrated luminosity of 3$fb^{-1}$, collected by the LHCb experiment in proton-proton collisions at centre-of-mass energies of $\\sqrt{s}$=7 and 8 TeV. The statistical significance for both signals is in excess of 9 standard deviations. The following ratios of branching fractions are measured to be \\begin{equation*}BR( B^+_c \\rightarrow J/\\psi D_s^+)/BR( B^+_c \\rightarrow J/\\psi \\pi+ ) = 2.90 \\pm 0.57 \\pm 0.24$,\\end{equation*} \\begin{equation*}BR( B^+_c \\rightarrow J/\\psi D_s^{*+} ) / BR ( B^+_c \\rightarrow J/\\psi D_s^+ ) = 2.37 \\pm 0.56 \\pm 0.10, \\end{equation*} where the first uncertainties are statistical and the second systematic. The mass of the $B^+_c$ meson is measured to be \\begin{equation*}m_{B^+_c} = 6276.28 \\pm 1.44 (stat) \\pm 0.36(syst) MeV/c^2,\\end{equation*} using the $B^+_c \\rightarrow J/\\psi D_...
Discovery of a dsRNA virus infecting the marine photosynthetic protist Micromonas pusilla
International Nuclear Information System (INIS)
Brussaard, C.P.D.; Noordeloos, A.A.M.; Sandaa, R.-A.; Heldal, M.; Bratbak, G.
2004-01-01
We report the isolation of the first double-stranded (ds) RNA virus in the family Reoviridae that infects a protist (microalga Micromonas pusilla, Prasinophyceae). The dsRNA genome was composed of 11 segments ranging between 0.8 and 5.8 kb, with a total size of approximately 25.5 kb. The virus (MpRNAV-01B) could not be assigned to the genus level because host type, genome size, and number of segments smaller than 2 kb did not correspond to either of the two existing 11-segmented dsRNA genera Rotavirus and Aquareovirus. MpRNAV-01B has a particle size of 65-80 nm, a narrow host range, a latent period of 36 h, and contains five major proteins (120, 95, 67, 53, and 32 kDa). MpRNAV-01B was stable to freeze-thawing, resistant to chloroform, ether, nonionic detergents, chelating and reducing agents. The virus was inactivated at temperatures above 35 deg. C and by ionic detergent, ethanol, acetone, and acidic conditions (pH 2-5)
Measurement of the Bc+ meson lifetime using the decay mode Bc+ --> J/Psie+nue.
Abulencia, A; Acosta, D; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Bachacou, H; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Ben Haim, E; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chapman, J; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Chu, P H; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Cresciolo, F; Cruz, A; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cyr, D; DaRonco, S; D'Auria, S; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demers, S; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Devlin, T; Dionisi, C; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Ebina, K; Efron, J; Ehlers, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Flores-Castillo, L R; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garcia Sciveres, M; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Ginsburg, C; Giokaris, N; Giolo, K; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Gotra, Y; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, S R; Hahn, K; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hatakeyama, K; Hauser, J; Hays, C; Heijboer, A; Heinemann, B; Heinrich, J; Herndon, M; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Junk, T R; Kamon, T; Kang, J; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kobayashi, H; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kuhlmann, S E; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Liss, T M; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Martin, A; Martin, V; Martínez, M; Maruyama, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; von der Mey, M; Miao, T; Miladinovic, N; Miles, J; Miller, R; Miller, J S; Mills, C; Milnik, M; Miquel, R; Mitra, A; Mitselmakher, G; Miyamoto, A; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Naganoma, J; Nahn, S; Nakano, I; Napier, A; Naumov, D; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Ogawa, T; Oh, S H; Oh, Y D; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Paoletti, R; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Rakitin, A; Rappoccio, S; Ratnikov, F; Reisert, B; Rekovic, V; van Remortel, N; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robertson, W J; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Rott, C; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sanchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfiligoi, I; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Skiba, A; Slaughter, A J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spezziga, M; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sumorok, K; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tanimoto, N; Tecchio, M; Teng, P K; Terashi, K; Tether, S; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Tönnesmann, M; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vaiciulis, A; Vallecorsa, S; Varganov, A; Vataga, E; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wallny, R; Walter, T; Wan, Z; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zetti, F; Zhang, X; Zhou, J; Zucchelli, S
2006-07-07
We present a measurement of the Bc+ meson lifetime in the decay mode Bc+ --> J/Psie+nue using the Collider Detector at Fermilab II detector at the Fermilab Tevatron Collider. From a sample of about of 360 pb(-1) of pp collisions at square root of s = 1.96 TeV, we reconstruct J/Psie+ pairs with invariant mass in the kinematically allowed range 4< M(J/Psie) < 6 GeV/c2. A fit to the decay-length distribution of 238 signal events yields a measured Bc+ meson lifetime of 0.463(-0.065)(+0.073)(stat) +/- 0.036(syst) ps.
BC hydro: Annual report, 1991-1992
Energy Technology Data Exchange (ETDEWEB)
1992-01-01
The third largest electric utility in Canada, B.C. Hydro services almost 1.3 million customers in an area containing over 92 per cent of British Columbia's population. B.C. Hydro's mission is to generate, transmit and distribute electricity. This annual report covers the business and financial performance of B.C. Hydro, and financial statistics.
Directory of Open Access Journals (Sweden)
Peter J Unmack
Full Text Available The freshwater fauna of Southern Australia is primarily restricted to the southwestern and southeastern corners of the continent, and is separated by a large, arid region that is inhospitable to this biota. This geographic phenomenon has attracted considerable interest from biogeographers looking to explain evolutionary diversification in this region. Here, we employed phylogenetic and phylogeographic approaches to evaluate the effect of this barrier on a group of four galaxiid fish species (Galaxiella endemic to temperate Southern Australia. We also tested if continental shelf width has influenced connectivity among populations during low sea levels when rivers, now isolated, could have been connected. We addressed these questions by sampling each species across its range using multiple molecular markers (mitochondrial cytochrome b sequences, nuclear S7 intron sequences, and 49 allozyme loci. These data also allowed us to assess species boundaries, to refine phylogenetic affinities, and to estimate species ages. Interestingly, we found compelling evidence for cryptic species in G. pusilla, manifesting as allopatric eastern and western taxa. Our combined phylogeny and dating analysis point to an origin for the genus dating to the early Cenozoic, with three of the four species originating during the Oligocene-Miocene. Each Galaxiella species showed high levels of genetic divergences between all but the most proximate populations. Despite extensive drainage connections during recent low sea levels in southeastern Australia, populations of both species within G. pusilla maintained high levels of genetic structure. All populations experienced Late Pleistocene-Holocene population growth, possibly in response to the relaxation of arid conditions after the last glacial maximum. High levels of genetic divergence and the discovery of new cryptic species have important implications for the conservation of this already threatened group of freshwater
Unmack, Peter J.; Bagley, Justin C.; Adams, Mark; Hammer, Michael P.; Johnson, Jerald B.
2012-01-01
The freshwater fauna of Southern Australia is primarily restricted to the southwestern and southeastern corners of the continent, and is separated by a large, arid region that is inhospitable to this biota. This geographic phenomenon has attracted considerable interest from biogeographers looking to explain evolutionary diversification in this region. Here, we employed phylogenetic and phylogeographic approaches to evaluate the effect of this barrier on a group of four galaxiid fish species (Galaxiella) endemic to temperate Southern Australia. We also tested if continental shelf width has influenced connectivity among populations during low sea levels when rivers, now isolated, could have been connected. We addressed these questions by sampling each species across its range using multiple molecular markers (mitochondrial cytochrome b sequences, nuclear S7 intron sequences, and 49 allozyme loci). These data also allowed us to assess species boundaries, to refine phylogenetic affinities, and to estimate species ages. Interestingly, we found compelling evidence for cryptic species in G. pusilla, manifesting as allopatric eastern and western taxa. Our combined phylogeny and dating analysis point to an origin for the genus dating to the early Cenozoic, with three of the four species originating during the Oligocene-Miocene. Each Galaxiella species showed high levels of genetic divergences between all but the most proximate populations. Despite extensive drainage connections during recent low sea levels in southeastern Australia, populations of both species within G. pusilla maintained high levels of genetic structure. All populations experienced Late Pleistocene-Holocene population growth, possibly in response to the relaxation of arid conditions after the last glacial maximum. High levels of genetic divergence and the discovery of new cryptic species have important implications for the conservation of this already threatened group of freshwater species. PMID:22693638
Measurements of $B_c^+$ production and mass with the $B_c^+ \\to J/\\psi \\pi^+$ decay
Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Kochebina, O; Komarov, V; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maino, M; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voss, H; Voß, C; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A
2012-01-01
Measurements of $B_c^+$ production and mass are performed with the decay mode $B_c^+ \\to J/\\psi \\pi^+$ using 0.37 fb$^{-1}$ of data collected in $pp$ collisions at $\\sqrt{s}=7$~TeV by the LHCb experiment. The ratio of the production cross-section times branching fraction between the $B_c^+ \\to J/\\psi \\pi^+$ and the $B^+ \\to J/\\psi K^+$ decays is measured to be $(0.68 \\pm 0.10\\,({\\rm stat.}) \\pm 0.03\\,({\\rm syst.}) \\pm 0.05\\,({\\rm lifetime}) )\\%$ for $B_c^+$ and $B^+$ mesons with transverse momenta $p_{\\rm T}>4~$GeV/$c$ and pseudorapidities $2.5<\\eta<4.5$. The $B_c^+$ mass is directly measured to be $6273.7 \\pm 1.3\\,({\\rm stat.}) \\pm 1.6 \\,({\\rm syst.})$~MeV/$c^2$, and the measured mass difference with respect to the $B^+$ meson is $M(B_c^+)-M(B^+) = 994.6 \\pm 1.3\\,({\\rm stat.}) \\pm 0.6\\,({\\rm syst.})$~MeV/$c^2$.
Regulatory BC1 RNA in Cognitive Control
Iacoangeli, Anna; Dosunmu, Aderemi; Eom, Taesun; Stefanov, Dimitre G.; Tiedge, Henri
2017-01-01
Dendritic regulatory BC1 RNA is a non-protein-coding (npc) RNA that operates in the translational control of gene expression. The absence of BC1 RNA in BC1 knockout (KO) animals causes translational dysregulation that entails neuronal phenotypic alterations including prolonged epileptiform discharges, audiogenic seizure activity in vivo, and…
Identification and quantification of the halogenated natural product BC-3
Energy Technology Data Exchange (ETDEWEB)
Melcher, J.; Olbrich, D.; Vetter, W. [Hohenheim Univ., Stuttgart (Germany). Inst. fuer Lebensmittelchemie; Marsh, G. [Stockholm Univ. (Sweden). Dept. of Environmental Chemistry; Gaus, C.; Mueller, J.F. [National Research Centre for Environmental Toxicology, Coopers Plains (Australia)
2004-09-15
Halogenated natural products (HNPs) of marine origin are increasingly recognized as critical residues in foodstuff (e. g. fish) and environmental samples (e. g. marine mammals and birds). Some of these HNPs (Q1, MHC-1, BC-2, and HDBPs including BC-10) were detected in diverse fish and marine mammal samples at concentrations sometimes exceeding those of PCBs, DDT, and other anthropogenic pollutants. Recent studies with marine mammal samples from Australia led to the detection of six abundant HNPs (Q1, BC-1, BC-2, BC-3, BC-10, and BC-11). In the meantime, Q1 was identified as heptachloro-1{sup '}-methyl-1,2{sup '}-bipyrrole, BC-2 as 4,6-dibromo-2-(2{sup '},4{sup '}-dibromo)phenoxyanisole, BC- 10 as 1,1{sup '}-dimethyl-3,3{sup '},4,4{sup '}-tetrabromo-5,5{sup '}-dichloro-2,2{sup '}-bipyrrole, and BC-11 as 3,5-dibromo- 2-(3{sup '},5{sup '}-dibromo,2{sup '}-methoxy)phenoxyanisole. However the identity of BC-1 and BC-3 remained unclear. The goal of the present study was the identification of BC-3. The tetrabromo compound BC-3 has previously been detected in marine mammals from four continents. Furthermore, we attempted establishing quantitative concentrations in diverse marine biota samples.
First observation of a baryonic Bc+ decay.
Aaij, R; Adeva, B; Adinolfi, M; Affolder, A; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Anderson, J; Andreassen, R; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Borsato, M; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brodzicka, J; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chefdeville, M; Chen, S; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cojocariu, L; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Corvo, M; Counts, I; Couturier, B; Cowan, G A; Craik, D C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dalseno, J; David, P; David, P N Y; Davis, A; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Donleavy, S; Dordei, F; Dorigo, M; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dreimanis, K; Dujany, G; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Ely, S; Esen, S; Evans, H-M; Evans, T; Falabella, A; Färber, C; Farinelli, C; Farley, N; Farry, S; Fay, Rf; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Fu, J; Furfaro, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; García Pardiñas, J; Garofoli, J; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gavardi, L; Gavrilov, G; Geraci, A; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianelle, A; Giani', S; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Henry, L; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Hussain, N; Hutchcroft, D; Hynds, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Karodia, S; Kelsey, M; Kenyon, I R; Ketel, T; Khanji, B; Khurewathanakul, C; Klaver, S; Klimaszewski, K; Kochebina, O; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanfranchi, G; Langenbruch, C; Langhans, B; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Likhomanenko, T; Liles, M; Lindner, R; Linn, C; Lionetto, F; Liu, B; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lowdon, P; Lu, H; Lucchesi, D; Luo, H; Lupato, A; Luppi, E; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Malinin, A; Manca, G; Mancinelli, G; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Moggi, N; Molina Rodriguez, J; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Morris, A-B; Mountain, R; Muheim, F; Müller, K; Mussini, M; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, G; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Pistone, A; Playfer, S; Plo Casasus, M; Polci, F; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Price, E; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rama, M; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Reichert, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rotondo, M; Rouvinet, J; Ruf, T; Ruiz, H; Ruiz Valls, P; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Silva Coutinho, R; Simi, G; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Steinkamp, O; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Stroili, R; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Tellarini, G; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2014-10-10
A baryonic decay of the B(c)(+) meson, B(c)(+) → J/ψppπ(+), is observed for the first time, with a significance of 7.3 standard deviations, in pp collision data collected with the LHCb detector and corresponding to an integrated luminosity of 3.0 fb(-1) taken at center-of-mass energies of 7 and 8 TeV. With the B(c)(+) → J/ψπ(+) decay as the normalization channel, the ratio of branching fractions is measured to be B(B(c)(+) → J/ψppπ(+))/B(B(c)(+) → J/ψπ(+)) = 0.143(-0.034)(+0.039)(stat) ± 0.013(syst). The mass of the B(c)(+) meson is determined as M(B(c)(+) = 6274.0 ± 1.8(stat) ± 0.4(syst) MeV/c(2), using the B(c)(+) → J/ψppπ(+) channel.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BC16 (Link to dictyBase) - - - Contig-U15105-1 FC-BC16Z (Li...nk to Original site) - - FC-BC16Z 620 - - - - Show FC-BC16 Library FC (Link to library) Clone ID FC-BC16 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...4 2e-66 AY961522_1( AY961522 |pid:none) Lysiphlebus testaceipes ribosomal ... 254 2e-66 AF402813_1( AF402813 |pid:none) Ict...hondrial 4.0 %: nuclear >> prediction for FC-BC16 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq
Feng, Xue; Orellana, Gardenia; Myers, James; Karasev, Alexander V
2018-04-12
Recessive resistance to Bean common mosaic virus (BCMV) in common bean (Phaseolus vulgaris L.) is governed by four genes that include one strain-nonspecific helper gene bc-u, and three strain-specific genes bc-1, bc-2, and bc-3. The bc-3 gene was identified as an eIF4E translation initiation factor gene mediating resistance through disruption of the interaction between this protein and the VPg protein of the virus. The mode of action of bc-1 and bc-2 in expression of BCMV resistance is unknown, although bc-1 gene was found to affect systemic spread of a related potyvirus, Bean common mosaic necrosis virus. To investigate the possible role of both bc-1 and bc-2 genes in replication, cell-to-cell, and long distance movement of BCMV in P. vulgaris, we tested virus spread of eight BCMV isolates representing pathogroups I, IV, VI, VII, and VIII, in a set of bean differentials expressing different combinations of six resistance alleles including bc-u, bc-1, bc-1 2 , bc-2, bc-2 2 , and bc-3. All studied BCMV isolates were able to replicate and spread in inoculated leaves of bean cultivars harboring bc-u, bc-1, bc-1 2 , bc-2, and bc-2 2 alleles and their combinations, while no BCMV replication was found in inoculated leaves of 'IVT7214' carrying the bc-u, bc-2 and bc-3 genes, except for isolate 1755a capable of overcoming the resistance conferred by bc-2 and bc-3. In contrast, the systemic spread of all BCMV isolates from pathogroups I, IV,VI, VII, and VIII was impaired in common bean cultivars carrying bc-1, bc-1 2 , bc-2, and bc-2 2 alleles. The data suggest that bc-1 and bc-2 recessive resistance genes have no effect on the replication and cell-to-cell movement of BCMV, but affect systemic spread of BCMV in common bean. The BCMV resistance conferred by bc-1 and bc-2 and affecting systemic spread was found only partially effective when these two genes were expressed singly. The efficiency of the restriction of the systemic spread of the virus was greatly enhanced when
AP calculus AB & BC crash course
Rosebush, J
2012-01-01
AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our
Directory of Open Access Journals (Sweden)
Qianqian Yang
Full Text Available Tyrosine phosphorylation and dephosphorylation have emerged as fundamentally important mechanisms of signal transduction and regulation in eukaryotic cells, governing many processes, but little has been known about their functions in filamentous fungi. In this study, we deleted two putative protein tyrosine phosphatase (PTP genes (BcPTPA and BcPTPB in Botrytis cinerea, encoding the orthologs of Saccharomyces cerevisiae Ptp2 and Ptp3, respectively. Although BcPtpA and BcPtpB have opposite functions in conidiation, they are essential for sclerotial formation in B. cinerea. BcPTPA and BcPTPB deletion mutants ΔBcPtpA-10 and ΔBcPtpB-4 showed significantly increased sensitivity to osmotic and oxidative stresses, and to cell wall damaging agents. Inoculation tests showed that both mutants exhibited dramatically decreased virulence on tomato leaves, apples and grapes. In S. cerevisiae, it has been shown that Ptp2 and Ptp3 negatively regulate the high-osmolarity glycerol (HOG pathway and the cell wall integrity (CWI pathway. Although both BcPtpA and BcPtpB were able to inactive Hog1 and Mpk1 in S. cerevisiae, in contrast to S. cerevisiae, they positively regulate phosphorylation of BcSak1 (the homologue of Hog1 and BcBmp3 (the homologue of Mpk1 in B. cinerea under stress conditions. These results demonstrated that functions of PTPs in B. cinerea are different from those in S. cerevisiae, and BcPtpA and BcPtpB play important roles in regulation of vegetative development, virulence and in adaptation to oxidative, osmotic and cell-wall damage stresses in B. cinerea.
Search for Bc+ decays to two charm mesons
Directory of Open Access Journals (Sweden)
R. Aaij
2018-05-01
Full Text Available A search for decays of Bc+ mesons to two charm mesons is performed for the first time using data corresponding to an integrated luminosity of 3.0fb−1, collected by the LHCb experiment in pp collisions at centre-of-mass energies of 7 and 8 TeV. The decays considered are Bc+→D(s(⁎+D‾(⁎0 and Bc+→D(s(⁎+D(⁎0, which are normalised to high-yield B+→D(s+D‾0 decays. No evidence for a signal is found and limits are set on twelve Bc+ decay modes.
International Nuclear Information System (INIS)
Anon.
2005-01-01
The abandonment of the proposed natural gas-fired Duke Point Power Project on Vancouver Island was discussed. It was suggested that the continuing appeal process increases the risk that the plant will not be built in time. The news followed a decision by the British Columbia (BC) Court of Appeal to hear an appeal of the project by a number of intervenors. Over $170 million has been spent on the project to date. The decision will impact the BC treasury, as the amount is being deducted from the dividends that BC Hydro would have paid to the government. A coalition of individuals and environmental groups, as well as local industry, are opposed to the plant on the basis of increased greenhouse (GHG) emissions and higher natural gas prices. The project would have required a natural gas pipeline to be built under Georgia Strait. The project was thought necessary due to the deteriorating condition of high voltage direct current cables running under the strait. BC Hydro's fallback plan for the island is load reduction. A new transmission line is also planned
BC Hydro shops for GHG offsets
International Nuclear Information System (INIS)
Anon.
2000-01-01
BC Hydro is reported to have offered to purchase one million tonnes of carbon dioxide reductions in Canada's Greenhouse Gas Emissions Reduction Trading program (GERT). The program uses a baseline and credit system, where emitters purchase measurable quantities of site-specific GHG reductions. Since mid-1998, the program registered five bilateral trades and seven offers to sell. BC Hydro's recent offer is the first offer to buy. BC Hydro has made the offer to buy in expectation of the introduction of the start of the Kyoto Protocol reductions, and expects to be in the game for some time to come if it is to meet its obligations under the Kyoto Protocol. Preference will be given to projects located in Canada, but BC Hydro will consider reductions created anywhere in the world. The financial range of a single trade is between $50,000 and $1 million. (GHG offsets are currently trading in North America for between $.50 and $3.00 Cdn per metric tonne of carbon dioxide equivalent.) At present, offsets are selling at a heavily discounted price because of the uncertainty that investments made now will be credited against future regulations curbing emitters. Consequently, buying now while prices are low, may lead to sizable benefits later, depending on the actual regulations when they are promulgated. Trading now will also give BC Hydro greater credibility and assurance to have its voice heard when discussions about emissions trading and the implementation of emission trading rules reaches the serious stage
Biogenesis of the yeast cytochrome bc1 complex.
Zara, Vincenzo; Conte, Laura; Trumpower, Bernard L
2009-01-01
The mitochondrial respiratory chain is composed of four different protein complexes that cooperate in electron transfer and proton pumping across the inner mitochondrial membrane. The cytochrome bc1 complex, or complex III, is a component of the mitochondrial respiratory chain. This review will focus on the biogenesis of the bc1 complex in the mitochondria of the yeast Saccharomyces cerevisiae. In wild type yeast mitochondrial membranes the major part of the cytochrome bc1 complex was found in association with one or two copies of the cytochrome c oxidase complex. The analysis of several yeast mutant strains in which single genes or pairs of genes encoding bc1 subunits had been deleted revealed the presence of a common set of bc1 sub-complexes. These sub-complexes are represented by the central core of the bc1 complex, consisting of cytochrome b bound to subunit 7 and subunit 8, by the two core proteins associated with each other, by the Rieske protein associated with subunit 9, and by those deriving from the unexpected interaction of each of the two core proteins with cytochrome c1. Furthermore, a higher molecular mass sub-complex is that composed of cytochrome b, cytochrome c1, core protein 1 and 2, subunit 6, subunit 7 and subunit 8. The identification and characterization of all these sub-complexes may help in defining the steps and the molecular events leading to bc1 assembly in yeast mitochondria.
The BC-Alberta intertie : impact of regulatory change
International Nuclear Information System (INIS)
Christian, J.; Hughes, K.
2004-01-01
The interconnected electricity system between the provinces of British Columbia (BC) and Alberta was discussed with reference to the Cranbrook-Langdon 500 kV line and two 138 kV transmission lines. The lines in British Columbia are owned by BC Hydro and operated by the BC Transmission Corporation, while the lines in Alberta are owned by AltaLink and operated by the Alberta Electric Systems Operator (AESO). The operating terms and conditions are established by an Interconnection Agreement between all parties. The Alberta-BC Intertie was designed to operate at an operating transfer capacity of 1200 MW from BC to Alberta, and 1000 MW from Alberta to BC. The operational limits on Intertie capacity were imposed due to voltage constraints within Alberta during high load periods resulting from insufficient transmission support. It was noted that available capacity is often under-utilized because sometimes it is not economical to schedule into or out of Alberta due to better market conditions in the Pacific Northwest. Transmission users in BC have explicit transmission rights which must be purchased on an hourly basis. However, transmission rights in Alberta follow dispatch of generation through Power Pool bidding. The impact of an under-utilized transmission capacity is higher wholesale prices in both Alberta and in the Pacific Northwest because ratepayers end up paying for the under-used capacity. This presentation also outlined regulatory change in Alberta with reference to consolidation of Alberta's Transmission Administrator, Power Pool Administrator and system controller functions; Alberta's new transmission policy; and, the enhanced role of market surveillance administrator. It also outlined the regulatory change in British Columbia with reference to the creation of the BC Transmission Corporation; the Heritage Contract; and, stepped rates and retail access. The effect of changes on intertie usage in both Alberta and British Columbia were also outlined. 31 refs
Symmetry Properties of Single-Walled BC2N Nanotubes
Directory of Open Access Journals (Sweden)
Lin Jianyi
2009-01-01
Full Text Available Abstract The symmetry properties of the single-walled BC2N nanotubes were investigated. All the BC2N nanotubes possess nonsymmorphic line groups. In contrast with the carbon and boron nitride nanotubes, armchair and zigzag BC2N nanotubes belong to different line groups, depending on the index n (even or odd and the vector chosen. The number of Raman- active phonon modes is almost twice that of the infrared-active phonon modes for all kinds of BC2N nanotubes.
International Nuclear Information System (INIS)
1997-03-01
The 100-BC-1, 100-BC-2, 100-DR-1, and 100-DR-2 Group 3 waste sites contain 22 past-practice liquid waste disposal sites and process effluent piping associated with four plutonium-production nuclear reactors that operated from 1944 to 1967. The 100-BC-1, 100-BC-2, 100-DR-1, and 100-DR-2 Group 3 waste sites are the third set of Hanford 100 Area sites to undergo remediation to the extent practicable. Like the sites listed in Groups 1 and 2, the Group 3 sites are considered high-priority because of the contaminants present and their proximity to the Columbia River. Remediation of the 100-BC-1, 100-HR-1 and 100-DR-1 radioactive liquid waste sites is planned to occur in two phases: The first phase, which has been completed, was a demonstration project in the 100-B/C Area to test field techniques and acquire contamination data. The second phase is full-scale remediation of all the reactor areas, starting in the 10-B/C Area, using the field experience gained in the first phase and each subsequent reactor area remediation. This document provides the DQO in support of remediation sampling and analysis at selected sites in the 100-B/C and 100-D Areas
Climate impact on BC Hydro's water resources
International Nuclear Information System (INIS)
Smith, D.; Rodenhuis, D.
2008-01-01
BC Hydro like many other hydro utilities has used the historical record of weather and runoff as the standard description the variability and uncertainty of the key weather drivers for its operation and planning studies. It has been conveniently assumed that this historical record is or has been statistically stationary and therefore is assumed to represent the future characteristics of climatic drivers on our system. This assumption is obviously no longer justifiable. To address the characterisation of future weather, BC Hydro has a multi-year a directed research program with the Pacific Climate Impacts Consortium to evaluate the impacts of climate change on the water resources that BC Hydro manages for hydropower generation and other uses. The objective of this program is to derive climate change adjusted meteorologic and hydrologic sequences suitable for use in system operations and planning studies. These climate-adjusted sequences then can be used to test system sensitivity to climate change scenarios relative to the baseline of the historical record. This paper describes BC Hydro's research program and the results achieved so far. (author)
Search for the $B_c$ meson in hadronic $Z^0$ decays
Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Beeston, C.; Behnke, T.; Bell, A.N.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bloomer, J.E.; Bobinski, M.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Clarke, P.E.L.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallapiccola, C.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; Desch, K.; Dienes, B.; Dixit, M.S.; Doucet, M.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Edwards, J.E.G.; Estabrooks, P.G.; Evans, H.G.; Evans, M.; Fabbri, F.; Fanfani, A.; Fanti, M.; Faust, A.A.; Feld, L.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Fong, D.G.; Foucher, M.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geddes, N.I.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Giacomelli, R.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Goodrick, M.J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hart, P.A.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Hutchcroft, D.E.; Igo-Kemenes, P.; Imrie, D.C.; Ingram, M.R.; Ishii, K.; Jawahery, A.; Jeffreys, P.W.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jones, G.; Jones, M.; Jost, U.; Jovanovic, P.; Junk, T.R.; Kanzaki, J.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kirk, J.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lahmann, R.; Lai, W.P.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Markus, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mikenberg, G.; Miller, D.J.; Mincer, A.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Muller, U.; Mihara, S.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Oldershaw, N.J.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Posthaus, A.; Rembser, C.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rooke, A.; Rossi, A.M.; Routenburg, P.; Rozen, Y.; Runge, K.; Runolfsson, O.; Ruppel, U.; Rust, D.R.; Rylko, R.; Sachs, K.; Saeki, T.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schleper, P.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schultz-Coulon, H.C.; Schumacher, M.; Schwick, C.; Scott, W.G.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skillman, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Springer, Robert Wayne; Sproston, M.; Stephens, K.; Steuerer, J.; Stockhausen, B.; Stoll, K.; Strom, David M.; Strohmer, R.; Szymanski, P.; Tafirout, R.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Utzat, P.; Van Kooten, Rick J.; Verzocchi, M.; Vikas, P.; Vokurka, E.H.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilkens, B.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.
1998-01-01
A search for decays of the B_c meson was performed using data collected from 1990-1995 with the OPAL detector on or near the Z peak at LEP. The decay channels B_c^+ -> J/psi pi^+, B_c^+ -> J/psi a_1^+ and B_c^+ -> J/psi ell^+ nu were investigated, where ell denotes an electron or a muon. Two candidates are observed in the mode B_c^+ -> J/psi pi^+, with an estimated background of (0.63 +/- 0.20) events. The weighted mean of the masses of the two candidates is (6.32 +/- 0.06) GeV/c^2, which is consistent with the predicted mass of the B_c meson. One candidate event is observed in the mode B_c^+ -> J/psi ell^+ nu with an estimated background of (0.82 +/- 0.19) events. No candidate events are observed in the B_c^+ -> J/psi a_1^+ decay mode, with an estimated background of (1.10 +/- 0.22) events. Upper bounds at the 90% confidence level are set on the production rates for these processes.
Economic impacts of the BC recycling regulation
Energy Technology Data Exchange (ETDEWEB)
NONE
2008-08-31
Extended producer responsibility (EPR) is an environmental approach used in British Columbia (BC) to consider the entire life cycle of a product from the selection and materials and design to the post-consumer stage. This paper discussed EPR strategies that are currently being used to help the BC government remove toxins from its waste stream and develop recycling programs that contribute to the sustainable use of BC's resources. BC's recycling regulation was designed to ensure that producers of designated materials take responsibility for managing products at end-of-life under approved product stewardship plans. The stewardship management recycling program has provided an estimated 1600 full-time equivalent jobs in the province. Overall employment rates are expected to reach over 2100. A waste reduction model (WARM) analysis showed that BC stewardships provide an estimated reduction of 73,000 metric tonnes of carbon equivalent (MTCE). Aluminum can and tire recycling programs account for 82 per cent of the reductions. Diverting the wastes from landfill has helped to avoid the costs of remedial clean-ups as well as avoid the costs of handling hazardous materials. It was concluded that total revenues of $109 million were earned in 2007 from fees, deposits, and the sale of recovered materials. Separate data were provided for stewardship programs for beverage containers; beer containers; tires; used oil; electronics; paint, flammables, and pesticides; tree paint; and pharmaceuticals. 28 tabs., 5 figs.
Aad, Georges; Abdallah, Jalal; Abdinov, Ovsat; Aben, Rosemarie; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Alimonti, Gianluca; Alio, Lion; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Bacci, Cesare; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bain, Travis; Baines, John; Baker, Oliver Keith; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Bansil, Hardeep Singh; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James Baker; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Kathrin; Becker, Maurice; Becker, Sebastian; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Beringer, Jürg; Bernard, Clare; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertsche, Carolyn; Bertsche, David; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bevan, Adrian John; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blanco, Jacobo Ezequiel; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boehler, Michael; Bogaerts, Joannes Andreas; Bogavac, Danijela; Bogdanchikov, Alexander; Bohm, Christian; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozic, Ivan; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Breaden Madden, William Dmitri; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Lydia; Brenner, Richard; Bressler, Shikma; Bristow, Kieran; Bristow, Timothy Michael; Britton, Dave; Britzger, Daniel; Brochu, Frederic; Brock, Ian; Brock, Raymond; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bruscino, Nello; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Buchholz, Peter; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bullock, Daniel; Burckhart, Helfried; Burdin, Sergey; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Buzykaev, Aleksey; Cabrera Urbán, Susana; Caforio, Davide; Cairo, Valentina; Cakir, Orhan; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Caloba, Luiz; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarda, Stefano; Camarri, Paolo; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Cardillo, Fabio; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Caudron, Julien; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Charlton, Dave; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Ye; Cheng, Hok Chuen; Cheng, Yangyang; Cheplakov, Alexander; Cheremushkina, Evgenia; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Childers, John Taylor; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Choi, Kyungeon; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christodoulou, Valentinos; Chromek-Burckhart, Doris; Chudoba, Jiri; Chuinard, Annabelle Julia; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Cinca, Diane; Cindro, Vladimir; Cioara, Irina Antonela; Ciocio, Alessandra; Citron, Zvi Hirsh; Ciubancan, Mihai; Clark, Allan G; Clark, Brian Lee; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Cogan, Joshua Godfrey; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Connell, Simon Henry; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Côté, David; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Dandoy, Jeffrey Rogers; Dang, Nguyen Phuong; Daniells, Andrew Christopher; Danninger, Matthias; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davison, Peter; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Deigaard, Ingrid; Del Peso, Jose; Del Prete, Tarcisio; Delgove, David; Deliot, Frederic; Delitzsch, Chris Malena; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; DeMarco, David; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaconu, Cristinel; Diamond, Miriam; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; Barros do Vale, Maria Aline; Dobos, Daniel; Dobre, Monica; Doglioni, Caterina; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Drechsler, Eric; Dris, Manolis; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Duflot, Laurent; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Duschinger, Dirk; Dyndal, Mateusz; Eckardt, Christoph; Ecker, Katharina Maria; Edgar, Ryan Christopher; Edson, William; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Elliot, Alison; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Erdmann, Johannes; Ereditato, Antonio; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Faucci Giannelli, Michele; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Feremenga, Last; Fernandez Martinez, Patricia; Fernandez Perez, Sonia; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Cora; Fischer, Julia; Fisher, Wade Cameron; Fitzgerald, Eric Andrew; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Fletcher, Rob Roy MacGregor; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Formica, Andrea; Forti, Alessandra; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Francis, David; Franconi, Laura; Franklin, Melissa; Frate, Meghan; Fraternali, Marco; Freeborn, David; French, Sky; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yanyan; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudiello, Andrea; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Geisler, Manuel Patrice; Gemme, Claudia; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giromini, Paolo; Giugni, Danilo; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gkougkousis, Evangelos Leonidas; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godlewski, Jan; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Goujdami, Driss; Goussiou, Anna; Govender, Nicolin; Gozani, Eitan; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Graziani, Enrico; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Grout, Zara Jane; Guan, Liang; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Gupta, Shaun; Gustavino, Giuliano; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Haefner, Petra; Hageböck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Haley, Joseph; Hall, David; Halladjian, Garabed; Hallewell, Gregory David; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Maike Christina; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harrington, Robert; Harrison, Paul Fraser; Hartjes, Fred; Hasegawa, Makoto; Hasegawa, Satoshi; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauser, Reiner; Hauswald, Lorenz; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hays, Jonathan Michael; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Lukas; Hejbal, Jiri; Helary, Louis; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Hengler, Christopher; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Hernández Jiménez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hetherly, Jeffrey Wayne; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hinman, Rachel Reisner; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hohlfeld, Marc; Hohn, David; Holmes, Tova Ray; Homann, Michael; Hong, Tae Min; Hooft van Huysduynen, Loek; Hopkins, Walter; Horii, Yasuyuki; Horton, Arthur James; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hrynevich, Aliaksei; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Qipeng; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Ilchenko, Iurii; Iliadis, Dimitrios; Ilic, Nikolina; Inamaru, Yuki; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Ivarsson, Jenny; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jabbar, Samina; Jackson, Brett; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansky, Roland; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanty, Laura; Jejelava, Juansher; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Yi; Jiggins, Stephen; Jimenez Pena, Javier; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kahn, Sebastien Jonathan; Kajomovitz, Enrique; Kalderon, Charles William; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karamaoun, Andrew; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Kehoe, Robert; Keller, John; Kempster, Jacob Julian; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Keyes, Robert; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharlamov, Alexey; Khoo, Teng Jian; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hee Yeun; Kim, Hyeon Jin; Kim, Shinhong; Kim, Young-Kee; Kimura, Naoki; Kind, Oliver Maria; King, Barry; King, Matthew; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kiuchi, Kenji; Kivernyk, Oleh; Kladiva, Eduard; Klein, Matthew Henry; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Aine; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; König, Sebastian; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Kortner, Oliver; Kortner, Sandra; Kosek, Tomas; Kostyukhin, Vadim; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumeli-Charalampidi, Athina; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Krizka, Karol; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuger, Fabian; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunigo, Takuto; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kurumida, Rie; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwan, Tony; Kyriazopoulos, Dimitrios; La Rosa, Alessandro; La Rosa Navarro, Jose Luis; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Lambourne, Luke; Lammers, Sabine; Lampen, Caleb; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, J örn Christian; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Lazovich, Tomo; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeBlanc, Matthew Edgar; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leisos, Antonios; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Leroy, Claude; Lester, Christopher; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Lewis, Adrian; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Shu; Li, Yichen; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Liblong, Aaron; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Hao; Liu, Jian; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Long, Brian Alexander; Long, Jonathan David; Long, Robin Eamonn; Looper, Kristina Anne; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lösel, Philipp Jonathan; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Macdonald, Calum Michael; Machado Miguens, Joana; Macina, Daniela; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeland, Steffen; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maier, Thomas; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mancini, Giada; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mantoani, Matteo; Mapelli, Livio; March, Luis; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marjanovic, Marija; Marley, Daniel; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian Thomas; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Mario; Martin-Haugh, Stewart; Martoiu, Victor Sorin; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazza, Simone Michele; Mazzaferro, Luca; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Middleton, Robin; Miglioranzi, Silvia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milesi, Marco; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Mönig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Morinaga, Masahiro; Morisbak, Vanja; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Mortensen, Simon Stark; Morton, Alexander; Morvaj, Ljiljana; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Ralph Soeren Peter; Mueller, Thibaut; Muenstermann, Daniel; Mullen, Paul; Mullier, Geoffrey; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagata, Kazuki; Nagel, Martin; Nagy, Elemer; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Naranjo Garcia, Roger Felipe; Narayan, Rohin; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Nef, Pascal Daniel; Negri, Andrea; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolopoulos, Konstantinos; Nilsen, Jon Kerr; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nomachi, Masaharu; Nomidis, Ioannis; Nooney, Tamsin; Norberg, Scarlet; Nordberg, Markus; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; Nuti, Francesco; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Ochoa-Ricoux, Juan Pedro; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Oide, Hideyuki; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Rhys Edward; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Palma, Alberto; Pan, Yibin; Panagiotopoulou, Evgenia; Pandini, Carlo Enrico; Panduro Vazquez, William; Pani, Priscilla; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parker, Kerry Ann; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pasqualucci, Enrico; Passaggio, Stefano; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Pauly, Thilo; Pearce, James; Pearson, Benjamin; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Pettersson, Nora Emilia; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Pickering, Mark Andrew; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pires, Sylvestre; Pitt, Michael; Pizio, Caterina; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Pluth, Daniel; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Polesello, Giacomo; Poley, Anne-luise; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Prell, Soeren; Price, Darren; Price, Lawrence; Primavera, Margherita; Prince, Sebastien; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Ptacek, Elizabeth; Puddu, Daniele; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quarrie, David; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Raddum, Silje; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Rangel-Smith, Camila; Rauscher, Felix; Rave, Stefan; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reisin, Hernan; Relich, Matthew; Rembser, Christoph; Ren, Huan; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter, Stefan; Richter-Was, Elzbieta; Ricken, Oliver; Ridel, Melissa; Rieck, Patrick; Riegel, Christian Johann; Rieger, Julia; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ristić, Branislav; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Roe, Shaun; Røhne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romano Saez, Silvestre Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Peyton; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Russell, Heather; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sabato, Gabriele; Sacerdoti, Sabrina; Saddique, Asif; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Saimpert, Matthias; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sannino, Mario; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sasaki, Osamu; Sasaki, Yuichi; Sato, Koji; Sauvage, Gilles; Sauvan, Emmanuel; Savage, Graham; Savard, Pierre; Sawyer, Craig; Sawyer, Lee; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaefer, Ralph; Schaeffer, Jan; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Schiavi, Carlo; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Sebastian; Schmitt, Stefan; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schopf, Elisabeth; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schwegler, Philipp; Schweiger, Hansdieter; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seema, Pienpen; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekhon, Karishma; Sekula, Stephen; Seliverstov, Dmitry; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Sessa, Marco; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shaw, Savanna Marie; Shcherbakova, Anna; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shiyakova, Mariya; Shmeleva, Alevtina; Shoaleh Saadi, Diane; Shochet, Mel; Shojaii, Seyedruhollah; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silver, Yiftah; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simon, Dorian; Simoniello, Rosa; Sinervo, Pekka; Sinev, Nikolai; Siragusa, Giovanni; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinner, Malcolm Bruce; Skottowe, Hugh Philip; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Slawinska, Magdalena; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Matthew; Smith, Russell; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Song, Hong Ye; Soni, Nitesh; Sood, Alexander; Sopczak, Andre; Sopko, Bruno; Sopko, Vit; Sorin, Veronica; Sosa, David; Sosebee, Mark; Sotiropoulou, Calliope Louisa; Soualah, Rachik; Soukharev, Andrey; South, David; Sowden, Benjamin; Spagnolo, Stefania; Spalla, Margherita; Spanò, Francesco; Spearman, William Robert; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; Spreitzer, Teresa; St Denis, Richard Dante; Staerz, Steffen; Stahlman, Jonathan; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Shota; Suzuki, Yu; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Shuji; Tannenwald, Benjamin Bordy; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Tepel, Fabian-Phillipp; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Ray; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thun, Rudolf; Tibbetts, Mark James; Ticse Torres, Royer Edson; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Truong, Loan; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turra, Ruggero; Turvey, Andrew John; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urban, Jozef; Urquijo, Phillip; Urrejola, Pedro; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valderanis, Chrysostomos; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloce, Laurelle Maria; Veloso, Filipe; Velz, Thomas; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wang, Chao; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; Wharton, Andrew Mark; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wildauer, Andreas; Wilkens, Henric George; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, Alan; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winter, Benedict Tobias; Wittgen, Matthias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wu, Mengqing; Wu, Miles; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yakabe, Ryota; Yamada, Miho; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Shimpei; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Yi; Yao, Weiming; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zalieckas, Justas; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Huijun; Zhang, Jinlong; Zhang, Lei; Zhang, Ruiqi; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Xiandong; Zhao, Yongke; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Chen; Zhou, Lei; Zhou, Li; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Stephanie; Zinonos, Zinonas; Zinser, Markus; Ziolkowski, Michael; Živković, Lidija; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zwalinski, Lukasz
2016-01-05
The decays $B_c^+ \\to J/\\psi D_s^+$ and $B_c^+ \\to J/\\psi D_s^{*+}$ are studied with the ATLAS detector at the LHC using a dataset corresponding to integrated luminosities of 4.9 fb$^{-1}$ and 20.6 fb$^{-1}$ of $pp$ collisions collected at centre-of-mass energies $\\sqrt{s} = 7$ TeV and 8 TeV, respectively. Signal candidates are identified through $J/\\psi\\to\\mu^+\\mu^-$ and $D_s^{(*)+}\\to\\phi\\pi^+(\\gamma/\\pi^0)$ decays. With a two-dimensional likelihood fit involving the $B_c^+$ reconstructed invariant mass and an angle between the $\\mu^+$ and $D_s^+$ candidate momenta in the muon pair rest frame, the yields of $B_c^+ \\to J/\\psi D_s^+$ and $B_c^+ \\to J/\\psi D_s^{*+}$, and the transverse polarisation fraction in $B_c^+ \\to J/\\psi D_s^{*+}$ decay are measured. The transverse polarisation fraction is determined to be $\\Gamma_{\\pm\\pm}(B_c^+ \\to J/\\psi D_s^{*+})/\\Gamma(B_c^+ \\to J/\\psi D_s^{*+}) = 0.38 \\pm 0.23 \\pm 0.07$, and the derived ratio of the branching fractions of the two modes is $\\mathcal{B}_{B_c^+ \\to J/...
Dual Nature of Translational Control by Regulatory BC RNAs ▿
Eom, Taesun; Berardi, Valerio; Zhong, Jun; Risuleo, Gianfranco; Tiedge, Henri
2011-01-01
In higher eukaryotes, increasing evidence suggests, gene expression is to a large degree controlled by RNA. Regulatory RNAs have been implicated in the management of neuronal function and plasticity in mammalian brains. However, much of the molecular-mechanistic framework that enables neuronal regulatory RNAs to control gene expression remains poorly understood. Here, we establish molecular mechanisms that underlie the regulatory capacity of neuronal BC RNAs in the translational control of gene expression. We report that regulatory BC RNAs employ a two-pronged approach in translational control. One of two distinct repression mechanisms is mediated by C-loop motifs in BC RNA 3′ stem-loop domains. These C-loops bind to eIF4B and prevent the factor's interaction with 18S rRNA of the small ribosomal subunit. In the second mechanism, the central A-rich domains of BC RNAs target eIF4A, specifically inhibiting its RNA helicase activity. Thus, BC RNAs repress translation initiation in a bimodal mechanistic approach. As BC RNA functionality has evolved independently in rodent and primate lineages, our data suggest that BC RNA translational control was necessitated and implemented during mammalian phylogenetic development of complex neural systems. PMID:21930783
Search for the $B_{c}$ meson in hadronic Z decays
Barate, R; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Pietrzyk, B; Casado, M P; Chmeissani, M; Comas, P; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Juste, A; Martínez, M; Miquel, R; Mir, L M; Orteu, S; Padilla, C; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Alemany, R; Becker, U; Bazarko, A O; Bright-Thomas, P G; Cattaneo, M; Cerutti, F; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Lutters, G; Mato, P; Minten, Adolf G; Moneta, L; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rensing, P E; Rizzo, G; Rolandi, Luigi; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Tomalin, I R; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Rossignol, J M; Fearnley, Tom; Hansen, J B; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Siotis, I; Vayaki, Anna; Blondel, A; Bonneaud, G R; Brient, J C; Bourdon, P; Rougé, A; Rumpf, M; Valassi, Andrea; Verderi, M; Videau, H L; Candlin, D J; Parsons, M I; Focardi, E; Parrini, G; Zachariadou, K; Corden, M; Georgiopoulos, C H; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Thomson, F; Turnbull, R M; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Schmidt, M; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Moutoussi, A; Nash, J; Sedgbeer, J K; Stacey, A M; Williams, M D; Dissertori, G; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Sloan, Terence; Williams, M I; Galla, A; Giehl, I; Greene, A M; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Calvet, D; Carr, J; Coyle, P; Diaconu, C A; Etienne, F; Konstantinidis, N P; Leroy, O; Motsch, F; Payre, P; Rousseau, D; Talby, M; Sadouki, A; Thulasidas, M; Trabelsi, K; Aleppo, M; Ragusa, F; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Dydak, Friedrich; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Choi, Y; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Jacquet, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Schune, M H; Simion, S; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Batignani, G; Bettarini, S; Bozzi, C; Calderini, G; Carpinelli, M; Ciocci, M A; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Foà, L; Forti, F; Giassi, A; Giorgi, M A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Spagnolo, P; Steinberger, Jack; Tenchini, Roberto; Tonelli, G; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Emery, S; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Johnson, R P; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Newton, W M; Reeve, J; Thompson, L F; Böhrer, A; Brandt, S; Cowan, G D; Grupen, Claus; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Rothberg, J E; Wasserbaech, S R; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y S; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Yamartino, J M; Zobernig, G
1997-01-01
A search for the Bc meson decaying into the channels J/psi pi+ and J/psi l nu (l = e or mu) is performed in a sample of 3.9 million hadronic Z decays collected by the ALEPH detector. This search results in the observation of 0 and 2 candidates in each of these channels, respectively, while 0.44 and 0.81 background events are expected. The following 90\\% confidence level upper limits are derived: Br(Z->Bc X)/Br(Z->q q )*Br(Bc->J/psi pi+) Bc X)/Br(Z->q q )*Br(Bc->J/psi l nu) J/psi(e+e-) mu nu candidate with very low background probability, found in an independent analysis, is also described in detail.
Preparation and characterization of BC/PAM-AgNPs nanocomposites for antibacterial applications.
Yang, Guang; Wang, Caixia; Hong, Feng; Yang, Xuexia; Cao, Zhangjun
2015-01-22
In this work, a bacterial cellulose/polyacrylamide (BC/PAM) double network composite was prepared to act as the template for in situ synthesis of silver nanoparticles (AgNPs). Effects of reaction conditions of the BC/PAM composite were investigated on its microstructure, mechanical properties and thermal stabilities. Both the BC/PAM composite and pure BC were utilized to prepare the corresponding silver impregnated nanocomposites, i.e., BC/PAM-AgNPs and BC-AgNPs, by an environmental friendly method, UV irradiation. The influences of the templates were investigated on the AgNPs formation and the antibacterial activities of the nanocomposites by both the zone of inhibition and dynamic shake flask methods. It was shown that the BC/PAM composite displayed a denser microstructure and higher thermal stabilities than pure BC. The BC/PAM-AgNPs nanocomposite exhibited a bigger particle size and lower mass content of AgNPs than the BC-AgNPs one. For the antibacterial test, two nanocomposites exhibited a close antibacterial effect, with a high log reduction above 3 and killing ratio above 99.9%, respectively. Copyright © 2014 Elsevier Ltd. All rights reserved.
Architecture for the Secret-Key BC3 Cryptography Algorithm
Directory of Open Access Journals (Sweden)
Arif Sasongko
2011-08-01
Full Text Available Cryptography is a very important aspect in data security. The focus of research in this field is shifting from merely security aspect to consider as well the implementation aspect. This paper aims to introduce BC3 algorithm with focus on its hardware implementation. It proposes architecture for the hardware implementation for this algorithm. BC3 algorithm is a secret-key cryptography algorithm developed with two considerations: robustness and implementation efficiency. This algorithm has been implemented on software and has good performance compared to AES algorithm. BC3 is improvement of BC2 and AE cryptographic algorithm and it is expected to have the same level of robustness and to gain competitive advantages in the implementation aspect. The development of the architecture gives much attention on (1 resource sharing and (2 having single clock for each round. It exploits regularity of the algorithm. This architecture is then implemented on an FPGA. This implementation is three times smaller area than AES, but about five times faster. Furthermore, this BC3 hardware implementation has better performance compared to BC3 software both in key expansion stage and randomizing stage. For the future, the security of this implementation must be reviewed especially against side channel attack.
Directory of Open Access Journals (Sweden)
Terry Erwin
2010-11-01
Full Text Available Revisions of two new species groups of the genus Agra Fabricius are presented with the following species described as new: pusilla group - Agra cruciaria sp. n. (Brazil, Agra grace sp. n. (Ecuador, Perú, Agra max sp. n. (Brazil, Agra minasianus sp. n. (Brazil, Agra notpusilla sp. n. (Brazil, Agra pseudopusilla sp. n. (Brazil; piranha group - Agra ce sp. n. (Perú, Agra risseri sp. n. (Bolivia, Brazil, Agra maia sp. n. (Bolivia, Agra piranha sp. n. (Ecuador; Agra tiputini sp. n. (Ecuador. Species of these two groups have adults that are the smallest in the entire genus, although this does not indicate they are closely related based on other attributes. All species are Amazonian in distribution.
Band gap engineering of BC2N for nanoelectronic applications
Lim, Wei Hong; Hamzah, Afiq; Ahmadi, Mohammad Taghi; Ismail, Razali
2017-12-01
The BC2N as an example of boron-carbon-nitride (BCN), has the analogous structure as the graphene and boron nitride. It is predicted to have controllable electronic properties. Therefore, the analytical study on the engineer-able band gap of the BC2N is carried out based on the schematic structure of BC2N. The Nearest Neighbour Tight Binding (NNTB) model is employed with the dispersion relation and the density of state (DOS) as the main band gap analysing parameter. The results show that the hopping integrals having the significant effect on the band gap, band structure and DOS of BC2N nanowire (BC2NNW) need to be taken into consideration. The presented model indicates consistent trends with the published computational results around the Dirac points with the extracted band gap of 0.12 eV. Also, it is distinguished that wide energy gap of boron nitride (BN) is successfully narrowed by this carbon doped material which assures the application of BC2N on the nanoelectronics and optoelectronics in the near future.
P-wave excited {B}_{c}^{* * } meson photoproduction at the LHeC
Kai, He; Huan-Yu, Bi; Ren-You, Zhang; Xiao-Zhou, Li; Wen-Gan, Ma
2018-05-01
As an important sequential work of the S-wave {B}c(* ) ({}1{S}0({}3{S}1) ) meson production at the large hadron electron collider (LHeC), we investigate the production of the P-wave excited {B}c* * states (1 P 1 and 3 P J with J = 0, 1, 2) via photoproduction mechanism within the framework of nonrelativistic QCD at the LHeC. Generally, the {e}-+P\\to γ +g\\to {B}c* * +b+\\bar{c} process is considered as the main production mechanism at an electron–proton collider due to the large luminosity of the gluon. However, according to our experience on the S-wave {B}c(* ) meson production at the LHeC, the extrinsic production mechanism, i.e., {e}-+P\\to γ +c\\to {B}c* * +b and {e}-+P\\to γ +\\bar{b} \\to {B}c* * +\\bar{c}, could also provide dominating contributions at low p T region. A careful treatment between these channels is performed and the results on total and differential cross sections, together with main uncertainties are discussed. Taking the quark masses m b = 4.90 ± 0.40 GeV and m c = 1.50 ± 0.20 GeV into account and summing up all the production channels, we expect to accumulate ({2.48}-1.75+3.55)× {10}4 {B}c* * ({}1{P}1), ({1.14}-0.82+1.49)× {10}4 {B}c* * ({}3{P}0),({2.38}-1.74+3.39)× {10}4 {B}c* * ({}3{P}1) and ({5.59}-3.93+7.84)× {10}4 {B}c* * ({}3{P}2) events at the \\sqrt{S}=1.30 {{T}}{{e}}{{V}} LHeC in one operation year with luminosity { \\mathcal L }={10}33 cm‑2 s‑1. With such sizable events, it is worth studying the properties of excited P-wave {B}c* * states at the LHeC.
Okounkov's BC-Type Interpolation Macdonald Polynomials and Their q=1 Limit
Koornwinder, T.H.
2015-01-01
This paper surveys eight classes of polynomials associated with A-type and BC-type root systems: Jack, Jacobi, Macdonald and Koornwinder polynomials and interpolation (or shifted) Jack and Macdonald polynomials and their BC-type extensions. Among these the BC-type interpolation Jack polynomials were
Abulencia, A; Acosta, D; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Bachocou, H; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Ben-Haim, E; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bishai, M; Blair, R E; Blocker, C; Bloom, K; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Bourov, S; Boveia, A; Brau, B; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chapman, J; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Chu, P H; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Cijliak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Connolly, A; Convery, M; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Cranshaw, J; Cruz, A; Cuevas, J; Culbertson, R; Cyr, D; Da Ronco, S; D'Auria, S; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Demers, S; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Devlin, T; Dionisi, C; Dittmann, J R; DiTuro, P; Dörr, C; Dominguez, A; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Ebina, K; Efron, J; Ehlers, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Flores-Castillo, L R; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Fujii, Y; Furic, I; Gajjar, A; Gallinaro, M; Galyardt, J; Garcia, J E; Garcia Sciveres, M; Garfinkel, A F; Gay, C; Gerberich, H; Gerchtein, E; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Ginsburg, C; Giolo, K; Giordani, M; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Gotra, Y; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Haber, C; Hahn, S R; Hahn, K; Halkiadakis, E; Hamilton, A; Han, B-Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hatakeyama, K; Hauser, J; Hays, C; Hayward, H; Heijboer, A; Heinemann, B; Heinrich, J; Hennecke, M; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Huston, J; Ikado, K; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jones, M; Joo, K K; Jun, S Y; Junk, T R; Kamon, T; Kang, J; Karagoz-Unel, M; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, M S; Kim, S B; Kim, S H; Kim, Y K; Kirby, M; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kobayashi, H; Kondo, K; Kong, D J; Konigsberg, J; Kordas, K; Korytov, A; Kotwal, A V; Kovalev, A; Kraus, J; Kravchenko, I; Kreps, M; Kreymer, A; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kuhlmann, S E; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecci, C; LeCompte, T; Lee, J; Lee, J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Li, K; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Liss, T M; Lister, A; Litvintsev, D O; Liu, T; Liu, Y; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Maksimovic, P; Manca, G; Margaroli, F; Marginean, R; Marino, C; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McGivern, D; McIntyre, P; McNamara, P; McNulty, R; Mehta, A; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; von der Mey, M; Miao, T; Miladinovic, N; Miles, J; Miller, R; Miller, J S; Mills, C; Milnik, M; Miquel, R; Miscetti, S; Mitselmakher, G; Miyamoto, A; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Mulhearn, M; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nahn, S; Nakano, I; Napier, A; Naumov, D; Necula, V; Neu, C; Neubauer, M S; Nicolas, L; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Ogawa, T; Oh, S H; Oh, Y D; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Paoletti, R; Papadimitriou, V; Papikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pitts, K; Plager, C; Pondrom, L; Pope, G; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Rakitin, A; Rappoccio, S; Ratnikov, F; Reisert, B; Rekovic, V; van Remortel, N; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Rinnert, K; Ristori, L; Robertson, W J; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Rott, C; Ruiz, A; Russ, J; Rusu, V; Ryan, D; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Salto, O; Saltzberg, D; Sanchez, C; Santi, L; Sarkar, S; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Semeria, F; Sexton-Kennedy, L; Sfiligoi, I; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sill, A; Sinervo, P; Sisakyan, A; Sjolin, J; Skiba, A; Slaughter, A J; Sliwa, K; Smirnov, D; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spezziga, M; Spinella, F; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sumorok, K; Sun, H; Suzuki, T; Taffard, A; Tafirout, R; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Tether, S; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tollefson, K; Tomura, T; Tonelli, D; Tönnesmann, M; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vacavant, L; Vaiciulis, A; Vallecorsa, S; Varganov, A; Vataga, E; Velev, G; Veramendi, G; Veszpremi, V; Vickey, T; Vidal, R; Vila, I; Vilar, R; Vollrath, I; Volobouev, I; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wallny, R; Walter, T; Wan, Z; Wang, M J; Wang, S M; Warburton, A; Ward, B; Waschke, S; Waters, D; Watts, T; Weber, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Worm, S; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, Y; Yang, C; Yang, U K; Yao, W M; Yeh, G P; Yi, K; Yoh, J; Yorita, K; Yoshida, T; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zetti, F; Zhang, X; Zhou, J; Zucchelli, S
2006-03-03
We report the first evidence for a fully reconstructed decay mode of the B(c)+- meson in the channel B(c)+- --> J/psi pi+-, with J/psi --> mu+ mu-. The analysis is based on an integrated luminosity of 360 pb(-1) in pp collisions at 1.96 TeV center of mass energy collected by the Collider Detector at Fermilab. We observe 14.6 +/- 4.6 signal events with a background of 7.1 +/- 0.9 events, and a fit to the J/psi pi+-mass spectrum yields a B(c)+- mass of 6285.7 +/- 5.3(stat) +/- 1.2(syst) MeV/c2. The probability of a peak of this magnitude occurring by random fluctuation in the search region is estimated as 0.012%.
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casanova Mohr, Raimon; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew Christopher; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Domenico, Antonio; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gastaldi, Ugo; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lowdon, Peter; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skillicorn, Ian; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Sterpka, Christopher Francis; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viana Barbosa, Joao Vitor; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wiedner, Dirk; Wilkinson, Guy; Wilkinson, Michael; Williams, Matthew; Williams, Mike; Wilschut, Hans; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang
2015-01-01
The difference in total widths between the $B_c^+$ and $B^+$ mesons is measured using 3.0fb$^{-1}$ of data collected by the LHCb experiment in 7 and 8 TeV centre-of-mass energy proton-proton collisions at the LHC. Through the study of the time evolution of $B_c^+ \\rightarrow J/\\psi \\pi^+$ and $B^+\\rightarrow J/\\psi K^+$ decays, the width difference is measured to be $ \\Delta\\Gamma \\equiv \\Gamma_{B_c^+} - \\Gamma_{B^+} = 4.46 \\pm 0.14 \\pm 0.07mm^{-1}c,$ where the first uncertainty is statistical and the second systematic. The known lifetime of the $B^+$ meson is used to convert this to a precise measurement of the $B_c^+$ lifetime, $\\tau_{B_c^+} = 513.4 \\pm 11.0 \\pm 5.7fs,$ where the first uncertainty is statistical and the second systematic.
A Study on BC Emission from Vehicles using Different Types of Fuel
Kim, K.; Son, J.; Kim, J.; Kim, S.; Park, G.; Sung, K.; Kim, I.; Chung, T.; Park, T.; Kang, S.; Ban, J.; Kim, J.; Hong, Y. D.; Woo, J. H.; Lee, T.
2017-12-01
Black carbon (BC) is an anthropogenic aerosol from fossil fuels, and biomass burning. It absorbs solar radiation, and heats the atmosphere leading 0.4W m-2 radiative forcing. BC is a particle that can cause serious effects on human body as well. Toxicological studies of black carbon suggests that BC may be an important carrier of toxic chemicals to human body. The recent researches show that one of the main precursor of BC is vehicle emission, but the inventory of BC emission rate from vehicle is inadequate in South Korea. This study tries to find differences of BC emission from different sizes of vehicles using different types of fuels. Fuels used in vehicles are gasoline, liquefied petroleum gas (LPG), and diesel. BC was directly measured from the tail pipe of vehicles using Aethalometer (AE33, Magee Scientific Corporation). This study was conducted in Transport Pollutant Research Center, National Institute of Environmental Research, South Korea. Measurement was progressed with the five different test modes of speeds. Speed modes includes 4.7, 17.3, 34.1, 65.4, and 97.3 km h-1. Emission rate of BC was high in the slowest speed mode, and showed decrease with increase of the speed of vehicles. Gasoline vehicles had the relatively higher emission rate of BC than the LPG vehicle, while the emission rate of BC for Diesel with DPF (Diesel Particle Filter) was observed to be the lowest.
B.C. Hydro : 1997 annual report
International Nuclear Information System (INIS)
1997-01-01
Operating and financial information from B.C. Hydro for 1997 is presented. B.C. Hydro is the third largest electric utility in Canada. The utility generates between 43,000 and 54,000 gigawatt-hours of electricity annually. More than 80 per cent of the electricity is produced by major hydroelectric generating stations on the Columbia and Peace rivers. This report presents a picture of improved financial performance, details of all revenues and expenditures and capsule summaries of the Utility's operations. The report also addresses issues regarding strategic direction, local and international competition, and consultation and regulatory activities. tabs. and figs
Wood ethanol: a BC value-added opportunity
Energy Technology Data Exchange (ETDEWEB)
McCloy, B. W.; O' Connor, D. V.
1998-12-01
The environmental, economic and social benefits to be derived from the conversion of woodwaste to ethanol are reviewed as part of the justification by the Greenhouse Gas Forum, a multi-stakeholder environmental advisory group, to recommend to the BC government to support the development and commercialization of technologies to produce ethanol fuel using waste from British Columbia's sawmills. The Greenhouse Gas Forum also recommended government support for the construction of a demonstration ethanol plant by the private sector. The principal arguments underlying the Greenhouse Gas Forum's recommendations are: (1) reduction in BC's greenhouse gas emissions by one mega tonne, or two per cent of BC's 1990 emissions, (2) reducing carbon monoxide , nitrogen oxides, volatile organic compounds and other toxic emissions that contribute to urban smog, and (3) accelerating the elimination of sawmill waste burners and providing a substitute for MMT (methylcyclopentadienyl manganese tricarbonyl, a fuel additive) and MTBE ( methyl tertiary butyl ether, a component used in gasoline), thus helping to reduce health hazards from fine particulate inhalation. Economic and social benefits envisaged include creation of leading edge technology at the University of British Columbia, a substantial number of new jobs, and the potential for the development of various co-products from wood ethanol conversion. The report examines five different technologies to produce ethanol (the processes developed by Iogen, BC International, and Arkenol Inc., the Paszner ACOS process and a gasification-fermentation process), the market demand for ethanol blended gasoline and concludes that there are strong environmental, health and economic reasons for BC to increase the use of wood-ethanol as a transportation fuel and to support the establishment of an ethanol plant using wood residue. 27 refs., 5 tabs., 6 figs., 1 glossary.
Wood ethanol: a BC value-added opportunity
International Nuclear Information System (INIS)
McCloy, B. W.; O'Connor, D. V.
1998-12-01
The environmental, economic and social benefits to be derived from the conversion of woodwaste to ethanol are reviewed as part of the justification by the Greenhouse Gas Forum, a multi-stakeholder environmental advisory group, to recommend to the BC government to support the development and commercialization of technologies to produce ethanol fuel using waste from British Columbia's sawmills. The Greenhouse Gas Forum also recommended government support for the construction of a demonstration ethanol plant by the private sector. The principal arguments underlying the Greenhouse Gas Forum's recommendations are: (1) reduction in BC's greenhouse gas emissions by one mega tonne, or two per cent of BC's 1990 emissions, (2) reducing carbon monoxide , nitrogen oxides, volatile organic compounds and other toxic emissions that contribute to urban smog, and (3) accelerating the elimination of sawmill waste burners and providing a substitute for MMT (methylcyclopentadienyl manganese tricarbonyl, a fuel additive) and MTBE ( methyl tertiary butyl ether, a component used in gasoline), thus helping to reduce health hazards from fine particulate inhalation. Economic and social benefits envisaged include creation of leading edge technology at the University of British Columbia, a substantial number of new jobs, and the potential for the development of various co-products from wood ethanol conversion. The report examines five different technologies to produce ethanol (the processes developed by Iogen, BC International, and Arkenol Inc., the Paszner ACOS process and a gasification-fermentation process), the market demand for ethanol blended gasoline and concludes that there are strong environmental, health and economic reasons for BC to increase the use of wood-ethanol as a transportation fuel and to support the establishment of an ethanol plant using wood residue. 27 refs., 5 tabs., 6 figs., 1 glossary
BC Hydro triple bottom line report 2002
International Nuclear Information System (INIS)
Anon
2002-08-01
British Columbia Hydro (BC Hydro) published this document which measures the environmental, social and economic performance of the company. It is a complement to BC Hydro's 2002 Annual Report. The report was prepared to better understand the company's business in terms of its commitment to being an environmentally, socially, and economically responsible company (the three bottom lines). BC Hydro proved its ability to integrate the three bottom lines in decision making processes by carefully examining the environmental, social and economical impacts of programs such as Power Smart, Green and Alternative Energy, and Water Use Planning. All indicators point to BC Hydro achieving its commitment of providing a minimum of 10 per cent of new demand through 2010 with new green energy sources. Water Use Plans were developed for hydroelectric generating stations, and they should all be in place by 2003. Efficiencies realised through the Power Smart program offset the increases in greenhouse gas associated with increased energy demand. Juvenile sturgeon raised in a hatchery were released into the Columbia River in May 2002. The completion of a 40-kilometre trail on the Sunshine Coast was helped by a financial contribution from BC Hydro in the amount of 23,000 dollars. Safety improvements were implemented at eight facilities, such as dam remediation, dam surveillance and instrumentation updates. Scholarships were awarded across the province, along with additional donations to non-profit organizations. Co-op positions were provided for 150 students. Internal energy efficiency programs were successful. Planning is under way for significant maintenance work and equipment replacement projects as the transmission and distribution infrastructure ages. The number of reported indicators was expanded this year. In turn, they were aligned with the revised Global Reporting Initiative (GRI) guidelines. tabs
BC's oil and gas industry : opportunities and challenges
International Nuclear Information System (INIS)
Alvarez, P.
2003-01-01
An update of the Canadian petroleum and natural gas industry was presented with reference to activity trends and major issues. The presentation also described opportunities and challenges facing the industry in British Columbia and reviewed the impact of federal policies on BC. In recent years the industry has moved to oil sands and unconventional gas, offshore sites, and coalbed methane development. Other changes are a result of technology which makes it possible to drill deeper and faster while having less environmental impact. Government issues have become increasingly complex, however. Industry capital spending from 2000 to 2003 was presented for Northern Canada, the east coast offshore, Alberta, the Western Canada Sedimentary Basin, oil sand deposits, and international activities. The presentation included several graphs depicting: the changing natural gas production mix; North American natural gas demand; wells drilled by province; natural gas resources in BC; upstream capital spending in BC; wells drilled by type and depth in BC; top natural gas wells in 2000 and 2002; natural gas production in BC; finding and development costs for Canadian natural gas; and, the widening gap of the federal income tax rate between oil and natural gas and other industries. British Columbia is in the strategic position of having significant untapped gas potential in the northeastern part of the province. For now, there is sufficient pipeline capacity to bring the gas to markets in the United States where there is a strong demand for electric power generation. 16 figs
Electronic, elastic, and optical properties of monolayer BC{sub 2}N
Energy Technology Data Exchange (ETDEWEB)
Jiao, Lina; Hu, Meng; Peng, Yusi; Luo, Yanting; Li, Chunmei; Chen, Zhiqian, E-mail: chen_zq@swu.edu.cn
2016-12-15
The structural stability, electronic structure, elasticity, and optical properties of four types of monolayer BC{sub 2}N have been investigated from first principles using calculation based on density functional theory. The results show that the structural stability of BC{sub 2}N increases with the number of C–C and B–N bonds. By calculating the two-dimensional Young's modulus, shear modulus, Poisson's ratio, and shear anisotropic factors in different directions, four structures present various anisotropies and the most stable structure is almost isotropic. For C-type BC{sub 2}N, the values of two-dimensional Young's modulus, shear modulus, and bulk modulus (309, 128, 195 GPa m{sup −1}), are smaller than those of graphene (343, 151, 208) but bigger than those of h-BN (286, 185, 116). Furthermore, the dielectric function, refractive index, reflectivity, absorption coefficient, and energy loss spectrum are also calculated to investigate the mechanism underpinning the optical transitions in BC{sub 2}N, revealing monolayer BC{sub 2}N as a candidate window material. - Graphical abstract: Schematic diagram of BC{sub 2}N under the biaxial tensile strain. Changes in the valence-band top and the conduction-band bottom of BC{sub 2}N with increasing strain.
Energy Technology Data Exchange (ETDEWEB)
Pusztai, B.G., E-mail: gpusztai@math.u-szeged.hu
2013-09-11
In this paper, we investigate the scattering properties of the hyperbolic BC{sub n} Sutherland and the rational BC{sub n} Ruijsenaars–Schneider–van Diejen many-particle systems with three independent coupling constants. Utilizing the recently established action-angle duality between these classical integrable models, we construct their wave and scattering maps. In particular, we prove that for both particle systems the scattering map has a factorized form.
Atomic scale onset of Al adhesion on Mo2BC
International Nuclear Information System (INIS)
Bolvardi, Hamid; Music, Denis; Schneider, Jochen M.
2015-01-01
We have explored interfacial interactions between a Mo–C terminated Mo 2 BC(040) surface and an Al cluster using ab initio molecular dynamics. The Al cluster is disrupted and wets the Mo 2 BC(040) surface. This can be understood based on the electronic structure. Across the Al–MoC interface C s–Al s hybridized states are formed. These bonds are stronger than the Al–Al intra-cluster bonds. Hence, the onset of Al adhesion is caused by bond formation across the Al–MoC interface. - Highlights: • Interfacial interactions between Mo 2 BC and an Al cluster were explored. • Al forms bonds to C constituting the onset of Al adhesion on Mo 2 BC. • These data are relevant for other carbide coatings
Concept of BuBc in neonatal jaundice – needs a change
Singh, Kalpana; Borrison, Auxilia; Mahdi, Abbas Ali
2014-01-01
Orthoclinical diagnostics Vitros microslide came with a method by which Bu and Bc can be estimated directly. The advantage of this microslide technology is that conjugated bilirubin (Bc) does not contain delta bilirubin and the fractions i.e BuBc are actually estimated. TBil estimation is also available based on traditional diazo method on the same instrument
Architecture for the Secret-Key BC3 Cryptography Algorithm
Directory of Open Access Journals (Sweden)
Arif Sasongko
2014-11-01
Full Text Available Cryptography is a very important aspect in data security. The focus of research in this field is shifting from merely security aspect to consider as well the implementation aspect. This paper aims to introduce BC3 algorithm with focus on its hardware implementation. It proposes an architecture for the hardware implementation for this algorithm. BC3 algorithm is a secret-key cryptography algorithm developed with two considerations: robustness and implementation efficiency. This algorithm has been implemented on software and has good performance compared to AES algorithm. BC3 is improvement of BC2 and AE cryptographic algorithm and it is expected to have the same level of robustness and to gain competitive advantages in the implementation aspect. The development of the architecture gives much attention on (1 resource sharing and (2 having single clock for each round. It exploits regularity of the algorithm. This architecture is then implemented on an FPGA. This implementation is three times smaller area than AES, but about five times faster. Furthermore, this BC3 hardware implementation has better performance compared to BC3 software both in key expansion stage and randomizing stage. For the future, the security of this implementation must be reviewed especially against side channel attack.
B&C +Emerging Music+ Management+
Díaz Velásquez, Leonardo Alfredo; Hernández Capdevilla, María Cristina; Torres Jiménez, Natalia Estefanía
2013-01-01
B&C tiene como idea de negocio representar a músicos emergentes ofreciendo un servicio de asesoría y acompañamiento integral para la construcción de un producto musical altamente competitivo en el mercado global.
Measurements of B(c)+ production and mass with the B(c)+ → J/ψπ+ decay.
Aaij, R; Abellan Beteta, C; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Kochebina, O; Komarov, V; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maino, M; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voss, H; Voss, C; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A
2012-12-07
Measurements of B(c)(+) production and mass are performed with the decay mode B(c)(+)→J/ψπ(+) using 0.37 fb(-1) of data collected in pp collisions at √[s]=7 TeV by the LHCb experiment. The ratio of the production cross section times branching fraction between the B(c)(+)→J/ψπ(+) and the B(+)→J/ψK(+) decays is measured to be (0.68±0.10(stat)±0.03(syst)±0.05(lifetime))% for B(c)(+) and B(+) mesons with transverse momenta p(T)>4 GeV/c and pseudorapidities 2.5M(B(c)(+))-M(B(+))=994.6±1.3(stat)±0.6(syst) MeV/c(2).
BC Hydro's business plan: a summary of BC Hydro's strategic business plan and performance measures
International Nuclear Information System (INIS)
2000-04-01
This document contains a summary of BC Hydro's Strategic Plan and performance measures. The plan has been prepared in response to the recommendations of the Budget Process Review Panel, convened by the BC Government, which recommended that each public body, crown corporation, and other agencies of government, prepare an annual three year business plan. The document reviews the utility's current situation, provides an outline of the company's vision of its role, its mission and values, its strategic objectives (effective governance, efficiency and productivity; service excellence and value-added solutions; market development ; strong and capable organization) and the tools to be utilized in measuring performance. Various strategic issues (financial resources, the need to protect and enhance the value of electricity trading; the impact of information technology; power technology development; environmental trends and 'green energy' initiatives; workforce training and development) are also highlighted
100-B/C Target Analyte List Development for Soil
Energy Technology Data Exchange (ETDEWEB)
R.W. Ovink
2010-03-18
This report documents the process used to identify source area target analytes in support of the 100-B/C remedial investigation/feasibility study addendum to DOE/RL-2008-46. This report also establishes the analyte exclusion criteria applicable for 100-B/C use and the analytical methods needed to analyze the target analytes.
BC Citizen's Advisory Committee on oil spill prevention 1995-1996 annual report
International Nuclear Information System (INIS)
1996-01-01
A committee comprised of BC citizens with some experience in oil spill issues was established in 1990 to give advise to the BC Ministry of Environment, Lands and Parks. The committee was responsible for conducting discussions with government, industry and public representatives on the state and progress of oil spill matters, particularly on the attempts to prevent and respond to spills. Within the context of a brief report about the accomplishments of the past year, this report focused on issues raised by the BC public during three public forums. These issues were: (1) update of government activities, (2) general response capability on the BC coast and BC waters, (3) support for BC Citizen's Advisory Committee, (4) wildlife response, (5) spill prevention plans, (6) escort tugs, (7) waste oil disposal and prevention of land based sources of marine pollution, and (8) fishing and tourism concerns. The report described the discussions on the issues and summarized the recommendations for action in each of these areas of concern. 2 tabs
Deconstructing hydro: the BC electricity sector in this decade
International Nuclear Information System (INIS)
Jaccard, M.
2001-01-01
This paper provided speculation regarding the world-wide trend to deregulate electric utilities with particular focus on power deregulation in British Columbia. The four main issues facing electricity reform in British Columbia are to determine if publicly-owned assets should be privatised, how to achieve competitive electricity commodity prices in a de-regulated generation market, to determine the extent to which customers will be allowed direct access to sellers of electricity, and to determine which changes in industry structure are needed to ensure that control over the common carrier does not hinder fair competition. BC Hydro recently issued a plan for the next decade entitled the Integrated Electricity Plan which suggests that almost all growth in supply on the Hydro system will be limited to a few large projects totalling 900 megawatts, to be owned and operated by either BC Hydro or by the Columbia Power Corporation, another Crown entity. This plan is in complete contrast to the evolution of the electricity industry nearly everywhere else in the world where demand growth is being met almost entirely by small- and medium-scale non-utility resources issuing from competitive markets with minimal public funding. This article looks at why BC Hydro will probably be transformed significantly, even dismantled, in the coming decade. The article begins with a section explaining the cause and effects of major changes in the world-wide electricity industry. This is followed by a section reviewing what BC Hydro did in the 1990s while reform was taking place. The article also describes what BC Hydro intends to do in the next decade and explores reasons why this outcome is unlikely. The final section of the article provides an alternative vision of BC Hydro's future over the next decade. 1 tab., 3 figs
[Inheritance of bc1 gene in intersubspecific hybrids of rice (Oryza sativa L.)].
Lü, Chuan-Gen; Zong, Shou-Yu; Zhao, Ling; Qi, Qing-Ming; Zou, Jiang-Shi; Ikehashi, Hiroshi
2004-10-01
Distorted segregation of the brittle culm-1 gene (bc1) on rice chromosome 3 was found with greatly increased or decreased frequency of bc1 bc1 genotype in inter-subspecific hybrids, although the gene normally transmitted to its offspring following the Mendelian Law in intra-subspecific hybrids. In a combination of Kamairazu//Ketan Nangka/Kamairazu,an increased frequency of bc1 bc1 in F1, normal segregation in F2, and increased and decreased frequency in a few F3 and F4 lines were observed. In a cross of IR36/Kamairazu, decreased frequency in F2, both normal and decreased segregations in F3 and F4, and a few lines of increased ratio in F4 were found. In F2 of Ketan Nangka/IR36//Kamairazu, increased and decreased and normal segregations were all observed. There was no significant correlation between the frequency of bc1 bc1 and pollen fertility. It implied that distorted segregation of bc1 was caused by selective fertilization of male gametes, which were governed by gametophyte genes of ga2, ga3 and ga14 on chromosome 3.
BC Hydro's transmission business : transition to a competitive marketplace
International Nuclear Information System (INIS)
Threlkeld, R.J.
1998-01-01
Progress made by BC Hydro to facilitate the use of the transmission system for wholesale electricity transactions, including the separation of the system operation function from generation and merchant functions, was discussed. BC Hydro, Canada's third largest electric utility, was the first Canadian utility to offer open access to its transmission system for wholesale transactions. The utility has an installed generating capacity of about 10.8 gigawatts, 90 per cent of which is hydroelectric. The remainder is thermal, gas turbine and stationary and mobile diesel generation. The key element in establishing wholesale transmission transactions was the FERC-mandated open access same-time information system (OASIS) on which BC Hydro posts available transmission capacity, planned outages and pricing. The system operates on BC Hydro's internet node and interfaces to a Transmission Scheduling System (TSS). The TSS was developed in-house to handle the increased complexity of scheduling multiple energy and capacity transactions for users of the transmission system. Operation of the system and the challenge to constantly improve it were discussed
Bacterial Cellulose (BC) as a Functional Nanocomposite Biomaterial
Nandgaonkar, Avinav Ghanashyam
Cellulosic is the most abundant biopolymer in the landscape and can be found in many different organisms. It has been already seen use in the medical field, for example cotton for wound dressings and sutures. Although cellulose is naturally occurring and has found a number of applications inside and outside of the medical field, it is not typically produced in its pure state. A lengthy process is required to separate the lignin, hemicelluloses and other molecules from the cellulose in most renewables (wood, agricultural fibers such as cotton, monocots, grasses, etc.). Although bacterial cellulose has a similar chemical structure to plant cellulose, it is easier to process because of the absence of lignin and hemicelluloses which require a lot of energy and chemicals for removal. Bacterial cellulose (BC) is produced from various species of bacteria such as Gluconacetobacter xylinus. Due to its high water uptake, it has the tendency to form gels. It displays high tensile strength, biocompatibility, and purity compared to wood cellulose. It has found applications in fields such as paper, paper products, audio components (e.g., speaker diaphragms), flexible electronics, supercapacitors, electronics, and soft tissue engineering. In my dissertation, we have functionalized and studied BC-based materials for three specific applications: cartilage tissue engineering, bioelectronics, and dye degradation. In our first study, we prepared a highly organized porous material based on BC by unidirectional freezing followed by a freeze-drying process. Chitosan was added to impart additional properties to the resulting BC-based scaffolds that were evaluated in terms of their morphological, chemical, and physical properties for cartilage tissue engineering. The properties of the resulting scaffold were tailored by adjusting the concentration of chitosan over 1, 1.5, and 2 % (by wt-%). The scaffolds containing chitosan showed excellent shape recovery and structural stability after
Study of Bc+ decays to the K+K-π+ final state and evidence for the decay Bc+ →χc0π+
Aaij, R.; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; Everse, LA; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J.E.; Appleby, R. B.; Archilli, F.; d'Argent, P.; Arnau Romeu, J.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Babuschkin, I.; Carvalho Akiba, K.; Coco, V.; David, P. N Y; De Bruyn, K.; Ferro-Luzzi, M.; Ketel, T.; Koopman, R. F.; Van Leerdam, J.; Merk, M.; Onderwater, C. J G; Raven, G.; Schiller, M.; Serra, N.; Snoek, H.; Storaci, B.; Syropoulos, V.; Van Tilburg, J.; Tolk, S.; Tsopelas, P.; Tuning, N.
2016-01-01
A study of Bc+→K+K-π+ decays is performed for the first time using data corresponding to an integrated luminosity of 3.0 fb-1 collected by the LHCb experiment in pp collisions at center-of-mass energies of 7 and 8 TeV. Evidence for the decay Bc+→χc0(→K+K-)π+ is reported with a significance of 4.0
Overview of Hydrometeorologic Forecasting Procedures at BC Hydro
McCollor, D.
2004-12-01
Energy utility companies must balance production from limited sources with increasing demand from industrial, business, and residential consumers. The utility planning process requires a balanced, efficient, and effective distribution of energy from source to consumer. Therefore utility planners must consider the impact of weather on energy production and consumption. Hydro-electric companies should be particularly tuned to weather because their source of energy is water, and water supply depends on precipitation. BC Hydro operates as the largest hydro-electric company in western Canada, managing over 30 reservoirs within the province of British Columbia, and generating electricity for 1.6 million people. BC Hydro relies on weather forecasts of watershed precipitation and temperature to drive hydrologic reservoir inflow models and of urban temperatures to meet energy demand requirements. Operations and planning specialists in the company rely on current, value-added weather forecasts for extreme high-inflow events, daily reservoir operations planning, and long-term water resource management. Weather plays a dominant role for BC Hydro financial planners in terms of sensitive economic responses. For example, a two percent change in hydropower generation, due in large part to annual precipitation patterns, results in an annual net change of \\50 million in earnings. A five percent change in temperature produces a \\5 million change in yearly earnings. On a daily basis, significant precipitation events or temperature extremes involve potential profit/loss decisions in the tens of thousands of dollars worth of power generation. These factors are in addition to environmental and societal costs that must be considered equally as part of a triple bottom line reporting structure. BC Hydro water resource managers require improved meteorological information from recent advancements in numerical weather prediction. At BC Hydro, methods of providing meteorological forecast data
Electronic and magnetic properties of Fe-, Co-, and Ni-decorated BC3: A first-principles study
Zhu, Jingzhong; Zhao, Yinchang; Zulfiqar, Muhammad; Zeng, Shuming; Ni, Jun
2018-05-01
The electronic and magnetic properties of Fe-, Co-, and Ni-decorated two dimensional (2D) BC3 are systematically investigated by first-principles calculations. We find that the Fe, Co, and Ni atoms can be strongly adsorbed on the hollow sites of 2D BC3. Fe and Co adatoms are more stable when adsorbed on the hollow sites of the carbon rings in the 2D BC3, while the hollow sites of boron-carbon rings in the 2D BC3 are the most stable sites for the adsorption of Ni adatoms. These proposed metal-BC3 complexes exhibit interesting electronic and magnetic behaviors. In particular, the Fe-BC3 and Co-BC3 complexes are metals with magnetic ground states , while the Ni-BC3 complex behaves as a nonmagnetic semiconductor with a direct bandgap. Furthermore, our magnetic analysis reveals that induced magnetism in the Fe-BC3 and Co-BC3 complexes arises from their local magnetic moments. Functionalization of 2D BC3 through these metal-adatom adsorption appears to be a promising way to extend its applications.
Chen, Wei; Steele, T. G.; Zhu, Shi-Lin
2013-01-01
We study the exotic $bc\\bar{q}\\bar{q}$, $bc\\bar{s}\\bar{s}$ and $qc\\bar{q}\\bar{b}$, $sc\\bar{s}\\bar{b}$ systems by constructing the corresponding tetraquark currents with $J^P=0^+$ and $1^+$. After investigating the two-point correlation functions and the spectral densities, we perform QCD sum rule analysis and extract the masses of these open-flavor tetraquark states. Our results indicate that the masses of both the scalar and axial vector tetraquark states are about $7.1-7.2$ GeV for the $bc\\...
Atomic scale onset of Al adhesion on Mo{sub 2}BC
Energy Technology Data Exchange (ETDEWEB)
Bolvardi, Hamid; Music, Denis, E-mail: music@mch.rwth-aachen.de; Schneider, Jochen M.
2015-08-31
We have explored interfacial interactions between a Mo–C terminated Mo{sub 2}BC(040) surface and an Al cluster using ab initio molecular dynamics. The Al cluster is disrupted and wets the Mo{sub 2}BC(040) surface. This can be understood based on the electronic structure. Across the Al–MoC interface C s–Al s hybridized states are formed. These bonds are stronger than the Al–Al intra-cluster bonds. Hence, the onset of Al adhesion is caused by bond formation across the Al–MoC interface. - Highlights: • Interfacial interactions between Mo{sub 2}BC and an Al cluster were explored. • Al forms bonds to C constituting the onset of Al adhesion on Mo{sub 2}BC. • These data are relevant for other carbide coatings.
Report of the special prosecutor: BC Hydro 'Raiwind' project
International Nuclear Information System (INIS)
Fraser, P. D. K.
1999-10-01
A special prosecutor has been appointed by the British Columbia Government to assist the Royal Canadian Mounted Police (RCMP) in its investigation, and to render appropriate charging decisions in the matter of the circumstances surrounding the creation of IPC International Power Corporation (IPC) owned by a Mr. John N. Laxton, former Chairman of BC Hydro and his two children, and its joint venture with BC Hydro for the development of an international power project in Pakistan known as the Raiwind project. Of particular concerns were the conflict of interest breached by Mr. Laxton in loaning a substantial sum of money to a principal member of the Pakistani side of the joint venture, and by the former President and CEO of BC Hydro, Mr. John Sheehan, by his purchase of shares of IPC by a company owned by members of his family. In 1996 Mr. Sheehan's employment as President and CEO was terminated by BC Hydro for breaching internal conflict of interest guidelines and for failing to get approval from BC Hydro for the acquisition of IPC shares. Subsequently, Mr. Sheehan commenced an action against BC Hydro for wrongful dismissal, a claim which was upheld by the Supreme Court of British Columbia. The focus of the special prosecutor's criminal investigation ultimately became the conduct of Mr. Laxton and whether a charge could or should be laid under Section 122 of the Criminal Code. The outcome of his investigation, which is discussed in this report, was that there was no substantial likelihood of conviction under the breach or trust provisions of Section 122 with respect to the indirect purchases by Mr. Laxton of shares in IPC. Nor was there any reason to believe that a personal loan made in high-risk circumstances could be a benefit or advantage to the lender. Furthermore, the loan cannot be causally related to any loss or financial harm to BC Hydro. In fact, it could be argued that Mr. Laxton's private decision to make the loan was of real assistance in ensuring that the
BC Transit Fuel Cell Bus Project: Evaluation Results Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, L. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2014-02-01
This report evaluates a fuel cell electric bus demonstration led by British Columbia Transit (BC Transit) in Whistler, Canada. BC Transit is collaborating with the California Air Resources Board and the U.S. Department of Energy's National Renewable Energy Laboratory to evaluate the buses in revenue service. This evaluation report covers two years of revenue service data on the buses from April 2011 through March 2013.
Zong, Yutong; Xiao, Qing; Lu, Shenggao
2018-02-01
Urban soils contain significant amounts of black carbon (BC) from biomass and fossil fuel combustion and regard to be a pool of BC. BC in urban soils has multiple effects on environmental processes in urban system, such as global climate change, air quality, and public health. Urban topsoil samples (0-10 cm) were collected from Anshan, Liaoning Province, northeast China, which is one of the most important old steel industrial bases in China. The BC in urban topsoils was extracted using the density method. Their chemical composition, morphology, molecular structure, and stable carbon isotopic composition were examined using elemental analysis, scanning electron microscopy with energy-dispersive X-ray spectroscopy (SEM-EDS), Fourier transform infrared spectroscopy (FTIR), thermogravimetric analysis (TGA), X-ray diffraction (XRD), and stable carbon isotope (δ 13 C). Elemental analysis shows that carbon content in the BC of studied soils ranged from 64.5 to 78.4%, with the average more than 70%. The O/C atomic ratio of BC is on average 0.18. The BC particle displays different morphology, including porous spherical, irregular porous fragmentary, and blocky shapes. The porous spherical BC particles has atomic molar O/C ratio determined by SEM-EDS ranging from 0.04 to 0.37. XRD indicates that BC exists in mainly combining with mineral phases hematite (Fe 2 O 3 ), kaolinite (Al 2 Si 2 O 5 (OH) 4 ), quartz (SiO 2 ), and calcite (CaCO 3 ). The FTIR spectra of BC particles show major bands at approximately 3400 cm -1 (O-H), 2920 cm -1 (C = H), 1600 cm -1 (C = C), 1230 cm -1 (C = O), and 1070 cm -1 (C = O). The stable carbon isotope (δ 13 C) of BC ranges from -24.48 to -23.18‰ with the average of -23.79 ± 0.39‰. The concentration of BC in the industrial area is significantly (p fuel combustion. Results indicated that a combination of atomic O/C ratio, porous structure, and stable carbon isotopic (δ 13 C) of BC could reflect effectively the origin of BC
Marketing strategy for the BC oil and gas service sector
Energy Technology Data Exchange (ETDEWEB)
NONE
2004-10-29
The British Columbia (BC) oil and gas service sector is collaborating with the BC Ministry of Energy and Mines (MEM) to enhance the competitiveness of oil and gas service providers in Northeast BC. The MEM agreed to provide one-time funding to develop this marketing strategy for the oil and gas sector, particularly for small to medium-sized companies with limited resources. This document is also a resource tool for suppliers in the sector that have developed and are implementing their own marketing plans and wish to enhance elements of their own plans. The strategy also outlines the potential role of associations in Northeast BC that represent the service sector. It links their marketing activities with the activities of individual service providers. Local service providers (LSP) include companies in a wide range of businesses such as drilling support, transportation, health and safety services, and construction. Six issues that directly impact the competitiveness of LSPs were also presented along with recommendations for participants in the service sector, associations and individual companies. tabs., figs., 11 appendices.
Marketing strategy for the BC oil and gas service sector
International Nuclear Information System (INIS)
2004-01-01
The British Columbia (BC) oil and gas service sector is collaborating with the BC Ministry of Energy and Mines (MEM) to enhance the competitiveness of oil and gas service providers in Northeast BC. The MEM agreed to provide one-time funding to develop this marketing strategy for the oil and gas sector, particularly for small to medium-sized companies with limited resources. This document is also a resource tool for suppliers in the sector that have developed and are implementing their own marketing plans and wish to enhance elements of their own plans. The strategy also outlines the potential role of associations in Northeast BC that represent the service sector. It links their marketing activities with the activities of individual service providers. Local service providers (LSP) include companies in a wide range of businesses such as drilling support, transportation, health and safety services, and construction. Six issues that directly impact the competitiveness of LSPs were also presented along with recommendations for participants in the service sector, associations and individual companies. tabs., figs., 11 appendices
Huang, Feiyi; Liu, Tongkun; Hou, Xilin
2018-01-01
MADS-box genes form a large gene family in plants and are involved in multiple biological processes, such as flowering. However, the regulation mechanism of MADS-box genes in flowering remains unresolved, especially under short-term cold conditions. In the present study, we isolated BcMAF1 , a Pak-choi ( Brassica rapa ssp. Chinensis ) MADS AFFECTING FLOWERING ( MAF ), as a floral repressor and functionally characterized BcMAF1 in Arabidopsis and Pak-choi. Subcellular localization and sequence analysis indicated that BcMAF1 was a nuclear protein and contained a conserved MADS-box domain. Expression analysis revealed that BcMAF1 had higher expression levels in leaves, stems, and petals, and could be induced by short-term cold conditions in Pak-choi. Overexpressing BcMAF1 in Arabidopsis showed that BcMAF1 had a negative function in regulating flowering, which was further confirmed by silencing endogenous BcMAF1 in Pak-choi. In addition, qPCR results showed that AtAP3 expression was reduced and AtMAF2 expression was induced in BcMAF1 -overexpressing Arabidopsis . Meanwhile, BcAP3 transcript was up-regulated and BcMAF2 transcript was down-regulated in BcMAF1 -silencing Pak-choi. Yeast one-hybrid and dual luciferase transient assays showed that BcMAF1 could bind to the promoters of BcAP3 and BcMAF2 . These results indicated that BcAP3 and BcMAF2 might be the targets of BcMAF1. Taken together, our results suggested that BcMAF1 could negatively regulate flowering by directly activating BcMAF2 and repressing BcAP3 .
Lost in transmission : a comprehensive critique of the BC energy plan
International Nuclear Information System (INIS)
Shaffer, M.; Hove, J.; Yamashita, J.
2007-06-01
This document presented an independent critique and review of the British Columbia (BC) 2007 energy plan. The critique focused on BC hydro-related policies in the energy plan, and was presented in three policy papers. The first paper addressed self-sufficiency and insurance issues. It examined the need for new sources of electricity supply in terms of imports and other market purchases that are currently used to meet BC Hydro's requirements. The second paper addressed BC Hydro electricity rates and the impacts and costs of buying high and selling low. It identified the impacts and costs of the low electricity rate policy in the energy plan, a policy that would inflate the demand for electricity and exaggerate the need for new sources of power caused by the self-sufficiency and insurance policies in the energy plan. Specifically, the second paper discussed BC Hydro rates under the energy plan, the limitations of power smart programs, distributional issues and alternative strategy. The third paper addressed supply issues in the energy plan, with particular reference to targeting low value/high cost resources. It focused on the types of resources BC Hydro had to acquire. It specifically addressed the pressure to acquire run-of-river and wind energy which, despite their superficial appeal, are low in value and high in cost, and could have significant environmental impact. It was concluded that despite the attempt to address environmental concerns, the province's energy plan is designed to artificially increase the market for new independent power producer supply. 76 refs., 9 tabs., 4 figs
Tuning hydrogen storage in lithium-functionalized BC2N sheets by doping with boron and carbon.
Qiu, Nian-xiang; Zhang, Cheng-hua; Xue, Ying
2014-10-06
First-principles calculations are used to explore the strong binding of lithium to boron- and carbon-doped BC2N monolayers (BC2NBC and BC2NCN, respectively) without the formation of lithium clusters. In comparison to BC2N and BC2NCB, lithium-decorated BC2NBC and BC2NCN systems possess stronger s-p and p-p hybridization and, hence, the binding energy is higher. Lithium becomes partially positively charged by donating electron density to the more electronegative atoms of the sheet. Attractive van der Waals interactions are responsible for binding hydrogen molecules around the lithium atoms. Each lithium atom can adsorb three hydrogen molecules on both sides of the sheet, with an average hydrogen binding energy of approximately 0.2 eV, which is in the range required for practical applications. The BC2NBC-Li and BC2NCN-Li complexes can serve as high-capacity hydrogen-storage media with gravimetric hydrogen capacities of 9.88 and 9.94 wt %, respectively. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Effects of Regulatory BC1 RNA Deletion on Synaptic Plasticity, Learning, and Memory
Chung, Ain; Dahan, Nessy; Alarcon, Juan Marcos; Fenton, André A.
2017-01-01
Nonprotein coding dendritic BC1 RNA regulates translation of mRNAs in neurons. We examined two lines of BC1 knockout mice and report that loss of BC1 RNA exaggerates group I mGluR-stimulated LTD of the Schaffer collateral synapse, with one of the lines showing a much more enhanced DHPG-induced LTD than the other. When the animals were given the…
Interaction of Al with O2 exposed Mo2BC
International Nuclear Information System (INIS)
Bolvardi, Hamid; Music, Denis; Schneider, Jochen M.
2015-01-01
Highlights: • Al adheres to many surfaces. • Solid–solid interactions challenging for real (oxidized) surfaces. • Dissociative O 2 adsorption on Mo 2 BC(0 4 0). • Al nonamer is disrupted on oxidized Mo 2 BC(0 4 0). • Adhesion of a residual Al on the native oxide. - Abstract: A Mo 2 BC(0 4 0) surface was exposed to O 2 . The gas interaction was investigated using ab initio molecular dynamics and X-ray photoelectron spectroscopy (XPS) of air exposed surfaces. The calculations suggest that the most dominating physical mechanism is dissociative O 2 adsorption whereby Mo−O, O−Mo−O and Mo 2 −C−O bond formation is observed. To validate these results, Mo 2 BC thin films were synthesized utilizing high power pulsed magnetron sputtering and air exposed surfaces were probed by XPS. MoO 2 and MoO 3 bond formation is observed and is consistent with here obtained ab initio data. Additionally, the interfacial interactions of O 2 exposed Mo 2 BC(0 4 0) surface with an Al nonamer is studied with ab initio molecular dynamics to describe on the atomic scale the interaction between this surface and Al to mimic the interface present during cold forming processes of Al based alloys. The Al nonamer was disrupted and Al forms chemical bonds with oxygen contained in the O 2 exposed Mo 2 BC(0 4 0) surface. Based on the comparison of here calculated adsorption energy with literature data, Al−Al bonds are shown to be significantly weaker than the Al−O bonds formed across the interface. Hence, Al−Al bond rupture is expected for a mechanically loaded interface. Therefore the adhesion of a residual Al on the native oxide layer is predicted. This is consistent with experimental observations. The data presented here may also be relevant for other oxygen containing surfaces in a contact with Al or Al based alloys for example during forming operations
HIV-1 CRF_BC recombinants infection in China: molecular epidemic and characterizations.
Ouyang, Yabo; Shao, Yiming; Ma, Liying
2012-03-01
CRF_BC recombinant strains were first identified in China and are one of the most prevalent and characteristically unique HIV-1 subtypes across China. Here we aim to review the published data about HIV-1 CRF_BC recombinant strains epidemic in China and to characterize the genetics, biology and drug resistance of this virus. This study may help to better understand the current situation of HIV-1 CRF_BC prevalence and facilitate the development of vaccines and more efficient anti-HIV-1 regimens in China.
Maat, Douwe S.; Bale, Nicole J.; Hopmans, Ellen C.; Sinninghe Damsté, Jaap S.; Schouten, Stefan; Brussaard, Corina P. D.
2016-03-01
The intact polar lipid (IPL) composition of phytoplankton is plastic and dependent on environmental factors. Previous studies have shown that phytoplankton under low phosphorus (P) availability substitutes phosphatidylglycerols (PGs) with sulfoquinovosyldiacylglycerols (SQDGs) and digalactosyldiacylglycerols (DGDGs). However, these studies focused merely on P depletion, while phytoplankton in the natural environment often experience P limitation whereby the strength depends on the supply rate of the limiting nutrient. Here we report on the IPL composition of axenic cultures of the picophotoeukaryote Micromonas pusilla under different degrees of P limitation, i.e., P-controlled chemostats at 97 and 32 % of the maximum growth rate, and P starvation (obtained by stopping P supply to these chemostats). P-controlled cultures were also grown at elevated partial carbon dioxide pressure (pCO2) to mimic a future scenario of strengthened vertical stratification in combination with ocean acidification. Additionally, we tested the influence of viral infection for this readily infected phytoplankton host species. Results show that both SQDG : PG and DGDG : PG ratios increased with enhanced P limitation. Lipid composition was, however, not affected by enhanced (750 vs. 370 µatm) pCO2. In the P-starved virally infected cells the increase in SQDG : PG and DGDG : PG ratios was lower, whereby the extent depended on the growth rate of the host cultures before infection. The lipid membrane of the virus MpV-08T itself lacked some IPLs (e.g., monogalactosyldiacylglycerols; MGDGs) in comparison with its host. This study demonstrates that, besides P concentration, also the P supply rate, viral infection and even the history of the P supply rate can affect phytoplankton lipid composition (i.e., the non-phospholipid : phospholipid ratio), with possible consequences for the nutritional quality of phytoplankton.
Evaluating BC and NOx emission inventories for the Paris region from MEGAPOLI aircraft measurements
Petetin, H.; Beekmann, M.; Colomb, A.; Denier van der Gon, H. A. C.; Dupont, J.-C.; Honoré, C.; Michoud, V.; Morille, Y.; Perrussel, O.; Schwarzenboeck, A.; Sciare, J.; Wiedensohler, A.; Zhang, Q. J.
2015-09-01
High uncertainties affect black carbon (BC) emissions, and, despite its important impact on air pollution and climate, very few BC emissions evaluations are found in the literature. This paper presents a novel approach, based on airborne measurements across the Paris, France, plume, developed in order to evaluate BC and NOx emissions at the scale of a whole agglomeration. The methodology consists in integrating, for each transect, across the plume observed and simulated concentrations above background. This allows for several error sources (e.g., representativeness, chemistry, plume lateral dispersion) to be minimized in the model used. The procedure is applied with the CHIMERE chemistry-transport model to three inventories - the EMEP inventory and the so-called TNO and TNO-MP inventories - over the month of July 2009. Various systematic uncertainty sources both in the model (e.g., boundary layer height, vertical mixing, deposition) and in observations (e.g., BC nature) are discussed and quantified, notably through sensitivity tests. Large uncertainty values are determined in our results, which limits the usefulness of the method to rather strongly erroneous emission inventories. A statistically significant (but moderate) overestimation is obtained for the TNO BC emissions and the EMEP and TNO-MP NOx emissions, as well as for the BC / NOx emission ratio in TNO-MP. The benefit of the airborne approach is discussed through a comparison with the BC / NOx ratio at a ground site in Paris, which additionally suggests a spatially heterogeneous error in BC emissions over the agglomeration.
Search for Bc+ decays to the pp‾π+ final state
Directory of Open Access Journals (Sweden)
R. Aaij
2016-08-01
Full Text Available A search for the decays of the Bc+ meson to pp¯π+ is performed for the first time using a data sample corresponding to an integrated luminosity of 3.0 fb−1 collected by the LHCb experiment in pp collisions at centre-of-mass energies of 7 and 8 TeV. No signal is found and an upper limit, at 95% confidence level, is set, fcfu×B(Bc+→pp‾π+<3.6×10−8 in the kinematic region m(pp‾<2.85 GeV/c2, pT(B<20 GeV/c and 2.0
Remote community electrification program - small wind integration in BC's offgrid communities
Energy Technology Data Exchange (ETDEWEB)
Lafaille, Julien [BC Hydro (Canada)
2011-07-01
The paper presents the Remote Community Electrification (RCE) program and wind integration in BC's off grid communities. The program offers electric utility service to eligible remote communities in BC. Most of them are offered off-grid services although it is cheaper to connect a community to a grid. BC hydro serves some communities that are not connected to the main grid. Local diesel or small hydro-generating stations are used to serve remote communities. The renewable energy program target is to reach 50% of remote communities. The reason that wind is a small part of the renewables is that hydro and biomass are abundant in BC. Some other barriers include high installation costs, durability concerns, and lack of in-house technical expertise. Some small Wind initiatives that have been taken were relatively few and fairly small. It can be concluded that due to a poor wind resource and the relatively low cost of diesel, there is limited potential for wind in BC remote communities.
Preparation of ZnO/CdS/BC Photocatalyst Hybrid Fiber and Research of Its Photocatalytic Properties
Directory of Open Access Journals (Sweden)
Beibei Dai
2015-01-01
Full Text Available An environment-friendly biomaterial bacterial cellulose (BC is introduced to substitute general organic polymers to assist the preparation of ZnO/CdS/BC photocatalyst hybrid nanofiber through coprecipitation method under the low-temperature condition. The XRD, XPS, and SEM results show that high load of ZnO/CdS/BC ternary hybrid fiber can be produced. TGA curves scan shows that ZnO/CdS/BC hybrid fiber has better thermal properties than bacterial cellulose. The UV-Vis spectra of the ZnO/CdS/BC hybrid nanofiber (0, 10, 20, and 50 wt%, resp. show that photocatalytic activities of ZnO/CdS/BC are influenced by the added amount of CdS. The degradation curve of methyl shows that ZnO/CdS/BC nanohybrid fibers exhibit excellent photocatalytic efficiency.
The most important key-performance indicators at BC Timişoara management
Directory of Open Access Journals (Sweden)
Silvia GRĂDINARU
2017-02-01
Full Text Available This article explores the management of objectives at BC Timisoara, motivation and performance analysis. The aim of this paper is to analyze the most important key factors involved in a basketball team performance. The basketball team analyzed is BC Timisoara, a well established club in this city of Western Romania. The article combines information gathered from BC Timisoara’s manager and management theories relevant to the topic. Goal setting is affected by financial and human resource factors as well control and regulation functions. Finally motivation plays a key role in players performance.
Tissue kallikrein protects neurons from hypoxia/reoxygenation-induced cell injury through Homer1b/c.
Su, Jingjing; Tang, Yuping; Zhou, Houguang; Liu, Ling; Dong, Qiang
2012-11-01
Previous studies have demonstrated that human tissue kallikrein (TK) gene delivery protects against mouse cerebral ischemia/reperfusion (I/R) injury through bradykinin B2 receptor (B2R) activation. We have also reported that exogenous TK administration can suppress glutamate- or acidosis-induced neurotoxicity through the extracellular signal-regulated kinase1/2 (ERK1/2) pathway. To further explore the neuroprotection mechanisms of TK, in the present study we performed immunoprecipitation analysis and identified a scaffolding protein Homer1b/c using MALDI-TOF MS analysis. Here, we tested the hypothesis that TK reduces cell injury induced by oxygen and glucose deprivation/reoxygenation (OGD/R) through activating Homer1b/c. We found that TK increased the expression of Homer1b/c in a concentration- and time-dependent manner. Moreover, TK facilitated the translocation of Homer1b/c to the plasma membrane under OGD/R condition by confocal microscope assays. We also observed that overexpression of Homer1b/c showed the neuroprotection against OGD/R-induced cell injury by enhancing cell survival, reducing LDH release, caspase-3 activity and cell apoptosis. However, the knockdown of Homer1b/c by small interfering RNA showed the opposite effects, indicating that Homer1b/c had protective effects against OGD/R-induced neuronal injury. More interestingly, TK exerted its much more significantly neuroprotective effects after Homer1b/c overexpression, whereas it exerted its reduced effects after Homer1b/c knockdown. In addition, TK pretreatment increased the phosphorylation of the ERK1/2 and Akt-GSK3β through Homer1b/c activation. The beneficial effects of Homer1b/c were abolished by the ERK1/2 or PI3K antagonist. Therefore, we propose novel signaling mechanisms involved in the anti-hypoxic function of TK through activation of Homer1b/c-ERK1/2 and Homer1b/c-PI3K-Akt signaling pathways. Copyright © 2012 Elsevier Inc. All rights reserved.
Oosterkamp, M.J.; Boeren, S.; Atashgahi, S.; Plugge, C.M.; Schaap, P.J.; Stams, A.J.M.
2015-01-01
Alicycliphilus denitrificans strain BC grows anaerobically on acetone with nitrate as electron acceptor. Comparative proteomics of cultures of A. denitrificans strain BC grown on either acetone or acetate with nitrate was performed to study the enzymes involved in the acetone degradation pathway. In
Feedback-Capacity of Degraded Gaussian Vector BC using Directed Information and Concave Envelopes
Ramachandran, Viswanathan
2017-01-01
It is known that the capacity region of a two user physically degraded discrete memoryless (DM) broadcastchannel (BC) is not enlarged by feedback. An identical result holds true for a physically degraded Gaussian BC,established later using a variant of the Entropy Power Inequality (EPI). In this paper, we extend the latter resultto a physically degraded Gaussian Vector BC (PD-GVBC). However, the extension is not EPI based, but employs arecent result on the factorization of concave envelopes. ...
Measurement of the $B_c^+$ meson lifetime using $B_c^+ \\to J/\\psi\\mu^+ \
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bauer, Thomas; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Callot, Olivier; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coca, Cornelia; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bonis, Isabelle; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dorosz, Piotr; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Fitzpatrick, Conor; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Hafkenscheid, Tom; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Huse, Torkjell; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Iakovenko, Viktor; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Wallaa; Karacson, Matthias; Karbach, Moritz; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Ian; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luisier, Johan; Luo, Haofei; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Manzali, Matteo; Maratas, Jan; Marconi, Umberto; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Mountain, Raymond; Mous, Ivan; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Muryn, Bogdan; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neubert, Sebastian; Neufeld, Niko; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pavel-Nicorescu, Carmen; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Pessina, Gianluigi; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Polok, Grzegorz; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redford, Sophie; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Roberts, Douglas; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Oksana; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spinella, Franco; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teodorescu, Eliza; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Webber, Adam Dane; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiechczynski, Jaroslaw; Wiedner, Dirk; Wiggers, Leo; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander
2014-01-01
The lifetime of the $B_c^+$ meson is measured using semileptonic decays having a $J/\\psi$ meson and a muon in the final state. The data, corresponding to an integrated luminosity of $2\\mathrm{~fb^{-1}}$, are collected by the LHCb detector in $pp$ collisions at a centre-of-mass energy of $8\\,\\mathrm{TeV}$. The measured lifetime is $$\\tau = 509 \\pm 8 \\pm 12 \\mathrm{~fs},$$ where the first uncertainty is statistical and the second is systematic.
Observation of the decay $B_c^+ \\rightarrow J/\\psi K^+ K^- \\pi^+$
Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Cheung, S -F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polyakov, I; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reichert, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-01-01
The decay $B_c^+ \\rightarrow J/\\psi K^+ K^- \\pi^+$ is observed for the first time, using proton-proton collisions collected with the LHCb detector corresponding to an integrated luminosity of 3 fb$^{-1}$. A signal yield of 78$\\pm$14 decays is reported with a significance of 6.2 standard deviations. The ratio of the branching fraction of $B_c^+ \\rightarrow J/\\psi K^+ K^- \\pi^+$ decays to that of $B_c^+ \\rightarrow J/\\psi \\pi^+$ decays is measured to be $0.53\\pm 0.10\\pm0.05$, where the first uncertainty is statistical and the second is systematic.
Genetic concepts in Greek literature from the eighth to the fourth century B.C.
Bazopoulou-Kyrkanidou, E
1992-03-01
A review of the concepts of genetics found in epic, historical and dramatic ancient Greek writings from the eighth to the fourth centuries B.C., is presented. The derived data suggest that the development of genetical concepts and ideas started with the praise of the heroes' divine or noble origin in Homer's epic poems (eighth century B.C.). It continued in the tracing of the descent and vicissitudes of the families of the Greek gods and the common ancestry of the Greek tribes as described in Hesiod's genealogical poems (around 700 B.C.), in the statement of descent and dual parenthood of leaders and kings in the books of Herodotus and Xenophon (fifth and fourth centuries B.C.), and in the concern about the lineage of the tragic figures in Greek drama (fifth century B.C.). The genetical concepts expressed in these writings most probably reflected popular notions of that time. They must, therefore, have been the basis of the perceptions and theories on heredity and procreation expressed by the ancient physicians and philosophers in the fifth and fourth centuries B.C., which in turn influenced the development of genetics for many centuries.
A Search for fully hadronic decay modes of the B(c) meson at CDF
Energy Technology Data Exchange (ETDEWEB)
Reher, Douglas Corey [Univ. of California, Berkeley, CA (United States)
2000-01-01
I present a search for the fully hadronic decays of the bottom-charm meson $B_c$ in the mass range 5.6 to 6.8 GeV. The decays $B_c \\to J/\\psi \\pi^+$ and $B_c \\to J/\\psi \\pi^+ \\pi^- \\pi^+$ are reconstructed using a data sample corresponding to an integrated luminosity of 109 pb$^{-1}$ of $pp$ collisions at $\\sqrt{s} = 1.8$ TeV collected with the Collider Detector at Fermilab. Upper limits on the cross section times branching ratio for each decay mode relative to $B^+ \\to J\\psi K^+$ are presented as a function of the $B_c$ mass.
Public safety for BC Hydro's dams and powerhouse
Energy Technology Data Exchange (ETDEWEB)
Cattanach, D. [BC Hydro, Burnaby, BC (Canada). Emergency Preparedness Security and Public Safety
2009-07-01
This presentation reviewed public safety and historical practices at British Columbia (BC) Hydro. Historically, visitors were guided to safe locations at their facilities by visitor centres and public use management areas. Fences and booms were used to protect visitors from the more dangerous areas around the facility. This presentation also described the features of the safety management plans that BC Hydro has in place for each of its 41 facilities. The safety management plans are approved by the plant managers; they have common controls such as fences and signs; and there are excellent maps defining the danger areas. New risks that were identified were also presented. The next steps for BC Hydro include test driving the draft Canadian Dam Association guidelines for the Aberfeldie Dam; a new powerhouse to reduce overtopping of the dam during the spring; and continuing with public safety hazards and controls such as bow-ties. figs.
Search for $B_c^+$ decays to two charm mesons
Aaij, Roel; LHCb Collaboration; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Alfonso Albero, Alejandro; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Atzeni, Michele; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Balagura, Vladislav; Baldini, Wander; Baranov, Alexander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baryshnikov, Fedor; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Beiter, Andrew; Bel, Lennaert; Beliy, Nikita; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Beranek, Sarah; Berezhnoy, Alexander; Bernet, Roland; Berninghoff, Daniel; Bertholet, Emilie; Bertolin, Alessandro; Betancourt, Christopher; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Birnkraut, Alex; Bizzeti, Andrea; Bjørn, Mikkel; Blake, Thomas; Blanc, Frederic; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bordyuzhin, Igor; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Brodzicka, Jolanta; Brundu, Davide; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Byczynski, Wiktor; Cadeddu, Sandro; Cai, Hao; Calabrese, Roberto; Calladine, Ryan; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Cattaneo, Marco; Cavallero, Giovanni; Cenci, Riccardo; Chamont, David; Chapman, Matthew George; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu Faye; Chitic, Stefan-Gabriel; Chobanova, Veronika; Chrzaszcz, Marcin; Chubykin, Alexsei; Ciambrone, Paolo; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collins, Paula; Colombo, Tommaso; Comerma-Montells, Albert; Contu, Andrea; Coombs, George; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Da Silva, Cesar Luiz; Dall'Occo, Elena; Dalseno, Jeremy; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Del Buono, Luigi; Dembinski, Hans Peter; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Nezza, Pasquale; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Douglas, Lauren; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Durante, Paolo; Durham, John Matthew; Dutta, Deepanwita; Dzhelyadin, Rustem; Dziewiecki, Michal; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fazzini, Davide; Federici, Luca; Ferguson, Dianne; Fernandez, Gerard; Fernandez Declara, Placido; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Lopes, Lino; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Funk, Wolfgang; Furfaro, Emiliano; Färber, Christian; Gabriel, Emmy; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, Vladimir; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Govorkova, Ekaterina; Grabowski, Jascha Peter; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greim, Roman; Griffith, Peter; Grillo, Lucia; Gruber, Lukas; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hamilton, Brian; Han, Xiaoxue; Hancock, Thomas Henry; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Hasse, Christoph; Hatch, Mark; He, Jibo; Hecker, Malte; Heinicke, Kevin; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hopchev, Plamen Hristov; Hu, Wenhua; Huang, Wenqian; Huard, Zachary; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hutchcroft, David; Ibis, Philipp; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kazeev, Nikita; Kecke, Matthieu; Keizer, Floris; Kelsey, Matthew; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Klimkovich, Tatsiana; Koliiev, Serhii; Kolpin, Michael; Kopecna, Renata; Koppenburg, Patrick; Kosmyntseva, Alena; Kotriakhova, Sofia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreps, Michal; Kress, Felix Johannes; Krokovny, Pavel; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Pei-Rong; Li, Tenglin; Li, Yiming; Li, Zhuoming; Liang, Xixin; Likhomanenko, Tatiana; Lindner, Rolf; Lionetto, Federica; Lisovskyi, Vitalii; Liu, Xuesong; Loh, David; Loi, Angelo; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Macko, Vladimir; Mackowiak, Patrick; Maddrell-Mander, Samuel; Maev, Oleg; Maguire, Kevin; Maisuzenko, Dmitrii; Majewski, Maciej Witold; Malde, Sneha; Malecki, Bartosz; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Marangotto, Daniele; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marinangeli, Matthieu; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurice, Emilie; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McNab, Andrew; McNulty, Ronan; Mead, James Vincent; Meadows, Brian; Meaux, Cedric; Meier, Frank; Meinert, Nis; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Millard, Edward James; Minard, Marie-Noelle; Minzoni, Luca; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Mombächer, Titus; Monroy, Igancio Alberto; Monteil, Stephane; Morandin, Mauro; Morello, Michael Joseph; Morgunova, Olga; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Thi Dung; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Nogay, Alla; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Ossowska, Anna; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palutan, Matteo; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Pereima, Dmitrii; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pietrzyk, Guillaume; Pikies, Malgorzata; Pinci, Davide; Pisani, Flavio; Pistone, Alessandro; Piucci, Alessio; Placinta, Vlad-Mihai; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poli Lener, Marco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Ponce, Sebastien; Popov, Alexander; Popov, Dmitry; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Pullen, Hannah Louise; Punzi, Giovanni; Qian, Wenbin; Qin, Jia-Jia; Quagliani, Renato; Quintana, Boris; Rachwal, Bartlomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Ratnikov, Fedor; Raven, Gerhard; Ravonel Salzgeber, Melody; Reboud, Meril; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Robbe, Patrick; Robert, Arnaud; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Ruiz Vidal, Joan; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarpis, Gediminas; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schreiner, HF; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepulveda, Eduardo Enrique; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Soares Lavra, Lais; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavomira; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stepanova, Margarita; Stevens, Holger; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Stramaglia, Maria Elena; Straticiuc, Mihai; Straumann, Ulrich; Sun, Jiayin; Sun, Liang; Swientek, Krzysztof; Syropoulos, Vasileios; Szumlak, Tomasz; Szymanski, Maciej Pawel; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Tourinho Jadallah Aoude, Rafael; Tournefier, Edwige; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Usachov, Andrii; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagner, Alexander; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Verlage, Tobias Anton; Vernet, Maxime; Vesterinen, Mika; Viana Barbosa, Joao Vitor; Vieira, Daniel; Vieites Diaz, Maria; Viemann, Harald; Vilasis-Cardona, Xavier; Vitti, Marcela; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Walsh, John; Wang, Jianchun; Wang, Yilong; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Weisser, Constantin; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Winn, Michael Andreas; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wyllie, Kenneth; Xie, Yuehong; Xu, Menglin; Xu, Qingnian; Xu, Zehua; Xu, Zhirui; Yang, Zhenwei; Yang, Zishuo; Yao, Yuezhe; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zheng, Yangheng; Zhu, Xianglei; Zhukov, Valery; Zonneveld, Jennifer Brigitta; Zucchelli, Stefano
2018-01-01
A search for decays of $B_c^+$ mesons to two charm mesons is performed for the first time using data corresponding to an integrated luminosity of 3.0 fb$^{-1}$, collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of 7 and 8 TeV. The decays considered are $B_c^+\\to D^{(*)+}_{(s)} \\overline{D}^{(*)0}$ and $B_c^+\\to D^{(*)+}_{(s)} D^{(*)0}$, which are normalised to high-yield $B^+\\to D^+_{(s)} \\overline{D}^0$ decays. No evidence for a signal is found and limits are set on twelve $B_c^+$ decay modes
Search for the Bc meson in hadronic Z decays
Barate, R.; Buskulic, D.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Comas, P.; Crespo, J. M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Juste, A.; Martinez, M.; Miquel, R.; Mir, Ll. M.; Orteu, S.; Padilla, C.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Alemany, R.; Becker, U.; Bazarko, A. O.; Bright-Thomas, P.; Cattaneo, M.; Cerutti, F.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Lutters, G.; Mato, P.; Minten, A.; Moneta, L.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rensing, P.; Rizzo, G.; Rolandi, L.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.-M.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Rougé, A.; Rumpf, M.; Valassi, A.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Focardi, E.; Parrini, G.; Zachariadou, K.; Corden, M.; Georgiopoulos, C.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, E.; Thomson, F.; Turnbull, R. M.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Schmidt, M.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Girone, M.; Goodsir, S.; Martin, E. B.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Stacey, A. M.; Williams, M. D.; Dissertori, G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Sloan, T.; Williams, M. I.; Galla, A.; Giehl, I.; Greene, A. M.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Coyle, P.; Diaconu, C.; Etienne, F.; Konstantinidis, N.; Leroy, O.; Motsch, F.; Payre, P.; Rousseau, D.; Talby, M.; Sadouki, A.; Thulasidas, M.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Dydak, F.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Chen, S.; Choi, Y.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Nikolic, I.; Schune, M.-H.; Simion, S.; Tournefier, E.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Batignani, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; dell'Orso, R.; Fantechi, R.; Ferrante, I.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciabà, A.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Vannini, C.; Venturi, A.; Verdini, P. G.; Blair, G. A.; Bryant, L. M.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Johnson, R. P.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Kelly, M. S.; Lehto, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Rothberg, J.; Wasserbaech, S.; Armstrong, S. R.; Charles, E.; Elmer, P.; Ferguson, D. P. S.; Gao, Y. S.; González, S.; Greening, T. C.; Hayes, O. J.; Hu, H.; Jin, S.; McNamara, P. A.; Nachtman, J. M.; Nielsen, J.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, J.; Sau, Lan Wu; Wu, X.; Yamartino, J. M.; Zobernig, G.
1997-02-01
A search for the Bc meson decaying into the channels J/ψπ+ and J/ψl+vl (l = e or μ) is performed in a sample of 3.9 million hadronic Z decays collected by the ALEPH detector. This search results in the observation of 0 and 2 candidates in each of these channels, respectively, while 0.44 and 0.81 background events are expected. The following 90% confidence level upper limits are derived: Another B+c -> J/ψ(e+e-)μ+vμ candidate with very low background probability, found in an independent analysis, is also described in detail.
Bacillus Coagulans GBI-30 (BC30 improves indices of Clostridium difficile-Induced colitis in mice
Directory of Open Access Journals (Sweden)
Fitzpatrick Leo R
2011-10-01
Full Text Available Abstract Background Probiotics have beneficial effects in rodent models of Clostridium difficile (C. diffiicle-induced colitis. The spore forming probiotic strain Bacillus Coagulans GBI-30, 6086 (BC30 has demonstrated anti-inflammatory and immune-modulating effects in vitro. Our goal was to determine if BC30 improved C. difficile-induced colitis in mice. Starting on study day 0, female C57BL/6 mice were dosed by oro-gastric gavage for 15 days with vehicle (saline or BC30 (2 × 109 CFU per day. Mice in the C. difficile groups received an antibiotic mixture (study days 5 to 8 in the drinking water, and clindamycin (10 mg/kg, i.p., on study day 10. The C. difficile strain VPI 10463 was given by gavage at 104 CFU to induce colitis on day 11. On day 16, stools and colons were collected for further analyses. Results All mice treated with BC30 survived on study day 13, while two mice treated with vehicle did not survive. On day 12, a significant difference (p = 0.0002 in the percentage of mice with normal stools (66.7% was found in the BC30/C. difficile group, as compared to the vehicle/C. diffcile group (13.0%. On study day 16, 23.8% of mice treated with BC30 had normal stools, while this value was 0% with vehicle treatment (p value = 0.0187. On this day, the stool consistency score for the BC30/C. difficile group (1.1 ± 0.2 was significantly lower (p C. difficile cohort (1.9 ± 0.2. BC30 modestly attenuated the colonic pathology (crypt damage, edema, leukocyte influx that was present following C. difficile infection. Colonic MIP-2 chemokine contents (pg/2 cm colon were: 10.2 ± 0.5 (vehicle/no C. difficile, 24.6 ± 9.5 (vehicle/C. difficile and 16.3 ± 4.3 (BC30/C. difficle. Conclusion The probiotic BC30 improved some parameters of C. difficile-induced colitis in mice. BC30 prolonged the survival of C. diffiicle infected mice. Particularly, this probiotic improved the stool consistency of mice, in this infectious colitis model.
Bacillus Coagulans GBI-30 (BC30) improves indices of Clostridium difficile-Induced colitis in mice
2011-01-01
Background Probiotics have beneficial effects in rodent models of Clostridium difficile (C. diffiicle)-induced colitis. The spore forming probiotic strain Bacillus Coagulans GBI-30, 6086 (BC30) has demonstrated anti-inflammatory and immune-modulating effects in vitro. Our goal was to determine if BC30 improved C. difficile-induced colitis in mice. Starting on study day 0, female C57BL/6 mice were dosed by oro-gastric gavage for 15 days with vehicle (saline) or BC30 (2 × 109 CFU per day). Mice in the C. difficile groups received an antibiotic mixture (study days 5 to 8 in the drinking water), and clindamycin (10 mg/kg, i.p., on study day 10). The C. difficile strain VPI 10463 was given by gavage at 104 CFU to induce colitis on day 11. On day 16, stools and colons were collected for further analyses. Results All mice treated with BC30 survived on study day 13, while two mice treated with vehicle did not survive. On day 12, a significant difference (p = 0.0002) in the percentage of mice with normal stools (66.7%) was found in the BC30/C. difficile group, as compared to the vehicle/C. diffcile group (13.0%). On study day 16, 23.8% of mice treated with BC30 had normal stools, while this value was 0% with vehicle treatment (p value = 0.0187). On this day, the stool consistency score for the BC30/C. difficile group (1.1 ± 0.2) was significantly lower (p < 0.05) than for the vehicle/C. difficile cohort (1.9 ± 0.2). BC30 modestly attenuated the colonic pathology (crypt damage, edema, leukocyte influx) that was present following C. difficile infection. Colonic MIP-2 chemokine contents (pg/2 cm colon) were: 10.2 ± 0.5 (vehicle/no C. difficile), 24.6 ± 9.5 (vehicle/C. difficile) and 16.3 ± 4.3 (BC30/C. difficle). Conclusion The probiotic BC30 improved some parameters of C. difficile-induced colitis in mice. BC30 prolonged the survival of C. diffiicle infected mice. Particularly, this probiotic improved the stool consistency of mice, in this infectious colitis model. PMID
Removal of Bound Triton X-100 from Purified Bovine Heart Cytochrome bc1
Varhač, Rastislav; Robinson, Neal C.; Musatov, Andrej
2009-01-01
Cytochrome bc1 isolated from Triton X-100 solubilized mitochondrial membranes contains up to 120 nmol of Triton X-100 bound per nmol of the enzyme. Purified cytochrome bc1 is fully active; however, protein bound Triton X-100 significantly interferes with structural studies of the enzyme. Removal of Triton X-100 bound to bovine cytochrome bc1 was accomplished by incubation with Bio-Beads SM-2 in presence of sodium cholate. Sodium cholate is critical since it does not interfere with the adsorpt...
HBV Genotype B/C and Response to Lamivudine Therapy: A Systematic Review
Directory of Open Access Journals (Sweden)
Xiu-Li Chen
2013-01-01
Full Text Available A number of nucleoside analogues such as lamivudine (LAM, actually used for the treatment of chronic hepatitis B, can suppress HBV DNA replication, improve transaminase level and liver histology, and enhance the rate of hepatitis B e antigen (HBeAg clearance. The responses to LAM therapy involve HBeAg clearance and HBV DNA conversion of negative. However, the associations between HBV genotype B/C and response to LAM therapy remain ambiguous. The aim of this meta-analysis is to determine more precise estimations of the relationship. All the publications on the associations between HBV genotype B/C and response to LAM (HBeAg clearance and HBV DNA conversion of negative through June 2013 were collected. Relative risk (RR with 95% confidence intervals (95% CI was calculated in fixed or random model, was calculated to examine heterogeneity, and funnel plots were plotted to examine small study effects with Stata 11 software. Overall, for HBeAg clearance and genotype B/C, the RR (95% CI was 1.27 (0.94–1.71, while for HBV DNA conversion of negative and genotype B/C, the RR (95% CI was 1.07 (0.98–1.17. HBV genotype B/C shows no significance associations with response to lamivudine therapy (HBeAg clearance and HBV DNA conversion of negative.
Observation of the decay $B_c^+ \\to \\psi(2S)\\pi^+$
INSPIRE-00258707; Abellan Beteta, C; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Oyanguren Campos, M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lohn, S; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Mcnab, A; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-01-01
The decay $B_c^+ \\to \\psi(2S)\\pi^+$ with $\\psi(2S) \\to \\mu^+\\mu^-$ is observed with a significance of $5.2\\,\\sigma$ using $pp$ collision data corresponding to an integrated luminosity of 1.0 $fb^{-1}$ collected by the LHCb experiment. The branching fraction of $B_c^+ \\to \\psi(2S)\\pi^+$ decays relative to that of the $B_c^+ \\to J/\\psi\\pi^+$ mode is measured to be \\begin{equation*} \\frac{\\mathcal{B}(B_c^+ \\to \\psi(2S)\\pi^+)}{\\mathcal{B}(B_c^+ \\to J/\\psi\\pi^+)} = 0.250 \\pm 0.068 \\,\\text{stat} \\pm 0.014 \\,\\text{\\syst} \\pm 0.006 \\,(\\mathcal{B}). \\end{equation*} The last term is the uncertainty on the ratio $\\mathcal{B}(\\psi(2S) \\to \\mu^+\\mu^-)/\\mathcal{B}(J/\\psi \\to \\mu^+\\mu^-)$.
Fang, Y.; Chen, Y.; Tian, C.
2015-12-01
Black carbon (BC) derived from incomplete combustion of fossil fuels and biomass has received increasing attention due to their potential importance in a wide range of biogeochemical processes. China has been generally considered as the world's largest BC emitter. Due to a combination of the prevailing East Asia monsoon and large amounts of riverine outflow, BC released from China can be transported to the adjacent continental shelf seas, the Bohai Sea (BS) and Yellow Sea (YS). Based on measurements of BC in 191 surface sediments, 36 riverine water, and 2 seawater samples, as well as the reported BC data set of the aerosol samples in the Bohai Rim, the concentration, flux, and budget of BC in the BS and YS were investigated. The spatial distribution of the BC concentration in surface sediments was largely influenced by the regional hydrodynamic conditions, with high values mainly occurring in the central mud areas. The BC burial flux in the BS and YS ranged from 4 to 1100 μg/cm2/yr, and averaged 166 ± 200 μg/cm2/yr. The area-integrated sedimentary BC sink flux in the entire BS and YS was ~325 Gg/yr. The BC budget calculated in the BS showed that atmospheric deposition and riverine discharge played comparable importance in delivering BC to the BS, and sequestration to bottom sediments was the major BC output pattern, accounting for ~88% of the total input BC. Besides, we attempted to apportion the BC sources in the BS and YS surface sediments using PAHs (organic molecular proxies cogenerated with BC) and BC as an input data to the Positive Matrix Factorization (PMF) receptor model. Results showed that ~83% of the sediment BC was attributed to the combustion of fossil fuels, and the remaining ~17% was from biomass burning. Due to the differences in their production mechanisms and therefore physicochemical properties, the above distinction and quantification would help us better understand their different environmental behaviors in the complex continental shelf
miR-34b/c Regulates Wnt1 and Enhances Mesencephalic Dopaminergic Neuron Differentiation
Directory of Open Access Journals (Sweden)
Roberto De Gregorio
2018-04-01
Full Text Available Summary: The differentiation of dopaminergic neurons requires concerted action of morphogens and transcription factors acting in a precise and well-defined time window. Very little is known about the potential role of microRNA in these events. By performing a microRNA-mRNA paired microarray screening, we identified miR-34b/c among the most upregulated microRNAs during dopaminergic differentiation. Interestingly, miR-34b/c modulates Wnt1 expression, promotes cell cycle exit, and induces dopaminergic differentiation. When combined with transcription factors ASCL1 and NURR1, miR-34b/c doubled the yield of transdifferentiated fibroblasts into dopaminergic neurons. Induced dopaminergic (iDA cells synthesize dopamine and show spontaneous electrical activity, reversibly blocked by tetrodotoxin, consistent with the electrophysiological properties featured by brain dopaminergic neurons. Our findings point to a role for miR-34b/c in neuronal commitment and highlight the potential of exploiting its synergy with key transcription factors in enhancing in vitro generation of dopaminergic neurons. : In this article, Bellenchi and colleagues show that the microRNA miR-34b/c is expressed in FACS-purified Pitx3-GFP+ neurons and promotes dopaminergic differentiation by negative modulating Wnt1 and the downstream WNT signaling pathway. Induced dopaminergic cells, expressing miR-34b/c, synthesize dopamine and show the electrophysiological properties featured by brain dopaminergic neurons. Keywords: microRNA, dopamine, mESC, miR34b/c, epiSC, transdifferentiation, Wnt1, Wnt pathway, reprogramming
International Nuclear Information System (INIS)
Chuang, Feng-Chuan; Huang, Zhi-Quan; Lin, Wen-Huan; Albao, Marvin A; Su, Wan-Sheng
2011-01-01
We have systematically investigated the effect of hydrogen adsorption on a single BC 3 sheet as well as graphene using first-principles calculations. Specifically, a comparative study of the energetically favorable atomic configurations for both H-adsorbed BC 3 sheets and graphene at different hydrogen concentrations ranging from 1/32 to 4/32 ML and 1/8 to 1 ML was undertaken. The preferred hydrogen arrangement on the single BC 3 sheet and graphene was found to have the same property as that of the adsorbed H atoms on the neighboring C atoms on the opposite sides of the sheet. Moreover, at low coverage of H, the pattern of hydrogen adsorption on the BC 3 shows a proclivity toward formation on the same ring, contrasting their behavior on graphene where they tend to form the elongated zigzag chains instead. Lastly, both the hydrogenated BC 3 sheet and graphene exhibit alternation of semiconducting and metallic properties as the H concentration is increased. These results suggest the possibility of manipulating the bandgaps in a single BC 3 sheet and graphene by controlling the H concentrations on the BC 3 sheet and graphene.
BC-Box Motif-Mediated Neuronal Differentiation of Somatic Stem Cells
Directory of Open Access Journals (Sweden)
Hiroshi Kanno
2018-02-01
Full Text Available Von Hippel-Lindau tumor suppressor protein (pVHL functions to induce neuronal differentiation of neural stem/progenitor cells (NSCs and skin-derived precursors (SKPs. Here we identified a neuronal differentiation domain (NDD in pVHL. Neuronal differentiation of SKPs was induced by intracellular delivery of a peptide composed of the amino-acid sequences encoded by the NDD. Neuronal differentiation mediated by the NDD was caused by the binding between it and elongin C followed by Janus kinase-2 (JAK2 ubiquitination of JAK2 and inhibition of the JAK2/the signal transducer and activator of transcription-3(STAT3 pathway. The NDD in pVHL contained the BC-box motif ((A,P,S,TLXXX (A,C XXX(A,I,L,V corresponding to the binding site of elongin C. Therefore, we proposed that other BC-box proteins might also contain an NDD; and subsequently also identified in them an NDD containing the amino-acid sequence encoded by the BC-box motif in BC-box proteins. Furthermore, we showed that different NDD peptide-delivered cells differentiated into different kinds of neuron-like cells. That is, dopaminergic neuron-like cells, cholinergic neuron-like cells, GABAnergic neuron-like cells or rhodopsin-positive neuron-like cells were induced by different NDD peptides. These novel findings might contribute to the development of a new method for promoting neuronal differentiation and shed further light on the mechanism of neuronal differentiation of somatic stem cells.
Theban victory at Haliartos (395 B.C.
Directory of Open Access Journals (Sweden)
Pascual, José
2007-12-01
Full Text Available This paper reviews the battle of Haliartos (395 B.C. analyzing the strategy of the contendings, both sides contingents and the routes followed by the armies in their way to the battlefield, especially Lysander, who used an inland boiotian route, the route of Koutomoulia and Evangelistria, and camped in the surroundings of modern Mazi about one kilometre to the south of Haliartos, and drew up in battle to a great extent as a Theban ambush.
Este trabajo examina la batalla de Haliarto (395 B.C. analizando la estrategia de los contendientes, los contingentes que concurrieron en ambos bandos y las rutas que siguieron los diferentes ejércitos hasta el campo de batalla, especialmente Lisandro, que empleó una ruta por el interior de Beocia, la ruta de Koutoumoulia y Evangelistria, y acampó en torno a la actual Mazi, aproximadamente a un kilómetro al sur de Haliarto, y presenta la batalla en gran medida como una emboscada tebana.
Seismicity Catalog Collection, 2150 BC to 1996 AD
National Oceanic and Atmospheric Administration, Department of Commerce — The Seismicity Catalog Collection is a compilation data on over four million earthquakes dating from 2150 BC to 1996 AD from NOAA's National Geophysical Data Center...
International Nuclear Information System (INIS)
Lu, Zheng; Ping, Liang; JianBo, Zhou; XiaoBing, Huang; Yu, Wen; Zheng, Wang; Jing, Li
2012-01-01
The biological functions of the BC047440 gene highly expressed by hepatocellular carcinoma (HCC) are unknown. The objective of this study was to reconstruct antisense eukaryotic expression vectors of the gene for inhibiting HepG 2 cell proliferation and suppressing their xenograft tumorigenicity. The full-length BC047440 cDNA was cloned from human primary HCC by RT-PCR. BC047440 gene fragments were ligated with pMD18-T simple vectors and subsequent pcDNA3.1(+) plasmids to construct the recombinant antisense eukaryotic vector pcDNA3.1(+)BC047440AS. The endogenous BC047440 mRNA abundance in target gene-transfected, vector-transfected and naive HepG 2 cells was semiquantitatively analyzed by RT-PCR and cell proliferation was measured by the MTT assay. Cell cycle distribution and apoptosis were profiled by flow cytometry. The in vivo xenograft experiment was performed on nude mice to examine the effects of antisense vector on tumorigenicity. BC047440 cDNA fragments were reversely inserted into pcDNA3.1(+) plasmids. The antisense vector significantly reduced the endogenous BC047440 mRNA abundance by 41% in HepG 2 cells and inhibited their proliferation in vitro (P < 0.01). More cells were arrested by the antisense vector at the G 1 phase in an apoptosis-independent manner (P = 0.014). Additionally, transfection with pcDNA3.1(+) BC047440AS significantly reduced the xenograft tumorigenicity in nude mice. As a novel cell cycle regulator associated with HCC, the BC047440 gene was involved in cell proliferation in vitro and xenograft tumorigenicity in vivo through apoptosis-independent mechanisms
The brain cytoplasmic RNA BC1 regulates dopamine D2 receptor-mediated transmission in the striatum.
Centonze, Diego; Rossi, Silvia; Napoli, Ilaria; Mercaldo, Valentina; Lacoux, Caroline; Ferrari, Francesca; Ciotti, Maria Teresa; De Chiara, Valentina; Prosperetti, Chiara; Maccarrone, Mauro; Fezza, Filomena; Calabresi, Paolo; Bernardi, Giorgio; Bagni, Claudia
2007-08-15
Dopamine D(2) receptor (D(2)DR)-mediated transmission in the striatum is remarkably flexible, and changes in its efficacy have been heavily implicated in a variety of physiological and pathological conditions. Although receptor-associated proteins are clearly involved in specific forms of synaptic plasticity, the molecular mechanisms regulating the sensitivity of D(2) receptors in this brain area are essentially obscure. We have studied the physiological responses of the D(2)DR stimulations in mice lacking the brain cytoplasmic RNA BC1, a small noncoding dendritically localized RNA that is supposed to play a role in mRNA translation. We show that the efficiency of D(2)-mediated transmission regulating striatal GABA synapses is under the control of BC1 RNA, through a negative influence on D(2) receptor protein level affecting the functional pool of receptors. Ablation of the BC1 gene did not result in widespread dysregulation of synaptic transmission, because the sensitivity of cannabinoid CB(1) receptors was intact in the striatum of BC1 knock-out (KO) mice despite D(2) and CB(1) receptors mediated similar electrophysiological actions. Interestingly, the fragile X mental retardation protein FMRP, one of the multiple BC1 partners, is not involved in the BC1 effects on the D(2)-mediated transmission. Because D(2)DR mRNA is apparently equally translated in the BC1-KO and wild-type mice, whereas the protein level is higher in BC1-KO mice, we suggest that BC1 RNA controls D(2)DR indirectly, probably regulating translation of molecules involved in D(2)DR turnover and/or stability.
DYNAMICAL MASS OF THE SUBSTELLAR BENCHMARK BINARY HD 130948BC , ,
International Nuclear Information System (INIS)
Dupuy, Trent J.; Liu, Michael C.; Ireland, Michael J.
2009-01-01
We present Keck adaptive optics imaging of the L4+L4 binary HD 130948BC along with archival Hubble Space Telescope and Gemini North observations, which together span ∼ 70% of the binary's orbital period. From the relative orbit, we determine a total dynamical mass of 0.109 ± 0.003 M sun (114 ± 3 M Jup ). The flux ratio of HD 130948BC is near unity, so both components are unambiguously substellar for any plausible mass ratio. An independent constraint on the age of the system is available from the primary HD 130948A (G2V, [M/H] = 0.0). The ensemble of available indicators suggests an age comparable to Hyades, with the most precise age being 0.79 +0.22 -0.15 Gyr based on gyrochronology. Therefore, HD 130948BC is now a unique benchmark among field L and T dwarfs, with a well-determined mass, luminosity, and age. We find that substellar theoretical models disagree with our observations. (1) Both components of HD 130948BC appear to be overluminous by a factor of ∼ 2-3 times compared to evolutionary models. The age of the system would have to be notably younger than the gyro age to ameliorate the luminosity disagreement. (2) Effective temperatures derived from evolutionary models for HD 130948B and C are inconsistent with temperatures determined from spectral synthesis for objects of similar spectral type. Overall, regardless of the adopted age, evolutionary and atmospheric models give inconsistent results, which indicate systematic errors in at least one class of models, possibly both. The masses of HD 130948BC happen to be very near the theoretical mass limit for lithium burning, and thus measuring the differential lithium depletion between B and C will provide a uniquely discriminating test of theoretical models. The potential underestimate of luminosities by evolutionary models would have wide-ranging implications; therefore, a more refined estimate age for HD 130948A is critically needed.
Global Significant Earthquake Database, 2150 BC to present
National Oceanic and Atmospheric Administration, Department of Commerce — The Significant Earthquake Database is a global listing of over 5,700 earthquakes from 2150 BC to the present. A significant earthquake is classified as one that...
Weelink, S.A.B.; Tan, N.C.G.; Broeke, H. ten; Kieboom, C. van den; Doesburg, W. van; Langenhoff, A.A.M.; Gerritse, J.; Junca, H.; Stams, A.J.M.
2008-01-01
A bacterium, strain BC, was isolated from a benzene-degrading chlorate-reducing enrichment culture. Strain BC degrades benzene in conjunction with chlorate reduction. Cells of strain BC are short rods that are 0.6 μm wide and 1 to 2 μm long, are motile, and stain gram negative. Strain BC grows on
Schwartz, Stu
2013-01-01
All Access for the AP® Calculus AB & BC Exams Book + Web + Mobile Everything you need to prepare for the Advanced Placement® exam, in a study system built around you! There are many different ways to prepare for an Advanced Placement® exam. What's best for you depends on how much time you have to study and how comfortable you are with the subject matter. To score your highest, you need a system that can be customized to fit you: your schedule, your learning style, and your current level of knowledge. This book, and the free online tools that come with it, will help you personalize your AP® Cal
International Nuclear Information System (INIS)
1993-05-01
This work plan and attached supporting project plans establish the operable unit setting and the objectives, procedures, tasks, and schedule for conducting the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) remedial investigation/feasibility study (RI/FS) for the 100-BC-2 operable unit in the 100 Area of the Hanford Site. The 100 Area is one of four areas at the Hanford Site that are on the US Environmental Protection Agency's (EPA) National Priorities List under CERCLA. The 100-BC-2 operable unit is one of two source operable units in the 100-B/C Area (Figure ES-1). Source operable units are those that contain facilities and unplanned release sites that are potential sources of hazardous substance contamination. The 100-BC-2 source operable unit contains waste sites that were formerly in the 100-BC-2, 100-BC-3, and 100-BC-4 operable units. Because of their size and geographic location, the waste sites from these two operable units were added to 100-BC-2. This allows for a more efficient and effective investigation of the remaining 100-B/C Reactor area waste sites. The investigative approach to waste sites associated with the 100-BC-2 operable unit are listed in Table ES-1. The waste sites fall into three general categories: high priority liquid waste disposal sites, low priority liquid waste disposal sites, and solid waste burial grounds. Several sites have been identified as candidates for conducting an IRM. Two sites have been identified as warranting additional limited field sampling. The two sites are the 116-C-2A pluto crib, and the 116-C-2C sand filter
An, Liupan
2016-01-01
Using the $pp$ collision data collected by LHCb at center-of-mass energies $\\sqrt{s} \\, = 7 \\, {\\rm TeV} \\,$ and $8 \\, {\\rm TeV} \\,$, corresponding to an integrated luminosity of $3 \\, \\mathrm{fb}^{-1} \\,$, the ratio of the branching fraction of the $B_{c}^{+} \\to \\psi(2S)\\pi^+$ decay relative to that of the $B_{c}^{+} \\to J/\\psi\\pi^+$ decay is measured to be ${0.268 \\pm 0.032\\mathrm{\\,(stat)} \\pm 0.007\\mathrm{\\,(syst)} \\pm 0.006\\,(\\mathrm{BF}) }$. The first uncertainty is statistical, the second is systematic, and the third is due to the uncertainties on the branching fractions of the $J/\\psi \\to \\mu^{+}\\mu^{-}$ and $\\psi(2S) \\to \\mu^{+}\\mu^{-}$ decays. To enhance the signal significance with limited $B_{c}^{+}$ statistics, the boosted decision tree selection is used to separate the signal and background effectively. The systematic uncertainties are discussed extensively. This measurement is consistent with the previous LHCb result, and the statistical uncertainty is halved.
Directory of Open Access Journals (Sweden)
Anton Liaimer
2016-11-01
Full Text Available Liverwort Blasia pusilla L. recruits soil nitrogen-fixing cyanobacteria of genus Nostoc as symbiotic partners. In this work we compared Nostoc community composition inside the plants and in the soil around them from two distant locations in Northern Norway. STRR fingerprinting and 16S rDNA phylogeny reconstruction showed a remarkable local diversity among isolates assigned to several Nostoc clades. An extensive web of negative allelopathic interactions was recorded at an agricultural site, but not at the undisturbed natural site. The cell extracts of the cyanobacteria did not show antimicrobial activities, but four isolates were shown to be cytotoxic to human cells. The secondary metabolite profiles of the isolates were mapped by MALDI-TOF MS, and the most prominent ions were further analysed by Q-TOF for MS/MS aided identification. Symbiotic isolates produced a great variety of small peptide-like substances, most of which lack any record in the databases. Among identified compounds we found microcystin and nodularin variants toxic to eukaryotic cells. Microcystin producing chemotypes were dominating as symbiotic recruits but not in the free-living community. In addition, we were able to identify several novel aeruginosins and banyaside-like compounds, as well as nostocyclopeptides and nosperin.
Liaimer, Anton; Jensen, John B.; Dittmann, Elke
2016-01-01
Liverwort Blasia pusilla L. recruits soil nitrogen-fixing cyanobacteria of genus Nostoc as symbiotic partners. In this work we compared Nostoc community composition inside the plants and in the soil around them from two distant locations in Northern Norway. STRR fingerprinting and 16S rDNA phylogeny reconstruction showed a remarkable local diversity among isolates assigned to several Nostoc clades. An extensive web of negative allelopathic interactions was recorded at an agricultural site, but not at the undisturbed natural site. The cell extracts of the cyanobacteria did not show antimicrobial activities, but four isolates were shown to be cytotoxic to human cells. The secondary metabolite profiles of the isolates were mapped by MALDI-TOF MS, and the most prominent ions were further analyzed by Q-TOF for MS/MS aided identification. Symbiotic isolates produced a great variety of small peptide-like substances, most of which lack any record in the databases. Among identified compounds we found microcystin and nodularin variants toxic to eukaryotic cells. Microcystin producing chemotypes were dominating as symbiotic recruits but not in the free-living community. In addition, we were able to identify several novel aeruginosins and banyaside-like compounds, as well as nostocyclopeptides and nosperin. PMID:27847500
Gleich, Stephan
2017-01-01
This thesis is dedicated to the study of Mo2BC coatings on silicon substrates. According to reported ab initio calculations in literature, which predicted a high stiffness and a moderate ductile behavior for the material, Mo2BC is a predestinated candidate to act as hard coating layer. The focus in this thesis is set on the nanostructure of Mo2BC hard coatings explored by transmission electron microscopy as a function of the used substrate temperature, applied during the deposition process us...
Measurement of the lifetime of the B-c(+) cmeson using the B-c(+) -> J/psi pi(+) decay mode
Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Bay, A.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Bettler, M. -O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P. M.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Borsato, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Brett, D.; Britsch, M.; Britton, T.; Brodzicka, J.; Brook, N. H.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Campana, P.; Perez, D. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carson, L.; Akiba, K. Carvalho; Casanova Mohr, R. C. M.; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chefdeville, M.; Chen, S.; Cheung, S. -F.; Chiapolini, N.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Counts, I.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A. C.; Torres, M. Cruz; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dalseno, J.; David, P.; David, P. N. Y.; Davis, A.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Silva, W.; De Simone, P.; Dean, C. -T.; De Camp, D.; De Ckenhoff, M.; Del Buono, L.; Deleage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Domenico, A.; Dijkstra, H.; Donleavy, S.; Dordei, F.; Dorigo, M.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dreimanis, K.; Dujany, G.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Faerber, C.; Farinelli, C.; Farley, N.; Farry, S.; Fay, R.; Ferguson, D.; Fernandez Albor, V.; Rodrigues, F. Ferreira; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fol, P.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; Garcia Pardinas, J.; Garofoli, J.; Tico, J. Garra; Garrido, L.; Gascon, D.; Gaspar, C.; Gastaldi, U.; Gauld, R.; Gavardi, L.; Gazzoni, G.; Geraci, A.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianelle, A.; Giani, S.; Gibson, V.; Giubega, L.; Gligorov, V. V.; Goebel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gotti, C.; Gandara, M. Grabalosa; Graciani Diaz, R.; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hampson, T.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J. A.; van herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jaton, P.; Jawahery, A.; Jing, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kelsey, M.; Kenyon, I. R.; Ketel, T.; Khanji, B.; Khurewathanakul, C.; Klaver, S.; Klimaszewski, K.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Korolev, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kurek, K.; Kvaratskheliya, T.; La Thi, V. N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R. W.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Likhomanenko, T.; Liles, M.; Lindner, R.; Linn, C.; Lionetto, F.; Liu, B.; Lohn, S.; Longstaff, I.; Lopes, J. H.; Lowdon, P.; Lucchesi, D.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Machefert, F.; Machikhiliyan, I. V.; Maciuc, F.; Maev, O.; Malde, S.; Malinin, A.; Manca, G.; Mancinelli, G.; Mapelli, A.; Maratas, J.; Marchand, J. F.; Marconi, U.; Marin Benito, C.; Marino, P.; Maerki, R.; Marks, J.; Martellotti, G.; Martinelli, M.; Santos, D. Martinez; Vidal, F. Martinez; Tostes, D. Martins; Massafferri, A.; Matev, R.; Mathe, Z.; Matteuzzi, C.; Mazurov, A.; McCann, M.; McCarthy, J.; McNab, A.; McNulty, R.; McSkelly, B.; Meadows, B.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D. A.; Minard, M. -N.; Moggi, N.; Molina Rodriguez, J.; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Morris, A. -B.; Mountain, R.; Muheim, F.; Mueller, K.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen, T. D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, C. J. G.; Orlandea, M.; OtaloraGoicochea, J. M.; Otto, A.; Owen, P.; Oyanguren, A.; Pal, B. K.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Pappalardo, L. L.; Parkes, C.; Parkinson, C. J.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Altarelli, M. Pepe; Perazzini, S.; Perret, P.; Pescatore, L.; Pesen, E.; Petridis, K.; Petrolini, A.; Picatoste Olloqui, E.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Pistone, A.; Playfer, S.; Casasus, M. Plo; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Price, E.; Price, J. D.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W.; Rachwal, B.; Rademacker, J. H.; Rakotomiaramanana, B.; Rama, M.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Redi, F.; Reichert, S.; Reid, M. M.; dos Reis, A. C.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Rives Molina, V.; Robbe, P.; Rodrigues, A. B.; Rodrigues, E.; Perez, P. Rodriguez; Roiser, S.; Romanovsky, V.; Vidal, A. Romero; Rotondo, M.; Rouvinet, J.; Ruf, T.; Ruiz, H.; Ruiz Valls, P.; Silva, J. J. Saborido; Sagidova, N.; Sail, P.; Saitta, B.; Guimaraes, V. Salustino; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schiller, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sepp, I.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Coutinho, R. Silva; Simi, G.; Sirendi, M.; Skidmore, N.; Skillicorn, I.; Skwarnicki, T.; Smith, N. A.; Smith, E.; Smith, E.; Smith, J.; Smith, M.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; Souza, D.; De Paula, B. Souza; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Steinkamp, O.; Stenyakin, O.; Sterpka, F.; Stevenson, S.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Stroili, R.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Tellarini, G.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Todd, J.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, M. T.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Garcia, M. Ubeda; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Vazquez Regueiro, P.; Vazquez Sierra, C.; Vecchi, S.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Barbosa, J. V. Viana; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; de Vries, J. A.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, J.; Wandernoth, S.; Wang, J.; Ward, D. R.; Watson, N. K.; Websdale, D.; Whitehead, M.; Wiedner, D.; Wilkinson, G.; Wilkinson, M.; Williams, M. P.; Williams, M.; Wilschut, H. W.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wright, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Xu, Z.; Yang, Z.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, L.; Zhang, W. C.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.
2015-01-01
The difference in total widths between the B-c(+) and B+ mesons is measured using a data sample corresponding to an integrated luminosity of 3.0 fb(-1) collected by the LHCb experiment in 7 and 8 TeV centre-of-mass energy proton-proton collisions at the LHC. Through the study of the time evolution
$B^+_c$ meson production, decays and properties at LHCb
Lusiani, Alberto
2016-01-01
We report the first study of the $B_c^+ \\to K^+K^-\\pi^+$ decay and an update of the measurement of the ratio of branching fractions $R_{K/\\pi} \\equiv {\\cal B}(B_c^+\\to J/\\psi K^+)/{\\cal B}(B_c^+\\to J/\\psi\\pi^+)$. Both results use an integrated luminosity of $3.0fb^{-1}$ collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of 7 and 8 TeV. We measure $B_c^+ \\to \\chi_{c0}(\\to K^+ K^-)\\pi^+$ with $4.0\\sigma$ significance and $\\frac {\\sigma(B_c^+)} {\\sigma(B^+)}$ X ${\\cal B}(B_c^+ \\to \\chi_{c0}\\pi^+)$ to be $(9.8^{+3.4}_{-3.0}(stat) \\pm 0.8(syst))$ X $10^{-6}$. The contribution of $B_c^+ \\to K^+K^-\\pi^+$ via $\\overline{b}c$ weak annihilation for $m(K^-\\pi^+) < 1.834 GeV$ is measured with $2.4\\sigma$ significance. The ratio of branching fractions $R_{K/\\pi} \\equiv {\\cal B}(B_c^+ \\to J/\\psi K^+) / {\\cal B}(B_c^+ \\to J/\\psi \\pi^+)$ is measured to be $R_{K/\\pi} = 0.079 \\pm 0.007(stat) \\pm 0.003(syst)$. This result significantly improves the previous LHCb measurement.
Relativistic corrections to the form factors of Bc into P-wave orbitally excited charmonium
Zhu, Ruilin
2018-06-01
We investigated the form factors of the Bc meson into P-wave orbitally excited charmonium using the nonrelativistic QCD effective theory. Through the analytic computation, the next-to-leading order relativistic corrections to the form factors were obtained, and the asymptotic expressions were studied in the infinite bottom quark mass limit. Employing the general form factors, we discussed the exclusive decays of the Bc meson into P-wave orbitally excited charmonium and a light meson. We found that the relativistic corrections lead to a large correction for the form factors, which makes the branching ratios of the decay channels B (Bc ± →χcJ (hc) +π± (K±)) larger. These results are useful for the phenomenological analysis of the Bc meson decays into P-wave charmonium, which shall be tested in the LHCb experiments.
BC Transit Fuel Cell Bus Project Evaluation Results: Second Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Post, M.
2014-09-01
Second report evaluating a fuel cell electric bus (FCEB) demonstration led by British Columbia Transit (BC Transit) in Whistler, Canada. BC Transit is collaborating with the California Air Resources Board and the U.S. Department of Energy's National Renewable Energy Laboratory to evaluate the buses in revenue service. NREL published its first report on the demonstration in February 2014. This report is an update to the previous report; it covers 3 full years of revenue service data on the buses from April 2011 through March 2014 and focuses on the final experiences and lessons learned.
Jiang, Yu; Yang, Jiacheng; Gagné, Stéphanie; Chan, Tak W.; Thomson, Kevin; Fofie, Emmanuel; Cary, Robert A.; Rutherford, Dan; Comer, Bryan; Swanson, Jacob; Lin, Yue; Van Rooy, Paul; Asa-Awuku, Akua; Jung, Heejung; Barsanti, Kelley; Karavalakis, Georgios; Cocker, David; Durbin, Thomas D.; Miller, J. Wayne; Johnson, Kent C.
2018-06-01
Knowledge of black carbon (BC) emission factors from ships is important from human health and environmental perspectives. A study of instruments measuring BC and fuels typically used in marine operation was carried out on a small marine engine. Six analytical methods measured the BC emissions in the exhaust of the marine engine operated at two load points (25% and 75%) while burning one of three fuels: a distillate marine (DMA), a low sulfur, residual marine (RMB-30) and a high-sulfur residual marine (RMG-380). The average emission factors with all instruments increased from 0.08 to 1.88 gBC/kg fuel in going from 25 to 75% load. An analysis of variance (ANOVA) tested BC emissions against instrument, load, and combined fuel properties and showed that both engine load and fuels had a statistically significant impact on BC emission factors. While BC emissions were impacted by the fuels used, none of the fuel properties investigated (sulfur content, viscosity, carbon residue and CCAI) was a primary driver for BC emissions. Of the two residual fuels, RMB-30 with the lower sulfur content, lower viscosity and lower residual carbon, had the highest BC emission factors. BC emission factors determined with the different instruments showed a good correlation with the PAS values with correlation coefficients R2 >0.95. A key finding of this research is the relative BC measured values were mostly independent of load and fuel, except for some instruments in certain fuel and load combinations.
Music in the Syrian city of Ebla in the late third millennium B.C.*
Krispijn, T.J.H.; Dumbrill, R.
2012-01-01
Musicians and musical instruments in the (bilingual Sumero-Akkadian) lexical and administrative texts from the Syrian city of Ebla (± 2300 B.C.) with occasional reference to the musical instruments of the city of Mari (±1750 B.C.)
Interaction of Al with O{sub 2} exposed Mo{sub 2}BC
Energy Technology Data Exchange (ETDEWEB)
Bolvardi, Hamid; Music, Denis, E-mail: music@mch.rwth-aachen.de; Schneider, Jochen M.
2015-03-30
Highlights: • Al adheres to many surfaces. • Solid–solid interactions challenging for real (oxidized) surfaces. • Dissociative O{sub 2} adsorption on Mo{sub 2}BC(0 4 0). • Al nonamer is disrupted on oxidized Mo{sub 2}BC(0 4 0). • Adhesion of a residual Al on the native oxide. - Abstract: A Mo{sub 2}BC(0 4 0) surface was exposed to O{sub 2}. The gas interaction was investigated using ab initio molecular dynamics and X-ray photoelectron spectroscopy (XPS) of air exposed surfaces. The calculations suggest that the most dominating physical mechanism is dissociative O{sub 2} adsorption whereby Mo−O, O−Mo−O and Mo{sub 2}−C−O bond formation is observed. To validate these results, Mo{sub 2}BC thin films were synthesized utilizing high power pulsed magnetron sputtering and air exposed surfaces were probed by XPS. MoO{sub 2} and MoO{sub 3} bond formation is observed and is consistent with here obtained ab initio data. Additionally, the interfacial interactions of O{sub 2} exposed Mo{sub 2}BC(0 4 0) surface with an Al nonamer is studied with ab initio molecular dynamics to describe on the atomic scale the interaction between this surface and Al to mimic the interface present during cold forming processes of Al based alloys. The Al nonamer was disrupted and Al forms chemical bonds with oxygen contained in the O{sub 2} exposed Mo{sub 2}BC(0 4 0) surface. Based on the comparison of here calculated adsorption energy with literature data, Al−Al bonds are shown to be significantly weaker than the Al−O bonds formed across the interface. Hence, Al−Al bond rupture is expected for a mechanically loaded interface. Therefore the adhesion of a residual Al on the native oxide layer is predicted. This is consistent with experimental observations. The data presented here may also be relevant for other oxygen containing surfaces in a contact with Al or Al based alloys for example during forming operations.
Electric energy supply and non-utility generation: A comparative analysis of B.C. and Wisconsin
International Nuclear Information System (INIS)
Logan, J.A.
1993-01-01
The pricing policies and buyback rates (those concerned with purchase of non-utility generation, NUG) of British Columbia (BC) Hydro are examined along with their effectiveness in encouraging the efficient use and development of power. Specifically, the levels of self-generation within BC's pulp mills are examined as well as mill manager attitudes to increasing energy production. BC Hydro's encouragement of self-generation is determined by examining the ratio of the industrial rate for pulp mills to the utility's long-run marginal cost of power. BC Hydro's buyback policies are also examined to determine the level of encouragement they provide for increased self-generation. Comparisons are made with similar data, wherever possible, from utilities and pulp mills in Wisconsin. The comparison reveals similarities with respect to pulp mills' attitudes toward increasing self-generation capacity. A significant difference is noted in terms of the amount of pulp mill self-generation: Wisconsin mills generate substantially more of their own energy requirements than BC mills. Wisconsin utilities provided greater markup through their industrial rates, and also provided the greater encouragement for increased self-generation through their buyback policies. BC Hydro is the only utility that offered a load displacement policy, however. In summary, the policies and regulations of both BC and Wisconsin utilities have the potential to encourage greater industrial self-sufficiency and increased levels of self-generated power. Existing levels of encouragement are not determined solely by economic considerations but also reflect utility planning objectives. 97 refs., 3 figs., 20 tabs
Directory of Open Access Journals (Sweden)
Lei Cao
2015-03-01
Full Text Available Background: Homer is a family of post synaptic density proteins functionally and physically attached to target proteins at proline-rich sequences. Reducing Homer1b/c expression has been shown in previous studies to be protective against excitotoxic insults, implicating Homer1b/c in the physiological regulation of aberrant neuronal excitability. Methods: To test the efficacy of a Homer1b/c reducing therapy for disorders with a detrimental hyperexcitability profile in mice, we used small interfere RNA (siRNA to decrease endogenous Homer1b/c expression in mouse hippocampus. The baseline motor and cognitive behavior was measured by sensorimotor tests, Morris water maze and elevated plus maze tasks. The anti-epileptic effects of Homer1b/c knockdown were determined in two chemically induced seizure models induced by Picrotoxin (PTX or pentylenetetrazole (PTZ administration. Results: The results of sensorimotor tests, Morris water maze and elevated plus maze tasks showed that Homer1b/c reduction had no effect on baseline motor or cognitive behavior. In two chemically induced seizure models, mice with reduced Homerb/c protein had less severe seizures than control mice. Total Homer1b/c protein levels and seizure severity were highly correlated, such that those mice with the most severe seizures also had the highest levels of Homer1b/c. In addition, the phosphorylation of mammalian target of rapamycin (mTOR and its target protein S6 was significantly inhibited in Homer1b/c down-regulated mice. Homer1b/c knockdown-induced inhibition of mTOR pathway was partially ablated by the metabotropic glutamate receptor 5 (mGluR5 agonist CHPG. Conclusion: Our results demonstrate that endogenous Homer1b/c is integral for regulating neuronal hyperexcitability in adult animals and suggest that reduction of Homer1b/c could protect against chemically induced seizures through inhibition mTOR pathway.
International Nuclear Information System (INIS)
Hao, Wentao; Yang, Yimin; Zhu, Jian; Gu, Zhou; Xie, Yaoting; Zhang, Jing; Wang, Lihua
2014-01-01
Highlights: • We analyzed faience of Peng State archaeological cemetery site in Western Zhou Dynasty (BC1046–BC771). • We investigated the chemical composition and oxidation state by energy dispersive X-ray fluorescence (EDXRF) and X-ray absorption near edge spectroscopy (XANES), respectively. • The coloring element in both beads is copper in +2 valence, and the color divergence of these two beads may originate from different local chemical environments of Cu 2+ . • Chinese faience in this period is the earliest glaze with copper colorant. - Abstract: As a special kind of glazed ceramic, faience has an important role to play in the technological trajectory that eventually leads to the development of ancient glass. In China, faience products first emerged in early Western Zhou Dynasty (1046BC–771BC), and their great significance as well as brilliant colors varying between blue and green attracted a lot of scholars. However, scientific researches on the color source of Chinese faience in view of microstructure characterization are quite few. In the present work, analyses by energy dispersive X-ray fluorescence (EDXRF) and X-ray absorption near edge spectroscopy (XANES) were carried out on two faience beads with relatively blue and green color, respectively, both of which were excavated from Peng State archaeological cemetery site in Western Zhou Dynasty. The results show that the coloring element in both beads is copper with +2 valence, and the color divergence of these two beads may originate from different local chemical environments of Cu 2+ . It is suggested that the faience in this period is the earliest glaze with copper colorant in China
Energy Technology Data Exchange (ETDEWEB)
Hao, Wentao; Yang, Yimin [Key Laboratory of Vertebrate Evolution and Human Origins of Chinese Academy of Sciences, Institute of Vertebrate Paleontology and Paleoanthropology, Chinese Academy of Sciences, Beijing 100044 (China); Department of Scientific History and Archaeometry, University of Chinese Academy of Sciences, Beijing 100049 (China); Zhu, Jian, E-mail: jzhu@ucas.ac.cn [Key Laboratory of Vertebrate Evolution and Human Origins of Chinese Academy of Sciences, Institute of Vertebrate Paleontology and Paleoanthropology, Chinese Academy of Sciences, Beijing 100044 (China); Department of Scientific History and Archaeometry, University of Chinese Academy of Sciences, Beijing 100049 (China); Gu, Zhou [Key Laboratory of Vertebrate Evolution and Human Origins of Chinese Academy of Sciences, Institute of Vertebrate Paleontology and Paleoanthropology, Chinese Academy of Sciences, Beijing 100044 (China); Department of Scientific History and Archaeometry, University of Chinese Academy of Sciences, Beijing 100049 (China); Xie, Yaoting [Institute of Archaeology of Shanxi Province, Taiyuan 030001 (China); Zhang, Jing [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Wang, Lihua [Shanghai Synchrotron Radiation Facility, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201204 (China)
2014-10-15
Highlights: • We analyzed faience of Peng State archaeological cemetery site in Western Zhou Dynasty (BC1046–BC771). • We investigated the chemical composition and oxidation state by energy dispersive X-ray fluorescence (EDXRF) and X-ray absorption near edge spectroscopy (XANES), respectively. • The coloring element in both beads is copper in +2 valence, and the color divergence of these two beads may originate from different local chemical environments of Cu{sup 2+}. • Chinese faience in this period is the earliest glaze with copper colorant. - Abstract: As a special kind of glazed ceramic, faience has an important role to play in the technological trajectory that eventually leads to the development of ancient glass. In China, faience products first emerged in early Western Zhou Dynasty (1046BC–771BC), and their great significance as well as brilliant colors varying between blue and green attracted a lot of scholars. However, scientific researches on the color source of Chinese faience in view of microstructure characterization are quite few. In the present work, analyses by energy dispersive X-ray fluorescence (EDXRF) and X-ray absorption near edge spectroscopy (XANES) were carried out on two faience beads with relatively blue and green color, respectively, both of which were excavated from Peng State archaeological cemetery site in Western Zhou Dynasty. The results show that the coloring element in both beads is copper with +2 valence, and the color divergence of these two beads may originate from different local chemical environments of Cu{sup 2+}. It is suggested that the faience in this period is the earliest glaze with copper colorant in China.
Aiken, A. C.; Liu, S.; Dubey, M. K.; Zaveri, R. A.; Shilling, J. E.; Gourihar, K.; Pekour, M. S.; Subramanian, R.; Zelenyuk, A.; Wilson, J. M.; Mazzoleni, C.; China, S.; Sharma, N.
2014-12-01
Black carbon (BC) is considered to be potentially the 2nd most important global warming factor behind CO2 (Bond et al., 2013). Uncertainties exist due to BC morphology and mixing state on the extent of the warming that it causes, e.g. Cappa et al., 2012. Core-shell BC is expected to enhance absorption by up to a factor of 2, but has yet to be observed to this extent from ambient data. Experiments were conducted during the Soot Aerosol Aging Study (SAAS) Laboratory Campaign at Pactific Northwest National Laboratory's Environmental Chamber in the winter of 2013-2014 to investigate the relationship between coatings and enhancements from diesel emissions. Direct on-line measurements were made with the single particle soot photometer (SP2) from fresh and aged BC from coating and coagulation experiments with secondary organic aerosol (SOA) formed in the chamber. BC measurements are coupled with photoactoustic measurements spanning the visible region to probe BC enhancements when mixed with SOA. Here we focus on the enhancements at 781 nm, that are tracked throughout SOA growth on BC, as determined from SP2 coating thicknesses. Thermal denuder (TD) experiments are conducted and enhancements are calculated from two different methods that agree well with each other, confirming the observed results. BC measurements are also compared with co-located measurements from SPLAT-II and filter analysis using SEM and TEM. BC coagulated with SOA produces minimal absorption enhancement values, whereas coatings are observed to have significant enhancement values at 300 degrees C, e.g. 1.3 for thickly coated BC. BC particles were coagulated with SOA in the chamber since this morphology has been observed in wildfire emissions (Sedlacek et al., 2012). Since we did not observe appreciable enhancements for the coagulated BC, we expect that ambient emissions dominated by this particle type to have enhancements due to other sources, such as brown carbon (BrC) that is often co-emitted (Saleh et
Evidence for the decay $B_c^+ \\rightarrow J/\\psi 3\\pi^+ 2\\pi^-$
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bauer, Thomas; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Callot, Olivier; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Caponio, Francesco; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coca, Cornelia; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Esen, Sevda; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Hafkenscheid, Tom; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jezabek, Marek; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Ian; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Manzali, Matteo; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Roberts, Douglas; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Oksana; Shevchenko, Vladimir; Shires, Alexander; Sidorov, Fedor; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spinella, Franco; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander
2014-01-01
Evidence is presented for the decay $B_c+\\rightarrow J/\\psi 3\\pi^+2\\pi^-$ using proton-proton collision data, corresponding to an integrated luminosity of 3fb$^{-1}$, collected with the LHCb detector. A signal yield of $32\\pm8$ decays is found with a significance of 4.5 standard deviations. The ratio of the branching fraction of the $B_c^+\\rightarrow J/\\psi 3\\pi^+ 2\\pi^-$ decay to that of the $B_c^+ \\rightarrow J/\\psi \\pi^+$ decay is measured to be $$ \\frac{Br (B_c^+ \\rightarrow J/\\psi 3\\pi^+2\\pi^)}{Br (B_c^+ \\rightarrow J/\\psi \\pi^+)} = 1.74\\pm0.44\\pm0.24, $$ where the first uncertainty is statistical and the second is systematic.
First observation of a baryonic $B_c^+$ decay
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander
2014-01-01
A baryonic decay of the $B_c^+$ meson, $B_c^+\\to J/\\psi p\\overline{p}\\pi^+$, is observed for the first time, with a significance of $7.3$ standard deviations, in $pp$ collision data collected with the LHCb detector and corresponding to an integrated luminosity of $3.0$ fb$^{-1}$ taken at center-of-mass energies of $7$ and $8$ $\\mathrm{TeV}$. With the $B_c^+\\to J/\\psi \\pi^+$ decay as normalization channel, the ratio of branching fractions is measured to be \\begin{equation*} \\frac{\\mathcal{B}(B_c^+\\to J/\\psi p\\overline{p}\\pi^+)}{\\mathcal{B}(B_c^+\\to J/\\psi \\pi^+)} = 0.143^{\\,+\\,0.039}_{\\,-\\,0.034}\\,(\\mathrm{stat})\\pm0.013\\,(\\mathrm{syst}). \\end{equation*} The mass of the $B_c^+$ meson is determined as $M(B_c^+)=6274.0\\pm1.8\\,(\\mathrm{stat})\\pm0.4\\,(\\mathrm{syst})\\,\\mathrm{MeV}/c^2$, using the $B_c^+\\to J/\\psi p\\overline{p}\\pi^+$ channel.
The dimerization of the yeast cytochrome bc1 complex is an early event and is independent of Rip1.
Conte, Annalea; Papa, Benedetta; Ferramosca, Alessandra; Zara, Vincenzo
2015-05-01
In Saccharomyces cerevisiae the mature cytochrome bc1 complex exists as an obligate homo-dimer in which each monomer consists of ten distinct protein subunits inserted into or bound to the inner mitochondrial membrane. Among them, the Rieske iron-sulfur protein (Rip1), besides its catalytic role in electron transfer, may be implicated in the bc1 complex dimerization. Indeed, Rip1 has the globular domain containing the catalytic center in one monomer while the transmembrane helix interacts with the adjacent monomer. In addition, the lack of Rip1 leads to the accumulation of an immature bc1 intermediate, only loosely associated with cytochrome c oxidase. In this study we have investigated the biogenesis of the yeast cytochrome bc1 complex using epitope tagged proteins to purify native assembly intermediates. We showed that the dimerization process is an early event during bc1 complex biogenesis and that the presence of Rip1, differently from previous proposals, is not essential for this process. We also investigated the multi-step model of bc1 assembly thereby lending further support to the existence of bona fide subcomplexes during bc1 maturation in the inner mitochondrial membrane. Finally, a new model of cytochrome bc1 complex assembly, in which distinct intermediates sequentially interact during bc1 maturation, has been proposed. Copyright © 2015 Elsevier B.V. All rights reserved.
Zhao, Pei-Liang; Wang, Le; Zhu, Xiao-Lei; Huang, Xiaoqin; Zhan, Chang-Guo; Wu, Jia-Wei; Yang, Guang-Fu
2009-01-01
Cytochrome bc1 complex (EC 1.10.2.2, bc1), an essential component of the cellular respiratory chain and the photosynthetic apparatus in photosynthetic bacteria, has been identified as a promising target for new drugs and agricultural fungicides. X-ray diffraction structures of the free bc1 complex and its complexes with various inhibitors revealed that the phenyl group of Phe274 in the binding pocket exhibited significant conformational flexibility upon different inhibitors binding to optimize respective π-π interactions, whereas the side chains of other hydrophobic residues showed conformational stability. Therefore, in the present study, a strategy of optimizing the π-π interaction with conformationally flexible residues was proposed to design and discover new bc1 inhibitors with a higher potency. Eight new compounds were designed and synthesized, among which compound 5c with a Ki value of 570 pM was identified as the most promising drug or fungicide candidate, significantly more potent than the commercially available bc1 inhibitors including azoxystrobin (AZ), kresoxim-methyl (KM), and pyraclostrobin (PY). To our knowledge, this is the first bc1 inhibitor discovered from structure-based design with a potency of subnanomolar Ki value. For all of the compounds synthesized and assayed, the calculated binding free energies correlated reasonably well with the binding free energies derived from the experimental Ki values with a correlation coefficient of r2 = 0.89. The further inhibitory kinetics studies revealed that compound 5c is a non-competitive inhibitor with respect to substrate cytochrome c, but is a competitive inhibitor with respect to substrate ubiquinol. Due to its subnanomolar Ki potency and slow dissociation rate constant (k−0 = 0.00358 s−1), compound 5c could be used as a specific probe for further elucidation of the mechanism of bc1 function and as a new lead compound for future drug discovery. PMID:19928849
Haloacyl complexes of boron, [(CF3)3BC(O)Hal]- (Hal=F, Cl, Br, I).
Finze, Maik; Bernhardt, Eduard; Willner, Helge; Lehmann, Christian W
2005-11-04
The haloacyltris(trifluoromethyl)borate anions [(CF3)3BC(O)Hal]- (Hal=F, Cl, Br, I) have been synthesized by reacting (CF3)3BCO with either MHal (M=K, Cs; Hal=F) in SO2 or MHal (M=[nBu4N]+, [Et4N]+, [Ph4P]+; Hal=Cl, Br, I) in dichloromethane. Metathesis reactions of the fluoroacyl complex with Me3SiHal (Hal=Cl, Br, I) led to the formation of its higher homologues. The thermal stabilities of the haloacyltris(trifluoromethyl)borates decrease from the fluorine to the iodine derivative. The chemical reactivities decrease in the same order as demonstrated by a series of selected reactions. The new [(CF3)3BC(O)Hal]- (Hal=F, Cl, Br) salts are used as starting materials in the syntheses of novel compounds that contain the (CF3)3B-C fragment. All borate anions [(CF3)3BC(O)Hal]- (Hal=F, Cl, Br, I) have been characterized by multinuclear NMR spectroscopy (11B, 13C, 17O, 19F) and vibrational spectroscopy. [PPh4][(CF3)3BC(O)Br] crystallizes in the monoclinic space group P2/c (no. 13) and the bond parameters are compared with those of (CF3)3BCO and K[(CF3)3BC(O)F]. The interpretation of the spectroscopic and structural data are supported by DFT calculations [B3LYP/6-311+G(d)].
Binding of the respiratory chain inhibitor ametoctradin to the mitochondrial bc1 complex.
Fehr, Marcus; Wolf, Antje; Stammler, Gerd
2016-03-01
Ametoctradin is an agricultural fungicide that inhibits the mitochondrial bc1 complex of oomycetes. The bc1 complex has two quinone binding sites that can be addressed by inhibitors. Depending on their binding sites and binding modes, the inhibitors show different degrees of cross-resistance that need to be considered when designing spray programmes for agricultural fungicides. The binding site of ametoctradin was unknown. Cross-resistance analyses, the reduction of isolated Pythium sp. bc1 complex in the presence of different inhibitors and molecular modelling studies were used to analyse the binding site and binding mode of ametoctradin. All three approaches provide data supporting the argument that ametoctradin binds to the Pythium bc1 complex similarly to stigmatellin. The binding mode of ametoctradin differs from other agricultural fungicides such as cyazofamid and the strobilurins. This explains the lack of cross-resistance with strobilurins and related inhibitors, where resistance is mainly caused by G143A amino acid exchange. Accordingly, mixtures or alternating applications of these fungicides and ametoctradin can help to minimise the risk of the emergence of new resistant isolates. © 2015 Society of Chemical Industry.
Global Significant Volcanic Eruptions Database, 4360 BC to present
National Oceanic and Atmospheric Administration, Department of Commerce — The Significant Volcanic Eruptions Database is a global listing of over 600 eruptions from 4360 BC to the present. A significant eruption is classified as one that...
Mycobacterium smegmatis PafBC is involved in regulation of DNA damage response.
Fudrini Olivencia, Begonia; Müller, Andreas U; Roschitzki, Bernd; Burger, Sibylle; Weber-Ban, Eilika; Imkamp, Frank
2017-10-25
Two genes, pafB and pafC, are organized in an operon with the Pup-ligase gene pafA, which is part of the Pup-proteasome system (PPS) present in mycobacteria and other actinobacteria. The PPS is crucial for Mycobacterium tuberculosis resistance towards reactive nitrogen intermediates (RNI). However, pafB and pafC apparently play only a minor role in RNI resistance. To characterize their function, we generated a pafBC deletion in Mycobacterium smegmatis (Msm). Proteome analysis of the mutant strain revealed decreased cellular levels of various proteins involved in DNA damage repair, including recombinase A (RecA). In agreement with this finding, Msm ΔpafBC displayed increased sensitivity to DNA damaging agents. In mycobacteria two pathways regulate DNA repair genes: the LexA/RecA-dependent SOS response and a predominant pathway that controls gene expression via a LexA/RecA-independent promoter, termed P1. PafB and PafC feature winged helix-turn-helix DNA binding motifs and we demonstrate that together they form a stable heterodimer in vitro, implying a function as a heterodimeric transcriptional regulator. Indeed, P1-driven transcription of recA was decreased in Msm ΔpafBC under standard conditions and induction of recA expression upon DNA damage was strongly impaired. Taken together, our data indicate an important regulatory function of PafBC in the mycobacterial DNA damage response.
The BC energy plan : a vision for clean energy leadership
International Nuclear Information System (INIS)
2007-02-01
Global warming is a pertinent environmental issue. This report presented a vision and plan for clean energy leadership in British Columbia (BC). The intent of the plan is make the province energy self-sufficient while taking responsibility for the natural environment and climate. The BC energy plan set out targets as well as a strategy for reducing greenhouse gas emissions. The plan outlines the steps that industry, environmental agencies, communities and citizens must take to reach goals for conservation, energy efficiency and clean energy. This report provided highlights of the BC energy plan and discussed energy conservation and efficiency targets. It also discussed electricity security and public ownership of electricity in addition to strategies and policy options for reducing greenhouse gas emissions from electricity. The report presented several policy options for alternative energy including an innovative clean energy fund; generating electricity from mountain pine beatlewood to turn wood waste into energy; and transportation strategies. The report also discussed electricity options such as bioenergy; coal thermal power; geothermal; hydrogen and fuel cell technology; large hydroelectric dams; natural gas; small hydro; solar; tidal energy; and wind. Other topics that were addressed in the report included skills, training and labour; and, oil and gas policy actions. A summary of policy actions was also presented. tabs., figs
The BC energy plan : a vision for clean energy leadership
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-02-15
Global warming is a pertinent environmental issue. This report presented a vision and plan for clean energy leadership in British Columbia (BC). The intent of the plan is make the province energy self-sufficient while taking responsibility for the natural environment and climate. The BC energy plan set out targets as well as a strategy for reducing greenhouse gas emissions. The plan outlines the steps that industry, environmental agencies, communities and citizens must take to reach goals for conservation, energy efficiency and clean energy. This report provided highlights of the BC energy plan and discussed energy conservation and efficiency targets. It also discussed electricity security and public ownership of electricity in addition to strategies and policy options for reducing greenhouse gas emissions from electricity. The report presented several policy options for alternative energy including an innovative clean energy fund; generating electricity from mountain pine beatlewood to turn wood waste into energy; and transportation strategies. The report also discussed electricity options such as bioenergy; coal thermal power; geothermal; hydrogen and fuel cell technology; large hydroelectric dams; natural gas; small hydro; solar; tidal energy; and wind. Other topics that were addressed in the report included skills, training and labour; and, oil and gas policy actions. A summary of policy actions was also presented. tabs., figs.
International Nuclear Information System (INIS)
Burger, Joanna; Gochfeld, Michael; Niles, Lawrence; Dey, Amanda; Jeitner, Christian; Pittfield, Taryn; Tsipoura, Nellie
2014-01-01
There is an abundance of field data on levels of metals for feathers in a variety of birds, but relatively few data for tissues, especially for migrant species from one location. In this paper we examine the levels of arsenic, cadmium, chromium, lead, manganese, mercury and selenium in muscle, liver, brain, fat and breast feathers from migrant semipalmated sandpipers (Calidris pusilla) collected from Delaware Bay, New Jersey. Our primary objectives were to (1) examine variation as a function of tissue, (2) determine the relationship of metal levels among tissues, and (3) determine the selenium:mercury molar ratio in different tissues since selenium is thought to protect against mercury toxicity. We were also interested in whether the large physiological changes that occur while shorebirds are on Delaware Bay (e.g. large weight gains in 2–3 weeks) affected metal levels, especially in the brain. There were significant differences among tissues for all metals. The brain had the lowest levels of arsenic and cadmium, and was tied for the lowest levels of all other metals except lead and selenium. Correlations among metals in tissues were varied, with mercury levels being positively correlated for muscle and brain, and for liver and breast feathers. Weights vary among individuals at the Delaware Bay stopover, as they arrive light, and gain weight prior to migration north. Bird weight and levels of arsenic, cadmium, and selenium in the brain were negatively correlated, while they were positively correlated for lead. There was no positive correlation for mercury in the brain as a function of body weight. The selenium:mercury molar ratio varied significantly among tissues, with brain (ratio of 141) and fat having the highest ratios, and liver and breast feathers having the lowest. In all cases, the ratio was above 21, suggesting the potential for amelioration of mercury toxicity. - Highlights: • Metal levels were examined for migrant semipalmated sandpipers. • There
Energy Technology Data Exchange (ETDEWEB)
Burger, Joanna, E-mail: burger@biology.rutgers.edu [Division of Life Sciences, Rutgers University, 604 Allison Road, Piscataway, NJ (United States); Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States); Gochfeld, Michael [Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States); Environmental and Occupational Medicine, Rutgers RWJ Medical School, Rutgers University, Piscataway, NJ (United States); Niles, Lawrence [Conserve Wildlife, 109 Market Lane, Greenwich, NJ (United States); Dey, Amanda [NJ Department of Environmental Protection, Endangered and Nongame Species Program, Trenton, NJ (United States); Jeitner, Christian; Pittfield, Taryn [Division of Life Sciences, Rutgers University, 604 Allison Road, Piscataway, NJ (United States); Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States); Tsipoura, Nellie [New Jersey Audubon Society, 11 Hardscrabble Rd, Bernardsville, NJ (United States)
2014-08-15
There is an abundance of field data on levels of metals for feathers in a variety of birds, but relatively few data for tissues, especially for migrant species from one location. In this paper we examine the levels of arsenic, cadmium, chromium, lead, manganese, mercury and selenium in muscle, liver, brain, fat and breast feathers from migrant semipalmated sandpipers (Calidris pusilla) collected from Delaware Bay, New Jersey. Our primary objectives were to (1) examine variation as a function of tissue, (2) determine the relationship of metal levels among tissues, and (3) determine the selenium:mercury molar ratio in different tissues since selenium is thought to protect against mercury toxicity. We were also interested in whether the large physiological changes that occur while shorebirds are on Delaware Bay (e.g. large weight gains in 2–3 weeks) affected metal levels, especially in the brain. There were significant differences among tissues for all metals. The brain had the lowest levels of arsenic and cadmium, and was tied for the lowest levels of all other metals except lead and selenium. Correlations among metals in tissues were varied, with mercury levels being positively correlated for muscle and brain, and for liver and breast feathers. Weights vary among individuals at the Delaware Bay stopover, as they arrive light, and gain weight prior to migration north. Bird weight and levels of arsenic, cadmium, and selenium in the brain were negatively correlated, while they were positively correlated for lead. There was no positive correlation for mercury in the brain as a function of body weight. The selenium:mercury molar ratio varied significantly among tissues, with brain (ratio of 141) and fat having the highest ratios, and liver and breast feathers having the lowest. In all cases, the ratio was above 21, suggesting the potential for amelioration of mercury toxicity. - Highlights: • Metal levels were examined for migrant semipalmated sandpipers. • There
Human behaviour towards climatic change during the 4th millennium BC in the Swiss Alpine forelands
DEFF Research Database (Denmark)
Karg, Sabine
Human behaviour towards climatic change during the 4th millennium BC in the Swiss Alpine forelands.......Human behaviour towards climatic change during the 4th millennium BC in the Swiss Alpine forelands....
A Toxin-Antitoxin System VapBC15 from Synechocystis sp. PCC 6803 Shows Distinct Regulatory Features
Directory of Open Access Journals (Sweden)
Qian Fei
2018-03-01
Full Text Available Type II toxin–antitoxin (TA systems play important roles in bacterial stress survival by regulating cell growth or death. They are highly abundant in cyanobacteria yet remain poorly characterized. Here, we report the identification and regulation of a putative type II TA system from Synechocystis PCC6803, VapBC15. The VapBC15 system is encoded by the chromosomal operon vapBC15. Exogenous expression of VapC15 dramatically arrested cell growth of Escherichia coli and reduced the numbers of colony-forming units (CFU. The VapC15 toxicity could be which was counteracted neutralized by simultaneous or delayed production of VapB15. Biochemical analysis demonstrated the formation of VapB15-VapC15 complexes by the physical interaction between VapB15 and VapC15. Notably, the VapB15 antitoxin up-regulated the transcription of the vapBC15 operon by directly binding to the promoter region, and the VapC15 toxin abolished the up-regulatory effect by destabilizing the binding. Moreover, VapB15 can be degraded by the proteases Lons and ClpXP2s from Synechocystis PCC6803, thus activating the latent toxicity of VapBC15. These findings suggest that VapBC15 represents a genuine TA system that utilizes a distinct mechanism to regulate toxin activity.
Identification of Ubiquinol Binding Motifs at the Qo-Site of the Cytochrome bc1 Complex
DEFF Research Database (Denmark)
Barragan, Angela M.; Crofts, Antony R.; Schulten, Klaus
2015-01-01
for the function of the bc1 complex is the initial redox process that involves a bifurcated electron transfer in which the two electrons from a quinol substrate are passed to different electron acceptors in the bc1 complex. The electron transfer is coupled to proton transfer. The overall mechanism of quinol...... all atom molecular dynamics and quantum chemical calculations to reveal the binding modes of quinol at the Qo-site of the bc1 complex from Rhodobacter capsulatus. The calculations suggest a novel configuration of amino acid residues responsible for quinol binding and support a mechanism for proton...
International Nuclear Information System (INIS)
Braizinha, B.; Esterline, J.H.; Karwowski, H.J.; Tornow, W.
2010-01-01
A cylindrical 5.1 cmx5.1 cm scintillator cell filled with the KamLAND liquid scintillator has been exposed to monoenergetic neutron beams produced via the 2 H(d,n) 3 He reaction to measure the proton light-response function for energies up to 10 MeV. Using Birks' recipe, the α-particle light-response function was derived from these data. The same method was applied to the BC-501A and BC-517H liquid scintillators to check on the systematic accuracy of the present data. The proton and α-particle light-response functions are needed to correct the KamLAND antineutrino prompt energy spectrum for background effects caused by the reaction 13 C(α,n) 16 O. Especially, the geo-antineutrino energy regime measured in the KamLAND experiment is contaminated by background events from this reaction.
Fabricate BC/Fe3O4@PPy 3D nanofiber film as flexible electrode for supercapacitor application
Lv, Xvdan; Li, Guohui; Pang, Zengyuan; Li, Dawei; Lei, Luo; Lv, Pengfei; Mushtaq, Muhammad; Wei, Qufu
2018-05-01
For flexible film supercapacitor, high areal capacitance is a main evaluating indicator. In this paper, bacterial cellulose (BC) with special three-dimensional structure was used as the natural flexible base material. Fe3O4 nanoparticles with average diameter of 20 nm were synthesized on the surface of BC fibers. The conductive path polypyrrole (PPy) was introduced as shell of BC/Fe3O4 fibers to further improve the pseudo capacitance in 1 mol/L H2SO4 solution. Besides, the BC/Fe3O4@PPy was used for supercapacitor application in acid electrolyte, and delivered higher areal capacitance compared to other Fe3O4 composites in previous reports. The obtained BC/Fe3O4@PPy film showed excellent mechanical strength (tensile strength reached 11 MPa), high areal specific capacitance (5.4 F cm-2 at active mass of 8.4 mg cm-2), and long cycle life (1.95 F cm-2 over 3500 cycles).
International Nuclear Information System (INIS)
1992-07-01
Four areas of the Hanford Site (the 100, 200, 300, and 1100 Areas) have been included on the US Environmental Protection Agency's (EPA's) National Priorities List (NPL) under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). The Tri-Party Agreement requires that the cleanup programs at the Hanford Site integrate the requirements of CERCLA, RCRA, and Washington State's dangerous waste (the state's RCRA-equivalent) program. This work plan and the attached supporting project plans establish the operable unit setting and the objectives, procedures, tasks, and schedule for conducting the CERCLA remedial investigation/feasibility study (RI/FS) for the 100-BC-5 operable unit. The 100-B/C Area consists of the 100-BC-5 groundwater operable unit and four source operable units. The 100-BC-5 operable unit includes all contamination found in the aquifer soils and water beneath the 100-B/C Area. Source operable units include facilities and unplanned release sites that are potential sources of contamination
Directory of Open Access Journals (Sweden)
Hsin-Hui Huang
Full Text Available The CreBC two-component system (TCS is a conserved regulatory system found in Escherichia coli, Aeromonas spp., Pseudomonas aeruginosa, and Stenotrophomonas maltophilia. In this study, we determined how CreBC TCS regulates secreted protease activities and swimming motility using creB, creC, and creBC in-frame deletion mutants (KJΔCreB, KJΔCreC, and KJΔBC of S. maltophilia KJ. Compared to wild-type KJ, KJΔCreB had a comparable secreted protease activity; however, the secreted protease activities were obviously reduced in KJΔCreC and KJΔBC, suggesting that CreC works together with another unidentified response regulator (not CreB to regulate secreted protease activity. Single gene inactivation of creB or creC resulted in mutants with an enhanced swimming motility, and this phenotype was exacerbated in a double mutant KJΔBC. To elucidate the underlying mechanism responsible for the ΔcreBC-mediated swimming enhancement, flagella morphology observation, RNA-seq based transcriptome assay, qRT-PCR, and membrane integrity and potential assessment were performed. Flagella morphological observation ruled out the possibility that swimming enhancement was due to altered flagella morphology. CreBC inactivation upregulated the expression of creD and flagella-associated genes encoding the basal body- and motor-associated proteins. Furthermore, KJΔBC had an increased membrane susceptibility to Triton X-100 and CreD upregulation in KJΔBC partially alleviated the compromise of membrane integrity. The impact of creBC TCS on bacterial membrane potential was assessed by carbonyl cyanide m-chlorophenyl hydrazine (CCCP50 concentration at which 50% of bacterial swimming is inhibited. CCCP50 of wild-type KJ increased when creBC was deleted, indicating an association between the higher membrane potential of KJΔBC cells and enhanced motility. Upregulation of the basal body- and motor-associated genes of flagella in KJΔBC cells may explain the increased
Le Nir, Vincent; Moonen, Marc; Verlinden, Jan; Guenach, Mamoun
2009-02-01
Recently, the duality between Multiple Input Multiple Output (MIMO) Multiple Access Channels (MAC) and MIMO Broadcast Channels (BC) has been established under a total power constraint. The same set of rates for MAC can be achieved in BC exploiting the MAC-BC duality formulas while preserving the total power constraint. In this paper, we describe the BC optimal power allo- cation applying this duality in a downstream x-Digital Subscriber Lines (xDSL) context under a total power constraint for all modems over all tones. Then, a new algorithm called BC-Optimal Spectrum Balancing (BC-OSB) is devised for a more realistic power allocation under per-modem total power constraints. The capacity region of the primal BC problem under per-modem total power constraints is found by the dual optimization problem for the BC under per-modem total power constraints which can be rewritten as a dual optimization problem in the MAC by means of a precoder matrix based on the Lagrange multipliers. We show that the duality gap between the two problems is zero. The multi-user power allocation problem has been solved for interference channels and MAC using the OSB algorithm. In this paper we solve the problem of multi-user power allocation for the BC case using the OSB algorithm as well and we derive a computational efficient algorithm that will be referred to as BC-OSB. Simulation results are provided for two VDSL2 scenarios: the first one with Differential-Mode (DM) transmission only and the second one with both DM and Phantom- Mode (PM) transmissions.
Observation of the decay $B_c^+ \\to B_s^0 \\pi^+$
Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Cheung, S -F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-01-01
The result of a search for the decay $B_c^+ \\to B_s^0 \\pi^+$ is presented, using the $B_s^0 \\to D_s^- \\pi^+$ and $B_s^0 \\to J/\\psi \\phi$ channels. The analysis is based on a data sample of pp collisions collected with the LHCb detector, corresponding to an integrated luminosity of 1 fb$^{-1}$ taken at a center-of-mass energy of 7 TeV, and 2 fb$^{-1}$ taken at 8 TeV. The decay $B_c^+ \\to B_s^0 \\pi^+$ is observed with significance in excess of five standard deviations independently in both decay channels. The measured product of the ratio of cross-sections and branching fraction is $\\sigma(B_c^+)/\\sigma(B_s^0) \\times \\mathcal{B}(B_c^+ \\to B_s^0 \\pi^+) = (2.37 \\pm 0.31 (\\text{stat}) \\pm 0.11 (\\text{syst}) ^{+0.17}_{-0.13} (\\tau_{B_c^+})) \\times 10^{-3}$ in the pseudorapidity range $2 < \\eta(B) < 5$, where the first uncertainty is statistical, the second is systematic and the third is due to the uncertainty on the $B_c^+$ lifetime. This is the first observation of a $B...
Lansoprazole is an antituberculous prodrug targeting cytochrome bc1.
Rybniker, Jan; Vocat, Anthony; Sala, Claudia; Busso, Philippe; Pojer, Florence; Benjak, Andrej; Cole, Stewart T
2015-07-09
Better antibiotics capable of killing multi-drug-resistant Mycobacterium tuberculosis are urgently needed. Despite extensive drug discovery efforts, only a few promising candidates are on the horizon and alternative screening protocols are required. Here, by testing a panel of FDA-approved drugs in a host cell-based assay, we show that the blockbuster drug lansoprazole (Prevacid), a gastric proton-pump inhibitor, has intracellular activity against M. tuberculosis. Ex vivo pharmacokinetics and target identification studies reveal that lansoprazole kills M. tuberculosis by targeting its cytochrome bc1 complex through intracellular sulfoxide reduction to lansoprazole sulfide. This novel class of cytochrome bc1 inhibitors is highly active against drug-resistant clinical isolates and spares the human H(+)K(+)-ATPase thus providing excellent opportunities for targeting the major pathogen M. tuberculosis. Our finding provides proof of concept for hit expansion by metabolic activation, a powerful tool for antibiotic screens.
BC Hydro best practices : energy efficiency and integrated planning
International Nuclear Information System (INIS)
Henriques, D.
2004-01-01
The key elements to success in energy efficiency include integrated energy planning, a review of conservation potential, pursuing a target, risk sharing between all parties, and long term planning when making investments in demand side management (DSM). The barriers to cost effective energy efficiency investment were also outlined along with the scope of the conservation potential review which included 95 per cent of electricity end use applications in all market sectors including residential, commercial, institutional and industrial. BC Hydro's Power Smart program focuses on energy efficiency and load displacement to meet 35 per cent of the utility's forecasted growth by 2012. The sources of savings within each of the market sectors were identified. Key recommendations regarding energy efficiency and conservation were also presented with reference to financial incentives offered by BC Hydro to consumers to encourage a switch to more efficient lighting systems. 10 figs
Yang, Wen-Chao; Li, Hui; Wang, Fu; Zhu, Xiao-Lei; Yang, Guang-Fu
2012-07-23
The cytochrome bc(1) complex (complex III, cyt bc(1)) is an essential component of cellular respiration. Cyt bc(1) has three core subunits that are required for its catalytic activity: cytochrome b, cytochrome c(1), and the Rieske iron-sulfur protein (ISP). Although most fungicides inhibit this enzyme by binding to the cytochrome b subunit, resistance to these fungicides has developed rapidly due to their widespread application. Resistance is mainly associated with mutations in cytochrome b, the only subunit encoded by mitochondrial DNA. Recently, the flexibility and motion of the ISP and its essential role in electron transfer have received intense attention; this leads us to propose a new classification of cyt bc(1) inhibitors (three types of Q(o) inhibitors) that mobilize, restrict, or fix the rotation of the ISP. Importantly, the strengths of the ISP-inhibitor interactions correlate with inhibitor activity and the development of resistance to Q(o) inhibitors, thereby offering clues for designing novel cyt bc(1) inhibitors with high potency and a low risk of resistance. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Observation of Bc+ →d0K+ Decays
Aaij, R.; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; Everse, LA; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J.E.; Appleby, R. B.; Archilli, F.; d'Argent, P.; Arnau Romeu, J.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Babuschkin, I.; Carvalho Akiba, K.; Coco, V.; David, P. N Y; De Bruyn, K.; Ferro-Luzzi, M.; Ketel, T.; Koopman, R. F.; Van Leerdam, J.; Merk, M.; Onderwater, C. J G; Raven, G.; Schiller, M.; Serra, N.; Snoek, H.; Storaci, B.; Syropoulos, V.; Van Tilburg, J.; Tolk, S.; Tsopelas, P.; Tuning, N.
2017-01-01
Using proton-proton collision data corresponding to an integrated luminosity of 3.0 fb-1, recorded by the LHCb detector at center-of-mass energies of 7 and 8 TeV, the Bc+→D0K+ decay is observed with a statistical significance of 5.1 standard deviations. By normalizing to B+→D0π+ decays, a
Institute of Scientific and Technical Information of China (English)
LIU Zhong-Li; CHENG Yan; TAN Ni-Na; GOU Qing-Quan
2006-01-01
The thermodynamic properties of LiBC are investigated by using the full-potential linearized muffin-tin orbital method (FP-LMTO) within the frame of density functional theory (DFT) and using the quasi-harmonic Debye model. The dependencies of the normalized lattice parameters a/a0 and c/c0, the ratio (c/a)/2, the normalized primitive volume V/V0 on pressure and temperature are successfully obtained. It is found that the interlayer covalent interactions (Li-B bonds or Li-C bonds) are more sensitive to temperature and pressure than intralayer ones (B-C bonds), as gives rise to the extreme lattice anisotropy in the bulk hcp LiBC.
Box, Dale
2008-01-01
The British Columbia (BC) Council on Admissions and Transfer (BCCAT) has undertaken, in the last couple of years, a review of the BC Transfer System. Preliminary findings indicate that the current structure of the BC Transfer Guide (BCTG), which designates institutions as either "sending" institutions or "receiving"…
Energy Technology Data Exchange (ETDEWEB)
Braizinha, B. [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Esterline, J.H. [Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Department of Physics, Duke University, Durham, NC 27708 (United States); Karwowski, H.J. [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Tornow, W., E-mail: tornow@tunl.duke.ed [Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Department of Physics, Duke University, Durham, NC 27708 (United States)
2010-11-21
A cylindrical 5.1 cmx5.1 cm scintillator cell filled with the KamLAND liquid scintillator has been exposed to monoenergetic neutron beams produced via the {sup 2}H(d,n){sup 3}He reaction to measure the proton light-response function for energies up to 10 MeV. Using Birks' recipe, the {alpha}-particle light-response function was derived from these data. The same method was applied to the BC-501A and BC-517H liquid scintillators to check on the systematic accuracy of the present data. The proton and {alpha}-particle light-response functions are needed to correct the KamLAND antineutrino prompt energy spectrum for background effects caused by the reaction {sup 13}C({alpha},n){sup 16}O. Especially, the geo-antineutrino energy regime measured in the KamLAND experiment is contaminated by background events from this reaction.
International Nuclear Information System (INIS)
Azila Adnan; Nair, G.R.; Roslan Umar; Roslan Umar
2015-01-01
Bacterial cellulose (BC) is a polymer of glucose monomers, which has unique properties including high crystallinity and high strength. It has potential to be used in biomedical applications such as making artificial blood vessel, wound dressings, and in the paper making industry. Extensive study on BC aimed to improve BC production such as by using glycerol as a cheaper carbon source. BC was produced in shake flask culture using five different concentrations of glycerol (10, 20, 30, 40 and 50 g/ L). Using concentration of glycerol above 20 g/ L inhibited culture growth and BC production. Further experiments were performed in batch culture (3-L bioreactor) using 20 g/ L glycerol. It produced yield and productivity of 0.15 g/ g and 0.29 g/ L/ day BC, respectively. This is compared with the control medium, 50 g/ L glucose, which only gave yield and productivity of 0.05 g/ g and 0.23 g/ L/ day, respectively. Twenty g/ L of glycerol enhanced BC production by Gluconacetobacter xylinus DSM46604 in batch fermentation system. (author)
Behzad, Somayeh
2017-11-01
Recently, a new two-dimensional (2D) material, the 2D BC3 crystal, has been synthesized. Here, the mechanical control of the electro-optical properties of monolayer and bilayer BC3 by applying the biaxial strain is investigated. The electronic structure calculations showed that the strain-free monolayer and bilayer BC3 are indirect band-gap semiconductors with band gap of 0.62 and 0.29 eV, respectively, where the conduction band minimum (CBM) is at the M point whereas the valence band maximum (VBM) is at the Γ point. The doubly degenerated bands in the monolayer BC3 are splitted in the bilayer BC3 due to the interlayer interactions. Both monolayer and bilayer BC3 remain indirect gap semiconductor under biaxial tensile strain and their band gaps increases with strain. On the other hand, by increasing the magnitude of tensile strain, the optical spectra shift to the lower energies and the static dielectric constant increases. These findings suggest the potential of strain-engineered 2D BC3 in electronic and optoelectronic device applications.
Energy Technology Data Exchange (ETDEWEB)
Sulyaeva, Veronica S., E-mail: veronica@niic.nsc.ru [Department of Functional Materials Chemistry, Nikolaev Institute of Inorganic Chemistry, SB RAS, 630090 Novosibirsk (Russian Federation); Rumyantsev, Yurii M. [Department of Functional Materials Chemistry, Nikolaev Institute of Inorganic Chemistry, SB RAS, 630090 Novosibirsk (Russian Federation); Kesler, Valerii G. [Laboratory of Physical Principles for Integrated Microelectronics, Rzhanov Institute of Semiconductor Physics, SB RAS, 630090 Novosibirsk (Russian Federation); Kosinova, Marina L. [Department of Functional Materials Chemistry, Nikolaev Institute of Inorganic Chemistry, SB RAS, 630090 Novosibirsk (Russian Federation)
2015-04-30
BC{sub x}N{sub y} films were obtained by plasma enhanced chemical vapor deposition method using a single-source precursor N-triethylborazine and hydrogen as plasma activating gas. The effect of synthesis temperature on the chemical composition and properties of the BC{sub x}N{sub y} films was investigated. The BC{sub x}N{sub y} films were examined by scanning electron microscopy, Fourier transform infrared and Raman spectroscopy, X-ray energy dispersive spectroscopy, X-ray photoelectron spectroscopy, and ellipsometry and spectrophotometry techniques. These experimental results indicated that the BC{sub x}N{sub y} films produced at low temperatures (T{sub dep} ≤ 673 K) are the polymer-like hydrogenated films with high transparency up to 93% in the visible part of the spectrum. BC{sub x}N{sub y} films produced at high temperatures (> 673 K) contain additional phase of disordered carbon which has dramatically reduce transparency. The band gap of the films varied from 0.6 to 4.5 eV, with variation in deposition temperature. - Highlights: • Thin BC{sub x}N{sub y} films have been obtained by plasma enhanced chemical vapor deposition. • N-triethylborazine was used as a precursor. • Low temperature BC{sub x}N{sub y} films were found to be high optical transparent layers (93%). • Optical band gap of the BC{sub x}N{sub y} layers varied from 0.6 to 4.5 eV.
Premature deaths attributed to source-specific BC emissions in six urban US regions
International Nuclear Information System (INIS)
Turner, Matthew D; Henze, Daven K; Capps, Shannon L; Hakami, Amir; Zhao, Shunliu; Resler, Jaroslav; Carmichael, Gregory R; Stanier, Charles O; Baek, Jaemeen; Sandu, Adrian; Russell, Armistead G; Nenes, Athanasios; Pinder, Rob W; Napelenok, Sergey L; Bash, Jesse O; Percell, Peter B; Chai, Tianfeng
2015-01-01
Recent studies have shown that exposure to particulate black carbon (BC) has significant adverse health effects and may be more detrimental to human health than exposure to PM 2.5 as a whole. Mobile source BC emission controls, mostly on diesel-burning vehicles, have successfully decreased mobile source BC emissions to less than half of what they were 30 years ago. Quantification of the benefits of previous emissions controls conveys the value of these regulatory actions and provides a method by which future control alternatives could be evaluated. In this study we use the adjoint of the Community Multiscale Air Quality (CMAQ) model to estimate highly-resolved spatial distributions of benefits related to emission reductions for six urban regions within the continental US. Emissions from outside each of the six chosen regions account for between 7% and 27% of the premature deaths attributed to exposure to BC within the region. While we estimate that nonroad mobile and onroad diesel emissions account for the largest number of premature deaths attributable to exposure to BC, onroad gasoline is shown to have more than double the benefit per unit emission relative to that of nonroad mobile and onroad diesel. Within the region encompassing New York City and Philadelphia, reductions in emissions from large industrial combustion sources that are not classified as EGUs (i.e., non-EGU) are estimated to have up to triple the benefits per unit emission relative to reductions to onroad diesel sectors, and provide similar benefits per unit emission to that of onroad gasoline emissions in the region. While onroad mobile emissions have been decreasing in the past 30 years and a majority of vehicle emission controls that regulate PM focus on diesel emissions, our analysis shows the most efficient target for stricter controls is actually onroad gasoline emissions. (letter)
Conte, Laura; Trumpower, Bernard L; Zara, Vincenzo
2011-01-01
The yeast cytochrome bc(1) complex, a component of the mitochondrial respiratory chain, is composed of ten distinct protein subunits. In the assembly of the bc(1) complex, some ancillary proteins, such as the chaperone Bcs1p, are actively involved. The deletion of the nuclear gene encoding this chaperone caused the arrest of the bc(1) assembly and the formation of a functionally inactive bc(1) core structure of about 500-kDa. This immature bc(1) core structure could represent, on the one hand, a true assembly intermediate or, on the other hand, a degradation product and/or an incorrect product of assembly. The experiments here reported show that the gradual expression of Bcs1p in the yeast strain lacking this protein was progressively able to rescue the bc(1) core structure leading to the formation of the functional homodimeric bc(1) complex. Following Bcs1p expression, the mature bc(1) complex was also progressively converted into two supercomplexes with the cytochrome c oxidase complex. The capability of restoring the bc(1) complex and the supercomplexes was also possessed by the mutated yeast R81C Bcsp1. Notably, in the human ortholog BCS1L, the corresponding point mutation (R45C) was instead the cause of a severe bc(1) complex deficiency. Differently from the yeast R81C Bcs1p, two other mutated Bcs1p's (K192P and F401I) were unable to recover the bc(1) core structure in yeast. This study identifies for the first time a productive assembly intermediate of the yeast bc(1) complex and gives new insights into the molecular mechanisms involved in the last steps of bc(1) assembly. Copyright © 2010 Elsevier B.V. All rights reserved.
A, Abubakr O; M, Mohamed M; A, Hatim A; Elamin, Mohamed Y; Younis, Brima M; E, Mona E; Musa, Ahmed M; Elhassan, Ahmed M; G, Eltahir A
2014-01-01
Visceral leishmaniasis (VL) is a life-threatening infection caused by Leishmania species. In Sudan, VL is caused by L donovani. Most drugs used to treat VL, especially pentavalent antimony compounds (sodium stibogluconate, SSG), are potentially hepatotoxic. A number of fatal catastrophes happened because patients with VL-hepatitis B/C coinfection were indiscriminately treated with SSG in settings where VL and viral hepatitis coexist. This study aimed to study biochemical and hematological parameters of patients with VL-hepatitis B/C coinfections with the aim to modify treatment protocols to reduce coinfection.added morbidity and mortality. This was a prospective analytical, hospital-based, and case-controlled study. The study was done at Kassab Hospital and Professor Elhassan Centre for tropical medicine during the period of February 2008 to April 2013. Following informed consent by the participants, 78 parasitologically confirmed VL patients with either hepatitis B or C or both and 528 sex- and age-unmatched VL patients without hepatitis B/C coinfection (control group) were enrolled sequentially. Diagnosis of hepatitis B or C was made using immunochromatographic test kits and confirmed by an enzyme-linked immunosorbent assay. VL patients with hepatitis B/C coinfections had significantly increased levels of AST, ALT, and total bilirubin compared to the control group (P=.0001 for all), with significantly decreased levels of albumin and platelets counts (P=.0029 for both). VL-hepatitis B/C coinfections are an emerging entity that needs anti-leishmanial treatment modification. Alternative treatments like paromomycin and amphotericin B (AmBisome) could be reserved for these patients.
Neutron detection and applications using a BC454/BGO array
International Nuclear Information System (INIS)
Miller, M.C.; Biddle, R.S.; Bourret, S.C.
1998-01-01
Neutron detection and multiplicity counting has been investigated using a boron-loaded plastic scintillator (BC454)/bismuth germanate (BGO) phoswich detector array. Boron-loaded plastic combines neutron moderation (H) and detection ( 10 B) at the molecular level, thereby physically coupling increasing detection efficiency and decreasing die-away time with detector volume. Separation of the phoswich response into its plastic scintillator and bismuth germanate components was accomplished on an event-by-event basis using custom integrator and timing circuits, enabling a prompt coincidence requirement between the BC454 and BGO to be used to identify neutron captures. In addition, a custom time-tag module was used to provide a time for each detector event. Time-correlation analysis was subsequently performed on the filtered event stream to obtain shift-register-type singles and doubles count rates
A new era of prosperity through power : maintaining BC's competitive advantage
International Nuclear Information System (INIS)
Potts, D.
2001-01-01
The availability of abundant low cost electric power has been a driving force behind British Columbia's economic growth. BC's low cost power resources can create a natural competitive economic advantage for the province. Electricity, as a publicly owned resource can offer many competitive advantages for business in British Columbia, if managed correctly. However, it was noted that meaningful economic advantages can only be realized if the existing power resources in the province are operated efficiently and priced at or close to cost. In the 1980s, the Joint Industry Electricity Steering Committee (JIESC) was formed following the regulation of BC Hydro by BC Utilities Commission. It became clear that maintaining low rates for electricity was a public issue that needed input from other governmental forums if JIESC was to be successful. The major sectors represented by JIESC include pulp and paper, mining, and electrochemicals. This paper listed each member company. In order to turn BC's economy around and re-establish the province as a leading economy in Canada, the following recommendations have been proposed for the short term: (1) maintain an ample supply of low cost power for the future, (2) remove the provincial sales tax on the purchase of electric power used for manufacturing and processing, (3) extend the current rate freeze, (4) initiate a long-term resource acquisition and transmission expansion strategy to assure the availability of ample supplies of low cost power. Recommendations for the long term include: (1) maintain regulated cost based rates, (2) develop ample low cost power, (3) utilize downstream benefits, (4) provide a role for the private sector, (5) maintain adequate transmission facilities, (6) reduce government revenues, and (7) instill customer driven management. 3 figs
Ito, A.; Akimoto, H.
2006-12-01
We estimate the emissions of black carbon (BC) from open vegetation fires in southern hemisphere Africa from 1998 to 2005 using satellite information in conjunction with a biogeochemical model. Monthly burned areas at a 0.5-degree resolution are estimated from the Visible and Infrared Scanner (VIRS) fire count product and the Moderate Resolution Imaging Spectroradiometer (MODIS) burned area data set associated with the MODIS tree cover imagery in grasslands and woodlands. The monthly fuel load distribution is derived from a 0.5- degree terrestrial carbon cycle model in conjunction with satellite data. The monthly maps of combustion factor and emission factor are estimated using empirical models that predict the effects of fuel conditions on these factors in grasslands and woodlands. Our annual averaged BC emitted per unit area burned is 0.17 g BC m-2 which is consistent with the product of fuel consumption and emission factor typically measured in southern Africa. The BC emissions from open vegetation burning in southern Africa ranged from 0.26 Tg BC yr-1 for 2002 to 0.42 Tg BC yr-1 for 1998. The peak in BC emissions is identical to that from previous top-down estimate using the Total Ozone Mapping Spectrometer (TOMS) Aerosol Index (AI) data. The sum of monthly emissions during the burning season in 2000 is in good agreement between our estimate (0.38 Tg) and previous estimate constrained by numerical model and measurements (0.47 Tg).
A comparative DFT study on CO oxidation reaction over Si-doped BC2N nanosheet and nanotube
Nematollahi, Parisa; Neyts, Erik C.
2018-05-01
In this study, we performed density functional theory (DFT) calculations to investigate different reaction mechanisms of CO oxidation catalyzed by the Si atom embedded defective BC2N nanostructures as well as the analysis of the structural and electronic properties. The structures of all the complexes are optimized and characterized by frequency calculations at the M062X/6-31G∗ computational level. Also, The electronic structures and thermodynamic parameters of adsorbed CO and O2 molecules over Si-doped BC2N nanostructures are examined in detail. Moreover, to investigate the curvature effect on the CO oxidation reaction, all the adsorption and CO oxidation reactions on a finite-sized armchair (6,6) Si-BC2NNT are also studied. Our results indicate that there can be two possible pathways for the CO oxidation with O2 molecule: O2(g) + CO(g) → O2(ads) + CO(ads) → CO2(g) + O(ads) and O(ads) + CO(g) → CO2(g). The first reaction proceeds via the Langmuir-Hinshelwood (LH) mechanism while the second goes through the Eley-Rideal (ER) mechanism. On the other hand, by increasing the tube diameter, the energy barrier increases due to the strong adsorption energy of the O2 molecule which is related to its dissociation over the tube surface. Our calculations indicate that the two step energy barrier of the oxidation reaction over Si-BC2NNS is less than that over the Si-BC2NNT. Hence, Si-BC2NNS may serve as an efficient and highly activated substrate to CO oxidation rather than (4,4) Si-BC2NNT.
NGDC/WDS Global Historical Tsunami Database, 2100 BC to present
National Oceanic and Atmospheric Administration, Department of Commerce — The Global Historical Tsunami Database provides information on over 2,400 tsunamis from 2100 BC to the present in the the Atlantic, Indian, and Pacific Oceans; and...
Theoretically predicted soft x-ray emission and absorption spectra of graphitic-structured BC2N
Muramatsu, Yasuji
Theoretical B K, C K and N K x-ray emission/absorption spectra of three possible graphitic-structured BC2N clusters are predicted based on the B2p-, C2p-, and N2p- density-of-states (DOS) calculated by discrete variational (DV)-X[alpha] molecular orbital calculations. Several prominent differences in DOS spectral features among BC2Ns, h-BN, and graphite are confirmed from comparison of calculated B2p-, C2p-, and N2p-DOS spectra. These variations in the spectra allow BC2N structures to be positively identified by high-resolution x-ray emission/absorption spectroscopy in the B K, C K, and N K regions.
Semileptonic decays of B_c meson to S-wave charmonium states in the perturbative QCD approach
International Nuclear Information System (INIS)
Rui, Zhou; Li, Hong; Wang, Guang-xin; Xiao, Ying
2016-01-01
Inspired by the recent measurement of the ratio of B_c branching fractions to J/ψπ"+ and J/ψμ"+ν_μ final states at the LHCb detector, we study the semileptonic decays of B_c meson to the S-wave ground and radially excited 2S and 3S charmonium states with the perturbative QCD approach. After evaluating the form factors for the transitions B_c → P,V, where P and V denote pseudoscalar and vector S-wave charmonia, respectively, we calculate the branching ratios for all these semileptonic decays. The theoretical uncertainty of hadronic input parameters are reduced by utilizing the light-cone wave function for the B_c meson. It is found that the predicted branching ratios range from 10"-"7 up to 10"-"2 and could be measured by the future LHCb experiment. Our prediction for the ratio of branching fractions (BR(B_c"+→J/Ψπ"+))/(BR(B_c"+→J/Ψμ"+ν_μ)) is in good agreement with the data. For B_c → Vlν_l decays, the relative contributions of the longitudinal and transverse polarization are discussed in different momentum transfer squared regions. These predictions will be tested on the ongoing and forthcoming experiments. (orig.)
Remedial action and waste disposal project: 100-B/C remedial action readiness evaluation plan
International Nuclear Information System (INIS)
April, J.G.; Bryant, D.L.; Cislo, G.B.
1996-06-01
The Readiness Evaluation Plan presents the methodology used to assess the readiness of the 100-B/C Remedial Action Project. The 100 Areas Remedial Action Project will remediate the 100 Areas liquid waste site identified in the Interim Action Record of Decision for the 100- BC-1, 100-DR-1, and 100-HR-1 Operable Units. These sites are located in the 100 Area of the Hanford Site in Richland, Washington
BC Hydro experiences the power of engineering document management software
International Nuclear Information System (INIS)
Wilkins, A.
2000-01-01
The recent popularity of electronic document management software (EDMS), specifically designed for engineering CAD/CAM drawings that holds the promise of reducing paper-pushing and freeing up organizational resources for more productive purposes, is discussed. To illustrate how such systems function, a document management system installed at BC Hydro, with over 2,500 users in two main engineering groups is described. The new system - FileNET - replaces several older systems that have been used as stand-alone systems in various divisions of BC Hydro for some time. Instead of integrating the entire file of some 750,000 documents, the new system has complete records of some 70,000 of the most recent CAD drawings and an on-line index to the older file that is used less frequently. Access to the entire storehouse of drawings is said to be fast, efficient and secure. Automated document control procedures during work-in-progress, viewing, redlining capabilities, seamless integration with CAD tools and Web access to drawings from anywhere within the two engineering divisions, are some of the most noteworthy characteristics of the new system. It does not completely replace paper, but it does promise significant streamlining of the paper handling function. It also ensures that BC Hydro's central computer is the prime repository of all documents and drawings, and that this valuable record of environmental. legal, regulatory and other public policy importance is instantly available, without the need to handle paper
Nematollahi, Parisa; Esrafili, Mehdi D.; Neyts, Erik C.
2018-06-01
In this study, the healing of N-vacancy boron carbonitride nanosheet (NV-BC2NNS) and nanotube (NV-BC2NNT) by NO molecule is studied by means of density functional theory calculations. Two different N-vacancies are considered in each of these structures in which the vacancy site is surrounded by either three B-atoms (NB) or by two B- and one C-atom (NBC). By means of the healed BC2NNS and BC2NNT as a support, the removal of two toxic gas molecules (NO and CO) are applicable. It should be noted that the obtained energy barriers of both healing and oxidizing processes are significantly lower than those of graphene, carbon nanotubes or boron nitride nanostructures. Also, at the end of the oxidation process, the pure BC2NNS or BC2NNT is obtained without any additional defects. Therefore, by using this method, we can considerably purify the defective BC2NNS/BC2NNT. Moreover, according to the thermochemistry calculations we can further confirm that the healing process of the NV-BC2NNS and NV-BC2NNT by NO are feasible at room temperature. So, we can claim that this study could be very helpful in both purifying the defective BC2NNS/BC2NNT while in the same effort removing toxic NO and CO gases.
Directory of Open Access Journals (Sweden)
Yuanfeng Wu
Full Text Available Genotoxicity assessment is of great significance in drug safety evaluation, and microarray is a useful tool widely used to identify genotoxic stress responsive genes. In the present work, by using oligonucleotide microarray in an in vivo model, we identified an unknown gene BC005512 (abbreviated as BC, official full name: cDNA sequence BC005512, whose expression in mouse liver was specifically induced by seven well-known genotoxins (GTXs, but not by non-genotoxins (NGTXs. Bioinformatics revealed that BC was a member of the GLN family of murine endogenous retrovirus (ERV. However, the relationship to genotoxicity and the cellular function of GLN are largely unknown. Using NIH/3T3 cells as an in vitro model system and quantitative real-time PCR, BC expression was specifically induced by another seven GTXs, covering diverse genotoxicity mechanisms. Additionally, dose-response and linear regression analysis showed that expression level of BC in NIH/3T3 cells strongly correlated with DNA damage, measured using the alkaline comet assay,. While in p53 deficient L5178Y cells, GTXs could not induce BC expression. Further functional studies using RNA interference revealed that down-regulation of BC expression induced G1/S phase arrest, inhibited cell proliferation and thus suppressed cell growth in NIH/3T3 cells. Together, our results provide the first evidence that BC005512, a member from GLN family of murine ERV, was responsive to DNA damage and involved in cell growth regulation. These findings could be of great value in genotoxicity predictions and contribute to a deeper understanding of GLN biological functions.
Contribution to the Analysis of the $B^{+}_{c} \\to K^{+}K^{-}\\pi^{+}$ decay in the LHCb Experiment
AUTHOR|(CDS)2093826
The studies of the $B^{+}_{c}$ meson's decays to final states containing $K^{+}K^{-}\\pi^{+}$, occurring through either direct annihilation diagrams or diagrams containing an intermediate $D^{0}$ meson, are potentially useful to probe Standard Model predictions. However, very few measurements regarding the $B^{+}_{c}$ meson have been performed, due to its low probability of being produced in particle accelerators. A measurement of these decays is only possible with the collision energies and the unprecedented amount of statistical data collected at the LHC. This dissertation details the steps in the $B^{+}_{c} \\to K^{+}K^{-}\\pi^{+}$ analysis that attempts to perform a measurement of the $B^{+}_{c}$ signal, using data collected by the LHCb detector from $2010$ to $2012$. The event selection is completed and the full fit model is determined, in preparation for a final measurement.
Zara, Vincenzo; Conte, Laura; Trumpower, Bernard L.
2009-01-01
The assembly status of the cytochrome bc1 complex has been analyzed in distinct yeast deletion strains in which genes for one or more of the bc1 subunits had been deleted. In all the yeast strains tested a bc1 sub-complex of about 500 kDa was found when the mitochondrial membranes were analyzed by blue native electrophoresis. The subsequent molecular characterization of this sub-complex, carried out in the second dimension by SDS-PAGE and immunodecoration, revealed the presence of the two catalytic subunits cytochrome b and cytochrome c1, associated with the non catalytic subunits core protein 1, core protein 2, Qcr7p and Qcr8p. Altogether these bc1 subunits build up the core structure of the cytochrome bc1 complex which is then able to sequentially bind the remaining subunits, such as Qcr6p, Qcr9p, the Rieske iron-sulfur protein and Qcr10p. This bc1 core structure may represent a true assembly intermediate during the maturation of the bc1 complex, first because of its wide distribution in distinct yeast deletion strains and second for its characteristics of stability which resemble those of the intact homodimeric bc1 complex. Differently from this latter, however, the bc1 core structure is not able to interact with the cytochrome c oxidase complex to form respiratory supercomplexes. The characterization of this novel core structure of the bc1 complex provides a number of new elements for clarification of the molecular events leading to the maturation of the yeast cytochrome bc1 complex in the inner mitochondrial membrane. PMID:19236481
Ma, Yuexin; Sun, Feixue; Zhang, Congyao; Bao, Pengyun; Cao, Shuqing; Zhang, Meiyan
2014-12-01
A marine bacterium, Pseudoalteromonas sp. BC228 was supplemented to feed in a feeding experiment aiming to determine its ability of enhancing the digestive enzyme activity and immune response of juvenile Apostichopus japonicus. Sea cucumber individuals were fed with the diets containing 0 (control), 105, 107 and 109 CFU g-1 diet of BC228 for 45 days. Results showed that intestinal trypsin and lipase activities were significantly enhanced by 107 and 109 CFU g-1 diet of BC228 in comparison with control ( P sea cucumber fed the diet supplemented with 107 CFU g-1 diet of BC228 was significantly higher than that of those fed control diet ( P sea cucumber, respectively, in comparison with other diets ( P Sea cucumbers, 10 each diet, were challenged with Vibrio splendidus NB13 after 45 days of feeding. It was found that the cumulative incidence and mortality of sea cucumber fed with BC228 containing diets were lower than those of animals fed control diet. Our findings evidenced that BC228 supplemented in diets improved the digestive enzyme activity of juvenile sea cucumber, stimulated its immune response and enhanced its resistance to the infection of V. splendidus.
Oosterkamp, Margreet J; Boeren, Sjef; Atashgahi, Siavash; Plugge, Caroline M; Schaap, Peter J; Stams, Alfons J M
2015-06-01
Alicycliphilus denitrificans strain BC grows anaerobically on acetone with nitrate as electron acceptor. Comparative proteomics of cultures of A. denitrificans strain BC grown on either acetone or acetate with nitrate was performed to study the enzymes involved in the acetone degradation pathway. In the proposed acetone degradation pathway, an acetone carboxylase converts acetone to acetoacetate, an AMP-dependent synthetase/ligase converts acetoacetate to acetoacetyl-CoA, and an acetyl-CoA acetyltransferase cleaves acetoacetyl-CoA to two acetyl-CoA. We also found a putative aldehyde dehydrogenase associated with acetone degradation. This enzyme functioned as a β-hydroxybutyrate dehydrogenase catalyzing the conversion of surplus acetoacetate to β-hydroxybutyrate that may be converted to the energy and carbon storage compound, poly-β-hydroxybutyrate. Accordingly, we confirmed the formation of poly-β-hydroxybutyrate in acetone-grown cells of strain BC. Our findings provide insight in nitrate-dependent acetone degradation that is activated by carboxylation of acetone. This will aid studies of similar pathways found in other microorganisms degrading acetone with nitrate or sulfate as electron acceptor. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
B.C. Indians Living Off Reserve: Some Economic Aspects.
Stanbury, W. T.
The study examined the economic development of British Columbia (B.C.) Indians who have moved off-reserve. The discussion included: (1) obtaining the sample, (2) sample description, (3) reasons for living off-reserve, (4) employment opportunities, (5) income and poverty line, and (6) academic achievement. A total of 1,095 persons interviewed…
Remedial action and waste disposal project: 100-B/C remedial action readiness report
International Nuclear Information System (INIS)
April, J.G.; Bryant, D.L.; Cislo, G.B.
1996-07-01
This Readiness Evaluation Report presents the results of the project readiness evaluation to assess the readiness of the 100-B/C source sites remediation. The 100-B/C Area is located at the Hanford Site in Richland, Washington. The evaluation was conducted at the conclusion of a series of readiness activities that began in May 1996. These activities included confirming the completion of project specific procedures, training of staff, obtaining support equipment, receipt of subcontractor submittals, approval of subcontractor submittals, and mobilization and construction of site support systems
Lu, J B; Cheng, B W; Deng, H Q; Su, C; Shen, X B; Du, W X; Yang, L; Wang, G Z; Xu, M
2016-07-01
To observe the Koch phenomenon of Mycobacterium tuberculosis(MTB)-infected guinea pigs after vaccinated with killed H37Ra bacteria or tuberculosis vaccine candidate AEC/BC02. Eighteen guinea pigs were challenged subcutaneously with 5.0×10(3) CFU MTB and after 40 days were divided into 3 groups (6 per group): NS group, AEC/BC02 group and H37Ra group, which were injected intramuscularly 3 times at 1 day interval with normal saline, AEC/BC02 vaccine and killed H37Ra bacteria respectively. Three weeks after the first vaccination, all guinea pigs were sacrificed to evaluate gross pathological scores for liver, spleen and lung, bacterial loads in lung and spleen, and lung inflammation. The gross pathological score in H37Ra group (48±26) was lower than that in NS group(62±15), but the difference was not significant (t=1.093, P=0.300). The AEC/BC02 group had a significantly lower gross pathological score (36±15) than NS group (t=2.980, P=0.014). No significant difference between H37Ra group and AEC/BC02 group was observed (t=1.009, P=0.337). The spleen bacterial load [(5.31±0.80) log10 CFU]in H37Ra group was slightly lower than that in NS group[(5.57±0.75) log10 CFU] but the difference was not significant (t=1.581, P=0.574). In AEC/BC02 group bacterial load in the spleen was (4.64±0.64) log10 CFU and significantly lower than NS group (t=2.306, P=0.044) and no significant difference between H37Ra group and AEC/BC02 group was observed (t=1.602, P=0.140). Meanwhile, the lung bacterial load in AEC/BC02 group was (3.71±1.01) log10 CFU and in H37Ra group was (3.82±1.25) log10 CFU. Compared to (4.15±0.69) log10 CFU in the NS group, no significant differences were found (t=0.881, P=0.399; t=0.566, P=0.584, respectively). For the lung inflammation, the inflamed areas in H37Ra group were significantly larger [(33.0±4.4%)] than those in both NS group [(14.8±8.4) %, t=4.719, P=0.001] and AEC/BC02 group [(14.8±8.4) %, t=3.616, P=0.005], and no significant differences were
A DFT study of adsorption of glycine onto the surface of BC_2N nanotube
International Nuclear Information System (INIS)
Soltani, Alireza; Azmoodeh, Zivar; Javan, Masoud Bezi; Lemeski, E. Tazikeh; Karami, Leila
2016-01-01
Highlights: • Glycine adsorption over the pristine BC_2N nanotubes is investigated by DFT calculations. • Adsorption of glycine in its zwitterionic form is stronger in comparison with the radical form. • Adsorption of glycine from its amine head on adsorbent leads to a significant decrease in the electronic properties. - Abstract: A theoretical study of structure and the energy interaction of amino acid glycine (NH_2CH_2COOH) with BC_2N nanotube is crucial for apperception behavior occurring at the nanobiointerface. Herein, we studied the adsorption of glycine in their radical and zwitterionic forms upon the surface of BC_2N nanotube using M06 functional and 6-311G** standard basis set. We also considered the different orientations of the glycine amino acid on the surface of adsorbent. Further, we found out that the stability of glycine from its carbonyl group is higher than hydroxyl and amine groups. Our results also indicated that the electronic structure of BC_2N nanotube on the adsorption of glycine from its amine group is more altered than the other groups. Our study exhibits that opto-electronic property of adsorbent is changed after the glycine adsorption.
The Relationship Between Emissions and Economic Growth for SO2, CO2, and BC
Ru, M.; Shindell, D. T.; Tao, S.; Zhong, Q.; Seltzer, K.
2017-12-01
We characterize the relationship between per person emissions of SO2, CO2, and black carbon (BC) and income using a global country-level emission inventory. Pollutant emissions of SO2 and BC from the power, industry, and transportation sectors largely follow an Environmental Kuznets Curve (EKC) pattern with peak emissions at income levels between 10,000 and 100,000 USD per capita. However, for CO2, any estimated turnover income is extremely high and unlikely to be reached in the near future in power, industry, and transportation. Residential emissions show a negatively sloped linear relationship for BC, a small positive slope for CO2, and a fairly flat trajectory for SO2. For the EKC-like trajectories, "turning point" incomes for each sector and pollutant are related to technological advances and the effectiveness of emission controls. These results suggest that policy targeting technological advances and emission controls could change future pathways by affecting the "turning point" incomes. For the linear trajectories in the residential sector, we show that transitions from biomass fuel to coal in low-income countries and from coal to natural gas in middle and high-income countries, in concert with electrification levels, are the main factors governing slopes. Thus, the three pollutants show different income-emission trajectories based on the sum of the four major sectors, and the residential sector in particular has a unique relationship with income growth. As one of the first studies to analyze historical emission trajectories of BC, we find that BC differs from SO2 and CO2 because of its significantly earlier turnover in the power and industry sectors due to control policies. Total BC emissions trajectories follow a unique shape due to the combination of linearly decreasing residential emissions with EKC-like patterns in industry and transportation. We compare these trajectories to those in three Integrated Assessment Models (IAMs), GCAM, AIM, and MESSAGE
Directory of Open Access Journals (Sweden)
Q. Guo
2017-09-01
Full Text Available East Asia is a densely populated region with a myriad of primary emissions of pollutants such as black carbon (BC and carbon monoxide (CO. To characterize primary emissions over the eastern coast of China, a series of field campaigns were conducted in 2011, including measurements from a ship cruise, island, and coastal receptor sites. The relationship between BC and CO is presented here for the first ship cruise (C1, the second ship cruise (C2, an island site (Changdao Island, CD, and a coastal site (Wenling, WL. The average BC mass concentrations were 2.43, 2.73, 1.09, 0.94, and 0.77 µg m−3 for CD, WL, C1-YS (Yellow Sea, C1-ES (East China Sea, and C2-ES, respectively. For those locations, the average CO mixing ratios were 0.55, 0.48, 0.31, 0.36, and 0.27 ppm. The high loadings of both BC and CO imply severe anthropogenic pollution over the eastern coast of China. Additionally, the linear correlation between BC and CO was regressed for each location. The slopes, i.e., the ratios of ΔBC to ΔCO derived from their relationship, correlated well with the ratios of diesel consumption to gasoline consumption in each province/city, which reveals vehicular emission to be the common source for BC and CO and that there are distinct fuel structures between North and South China. The ΔBC/ΔCO values at coastal sites (Changdao Island and Wenling were much higher than those over the Yellow Sea and East China Sea, and the correlation coefficients also showed a decreasing trend from the coast to the sea. Therefore, the quantity of ΔBC/ΔCO and the correlation coefficients are possible indicators for the aging and removal of BC.
Cadmium Accumulation and Its Toxicity in Brittle Culm 1 (bc1, a Fragile Rice Mutant
Directory of Open Access Journals (Sweden)
Guo-sheng SHAO
2007-09-01
Full Text Available Cadmium (Cd accumulation and toxicity in rice plants were characterized and identified by using brittle culm 1 (bc1, a fragile rice mutant and its wild type (Shuangkezao, an indica rice as materials by hydroponics. The low Cd level didn't obviously affect the growth parameters in both rice genotypes, but under high Cd levels (1.0 and 5.0 μmol/L, the growth of both rice plants were substantially inhibited. Moreover, bc1 tended to suffer more seriously from Cd toxicity than Shuangkezao. Cd accumulation in both rice plants increased with the increase of Cd levels. There was a significant difference in Cd accumulation between the two rice genotypes with constantly higher Cd concentration in bc1, which also accumulated more Cd at 0, 0.1, and 1.0 μmol/L Cd levels. The same case was found in the two rice plants grown on Cd-contaminated soil. This suggested that cell wall might play an important role in Cd accumulation in rice plants by the physiological mechanisms. The malondialdehyde (MDA content, superoxide dismutase (SOD and peroxidase (POD activities in rice plants were affected differently under Cd treatments, and which implied that POD might play the main role in detoxifying active oxygen free radical. A significant difference in antioxidative system between the two rice genotypes was found with constantly higher MDA content, SOD and POD activities in bc1. In summary, bc1 accumulated more Cd and appeared to be more sensitive to Cd stress compared with its wild type.
Acid-base properties of 1-methyl-1,4-dilhydroborabenzene, CH3BC5H6
International Nuclear Information System (INIS)
Sullivan, S.A.; Sandford, H.; Beauchamp, J.L.; Ashe, A.J. III
1978-01-01
Ion cyclotron resonance techniques are employed to determine the gas-phase Bronsted and Lewis acidities as well as the Bronsted basicity of 1-methyl-1,4-dihydroborabenzene, CH 3 BC 5 H 6 . The ring proton is found to be highly acidic with PA(CH 3 BC 5 H 5 - ) = 337 +- 3 kcal/mol. This acidity results from the formation of 6π electron aromatic anion CH 3 BC 5 H 5 - , which is isoelectronic with toluene. Both the Lewis acidity toward F - as a reference base and the proton basicity of the parent molecule suggest that there is little interaction between the diene π system and the electron-deficient boron. This is further confirmed by the similarity of both negative and positive ion chemistry of the borabenzene to that of aliphatic boranes
Ministry of Advanced Education and Labour Market Development, 2009
2009-01-01
The BC Diploma, Associate Degree, and Certificate Student Outcomes (DACSO) Survey (formerly the BC College and Institute Student Outcomes Survey) collects and disseminates information about former students' post-secondary experiences and their subsequent labour market and further education experiences. The survey is administered annually to former…
Effect of diameter and chirality on the structure and electronic properties of BC2N nanotubes
International Nuclear Information System (INIS)
Akhavan, Mojdeh; Jalili, Seifollah; Schofield, Jeremy
2015-01-01
Highlights: • BC 2 N nanotubes with different diameters and four chirality types are studied. • Two lowest-diameter zigzag BC 2 N tubes are metallic and others are semiconducting. • Band gap of zigzag tubes is more sensitive to diameter compared to armchair tubes. • Even–odd oscillation is observed for the band gap of one kind of zigzag tubes. • The energy and band gap for large-diameter tubes converge to BC 2 N sheet values. - Abstract: Density functional theory calculations are used to investigate a series of BC 2 N nanotubes with a wide range of diameters. Two types of zigzag and two types of armchair nanotubes are studied to survey the effect of diameter and chirality on energetics and electronic properties of nanotubes. Two nanotubes are found to be metallic and others show semiconducting behavior. The diameter is shown to have a greater impact on the band gap of zigzag nanotubes than those of armchair tubes. (n, 0) zigzag nanotubes show an even–odd band gap oscillation, which can be explained by the electron density distribution of the lowest unoccupied crystalline orbital. The stability of the nanotubes is also assessed using strain energies and it is shown that the strain energy does not depend on nanotube type and chirality. In the limit of large diameters, the geometry and band gap of all nanotubes converge to BC 2 N sheet data
Ab initio pseudopotential studies of cubic BC2N under high pressure
International Nuclear Information System (INIS)
Pan Zicheng; Sun Hong; Chen Changfeng
2005-01-01
We present the results of a systematic study of the structural, electronic, and vibrational properties of various cubic BC 2 N phases under high pressure. Ab initio pseudopotential total-energy and phonon calculations have been carried out to examine the changes in the structural parameters, bonding behaviours, band structures, and dynamic instabilities caused by phonon softening in these phases. We find that an experimentally synthesized high-density phase of cubic BC 2 N exhibits outstanding stability in the structural and electronic properties up to very high pressures. On the other hand, another experimentally identified phase with lower density and lower symmetry undergoes a dramatic structural transformation with a volume and bond-length collapse and a concomitant semi-metal to semiconductor transition. A third phase is predicted to be favourable over the above-mentioned lower-density phase by the enthalpy calculations. However, the dynamic phonon calculations reveal that it develops imaginary phonon modes and, therefore, is unstable in the experimental pressure range. The calculations indicate that its synthesis may be achieved at reduced pressures. These results provide a comprehensive understanding for the high-pressure behaviour of the cubic BC 2 N phases and reveal their interesting properties that can be verified by experiments
Naylor, Patti-Jean; Macdonald, Heather M; Zebedee, Janelle A; Reed, Katherine E; McKay, Heather A
2006-10-01
The 'active school' model offers promise for promoting school-based physical activity (PA); however, few intervention trials have evaluated its effectiveness. Thus, our purpose was to: (1) describe Action Schools! BC (AS! BC) and its implementation (fidelity and feasibility) and (2) evaluate the impact of AS! BC on school provision of PA. Ten elementary schools were randomly assigned to one of the three conditions: Usual Practice (UP, three schools), Liaison (LS, four schools) or Champion (CS, three schools). Teachers in LS and CS schools received AS! BC training and resources but differed on the level of facilitation provided. UP schools continued with regular PA. Delivery of PA during the 11-month intervention was assessed with weekly Activity Logs and intervention fidelity and feasibility were assessed using Action Plans, workshop evaluations, teacher surveys and focus groups with administrators, teachers, parents and students. Physical activity delivered was significantly greater in LS (+67.4 min/week; 95% CI: 18.7-116.1) and CS (+55.2 min/week; 95% CI: 26.4-83.9) schools than UP schools. Analysis of Action Plans and Activity Logs showed fidelity to the model and moderate levels of compliance (75%). Teachers were highly satisfied with training and support. Benefits of AS! BC included positive changes in the children and school climate, including provision of resources, improved communication and program flexibility. These results support the use of the 'active school' model to positively alter the school environment. The AS! BC model was effective, providing more opportunities for "more children to be more active more often" and as such has the potential to provide health benefits to elementary school children.
Zara, Vincenzo; Conte, Laura; Trumpower, Bernard L
2009-04-01
The assembly status of the cytochrome bc(1) complex has been analyzed in distinct yeast deletion strains in which genes for one or more of the bc(1) subunits were deleted. In all the yeast strains tested, a bc(1) sub-complex of approximately 500 kDa was found when the mitochondrial membranes were analyzed by blue native electrophoresis. The subsequent molecular characterization of this sub-complex, carried out in the second dimension by SDS/PAGE and immunodecoration, revealed the presence of the two catalytic subunits, cytochrome b and cytochrome c(1), associated with the noncatalytic subunits core protein 1, core protein 2, Qcr7p and Qcr8p. Together, these bc(1) subunits build up the core structure of the cytochrome bc(1) complex, which is then able to sequentially bind the remaining subunits, such as Qcr6p, Qcr9p, the Rieske iron-sulfur protein and Qcr10p. This bc(1) core structure may represent a true assembly intermediate during the maturation of the bc(1) complex; first, because of its wide distribution in distinct yeast deletion strains and, second, for its characteristics of stability, which resemble those of the intact homodimeric bc(1) complex. By contrast, the bc(1) core structure is unable to interact with the cytochrome c oxidase complex to form respiratory supercomplexes. The characterization of this novel core structure of the bc(1) complex provides a number of new elements clarifying the molecular events leading to the maturation of the yeast cytochrome bc(1) complex in the inner mitochondrial membrane.
Measurement of the Bc± production cross section in p p ¯ collisions at √{s }=1.96 TeV
Aaltonen, T.; Amerio, S.; Amidei, D.; Anastassov, A.; Annovi, A.; Antos, J.; Apollinari, G.; Appel, J. A.; Arisawa, T.; Artikov, A.; Asaadi, J.; Ashmanskas, W.; Auerbach, B.; Aurisano, A.; Azfar, F.; Badgett, W.; Bae, T.; Barbaro-Galtieri, A.; Barnes, V. E.; Barnett, B. A.; Barria, P.; Bartos, P.; Bauce, M.; Bedeschi, F.; Behari, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Beretvas, A.; Bhatti, A.; Bland, K. R.; Blumenfeld, B.; Bocci, A.; Bodek, A.; Bortoletto, D.; Boudreau, J.; Boveia, A.; Brigliadori, L.; Bromberg, C.; Brucken, E.; Budagov, J.; Budd, H. S.; Burkett, K.; Busetto, G.; Bussey, P.; Butti, P.; Buzatu, A.; Calamba, A.; Camarda, S.; Campanelli, M.; Canelli, F.; Carls, B.; Carlsmith, D.; Carosi, R.; Carrillo, S.; Casal, B.; Casarsa, M.; Castro, A.; Catastini, P.; Cauz, D.; Cavaliere, V.; Cerri, A.; Cerrito, L.; Chen, Y. C.; Chertok, M.; Chiarelli, G.; Chlachidze, G.; Cho, K.; Chokheli, D.; Clark, A.; Clarke, C.; Convery, M. E.; Conway, J.; Corbo, M.; Cordelli, M.; Cox, C. A.; Cox, D. J.; Cremonesi, M.; Cruz, D.; Cuevas, J.; Culbertson, R.; d'Ascenzo, N.; Datta, M.; de Barbaro, P.; Demortier, L.; Deninno, M.; D'Errico, M.; Devoto, F.; Di Canto, A.; Di Ruzza, B.; Dittmann, J. R.; Donati, S.; D'Onofrio, M.; Dorigo, M.; Driutti, A.; Ebina, K.; Edgar, R.; Erbacher, R.; Errede, S.; Esham, B.; Farrington, S.; Fernández Ramos, J. P.; Field, R.; Flanagan, G.; Forrest, R.; Franklin, M.; Freeman, J. C.; Frisch, H.; Funakoshi, Y.; Galloni, C.; Garfinkel, A. F.; Garosi, P.; Gerberich, H.; Gerchtein, E.; Giagu, S.; Giakoumopoulou, V.; Gibson, K.; Ginsburg, C. M.; Giokaris, N.; Giromini, P.; Glagolev, V.; Glenzinski, D.; Gold, M.; Goldin, D.; Golossanov, A.; Gomez, G.; Gomez-Ceballos, G.; Goncharov, M.; González López, O.; Gorelov, I.; Goshaw, A. T.; Goulianos, K.; Gramellini, E.; Grosso-Pilcher, C.; Guimaraes da Costa, J.; Hahn, S. R.; Han, J. Y.; Happacher, F.; Hara, K.; Hare, M.; Harr, R. F.; Harrington-Taber, T.; Hartz, M.; Hatakeyama, K.; Hays, C.; Heinrich, J.; Herndon, M.; Hocker, A.; Hong, Z.; Hopkins, W.; Hou, S.; Hughes, R. E.; Husemann, U.; Hussein, M.; Huston, J.; Introzzi, G.; Iori, M.; Ivanov, A.; James, E.; Jang, D.; Jayatilaka, B.; Jeon, E. J.; Jindariani, S.; Jones, M.; Joo, K. K.; Jun, S. Y.; Junk, T. R.; Kambeitz, M.; Kamon, T.; Karchin, P. E.; Kasmi, A.; Kato, Y.; Ketchum, W.; Keung, J.; Kilminster, B.; Kim, D. H.; Kim, H. S.; Kim, J. E.; Kim, M. J.; Kim, S. H.; Kim, S. B.; Kim, Y. J.; Kim, Y. K.; Kimura, N.; Kirby, M.; Knoepfel, K.; Kondo, K.; Kong, D. J.; Konigsberg, J.; Kotwal, A. V.; Kreps, M.; Kroll, J.; Kruse, M.; Kuhr, T.; Kurata, M.; Laasanen, A. T.; Lammel, S.; Lancaster, M.; Lannon, K.; Latino, G.; Lee, H. S.; Lee, J. S.; Leo, S.; Leone, S.; Lewis, J. D.; Limosani, A.; Lipeles, E.; Lister, A.; Liu, Q.; Liu, T.; Lockwitz, S.; Loginov, A.; Lucchesi, D.; Lucà, A.; Lueck, J.; Lujan, P.; Lukens, P.; Lungu, G.; Lys, J.; Lysak, R.; Madrak, R.; Maestro, P.; Malik, S.; Manca, G.; Manousakis-Katsikakis, A.; Marchese, L.; Margaroli, F.; Marino, P.; Matera, K.; Mattson, M. E.; Mazzacane, A.; Mazzanti, P.; McNulty, R.; Mehta, A.; Mehtala, P.; Mesropian, C.; Miao, T.; Mietlicki, D.; Mitra, A.; Miyake, H.; Moed, S.; Moggi, N.; Moon, C. S.; Moore, R.; Morello, M. J.; Mukherjee, A.; Muller, Th.; Murat, P.; Mussini, M.; Nachtman, J.; Nagai, Y.; Naganoma, J.; Nakano, I.; Napier, A.; Nett, J.; Nigmanov, T.; Nodulman, L.; Noh, S. Y.; Norniella, O.; Oakes, L.; Oh, S. H.; Oh, Y. D.; Okusawa, T.; Orava, R.; Ortolan, L.; Pagliarone, C.; Palencia, E.; Palni, P.; Papadimitriou, V.; Parker, W.; Pauletta, G.; Paulini, M.; Paus, C.; Phillips, T. J.; Piacentino, G.; Pianori, E.; Pilot, J.; Pitts, K.; Plager, C.; Pondrom, L.; Poprocki, S.; Potamianos, K.; Pranko, A.; Prokoshin, F.; Ptohos, F.; Punzi, G.; Redondo Fernández, I.; Renton, P.; Rescigno, M.; Rimondi, F.; Ristori, L.; Robson, A.; Rodriguez, T.; Rolli, S.; Ronzani, M.; Roser, R.; Rosner, J. L.; Ruffini, F.; Ruiz, A.; Russ, J.; Rusu, V.; Sakumoto, W. K.; Sakurai, Y.; Santi, L.; Sato, K.; Saveliev, V.; Savoy-Navarro, A.; Schlabach, P.; Schmidt, E. E.; Schwarz, T.; Scodellaro, L.; Scuri, F.; Seidel, S.; Seiya, Y.; Semenov, A.; Sforza, F.; Shalhout, S. Z.; Shears, T.; Shepard, P. F.; Shimojima, M.; Shochet, M.; Shreyber-Tecker, I.; Simonenko, A.; Sliwa, K.; Smith, J. R.; Snider, F. D.; Song, H.; Sorin, V.; St. Denis, R.; Stancari, M.; Stentz, D.; Strologas, J.; Sudo, Y.; Sukhanov, A.; Suslov, I.; Takemasa, K.; Takeuchi, Y.; Tang, J.; Tecchio, M.; Teng, P. K.; Thom, J.; Thomson, E.; Thukral, V.; Toback, D.; Tokar, S.; Tollefson, K.; Tomura, T.; Tonelli, D.; Torre, S.; Torretta, D.; Totaro, P.; Trovato, M.; Ukegawa, F.; Uozumi, S.; Vázquez, F.; Velev, G.; Vellidis, C.; Vernieri, C.; Vidal, M.; Vilar, R.; Vizán, J.; Vogel, M.; Volpi, G.; Wagner, P.; Wallny, R.; Wang, S. M.; Waters, D.; Wester, W. C.; Whiteson, D.; Wicklund, A. B.; Wilbur, S.; Williams, H. H.; Wilson, J. S.; Wilson, P.; Winer, B. L.; Wittich, P.; Wolbers, S.; Wolfe, H.; Wright, T.; Wu, X.; Wu, Z.; Yamamoto, K.; Yamato, D.; Yang, T.; Yang, U. K.; Yang, Y. C.; Yao, W.-M.; Yeh, G. P.; Yi, K.; Yoh, J.; Yorita, K.; Yoshida, T.; Yu, G. B.; Yu, I.; Zanetti, A. M.; Zeng, Y.; Zhou, C.; Zucchelli, S.; CDF Collaboration
2016-03-01
We describe a measurement of the ratio of the cross sections times branching fractions of the Bc+ meson in the decay mode Bc+→J /ψ μ+ν to the B+ meson in the decay mode B+→J /ψ K+ in proton-antiproton collisions at center-of-mass energy √{s }=1.96 TeV . The measurement is based on the complete CDF Run II data set, which comes from an integrated luminosity of 8.7 fb-1. The ratio of the production cross sections times branching fractions for Bc+ and B+ mesons with momentum transverse to the beam greater than 6 GeV /c and rapidity magnitude smaller than 0.6 is 0.211 ±0.012 (stat)-0.020 +0.021(syst ) . Using the known B+→J /ψ K+ branching fraction, the known B+ production cross section, and a selection of the predicted Bc+→J /ψ μ+ν branching fractions, the range for the total Bc+ production cross section is estimated.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yifu, E-mail: yfzhang@dlut.edu.cn; Zheng, Jiqi; Hu, Tao; Tian, Fuping; Meng, Changgong
2016-05-15
Highlights: • A facile one-pot hydrothermal method was used to synthesize VO{sub 2}(B)/C core–shell composites. • VO{sub 2}(B)/C composites consisted of the crystal VO{sub 2}(B) phase and the amorphous carbon phase. • The supercapacitor property of VO{sub 2}(B)/C composites was improved by this novel structure. - Abstract: VO{sub 2}(B)/C core–shell composites were successfully prepared using commercial V{sub 2}O{sub 5}, glucose and water as the starting materials by a facile one-pot hydrothermal method. The composition of the products was characterized by the techniques including X-ray powder diffraction, infrared spectroscopy, Raman, energy-dispersive X-ray spectrometer and elemental analysis. The morphology of the products was observed by scanning electron microscopy and transmission electron microscopy tests. The results showed the products consisted of the crystal VO{sub 2}(B) phase and the amorphous carbon phase. The amorphous carbon contained lots of organic groups, such as −OH, C−H, C=O and C=C, etc., which suggested that the carbon here was organic carbon. The morphology of the as-obtained VO{sub 2}(B)/C composites was well-defined nanobelts, and each VO{sub 2}(B) core was encapsulated into carbon. Furthermore, the electrochemical properties of VO{sub 2}(B)/C core–shell composites were investigated by cyclic voltammetry and galvanostatic charge–discharge. The results showed the measured capacitance of VO{sub 2}(B)/C composites was mainly based on the pseudocapacitance. VO{sub 2}(B)/C composites displayed the specific capacitance of 203, 190, 182, 173, 164, and 147 F g{sup −1} at the current density of 0.2, 0.5, 1, 5, 10 and 20 A g{sup −1}, respectively. They also showed an excellent energy density of 198.9 W h kg{sup −1} at a power density of 504.5 W kg{sup −1} and a rapidly reversible redox Faraday response.
BC Hydro's integrated resource planning : the 2004 IEP and beyond
International Nuclear Information System (INIS)
Soulsby, R.
2004-01-01
An outline of BC Hydro Integrated Electricity Plan (IEP) was presented in this paper, along with details of its environmental, social and business performance and statistics of its net income and revenue for 2003-2004. The IEP was created to match long term load to supply in the most cost-effective way and is also the basis for resource acquisition plans. In addition, the IEP models performance of portfolios of resources on a system-wide basis, considers uncertainties through sensitivity analysis and measures and evaluates multiple attributes from various portfolios. A flow chart of processes informed by the IEP was presented. Guiding principles behind the creation of the plan include low electricity rates and public ownership; secure, reliable supply; private sector development; environmental responsibility, with no nuclear power sources; ensuring energy self-sufficiency; and maintaining a balanced portfolio of resources. A pie chart of BC Hydro's current portfolio mix was presented as well as a supply and demand outlook and details of plans and new capacity resources required before 2013. Various resource options were presented. Key outcomes of First Nations and stakeholder engagement include the acceptance of BC Hydro as a sustainable energy company; a desire for higher priority on reliability and low cost; an agreement over the Power Smart 10 year plan; a general agreement that the current, balanced approach to resource acquisition was appropriate; and a desire for more rate options. There was an assurance that BC Hydro would continue to engage First Nations and stakeholders in integrated electricity planning. Other outcomes included requests for more information about outage and outage planning and process improvements; support to maintain low rates; a preference for maximizing use of existing facilities; support for wood waste cogeneration. A broad range of options were reviewed, but no superior portfolio was identified within the parameters of this paper
Directory of Open Access Journals (Sweden)
Ayudha Bahana I. Perdamaian
2018-01-01
Full Text Available Research aim to derive an excellent hybrid to be positioned as meat-type chicken. An excellent breed which possess uniform morphological character was archived by genetic selection through back-crossed mating shceme in focus on growth rate and plumage color uniformity. Day Old Chicken (DOC resulted from parent stock broiler cobb 500 and Pelung chicken originated from Cianjur district, West java mating were intensively reared for seven week from hatch. Each chicken weighted every seven day and morphological character assessed at seven weeks old. Observe variable are heterocyst, coefficient Inbreeding (Fx, Inbreeding rate (F, plumage and shank characteristic proportion, and its frequency gene alteration through selection. After serial genetic selection, the BC2 chicken has 1129 g body weight and uniform morphological character. Overall body weight of BC3 chicken offspring from BC2 and F1 was deteriorated compared its broiler predecessor because of Inbreeding depression (Fx: 0.4375; F: 0.3125 and heterocyst decrement (H: -39.33 however, morphological appearance were highly resemble pelung chicken. Based on these finding, BC2 chicken was promised meat-type hybrid chicken which has fast growth rate and similar morphological character.
Home-grown creativity; Northern BC inventor makes a name
International Nuclear Information System (INIS)
Finch, T.
2001-01-01
The GRAMUS pump is a gas-recovery and minimal usage mechanism designed to recover waste gases, thereby reducing emission to the atmosphere. The pump, invented by Dan Vezina in Fort St. John, requires no oil to lubricate it, is virtually maintenance-free and low enough in price to rapidly recover its cost when used to replace old style diaphragm pumps which are widely use in the petroleum industry for venting gas to the atmosphere. The GRAMUS pump recovers the drive gas, and rather than venting it into the atmosphere it injects it back into the system through its double-acting cylinder which pumps without the need for oil around its switching mechanism. The prototype was tested by Talisman Energy at their Inga Lake location, and found that the GRAMUS recovery system saved them $840 per month in propane costs (the gas that is commonly used to power the old style diaphragm pumps). The pumps are now manufactured and distributed commercially by Crown West Steel Fabricators in Kelowna, BC (in partnership with Vezina). They are doing brisk business with virtually every company in BC and Alberta whose operations formerly used the old diaphragm pumps
Probing the P -wave charmonium decays of Bc meson
Rui, Zhou
2018-02-01
Motivated by the large number of Bc meson decay modes observed recently by several detectors at the LHC, we present a detailed analysis of the Bc meson decaying to the P -wave charmonium states and a light pseudoscalar (P ) or vector (V ) meson within the framework of perturbative QCD factorization. The P -wave charmonium distribution amplitudes are extracted from the n =2 , l =1 Schrödinger states for a Coulomb potential, which can be taken as the universal nonperturbative objects to analyze the hard exclusive processes with P -wave charmonium production. It is found that these decays have large branching ratios of the order of 10-5˜10-2 , which seem to be in the reach of future experiments. We also provide predictions for the polarization fractions and relative phases of Bc→(χc 1,χc 2,hc)V decays. It is expected that the longitudinal polarization amplitudes dominate the branching ratios according to the quark helicity analysis, and the magnitudes and phases of parallel polarization amplitude are approximately equal to the perpendicular ones. The obtained results are compared with available experimental data, our previous studies, and numbers from other approaches.
Demystifying the hydrogen and fuel cell industry: Where are the investment opportunities in B.C.?
Energy Technology Data Exchange (ETDEWEB)
Kettlewell, D. [Hydrogen Media, BC (Canada)
2004-07-01
It is forecast that accessible supplies of oil will decline by 2020; a similar fate is forecast for natural gas occurring 20 years later in 2040. Taking into account finite supply sources and environmental concerns, planners are forced to consider alternative energy sources. In considering energy alternatives, hydrogen is commonly identified as the potential energy elixir, given its ability to generate highly concentrated forms of energy with clean water being the only 'waste product'. British Columbia has been the locus of major hydrogen and fuel cell research in Canada and is, therefore, in an exceptionally good position to play a leading role in the development of this abundant and clean energy source. This paper examines the history and future investments in BC's hydrogen and fuel cell sectors from a macro financial point of view, and with a critical eye towards global developments. The report recommends development of a Hydrogen Energy Research Centre of Excellence in BC; increased collaboration between private firms, academic researchers and technology partners; development of quantifiable and measurable revenue goals for the fuel cell sector; and additional tax benefit policies to attract and retain hydrogen specialists and entrepreneurs in BC. With regard to investments specifically, the report recommends building appropriate industry and academic relationships; concentration of clients, partners and revenues in geographic clusters closer to home before expanding around the world; development of local media interest in the sector; increased public awareness; focus on standards and opportunities for 'angel' investors; and creating increased awareness of the most promising areas of the industry for venture capital to focus on. Based on the high concentration of fuel cell intellectual capital in BC, the report forecasts substantial growth in BC's hydrogen economy in 2006 and beyond.
Cyclisation versus 1,1-Carboboration: Reactions of B(C6F5)3 with Propargyl Amides.
Melen, Rebecca L; Hansmann, Max M; Lough, Alan J; Hashmi, A Stephen K; Stephan, Douglas W
2013-09-02
A series of propargyl amides were prepared and their reactions with the Lewis acidic compound B(C6F5)3 were investigated. These reactions were shown to afford novel heterocycles under mild conditions. The reaction of a variety of N-substituted propargyl amides with B(C6F5)3 led to an intramolecular oxo-boration cyclisation reaction, which afforded the 5-alkylidene-4,5-dihydrooxazolium borate species. Secondary propargyl amides gave oxazoles in B(C6F5)3 mediated (catalytic) cyclisation reactions. In the special case of disubstitution adjacent to the nitrogen atom, 1,1-carboboration is favoured as a result of the increased steric hindrance (1,3-allylic strain) in the 5-alkylidene-4,5-dihydrooxazolium borate species. Copyright © 2013 WILEY‐VCH Verlag GmbH & Co. KGaA, Weinheim.
Fitzpatrick Leo R; Small Jeffrey S; Greene Wallace H; Karpa Kelly D; Keller David
2011-01-01
Abstract Background Probiotics have beneficial effects in rodent models of Clostridium difficile (C. diffiicle)-induced colitis. The spore forming probiotic strain Bacillus Coagulans GBI-30, 6086 (BC30) has demonstrated anti-inflammatory and immune-modulating effects in vitro. Our goal was to determine if BC30 improved C. difficile-induced colitis in mice. Starting on study day 0, female C57BL/6 mice were dosed by oro-gastric gavage for 15 days with vehicle (saline) or BC30 (2 × 109 CFU per d...
Fracture toughness and sliding properties of magnetron sputtered CrBC and CrBCN coatings
Wang, Qianzhi; Zhou, Fei; Ma, Qiang; Callisti, Mauro; Polcar, Tomas; Yan, Jiwang
2018-06-01
CrBC and CrBCN coatings with low and high B contents were deposited on 316L steel and Si wafers using an unbalanced magnetron sputtering system. Mechanical properties including hardness (H), elastic modulus (E) and fracture toughness (KIc) as well as residual stresses (σ) were quantified. A clear correlation between structural, mechanical and tribological properties of coatings was found. In particular, structural analyses indicated that N incorporation in CrBC coatings with high B content caused a significant structural evolution of the nanocomposite structure (crystalline grains embedded into an amorphous matrix) from nc-CrB2/(a-CrBx, a-BCx) to nc-CrN/(a-BCx, a-BN). As a result, the hardness of CrBC coating with high B content decreased from 23.4 to 16.3 GPa but the fracture toughness was enhanced. Consequently, less cracks initiated on CrBCN coatings during tribological tests, which combined with the shielding effect of a-BN on wear debris, led to a low friction coefficient and wear rate.
Directory of Open Access Journals (Sweden)
Kang Zhang
2018-05-01
Full Text Available A pathogenic mutant, BCG183, was obtained by screening the T-DNA insertion library of Botrytis cinerea. A novel pathogenicity-related gene BcKMO, which encodes kynurenine 3-monooxygenase (KMO, was isolated and identified via thermal asymmetric interlaced PCR, bioinformatics analyses, and KMO activity measurement. The mutant BCG183 grew slowly, did not produce conidia and sclerotia, had slender hyphae, and presented enhanced pathogenicity. The phenotype and pathogenicity of the BcKMO-complementing mutant (BCG183/BcKMO were similar to those of the wild-type (WT strain. The activities of polymethylgalacturonase, polygalacturonase, and toxins were significantly higher, whereas acid production was significantly decreased in the mutant BCG183, when compared with those in the WT and BCG183/BcKMO. Moreover, the sensitivity of mutant BCG183 to NaCl and KCl was remarkably increased, whereas that to fluconazole, Congo Red, menadione, H2O2, and SQ22536 and U0126 [cAMP-dependent protein kinase (cAMP and mitogen-activated protein kinase (MAPK signaling pathways inhibitors, respectively] were significantly decreased compared with the other strains. Furthermore, the key genes involved in the cAMP and MAPK signaling pathways, Pka1, Pka2, PkaR, Bcg2, Bcg3, bmp1, and bmp3, were significantly upregulated or downregulated in the mutant BCG183. BcKMO expression levels were also upregulated or downregulated in the RNAi mutants of the key genes involved in the cAMP and MAPK signaling pathways. These findings indicated that BcKMO positively regulates growth and development, but negatively regulates pathogenicity of B. cinerea. Furthermore, BcKMO was found to be involved in controlling cell wall degrading enzymes activity, toxins activity, acid production, and cell wall integrity, and participate in cAMP and MAPK signaling pathways of B. cinerea.
Zhang, Kang; Yuan, Xuemei; Zang, Jinping; Wang, Min; Zhao, Fuxin; Li, Peifen; Cao, Hongzhe; Han, Jianmin; Xing, Jihong; Dong, Jingao
2018-01-01
A pathogenic mutant, BCG183, was obtained by screening the T-DNA insertion library of Botrytis cinerea . A novel pathogenicity-related gene BcKMO , which encodes kynurenine 3-monooxygenase (KMO), was isolated and identified via thermal asymmetric interlaced PCR, bioinformatics analyses, and KMO activity measurement. The mutant BCG183 grew slowly, did not produce conidia and sclerotia, had slender hyphae, and presented enhanced pathogenicity. The phenotype and pathogenicity of the BcKMO -complementing mutant (BCG183/ BcKMO ) were similar to those of the wild-type (WT) strain. The activities of polymethylgalacturonase, polygalacturonase, and toxins were significantly higher, whereas acid production was significantly decreased in the mutant BCG183, when compared with those in the WT and BCG183/ BcKMO . Moreover, the sensitivity of mutant BCG183 to NaCl and KCl was remarkably increased, whereas that to fluconazole, Congo Red, menadione, H 2 O 2 , and SQ22536 and U0126 [cAMP-dependent protein kinase (cAMP) and mitogen-activated protein kinase (MAPK) signaling pathways inhibitors, respectively] were significantly decreased compared with the other strains. Furthermore, the key genes involved in the cAMP and MAPK signaling pathways, Pka1 , Pka2 , PkaR , Bcg2 , Bcg3 , bmp1 , and bmp3, were significantly upregulated or downregulated in the mutant BCG183. BcKMO expression levels were also upregulated or downregulated in the RNAi mutants of the key genes involved in the cAMP and MAPK signaling pathways. These findings indicated that BcKMO positively regulates growth and development, but negatively regulates pathogenicity of B. cinerea . Furthermore, BcKMO was found to be involved in controlling cell wall degrading enzymes activity, toxins activity, acid production, and cell wall integrity, and participate in cAMP and MAPK signaling pathways of B. cinerea .
Ito, Akinori; Ito, Akihiko; Akimoto, Hajime
2007-06-01
We estimate the emissions of carbon monoxide (CO) and black carbon (BC) from open vegetation fires in the Southern Hemisphere Africa from 1998 to 2005 using satellite information in conjunction with a biogeochemical model. Monthly burned areas at a 0.5-degree resolution are estimated from the Visible InfraRed Scanner (VIRS) fire count product and the MODerate resolution Imaging Spectroradiometer (MODIS) burned area data set associated with the MODIS tree cover imagery in grasslands and woodlands. The monthly fuel load distributions are derived from a 0.5-degree terrestrial carbon cycle model in conjunction with satellite data. The monthly maps of combustion factors and emission factors are estimated using empirical models that predict the effects of fuel conditions on these factors in grasslands and woodlands. Our annually averaged effective CO and BC emissions per area burned are 27 g CO m-2 and 0.17 g BC m-2 which are consistent with the products of fuel consumption and emission factors typically measured in southern Africa. The CO and BC emissions from open vegetation burning in southern Africa range from 45 Tg CO yr-1 and 0.26 Tg BC yr-1 for 2002 to 75 Tg CO yr-1 and 0.42 Tg BC yr-1 for 1998. The monthly averaged burned areas from VIRS fire counts peak earlier than modeled CO emissions. This characteristic delay between burned areas and emissions is mainly explained by significant changes in combustion factors for woodlands in our model. Consequently, the peaks in CO and BC emissions from our bottom-up approach are identical to those from previous top-down estimates using the Measurement Of the Pollution In The Troposphere (MOPITT) and the Total Ozone Mapping Spectrometer (TOMS) Aerosol Index (AI) data.
Lai, Jeffrey K F; Sam, I-Ching; Verlhac, Pauline; Baguet, Joël; Eskelinen, Eeva-Liisa; Faure, Mathias; Chan, Yoke Fun
2017-07-04
Viruses have evolved unique strategies to evade or subvert autophagy machinery. Enterovirus A71 (EV-A71) induces autophagy during infection in vitro and in vivo. In this study, we report that EV-A71 triggers autolysosome formation during infection in human rhabdomyosarcoma (RD) cells to facilitate its replication. Blocking autophagosome-lysosome fusion with chloroquine inhibited virus RNA replication, resulting in lower viral titres, viral RNA copies and viral proteins. Overexpression of the non-structural protein 2BC of EV-A71 induced autolysosome formation. Yeast 2-hybrid and co-affinity purification assays showed that 2BC physically and specifically interacted with a N -ethylmaleimide-sensitive factor attachment receptor (SNARE) protein, syntaxin-17 (STX17). Co-immunoprecipitation assay further showed that 2BC binds to SNARE proteins, STX17 and synaptosome associated protein 29 (SNAP29). Transient knockdown of STX17, SNAP29, and microtubule-associated protein 1 light chain 3B (LC3B), crucial proteins in the fusion between autophagosomes and lysosomes) as well as the lysosomal-associated membrane protein 1 (LAMP1) impaired production of infectious EV-A71 in RD cells. Collectively, these results demonstrate that the generation of autolysosomes triggered by the 2BC non-structural protein is important for EV-A71 replication, revealing a potential molecular pathway targeted by the virus to exploit autophagy. This study opens the possibility for the development of novel antivirals that specifically target 2BC to inhibit formation of autolysosomes during EV-A71 infection.
Oligoasthenoteratozoospermia and infertility in mice deficient for miR-34b/c and miR-449 loci.
Directory of Open Access Journals (Sweden)
Stefano Comazzetto
2014-10-01
Full Text Available Male fertility requires the continuous production of high quality motile spermatozoa in abundance. Alterations in all three metrics cause oligoasthenoteratozoospermia, the leading cause of human sub/infertility. Post-mitotic spermatogenesis inclusive of several meiotic stages and spermiogenesis (terminal spermatozoa differentiation are transcriptionally inert, indicating the potential importance for the post-transcriptional microRNA (miRNA gene-silencing pathway therein. We found the expression of miRNA generating enzyme Dicer within spermatogenesis peaks in meiosis with critical functions in spermatogenesis. In an expression screen we identified two miRNA loci of the miR-34 family (miR-34b/c and miR-449 that are specifically and highly expressed in post-mitotic male germ cells. A reduction in several miRNAs inclusive of miR-34b/c in spermatozoa has been causally associated with reduced fertility in humans. We found that deletion of both miR34b/c and miR-449 loci resulted in oligoasthenoteratozoospermia in mice. MiR-34bc/449-deficiency impairs both meiosis and the final stages of spermatozoa maturation. Analysis of miR-34bc-/-;449-/- pachytene spermatocytes revealed a small cohort of genes deregulated that were highly enriched for miR-34 family target genes. Our results identify the miR-34 family as the first functionally important miRNAs for spermatogenesis whose deregulation is causal to oligoasthenoteratozoospermia and infertility.
Is a liquid and competitive wholesale market feasible in BC?
International Nuclear Information System (INIS)
El-Ramly, A.
2004-01-01
This presentation outlined the principle market movements that helped build the electric power industry in British Columbia, from 1860 to the present. Today, British Columbia is a major player in interconnected and disconnected western markets that include Alberta, the gateway to California, California and the southwest. A profile of these markets was presented with reference to programs, regulations and services that have been launched since 1988. The impetus for change was discussed with reference to load resource balance in British Columbia; the drive for private investment; an improved provincial economy; and price stability, reduced volatility and low prices which are allowing market participants to focus on new developments. It was noted that the momentum is in place to take progressive measures in opening the regulatory process regarding power transmission and opening new markets to the east and south. The bad market powers at play were also described with reference to policy that dilutes innovation, heritage contracts, and the lack of interest by industrial customers in an open access market. This presentation also included a mid-term Alberta Power Pool price forecast and BC transmission activity. It was noted that in dollar terms, British Columbia has been a net importer from the United States since the third quarter in 2004 because of its supply shortage and unexpectedly high demand growth. BC has maintained a surplus with respect to Alberta, by arbitraging between the on-peak and off-peak hours. This trend presents opportunities for independent power producers (IPP). It was concluded that the BC power industry is in much better shape than any of the deregulated markets. Its heritage contract protects rate payers and the market is opening up cautiously. tabs., figs
Directory of Open Access Journals (Sweden)
Ashley J. Sprague
2008-12-01
Full Text Available The upper Bay of Fundy is a critical stopover site for Semipalmated Sandpipers (Calidris pusilla during their fall migration. However, little is known about factors that influence selection of feeding and roosting sites by these birds, or the extent to which birds move between different sites during their time in the region. Using radio-telemetry, we studied movement patterns, examined habitat use, and tested hypotheses associated with factors influencing foraging and roost-site selection. Movements of radio-tagged sandpipers were tracked in the upper Bay of Fundy in August 2004 and 2005. In 2004, sandpipers from the Minas Basin, Nova Scotia and Chignecto Bay, New Brunswick and Nova Scotia, were tracked, and in 2005, sandpipers were tracked only in Chignecto Bay. Sandpipers were highly mobile in both the Minas Basin 2004 and Chignecto Bay 2005, making daily movements of up to 20 km between foraging and roosting sites, although very little movement was detected in Chignecto Bay in 2004. Migrating sandpipers appeared to select foraging sites based on relative safety, as measured by distance to cover, provided that these sites offered an adequate food supply. Similarly, roosting sandpipers preferred sites that were far from nearby trees that might offer cover to predators. This preference for safe sites became more apparent later in their stay in the Bay of Fundy, when birds were heavier and, therefore, possibly more vulnerable to predation. Semipalmated Sandpipers appear to be flexible during their time in the upper Bay of Fundy, displaying year-to-year and site-to-site variability in movement and mudflat usage. Therefore, multiple, synchronized population counts should be conducted at known roost sites in order to more accurately estimate Semipalmated Sandpiper abundance in this region. Furthermore, in a highly dynamic system where food can be variable, landscape features such as distance to cover may be important factors to consider when
Jeong, Hyeran; Park, Donguk
2017-09-01
The aims of this study were to quantify the contributions of activities or microenvironments (MEs) to daily total exposure to and potential dose of black carbon (BC). Daily BC exposures (24-h) were monitored using a micro-aethalometer micoAeth AE51 with forty school-aged children living in an urban area in Korea from August 2015 to January 2016. The children's time-activity patterns and the MEs they visited were investigated by means of a time-activity diary (TAD) and follow-up interviews with the children and their parents. Potential inhaled dose was estimated by multiplying the airborne BC concentrations (μg/m3) we monitored for the time the children spent in a particular ME by the inhalation rate (IR, m3/h) for the time-activity performed. The contribution of activities and MEs to overall daily exposure to and potential dose of BC was quantified. Overall mean daily potential dose was equal to 24.1 ± 10.6 μg/day (range: 6.6-46.3 μg/day). The largest contribution to BC exposure and potential dose (51.9% and 41.7% respectively) occurred in the home thanks to the large amount of time spent there. Transportation was where children received the most intense exposure to (14.8%) and potential dose (20.2%) of BC, while it accounted for 7.6% of daily time. School on weekdays during the semester was responsible for 20.3% of exposure and 22.5% of potential dose. Contribution to BC exposure and potential dose was altered by several time-activity parameters, such as type of day (weekdays vs. weekends; school days vs. holidays), season, and gender. Traveling by motor vehicle and subway showed more elevated exposure or potential dose intensity on weekdays or school days, probably influenced by the increased surrounding traffic volumes on these days compared to on weekends or holidays. This study may be used to prioritize targets for minimizing children's exposure to BC and to indicate outcomes of BC control strategies.
Energy Technology Data Exchange (ETDEWEB)
Lombigit, L., E-mail: lojius@nm.gov.my; Yussup, N., E-mail: nolida@nm.gov.my; Ibrahim, Maslina Mohd; Rahman, Nur Aira Abd; Rawi, M. Z. M. [Instrumentation Group, Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia)
2015-04-29
A digital n/γ pulse shape discrimination (PSD) system is currently under development at Instrumentation and Automation Centre, Malaysian Nuclear Agency. This system aims at simultaneous detection of fast neutron and gamma ray in mixed radiations environment. This work reports the system characterization performed on the liquid scintillation detector (BC-501A) and digital pulse shape discrimination (DPSD) system. The characterization involves measurement of electron light output from the BC-501A detector and energy channels calibration of the pulse height spectra acquired with DPSD system using set of photon reference sources. The main goal of this experiment is to calibrate the ADC channel of our DPSD system, characterized the BC-501 detector and find the position of Compton edge which later could be used as threshold for the n/γ PSD experiment. The detector resolution however is worse as compared to other published data but it is expected as our detector has a smaller active volume.
International Nuclear Information System (INIS)
Lombigit, L.; Yussup, N.; Ibrahim, Maslina Mohd; Rahman, Nur Aira Abd; Rawi, M. Z. M.
2015-01-01
A digital n/γ pulse shape discrimination (PSD) system is currently under development at Instrumentation and Automation Centre, Malaysian Nuclear Agency. This system aims at simultaneous detection of fast neutron and gamma ray in mixed radiations environment. This work reports the system characterization performed on the liquid scintillation detector (BC-501A) and digital pulse shape discrimination (DPSD) system. The characterization involves measurement of electron light output from the BC-501A detector and energy channels calibration of the pulse height spectra acquired with DPSD system using set of photon reference sources. The main goal of this experiment is to calibrate the ADC channel of our DPSD system, characterized the BC-501 detector and find the position of Compton edge which later could be used as threshold for the n/γ PSD experiment. The detector resolution however is worse as compared to other published data but it is expected as our detector has a smaller active volume
A new era of prosperity through power : maintaining BC's competitive advantage
Energy Technology Data Exchange (ETDEWEB)
Potts, D. [BC Council of Forest Industries, Vancouver, BC (Canada)
2001-08-17
The availability of abundant low cost electric power has been a driving force behind British Columbia's economic growth. BC's low cost power resources can create a natural competitive economic advantage for the province. Electricity, as a publicly owned resource can offer many competitive advantages for business in British Columbia, if managed correctly. However, it was noted that meaningful economic advantages can only be realized if the existing power resources in the province are operated efficiently and priced at or close to cost. In the 1980s, the Joint Industry Electricity Steering Committee (JIESC) was formed following the regulation of BC Hydro by BC Utilities Commission. It became clear that maintaining low rates for electricity was a public issue that needed input from other governmental forums if JIESC was to be successful. The major sectors represented by JIESC include pulp and paper, mining, and electrochemicals. This paper listed each member company. In order to turn BC's economy around and re-establish the province as a leading economy in Canada, the following recommendations have been proposed for the short term: (1) maintain an ample supply of low cost power for the future, (2) remove the provincial sales tax on the purchase of electric power used for manufacturing and processing, (3) extend the current rate freeze, (4) initiate a long-term resource acquisition and transmission expansion strategy to assure the availability of ample supplies of low cost power. Recommendations for the long term include: (1) maintain regulated cost based rates, (2) develop ample low cost power, (3) utilize downstream benefits, (4) provide a role for the private sector, (5) maintain adequate transmission facilities, (6) reduce government revenues, and (7) instill customer driven management. 3 figs.
A DFT study of adsorption of glycine onto the surface of BC{sub 2}N nanotube
Energy Technology Data Exchange (ETDEWEB)
Soltani, Alireza, E-mail: Alireza.soltani46@yahoo.com [Joints, Bones and Connective Tissue Research Center, Golestan University of Medical Sciences, Gorgan (Iran, Islamic Republic of); Young Researchers and Elite Club, Gorgan Branch, Islamic Azad University, Gorgan (Iran, Islamic Republic of); Azmoodeh, Zivar [Department of Physics, Payame Noor University, P.O. Box 19395-3697, Tehran (Iran, Islamic Republic of); Javan, Masoud Bezi [Physics Department, Faculty of Sciences, Golestan University, Gorgan (Iran, Islamic Republic of); Lemeski, E. Tazikeh [Department of Chemistry, Gorgan Branch, Islamic Azad University, Gorgan (Iran, Islamic Republic of); Karami, Leila [Institute of Biochemistry and Biophysics, University of Tehran, Tehran (Iran, Islamic Republic of)
2016-10-30
Highlights: • Glycine adsorption over the pristine BC{sub 2}N nanotubes is investigated by DFT calculations. • Adsorption of glycine in its zwitterionic form is stronger in comparison with the radical form. • Adsorption of glycine from its amine head on adsorbent leads to a significant decrease in the electronic properties. - Abstract: A theoretical study of structure and the energy interaction of amino acid glycine (NH{sub 2}CH{sub 2}COOH) with BC{sub 2}N nanotube is crucial for apperception behavior occurring at the nanobiointerface. Herein, we studied the adsorption of glycine in their radical and zwitterionic forms upon the surface of BC{sub 2}N nanotube using M06 functional and 6-311G** standard basis set. We also considered the different orientations of the glycine amino acid on the surface of adsorbent. Further, we found out that the stability of glycine from its carbonyl group is higher than hydroxyl and amine groups. Our results also indicated that the electronic structure of BC{sub 2}N nanotube on the adsorption of glycine from its amine group is more altered than the other groups. Our study exhibits that opto-electronic property of adsorbent is changed after the glycine adsorption.
Charge Transfer at the Qo-Site of the Cytochrome bc1 Complex Leads to Superoxide Production
DEFF Research Database (Denmark)
Bøgh Salo, Adrian; Husen, Peter; Solov'yov, Ilia A
2017-01-01
The cytochrome bc1 complex is the third protein complex in the electron transport chain of mitochondria or photosynthetic bacteria, and it serves to create an electrochemical gradient across a cellular membrane, which is used to drive ATP synthesis. The purpose of this study is to investigate...... interactions involving an occasionally trapped oxygen molecule (O2) at the so-called Qo site of the bc1 complex, which is one of the central active sites of the protein complex, where redox reactions are expected to occur. The investigation focuses on revealing the possibility of the oxygen molecule...... to influence the normal operation of the bc1 complex and acquire an extra electron, thus becoming superoxide, a biologically toxic free radical. The process is modeled by applying quantum chemical calculations to previously performed classical molecular dynamics simulations. Investigations reveal several...
BC-454 boron-loaded plastic scintillator
International Nuclear Information System (INIS)
Bellian, J.G.
1984-01-01
Prototype samples of plastic scintillators containing up to 10% by weight of natural boron have been produced. The maximum size scintillators made to date are 28 mm dia. x 100 mm long. Rods containing up to 2% boron are now made routinely and work is progressing on higher concentrations. The plastics are clear and emit the same blue fluorescence as other common plastic scintillators. It is expected that rods up to 3'' dia. containing 5% boron will be produced during the next few months. BC-454 is particularly useful in neutron research, materials studies, some types of neutron dosimetry, and monitoring of medium to high energy neutrons in the presence of other types radiation. It combines attractive features that enhance its usefulness to the physics community
Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
Hao, Ge-Fei; Wang, Fu; Li, Hui; Zhu, Xiao-Lei; Yang, Wen-Chao; Huang, Li-Shar; Wu, Jia-Wei; Berry, Edward A; Yang, Guang-Fu
2012-07-11
A critical challenge to the fragment-based drug discovery (FBDD) is its low-throughput nature due to the necessity of biophysical method-based fragment screening. Herein, a method of pharmacophore-linked fragment virtual screening (PFVS) was successfully developed. Its application yielded the first picomolar-range Q(o) site inhibitors of the cytochrome bc(1) complex, an important membrane protein for drug and fungicide discovery. Compared with the original hit compound 4 (K(i) = 881.80 nM, porcine bc(1)), the most potent compound 4f displayed 20 507-fold improved binding affinity (K(i) = 43.00 pM). Compound 4f was proved to be a noncompetitive inhibitor with respect to the substrate cytochrome c, but a competitive inhibitor with respect to the substrate ubiquinol. Additionally, we determined the crystal structure of compound 4e (K(i) = 83.00 pM) bound to the chicken bc(1) at 2.70 Å resolution, providing a molecular basis for understanding its ultrapotency. To our knowledge, this study is the first application of the FBDD method in the discovery of picomolar inhibitors of a membrane protein. This work demonstrates that the novel PFVS approach is a high-throughput drug discovery method, independent of biophysical screening techniques.
Directory of Open Access Journals (Sweden)
R. Weller
2013-02-01
Full Text Available Continuous black carbon (BC observations were conducted from 1999 through 2009 by an Aethalometer (AE10 and from 2006 through 2011 by a Multi-Angle Absorption Photometer (MAAP at Neumayer Station (NM under stringent contamination control. Considering the respective observation period, BC concentrations measured by the MAAP were somewhat higher (median ± standard deviation: 2.1 ± 2.0 ng m−3 compared to the AE10 results (1.6 ± 2.1 ng m−3. Neither for the AE10 nor for the MAAP data set a significant long-term trend could be detected. Consistently a pronounced seasonality was observed with both instruments showing a primary annual maximum between October and November and a minimum in April with a maximum/minimum ratio of 4.5/1.6 = 3.8 and 2.7/0.64 = 4.2 for the MAAP and AE10 data, respectively. Occasionally a secondary summer maximum in January/February was visible. With the aim to assess the impact of BC on optical properties of the aerosol at NM, we evaluated the BC data along with particle scattering coefficients measured by an integrating nephelometer. We found the mean single scattering albedo of ω550 = 0.992 ± 0.0090 (median: 0.994 at a wavelength of 550 nm with a range of values from 0.95 to 1.0.
BC SEA Solar Hot Water Acceleration project
Energy Technology Data Exchange (ETDEWEB)
Harris, N.C. [BC Sustainable Energy Association, Victoria, BC (Canada)
2005-07-01
Although solar hot water heating is an environmentally responsible technology that reduces fossil fuel consumption and helps mitigate global climate change, there are many barriers to its widespread use. Each year, domestic water heating contributes nearly 6 million tonnes of carbon dioxide towards Canada's greenhouse gas emissions. The installation of solar water heaters can eliminate up to 2 tonnes of carbon dioxide emissions per household. The BC SEA Solar Hot Water Acceleration project was launched in an effort to demonstrate that the technology has the potential to be widely used in homes and businesses across British Columbia. One of the main barriers to the widespread use of solar hot water heating is the initial cost of the system. Lack of public awareness and understanding of the technology are other barriers. However, other jurisdictions around the world have demonstrated that the use of renewables are the product of conscious policy decisions, including low-cost financing and other subsidies that have created demand for these technologies. To this end, the BC SEA Solar Hot Water Acceleration project will test the potential for the rapid acceleration of solar water heating in pilot communities where barriers are removed. The objective of the project is to install 100 solar water systems in homes and 25 in businesses and institutions in communities in British Columbia by July 2007. The project will explore the financial barriers to the installation of solar hot water systems and produce an action plan to reduce these barriers. In addition to leading by example, the project will help the solar energy marketplace, mitigate climate change and improve energy efficiency.
Novel spin-electronic properties of BC7 sheets induced by strain
International Nuclear Information System (INIS)
Xu, Lei; Dai, ZhenHong; Sui, PengFei; Sun, YuMing; Wang, WeiTian
2014-01-01
Based on first-principles calculations, the authors have investigated the electronic and magnetic properties of BC 7 sheets with different planar strains. It is found that metal–semiconductor transition appears at the biaxial strain of 15.5%, and the sheets are characteristic of spin-polarized semiconductor with a zero band-gap. The band-gap rapidly increases with strain, and reaches a maximum value of 0.60 eV at the strain of 20%. Subsequently, the band-gap decreases until the strain reaches up to 22% and shows a semiconductor-half metal transformation. It will further present metal properties until the strain is up to the maximum value of 35%. The magnetic moments also have some changes induced by biaxial strain. The numerical analysis shows that the two-dimensional distortions have great influences on the magnetic moments. The novel spin-electronic properties make BC 7 sheets have potential applications in future spintronic nanodevices
Community energy and emissions planning : a guide for BC local governments
International Nuclear Information System (INIS)
2008-09-01
British Columbia (BC) local governments are becoming more interested in completing an energy and greenhouse gas emissions plan for their community as awareness of climate change grows and energy prices escalate. The purpose of this guide was to support local government elected officials and staff in undertaking an energy and emissions planning process. This guide described the purpose and content of a community energy and emissions plan, its benefits, and how to go about creating one. Specifically, the guide provided practical tips, examples from BC communities, and links to more detailed information. Topics that were presented in the guide included engagement; inventories; target-setting; action plan; implementation and monitoring; and funding and resources. It was concluded that the key to long-term success is to maintain good communication with council/board, staff and the public. The document emphasized that it is important to make sure that people know the work being undertaken, and the results achieved, so that momentum is not lost. refs., tabs., figs
Mutations at the Qo-Site of the Cytochrome bc1 Complex Strongly Affect Oxygen Binding
DEFF Research Database (Denmark)
Husen, Peter; Solov'yov, Ilia A
2017-01-01
The homodimeric bc1 protein complex is embedded in membranes of mitochondria and photosynthetic bacteria, where it transports protons across the membrane to maintain an electrostatic potential used to drive ATP synthesis as part of the respiratory or photosynthetic pathways. The reaction cycle...... at the Qo-sites, and, moreover, different behavior of the two monomers of the bc1 complex is observed. The conformational differences at the Qo-sites of the two monomers are studied in detail and discussed. The anionic form of semiquinone was identified as leading to the greatest opportunity for side...
McLean, Mark E
2003-01-01
Because heroin supply changes cannot be measured directly, their impact on populations is poorly understood. British Columbia has experienced an injection drug use epidemic since the 1980s that resulted in 2,590 illicit drug deaths from 1990-1999. Since previous work indicates heroin seizures can correlate with supply and B.C. receives heroin only from Southeast Asia, this study examined B.C. heroin deaths against opiate seizures in East/Southeast Asia. Opiate seizures in East/Southeast Asia and data from two B.C. mortality datasets containing heroin deaths were examined. The Pearson correlation coefficient for seizures against each mortality dataset was determined. Opiate seizures, all illicit drug deaths and all opiate deaths concurrently increased twice and decreased twice from 1989-1999, and all reached new peak values in 1993. Three B.C. sub-regions exhibited illicit drug deaths rate trends concurrent with the three principal datasets studied. The Pearson correlation coefficient for opiate-induced deaths against opiate seizures from 1980-1999 was R=0.915 (popiate seizures from 1987-1999 was R=0.896 (popiate seizures in East/Southeast Asia were very strongly correlated with B.C. opiate and illicit drug deaths. The number of B.C. heroin-related deaths may be strongly linked to heroin supply. Enforcement services are not effective in preventing harm caused by heroin in B.C.; therefore, Canada should examine other methods to prevent harm. The case for harm reduction is strengthened by the ineffectiveness of enforcement and the unlikelihood of imminent eradication of heroin production in Southeast Asia.
Capacity region of the 3 receiver state dependent multilevel BC with noncausal state information
Directory of Open Access Journals (Sweden)
Viswanathan Ramachandran
2017-09-01
Full Text Available We consider a three receiver state dependent multilevel broadcast channel (BC, where the state information is known non-causally at the encoder as well as all the decoders. This is an extension of Nair and El Gamal’s three receiver multilevel BC (Nair and El Gamal, 2009, wherein two of the receivers decode only a common message while a third receiver decodes a private message as well. The objective is to characterize the rate tuples that are simultaneously achievable while ensuring negligible probability of error at each of the receivers. We characterize the capacity region of this setup in the paper.
Hippocrates (ca 460-370 BC) on nasal cancer.
Tsoucalas, Gregory; Sgantzos, Markos
2016-01-01
The prevalence of cancer in antiquity is rather an unknown scientific field. Nevertheless, During the 5th century BC, Hippocrates and his followers, studied thoroughly this fatal disease and proposed surgical techniques and palliative drugs to confront and treat the malignant tumors caused by the black bile (the 4 humors theory). Inside Corpus Hippocraticum, nasal cancer was mentioned, alongside with its treatment. Local surgical excision, cautherization, drugs to relief the pain and face possible metastases combined with a possible pessary technique and endotracheal intubation, have been employed by the physicians of the era.
Mehdi Aghaei, Sadegh; Monshi, M. M.; Torres, I.; Zeidi, S. M. J.; Calizo, I.
2018-01-01
The adsorption behaviors of toxic gas molecules (NO, CO, NO2, and NH3) on the graphene-like boron carbide (BC3) are investigated using first-principle density functional theory. The graphene-like BC3 monolayer is a semiconductor with a band gap of 0.733 eV. It is discovered that all the above gas molecules are chemisorbed on the BC3 sheet while they retain their molecular forms. It is also revealed that the NO2 gas molecule could be dissociated into NO and O species through the adsorption process. The amounts of charge transfer upon adsorption of CO and NH3 gas molecules on the BC3 are found to be small. The band gap changes in BC3 as a result of interactions with CO and NH3 are only 4.63% and 16.7%, indicating that the BC3-based sensor has a low and moderate sensitivity to CO and NH3, respectively. Contrariwise, upon adsorption of NO or NO2 on the BC3, significant charges are transferred from the molecules to the BC3 sheet, causing a semiconductor-metal and semiconductor-p type semiconductor transition. Our study suggests that the BC3-based sensor has a high potential for NO and NO2 detection due to the significant conductance changes, moderate adsorption energy, and short recovery time. More excitingly, the BC3 is a likely catalyst for dissociation of the NO2 gas molecule.
International Nuclear Information System (INIS)
Veerkamp, M.
2002-06-01
The British Columbia government is planning to sell-off and deregulate the province's integrated, publicly-owned electric utilities despite election promises not to do so. The author argues that the consequences will be catastrophic with massive price increasing, rolling brownouts and service cuts. A recent poll indicates that 76 per cent of British Columbians oppose the decision to sell, 68 per cent do not support deregulation, and 83 per cent support a full public consultation before any changes are made. In response, the BC Citizens for Public Power Society was formed to give voice to British Columbians demand that their power system remain in public hands. This report presents a chronology of events for BC Hydro, and describes the experience of other jurisdictions with electricity deregulation. The BC Task Force on Energy Policy has released a report which claims that a fully competitive energy market will attract private capital and bring more energy supply, thereby lowering energy costs and increasing energy security. British Columbians condemn that report, arguing that it is too ideological and poorly substantiated. This paper discusses the impact that deregulation would have on the transmission system, the environment, and on local governments and small communities. It was noted that if the public electricity resources are removed from public ownership and control, the province's future options will be restricted under the North American Free Trade Agreement (NAFTA) and the General Agreement on Trade in Services (GATS). The BC Citizens for Public Power Society argues that the future power needs of the province are best met by public investment and energy conservation using BC Hydro. 65 refs
International Nuclear Information System (INIS)
1992-04-01
Four areas of the Hanford Site (the 100, 200, 300 and 1100 Areas) have been included on the US Environmental Protection Agency's (EPA's) National Priorities List (NPL) under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). Figure 1-1 shows the location of these areas. Under the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement, Ecology et al. 1990a), signed by the Washington State Department of Ecology (Ecology), EPA, and the US Department of Energy (DOE), more than 1,000 inactive waste disposal and unplanned release sites on the Hanford Site have been grouped into a number of source and groundwater operable units. These operable units contain contamination in the form of hazardous waste, radioactive/hazardous mixed waste and other CERCLA hazardous substances. Also included in the Tri-Party Agreement are 55 Resource Conservation and Recovery Act (RCRA) treatment, storage, or disposal (TSD) facilities that will be closed or permitted to operate in accordance with RCRA regulations, under the authority of Chapter 173-303 Washington Administrative Code (WAC). Some of the TSD facilities are included in the operable units. This work plant and the attached supporting project plans establish the operable unit setting and the objectives, procedures, tasks, and schedule for conducting the CERCLA remedial investigation/feasibility study (RI/FS) for the 100-BC-5 operable unit. The 100-B/C Area consists of the 100-BC-5 groundwater operable unit and four source operable units. The 100-BC-5 operable unit includes all contamination found in the aquifer soils and water beneath the 100-B/C Area. Source operable units include facilities and unplanned release sites that are potential sources of contamination
A rapid cosmic-ray increase in BC 3372-3371 from ancient buried tree rings in China.
Wang, F Y; Yu, H; Zou, Y C; Dai, Z G; Cheng, K S
2017-11-14
Cosmic rays interact with the Earth's atmosphere to produce 14 C, which can be absorbed by trees. Therefore, rapid increases of 14 C in tree rings can be used to probe previous cosmic-ray events. By this method, three 14 C rapidly increasing events have been found. Plausible causes of these events include large solar proton events, supernovae, or short gamma-ray bursts. However, due to the lack of measurements of 14 C by year, the occurrence frequency of such 14 C rapidly increasing events is poorly known. In addition, rapid increases may be hidden in the IntCal13 data with five-year resolution. Here we report the result of 14 C measurements using an ancient buried tree during the period between BC 3388 and 3358. We found a rapid increase of about 9‰ in the 14 C content from BC 3372 to BC 3371. We suggest that this event could originate from a large solar proton event.
A controlled clinical trial to evaluate the effect of GanedenBC(30) on immunological markers.
Kimmel, M; Keller, D; Farmer, S; Warrino, D E
2010-03-01
GanedenBC(30), a probiotic, has been shown to significantly increase T-cell production of TNF-alpha after ex vivo exposure to a strain of adenovirus (AdenoVI) or influenza A (H3N2 Texas strain [FluTex]). The current controlled study was designed to further evaluate the effect of GanedenBC(30) on immunological marker levels following viral exposure. Ten healthy subjects' baseline immunological marker levels were analyzed. Subjects consumed 1 capsule/day of GanedenBC(30) for 28 days and returned for post-treatment immunological marker evaluation. Subjects' baseline measurements served as their own control. All subjects completed the study with no adverse events; however, one subject was excluded from the final analysis based on a reasonable consideration as an outlier. CD3+CD69+ cells, IL-6, IL-8, interferon-gamma (IFN-gamma) and TNF-alpha levels were increased after exposure to AdenoVI and FluTex. IL-1beta levels also increased after exposure to AdenoVI but were decreased after ex vivo exposure to FluTex. CD3+CD69+ cells increased significantly (P = 0.023) after exposure to both viral strains. Differences in IL-8 levels after FluTex exposure achieved statistical significance (P = 0.039) as did IFN-gamma levels after AdenoVI exposure (P = 0.039). A regimen of one capsule per day containing 500 million CFU of GanedenBC30 may be a safe and effective option for enhancing the immunological response to common viral respiratory tract infections. 2010 Prous Science, S.A.U. or its licensors. All rights reserved.
An organization structure analysis for BC Hydro, Power Smart
Lellis, Leandro Bianchi
2006-01-01
Power Smart is BC Hydro’s demand-side management (DMS) initiative to encourage energy efficiency by its customers. Currently, they are in the midst of a very significant program redesign to influence their largest transmission voltage customers to use energy efficiently without the capability to award a capital incentive. From their internal operating model perspective, Power Smart is considering moving from an audit based function to a more consultative role. This project aims to provide and...
Apiano de Alejandría, traductor (BC IV 45 y V 191
Directory of Open Access Journals (Sweden)
José B. Torres
2006-06-01
Full Text Available This paper defends that Appian regards as translations two passages in his work (cfr. BC IV 45 and V 191. Both translations show different features which may be explained from the point of view of ancient theories concerning translation.
Energy Technology Data Exchange (ETDEWEB)
Tu, Alex; Leclair, Donna; Morrison, Allison
2010-09-15
In order for renewable energy to play a dominant role in the global electricity supply mix, emerging renewable energy technologies - such as wave, tidal, enhanced geothermal, and 3rd generation photovoltaic technologies - must prove their technical merits and achieve cost parity with conventional sources of supply. BC Hydro, a government-owned electric utility, launched an Alternative and Emerging Energy Strategy that describes its role as an enabler of technology innovation. This paper describes BC Hydro's goal, objectives and actions to accelerate the commercialization that will yield a diversity of supply options and a growing, local clean-tech cluster.
Wang, Rui
This work involves an analysis of data recorded at the Large Hadron Collider combined with a program to develop detectors for future collider experiments. Using the full 4.9 fb$^{-1}$ of 7 \\TeV~data collected in 2011 and the 19.2 fb$^{-1}$ of 8 \\TeV~data collected in 2012, the $\\Bc(2S)$ meson has been observed with the ATLAS detector in the hadronic decay mode $\\Bc(2S)\\rightarrow \\Bc\\pi^{+}\\pi^{-}$, $\\Bc\\rightarrow J/\\psi\\pi$. This new state has been found in the mass difference distribution with invariant mass $6842 \\pm 7_{stat.} \\pm 4_{syst.}$ \\MeV. To prepare for the high radiation environment at the High Luminosity LHC, diamond sensors are being developed. Their leakage current and resistivity are measured at fluences and temperatures relevant to the ATLAS upgrade. No evidence of dependence of the resistivity on fluence or temperature has been observed for the ranges [-10 $^\\circ$C, +20 $^\\circ$C] and [0, $1.0\\times10^{16} \\rm{n_{eq}/cm^2}$]. To study the radiation damage of the sensors in the ATLAS Pixel...
Maathuis, A J H; Keller, D; Farmer, S
2010-03-01
We have investigated the survival and activity of GanedenBC(30) during passage through the upper gastro-intestinal tract. GanedenBC(30) was tested in a dynamic, validated, in vitro model of the stomach and small intestine (TIM-1) on survival and its potential to aid in digestion of milk protein, lactose and fructose. The survival of GanedenBC(30) was high (70%), although germination of the spores was minimal (<10%) under the conditions tested. Survival of the strain in the presence of lactose and fructose was markedly lower (56-59%) than in the absence of the sugars. The amount of digested milk protein available for absorption was somewhat higher (+0.2 g) when GanedenBC(30) was added to the milk. When GanedenBC(30) was tested with lactose or fructose added to the meal, the cumulative amount of lactate produced was slightly higher (+0.12-0.18 mmol) compared to the GanedenBC(30) alone. In conclusion, although the differences in survival of GanedenBC(30) are small, these results show the potential of GanedenBC(30) to aid in protein digestion and in the digestion of lactose and fructose. If a larger fraction of the Bacillus coagulans cells had germinated, the influence on protein and carbohydrate digestion would probably have been much greater. Importance of the findings: the potential of GanedenBC(30) to aid in the digestion of lactose and fructose could be used to prevent occurrence of intestinal symptoms in individuals sensitive to these carbohydrates.
BC Hydro's smart grid strategy within a global transformation
Energy Technology Data Exchange (ETDEWEB)
Zucker, R. [BC Hydro, Vancouver, BC (Canada). Smart Grid Development Program
2009-07-01
Electric utilities are now examining methods of ensuring adequate supply and energy security for the future. This presentation discussed BC Hydro's smart grid program within the context of other global automated metering initiatives. Over 60 per cent of the United States' gross domestic product (GDP) is derived from industries and services dependent on electricity. Power outages and interruptions cost the country an estimated $150 billion per year. A more efficient and reliable grid will provide $1.8 trillion in annual additive revenue by 2020. BC Hydro currently has over 1.8 million customers, and is comprised of 41 dam sites, 30 hydro facilities, and 9 thermal units. The utility has over 18,000 km of transmission lines and 56,000 km of distribution lines. The province's energy plan hopes to achieve energy self-sufficiency by 2016, and all new electric generation will be net zero greenhouse gas (GHG) or serve as an offset for GHG emissions. The BC Hydro smart meter program will help to support the utility's conservation program. The smart grid will include fundamental applications for metering, meter data management, distribution automation and management, and substation automation. The foundation of the smart meter system is comprised of IT and telecommunications infrastructure and a circuit topology. Reliability and power quality improvements of 40 per cent are anticipated, as well as significant improvements in energy efficiency and customer service. Smart grid applications are being designed for microgrids and plug-in vehicles. A voltage control system has been designed to allow the real time management of energy flows. It was concluded that smart grid programs will provide significant benefits to utility customers and communities in the province. tabs., figs.
Doubly-heavy baryon weak decays: Ξbc0→pK− and Ξcc+→Σc++(2520K−
Directory of Open Access Journals (Sweden)
Run-Hui Li
2017-04-01
Full Text Available Doubly-heavy baryons, with two heavy and one light quarks, are expected to exist in QCD and their masses have been predicted in the quark model. However their existence is not well established so far in experiment. In this work, we explore the possibility of searching for Ξbc and Ξcc+ in the W-exchange processes, Ξbc0→pK− and Ξcc+→Σc++(2520K−. On the basis of perturbative calculations, we estimate the branching ratio of the first decay as BR(Ξbc0→p+K−≈3.21×Rf2×Rτ×10−7, where Rf (Rτ are the ratios of the decay constants (lifetimes of Ξbc0 and Λb0. The branching ratio of Ξcc+→Σc++(2520K− is related to that of Λc+→Δ++K−, and thereby a conjectured topology analysis leads to the range for the branching ratio as: BR(Ξcc+→Σc++(2520K−∈[0.36%,1.80%]. The decay Ξcc+→Σc++(2520K− would be reconstructed in the Λc+K−π+ final state which is easy to access even at a hadron collider. Based on the two facts that abundant heavy quarks can be produced at a hadron collider like LHC, and the branching ratios of Ξbc0→pK− and Ξcc+→Σc++(2520K− are sizable, we urge our experimental colleagues to perform a search at LHCb. This will presumably lead to the discovery of the Ξbc and Ξcc+, and precision measurements of the branching ratios in the future are helpful to investigate their decay mechanism.
Weighted Sum-Rate Maximization Using Weighted MMSE for MIMO-BC Beamforming Design
DEFF Research Database (Denmark)
Christensen, Søren; De Carvalho, Elisabeth; Agarwal, Rajiv
2009-01-01
This paper studies linear transmit filter design for weighted sum-rate (WSR) maximization in the multiple input multiple output broadcast channel (MIMO-BC). The problem of finding the optimal transmit filter is non-convex and intractable to solve using low complexity methods. Motivated by recent ...
Energy Technology Data Exchange (ETDEWEB)
Guerra, T.; Azevedo, S. [Departamento de Física/CCEN, Universidade Federal da Paraíba, Caixa Postal 5008, 58051-900 João Pessoa, PB (Brazil); Kaschny, J.R. [Instituto Federal da Bahia-Campus Vitória da Conquista, Caixa Postal 3150, 45075-265 Vitória da Conquista, BA (Brazil)
2017-04-15
Graphene nanoribbons are predicted to be essential components in future nanoelectronics. The size, edge type, arrangement of atoms and width of nanoribbons drastically change their properties. Boronnitrogencarbon nanoribbons properties are not fully understood so far. In the present contribution it was investigated the structural, electronic and magnetic properties of chevron-type carbon, boron nitride and BC{sub 2}N nanoribbons, using first-principles calculations. The results indicate that the structural stability is closely related to the discrepancies in the bond lengths, which can induce structural deformations and stress. Such nanoribbons present a wide range of electronic behaviors, depending on their composition and particularities of the atomic arrangement. A net magnetic moment is found for structures that present carbon atoms at the nanoribbon borders. Nevertheless, the calculated magnetic moment depends on the peculiarities of the symmetric arrangement of atoms and imbalance of carbon atoms between different sublattices. It was found that all structures which have a significant energy gap do not present magnetic moment, and vice-versa. Such result indicates the strong correlation between the electronic and magnetic properties of the chevron-type nanoribbons. - Highlights: • Small discrepancies between distinct bond lengths can influence the formation energy of the BC{sub 2}N nanoribbons. • The electronic behavior of the BC{sub 2}N chevron-type nanoribbons depends on the atomic arrangement and structural symmetries. • There is a strong correlation between the electronic and magnetic properties for the BC{sub 2}N structures.
BcII RFLP for the human vimentin gene
Energy Technology Data Exchange (ETDEWEB)
Marcus, E M; Smith, B A; Telenius, H; Ponder, B A.J.; Mathew, C G.P. [Haddow Laboratories, Surrey (England); Landsvater, R M; Buys, C H.C.M. [State Univ. of Groningen (Netherlands); Ferrari, S [Temple University Medical School, Philadelphia, PA (USA)
1988-09-26
A 1.1 kb cDNA clone (hp4F1) encoding the human vimentin gene was identified in a human library by screening with 4F1, a hamster vimentin cDNA. BcII (TGATCA) recognizes a two allele polymorphism: bands A1 at 8.1 kb, and A2 at 3.6 kb. The allele frequency was determined in 47 unrelated Caucasian individuals. The RFLP was mapped to chromosome 10pter-10q23 using somatic cell hybrids and to 10p13 by in situ hybridization. Co-dominant segregation was observed in 2 informative families.
Directory of Open Access Journals (Sweden)
Singh Ravindra
2009-01-01
Full Text Available Background: Platelet rich plasma-platelet concentrate (PRP-PC, buffy coat poor-platelet concentrate (BC-PC, and apheresis-PC were prepared and their quality parameters were assessed. Study Design: In this study, the following platelet products were prepared: from random donor platelets (i platelet rich plasma - platelet concentrate (PRP-PC, and (ii buffy coat poor- platelet concentrate (BC-PC and (iii single donor platelets (apheresis-PC by different methods. Their quality was assessed using the following parameters: swirling, volume of the platelet concentrate, platelet count, WBC count and pH. Results: A total of 146 platelet concentrates (64 of PRP-PC, 62 of BC-PC and 20 of apheresis-PC were enrolled in this study. The mean volume of PRP-PC, BC-PC and apheresis-PC was 62.30±22.68 ml, 68.81±22.95 ml and 214.05±9.91 ml and ranged from 22-135 ml, 32-133 ml and 200-251 ml respectively. The mean platelet count of PRP-PC, BC-PC and apheresis-PC was 7.6±2.97 x 1010/unit, 7.3±2.98 x 1010/unit and 4.13±1.32 x 1011/unit and ranged from 3.2-16.2 x 1010/unit, 0.6-16.4 x 1010/unit and 1.22-8.9 x 1011/unit respectively. The mean WBC count in PRP-PC (n = 10, BC-PC (n = 10 and apheresis-PC (n = 6 units was 4.05±0.48 x 107/unit, 2.08±0.39 x 107/unit and 4.8±0.8 x 106/unit and ranged from 3.4 -4.77 x 107/unit, 1.6-2.7 x 107/unit and 3.2 - 5.2 x 106/unit respectively. A total of 26 units were analyzed for pH changes. Out of these units, 10 each were PRP-PC and BC-PC and 6 units were apheresis-PC. Their mean pH was 6.7±0.26 (mean±SD and ranged from 6.5 - 7.0 and no difference was observed among all three types of platelet concentrate. Conclusion: PRP-PC and BC-PC units were comparable in terms of swirling, platelet count per unit and pH. As expected, we found WBC contamination to be less in BC-PC than PRP-PC units. Variation in volume was more in BC-PC than PRP-PC units and this suggests that further standardization is required for preparation of BC
Recent progress in heteronuclear long-range NMR of complex carbohydrates: 3D H2BC and clean HMBC
DEFF Research Database (Denmark)
Meier, Sebastian; Petersen, Bent O.; Duus, Jens Øllgaard
2009-01-01
carbohydrates whose structure has been determined by NMR, not least due to the enhanced resolution offered by the third dimension in 3D H2BC and the improved spectral quality due to artifact suppression in clean HMBC. Hence these new experiments set the scene to take advantage of the sensitivity boost achieved...... by the latest generation of cold probes for NMR structure determination of even larger and more complex carbohydrates in solution.......The new NMR experiments 3D H2BC and clean HMBC are explored for challenging applications to a complex carbohydrate at natural abundance of 13C. The 3D H2BC experiment is crucial for sequential assignment as it yields heteronuclear one- and two-bond together with COSY correlations for the 1H spins...
Observation of the decay Bc + → J/ψK +K-π+
Aaij, R.; Adeva, B.; Adinolfi, M.; Adrover, C.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; Anderlini, L.; Anderson, J.; Andreassen, P.R.; Andrews, J.E.; Appleby, R. B.; Aquines Gutierrez, O.; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Balagura, V.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bettler, M-O.; Van Beuzekom, Martin; Bien, A.; Bifani, S.; Bird, T.D.; Bizzeti, A.; Bjørnstad, P. M.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Brambach, T.; Van Den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N. H.; Brown, H.; Bursche, A.; Busetto, G.; Buytaert, J.; Cadeddu, S.; Callot, O.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Campora Perez, D.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carranza-Mejia, H.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Castillo Garcia, L.; Cattaneo, M.; Cauet, Ch; Cenci, R.; Charles, M.; Charpentier, Ph; Chen, P.; Cheung, S-F.; Chiapolini, N.; Chrzaszcz, M.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coca-Pelaz, A.; Coco, V.; Cogan, J.; Cogneras, E.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Cruz Torres, M.; Cunliffe, S.; Currie, C.R.; D'Ambrosio, C.; David, P.; David, P.; Davis, A.; De Bonis, I.; De Bruyn, K.; De Capua, S.; De Cian, M.; de Miranda, J. M.; Paula, L.E.; da-Silva, W.S.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Déléage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Di Canto, A.; Dijkstra, H.; Dogaru, M.; Donleavy, S.; Dordei, F.; Dosil Suárez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Van Eijk, D.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Falabella, A.; Färber, C.; Farinelli, C.; Farry, S.; Ferguson, D.; Fernandez Albor, V.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fitzpatrick, C.; Fontana, Mark; Fontanelli, F.; Forty, R.; De Aguiar Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gandelman, M.; Gandini, P.; Gao, Y.; Garofoli, J.; Garosi, P.; Garra Tico, J.; Garrido, L.; Carvalho-Gaspar, M.; Gauld, Rhorry; Gersabeck, E.; Gersabeck, M.; Gershon, T. J.; Ghez, Ph; Gibson, V.; Giubega, L.; Gligorov, V. V.; Göbel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.Q.; Gorbounov, P.; Head-Gordon, Teresa; Grabalosa Gándara, M.; Graciani Diaz, R.; Granado Cardoso, L. A.; Graugés, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grünberg, O.; Gui, B.; Gushchin, E.; Guz, Yu; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hampson, T.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; Hartmann, T.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Hernando Morata, J. A.; van Herwijnen, E.; Heß, M.; Hicheur, A.; Hicks, G.E.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Hunt, P.; Huse, J.T.; Hussain, N.; Hutchcroft, D. E.; Hynds, D.; Iakovenko, V.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jans, E.; Jaton, P.; Jawahery, A.; Jing, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Kaballo, M.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Kenyon, I. R.; Ketel, T.; Khanji, B.; Kochebina, O.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Korolev, M.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucharczyk, M.; Kudryavtsev, V.; Kurek, K.; Kvaratskheliya, T.; La Thi, V. N.; Lacarrere, D.; Lafferty, G. D.; Lai, A.; Lambert, D.M.; Lambert, R. W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Latham, T. E.; Lazzeroni, C.; Le Gac, R.; Van Leerdam, J.; Lees, J. P.; Lefèvre, R.; Leflat, A.; Lefrançois, J.; Di Leo, S.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Li Gioi, L.; Liles, M.; Lindner, R.; Linn, S.C.; Liu, B.; Liu, G.; Lohn, S.; Longstaff, I.; Lopes, J. H.; Lopez-March, N.; Lu, H.; Lucchesi, D.; Luisier, J.; Luo, H.; Lupton, O.; Machefert, F.; Machikhiliyan, I. V.; Maciuc, F.; Maev, O.; Malde, S.; Manca, G.; Mancinelli, G.; Maratas, J.; Marconi, U.; Marino, P.; Märki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martín Sánchez, A.; Martinelli-Boneschi, F.; Martinez-Santos, D.; Martins Tostes, D.; Martynov, A.; Massafferri, A.; Matev, R.; Mathe, Z.; Matteuzzi, C.; Maurice, E.; Mazurov, A.; McCarthy, J.; Mcnab, A.; McNulty, R.; McSkelly, B.; Meadows, B. T.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D. A.; Minard, M. N.; Molina Rodriguez, J.; Monteil, S.; Moran-Zenteno, D.; Morawski, P.; Mordà, A.; Morello, M. J.; Mountain, R.; Mous, I.; Muheim, F.; Müller, Karl; Muresan, R.; Muryn, B.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neubert, S.; Neufeld, N.; Nguyen, A. D.; Nguyen, T. D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Nomerotski, A.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Orlandea, M.; Otalora Goicochea, J. M.; Owen, R.P.; Oyanguren, A.; Pal, B. K.; Palano, A.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C. J.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrick, G. N.; Patrignani, C.; Pavel-Nicorescu, C.; Pazos Alvarez, A.; Pearce, D.A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perez Trigo, E.; Pérez-Calero Yzquierdo, A.; Perret, P.; Perrin-Terrin, M.; Pescatore, L.; Pesen, E.; Pessina, G.; Petridis, K.; Petrolini, A.; Phan, A.; Picatoste Olloqui, E.; Pietrzyk, B.; Pilař, T.; Pinci, D.; Playfer, S.; Plo Casasus, M.; Polci, F.; Polok, G.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; Prisciandaro, J.; Pritchard, C.A.; Prouve, C.; Pugatch, V.; Puig Navarro, A.; Punzi, G.; Qian, Y.W.; Rachwal, B.; Rademacker, J. H.; Rakotomiaramanana, B.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Redford, S.; Reichert, S.; Reid, M.; dos Reis, A. C.; Ricciardi, S.; Richards, Al.; Rinnert, K.; Rives Molina, V.; Roa Romero, D. A.; Robbe, P.; Roberts, D. A.; Rodrigues, A. B.; Rodrigues, L.E.T.; Rodriguez Perez, P.; Roiser, S.; Romanovsky, V.; Romero Vidal, A.; Rouvinet, J.; Ruf, T.; Ruffini, F.; Ruiz, van Hapere; Ruiz Valls, P.; Sabatino, G.; Saborido Silva, J. J.; Sagidova, N.; Sail, P.; Saitta, B.; Salustino Guimaraes, V.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schiller, M.; Schindler, R. H.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M. H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, O.; Shevchenko, V.; Shires, A.; Silva Coutinho, R.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, N. A.; Smith, E.; Smith, E.; Smith, J; Smith, M.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; de Souza, D.K.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stevenson-Moore, P.; Stoica, S.; Stone, S.; Storaci, B.; Straticiuc, M.; Straumann, U.; Subbiah, V. K.; Sun, L.; Sutcliffe, W.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szilard, D.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Teodorescu, E.; Teubert, F.; Thomas, C.; Thomas, E.; Van Tilburg, J.; Tisserand, V.; Tobin, M. N.; Tolk, S.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, N.T.M.T.; Tresch, M.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Ubeda Garcia, M.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vallier, A.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vázquez Sierra, C.; Vecchi, S.; Velthuis, M.J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voß, C.; Voss, H.; Waldi, R.; Wallace, C.; Wallace, R.; Wandernoth, S.; Wang, J.; Ward, D. R.; Watson, N. K.; Webber, A. D.; Websdale, D.; Whitehead, M.; Wicht, J.; Wiechczynski, J.; Wiedner, D.; Wiggers, L.; Wilkinson, G.; Williams, M.P.; Williams, M.; Wilson, James F; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wright, S.J.; Wu, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Yang, Z.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W. C.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.; Zvyagin, A.
2013-01-01
The decay Bc + → J/ψK+K -π+ is observed for the first time, using proton-proton collisions collected with the LHCb detector corresponding to an integrated luminosity of 3 fb-1. A signal yield of 78 ± 14 decays is reported with a significance of 6.2 standard deviations. The ratio of the branching
Production of inositol trisphosphates upon α-adrenergic stimulation in BC3H-1 muscle cells
International Nuclear Information System (INIS)
Ambler, S.K.; Thompson, B.; Brown, J.H.; Taylor, P.
1986-01-01
Activation of α 1 -adrenergic receptors in BC3H-1 muscle cells rapidly mobilizes intracellular and results in a paradoxically slower accumulation of inositol trisphosphate. A possible explanation for this discrepancy may be provided by the recent findings of Irvine et al. of additional Ins P3 isomers besides the Ca ++ -mobilizing isomer, Ins 1,4,5-P3. They have eluted and separated the inositol phosphates of BC3H-1 cells with an NH 4 + x HCO 2 - /H 3 PO 4 gradient on a Whatman Partisil 10SAX column using Hewlett-Packard HPLC. Commercial [ 3 H]Ins 1,4,5-P3 and [ 3 H]inositol phosphates from carbachol-stimulated parotid glands were used as standards. Little or no Ins 1,3,4-P3 could be detected in control or phenylephrine-treated BC3H-1 cells. Ins 1,4,5-P3 followed the pattern of agonist stimulation observed previously. As a positive control, Ins P3 isomers were also measured in 1321N1 astrocytoma cells. Muscarinic stimulation of 1321N1 cells results in both the rapid accumulation of Ins P3 and Ca ++ mobilization. There is no detectable basal Ins 1,3,4-P3, but carbachol stimulates a rapid production of this compound in 1321N1 cells. Agonist activation also results in a rapid increase in Ins 1,4,5-P3 above basal values. These studies indicate that Ins 1,3,4-P3 does not contribute to the InsP3 signal in BC3H-1 cells and multiple mechanisms may exist for the coupling of receptors to PI turnover
Novel spin-electronic properties of BC{sub 7} sheets induced by strain
Energy Technology Data Exchange (ETDEWEB)
Xu, Lei; Dai, ZhenHong, E-mail: zhdai@ytu.edu.cn; Sui, PengFei; Sun, YuMing; Wang, WeiTian [Computational Physics Laboratory, Institute of Opto-Electronic Information Science and Technology, Yantai University, Yantai 264005 (China)
2014-11-01
Based on first-principles calculations, the authors have investigated the electronic and magnetic properties of BC{sub 7} sheets with different planar strains. It is found that metal–semiconductor transition appears at the biaxial strain of 15.5%, and the sheets are characteristic of spin-polarized semiconductor with a zero band-gap. The band-gap rapidly increases with strain, and reaches a maximum value of 0.60 eV at the strain of 20%. Subsequently, the band-gap decreases until the strain reaches up to 22% and shows a semiconductor-half metal transformation. It will further present metal properties until the strain is up to the maximum value of 35%. The magnetic moments also have some changes induced by biaxial strain. The numerical analysis shows that the two-dimensional distortions have great influences on the magnetic moments. The novel spin-electronic properties make BC{sub 7} sheets have potential applications in future spintronic nanodevices.
47 CFR 52.12 - North American Numbering Plan Administrator and B&C Agent.
2010-10-01
... with any particular telecommunication industry segment. Accordingly, while conducting their respective... will not preclude telecommunications industry participants from identifying performance problems to the... problems are identified by a telecommunications industry participant, the NANC, B&C Agent or NANPA shall...
Conte, Laura; Zara, Vincenzo
2011-01-01
The Rieske iron-sulfur protein, one of the catalytic subunits of the cytochrome bc 1 complex, is involved in electron transfer at the level of the inner membrane of yeast mitochondria. The Rieske iron-sulfur protein is encoded by nuclear DNA and, after being synthesized in the cytosol, is imported into mitochondria with the help of a cleavable N-terminal presequence. The imported protein, besides incorporating the 2Fe-2S cluster, also interacts with other catalytic and non-catalytic subunits of the cytochrome bc 1 complex, thereby assembling into the mature and functional respiratory complex. In this paper, we summarize the most recent findings on the import and assembly of the Rieske iron-sulfur protein into Saccharomyces cerevisiae mitochondria, also discussing a possible role of this protein both in the dimerization of the cytochrome bc 1 complex and in the interaction of this homodimer with other complexes of the mitochondrial respiratory chain. PMID:21716720
Conte, Laura; Zara, Vincenzo
2011-01-01
The Rieske iron-sulfur protein, one of the catalytic subunits of the cytochrome bc(1) complex, is involved in electron transfer at the level of the inner membrane of yeast mitochondria. The Rieske iron-sulfur protein is encoded by nuclear DNA and, after being synthesized in the cytosol, is imported into mitochondria with the help of a cleavable N-terminal presequence. The imported protein, besides incorporating the 2Fe-2S cluster, also interacts with other catalytic and non-catalytic subunits of the cytochrome bc(1) complex, thereby assembling into the mature and functional respiratory complex. In this paper, we summarize the most recent findings on the import and assembly of the Rieske iron-sulfur protein into Saccharomyces cerevisiae mitochondria, also discussing a possible role of this protein both in the dimerization of the cytochrome bc(1) complex and in the interaction of this homodimer with other complexes of the mitochondrial respiratory chain.
Directory of Open Access Journals (Sweden)
Wenjun Zhu
2017-09-01
Full Text Available We experimentally isolated and characterized a CFEM protein with putative GPI-anchored site BcCFEM1 in Botrytis cinerea. BcCFEM1 contains a CFEM (common in several fungal extracellular membrane proteins domain with the characteristic eight cysteine residues at N terminus, and a predicted GPI modification site at C terminus. BcCFEM1 was significantly up-regulated during early stage of infection on bean leaves and induced chlorosis in Nicotiana benthamiana leaves using Agrobacterium infiltration method. Targeted deletion of BcCFEM1 in B. cinerea affected virulence, conidial production and stress tolerance, but not growth rate, conidial germination, colony morphology, and sclerotial formation. However, over expression of BcCFEM1 did not make any observable phenotype change. Therefore, our data suggested that BcCFEM1 contributes to virulence, conidial production, and stress tolerance. These findings further enhance our understanding on the sophisticated pathogenicity of B. cinerea beyond necrotrophic stage, highlighting the importance of CFEM protein to B. cinerea and other broad-host-range necrotrophic pathogens.
The homeobox BcHOX8 gene in Botrytis cinerea regulates vegetative growth and morphology.
Directory of Open Access Journals (Sweden)
Zsuzsanna Antal
Full Text Available Filamentous growth and the capacity at producing conidia are two critical aspects of most fungal life cycles, including that of many plant or animal pathogens. Here, we report on the identification of a homeobox transcription factor encoding gene that plays a role in these two particular aspects of the development of the phytopathogenic fungus Botrytis cinerea. Deletion of the BcHOX8 gene in both the B. cinerea B05-10 and T4 strains causes similar phenotypes, among which a curved, arabesque-like, hyphal growth on hydrophobic surfaces; the mutants were hence named Arabesque. Expression of the BcHOX8 gene is higher in conidia and infection cushions than in developing appressorium or mycelium. In the Arabesque mutants, colony growth rate is reduced and abnormal infection cushions are produced. Asexual reproduction is also affected with abnormal conidiophore being formed, strongly reduced conidia production and dramatic changes in conidial morphology. Finally, the mutation affects the fungus ability to efficiently colonize different host plants. Analysis of the B. cinerea genome shows that BcHOX8 is one member of a nine putative homeobox genes family. Available gene expression data suggest that these genes are functional and sequence comparisons indicate that two of them would be specific to B. cinerea and its close relative Sclerotinia sclerotiorum.
International Nuclear Information System (INIS)
Fu Fengfu; Watanabe, Kazuo; Shinohara, Nobuo; Xu Xueqin; Xu Liangjun; Akagi, Tasuku
2008-01-01
To observe surface morphology and light-absorption property of different black carbon (BC) particles, different-sized aerosols were collected in Tokaimura (36.27 o N, 140.36 o E), an urban seaside area of eastern central Japan, using a high-volume Andersen type sampler during a whole year (Jan. to Dec. in 2004). The morphology of individual BC particle separated from different-sized aerosols was observed with Scanning Electron Microscope with Energy Dispersive X-ray Spectrometer (SEM-EDX) and four types of morphology were observed: 50 nm spherical particles, micrometer-sized plates with homogeneous surfaces, micrometer-sized spherical particles with homogeneous surfaces and micrometer-sized spherical particles with small holes on surfaces. The light-absorption property of BC particles with different morphology has been determined by infrared spectrometry (IRS) with a photoacoustic technique in a region of 400-4000 wavenumbers (cm -1 ). All morphology BC particles showed a strong light-absorption during 500-3000 wavenumbers (cm -1 ) with two strong broad peaks in 750-1100 and 1200-2200 wavenumbers (cm -1 ), implying that all morphology BC particles can absorb a significant part of thermal infrared emitted from the earth (wavelength 4000-50,000 nm). The seasonal variation and the size-distribution of aerosols and its chemical components (e.g. C, Na, Cl, NH 4 + , NO 3 - , SO 4 2- , Al, Ca, Mg and Fe) were also measured in this study. More than 55% of non-inorganic carbon (OC + BC) in the atmosphere was detected in the aerosols with a size smaller than 1.1 μm and the concentration of non-inorganic carbon in the atmosphere showed only a faint variation during a whole year, although the concentrations of total aerosols and its chemical components exhibited a distinct variation
Fu, Feng Fu; Watanabe, Kazuo; Shinohara, Nobuo; Xu, Xueqin; Xu, Liangjun; Akagi, Tasuku
2008-04-15
To observe surface morphology and light-absorption property of different black carbon (BC) particles, different-sized aerosols were collected in Tokaimura (36.27 degrees N, 140.36 degrees E), an urban seaside area of eastern central Japan, using a high-volume Andersen type sampler during a whole year (Jan. to Dec. in 2004). The morphology of individual BC particle separated from different-sized aerosols was observed with Scanning Electron Microscope with Energy Dispersive X-ray Spectrometer (SEM-EDX) and four types of morphology were observed: 50 nm spherical particles, micrometer-sized plates with homogeneous surfaces, micrometer-sized spherical particles with homogeneous surfaces and micrometer-sized spherical particles with small holes on surfaces. The light-absorption property of BC particles with different morphology has been determined by infrared spectrometry (IRS) with a photoacoustic technique in a region of 400-4000 wavenumbers (cm(-1)). All morphology BC particles showed a strong light-absorption during 500-3000 wavenumbers (cm(-1)) with two strong broad peaks in 750-1100 and 1200-2200 wavenumbers (cm(-1)), implying that all morphology BC particles can absorb a significant part of thermal infrared emitted from the earth (wavelength 4000-50,000 nm). The seasonal variation and the size-distribution of aerosols and its chemical components (e.g. C, Na, Cl, NH(4)(+), NO(3)(-), SO(4)(2-), Al, Ca, Mg and Fe) were also measured in this study. More than 55% of non-inorganic carbon (OC+BC) in the atmosphere was detected in the aerosols with a size smaller than 1.1 microm and the concentration of non-inorganic carbon in the atmosphere showed only a faint variation during a whole year, although the concentrations of total aerosols and its chemical components exhibited a distinct variation.
Gosman, Nathaniel
For energy utilities faced with expanded jurisdictional energy efficiency requirements and pursuing demand-side management (DSM) incentive programs in the large industrial sector, performance incentive programs can be an effective means to maximize the reliability of planned energy savings. Performance incentive programs balance the objectives of high participation rates with persistent energy savings by: (1) providing financial incentives and resources to minimize constraints to investment in energy efficiency, and (2) requiring that incentive payments be dependent on measured energy savings over time. As BC Hydro increases its DSM initiatives to meet the Clean Energy Act objective to reduce at least 66 per cent of new electricity demand with DSM by 2020, the utility is faced with a higher level of DSM risk, or uncertainties that impact the costeffective acquisition of planned energy savings. For industrial DSM incentive programs, DSM risk can be broken down into project development and project performance risks. Development risk represents the project ramp-up phase and is the risk that planned energy savings do not materialize due to low customer response to program incentives. Performance risk represents the operational phase and is the risk that planned energy savings do not persist over the effective measure life. DSM project development and performance risks are, in turn, a result of industrial economic, technological and organizational conditions, or DSM risk factors. In the BC large industrial sector, and characteristic of large industrial sectors in general, these DSM risk factors include: (1) capital constraints to investment in energy efficiency, (2) commodity price volatility, (3) limited internal staffing resources to deploy towards energy efficiency, (4) variable load, process-based energy saving potential, and (5) a lack of organizational awareness of an operation's energy efficiency over time (energy performance). This research assessed the capacity
Sato, Kanna; Ito, Sachiko; Fujii, Takeo; Suzuki, Ryu; Takenouchi, Sachi; Nakaba, Satoshi; Funada, Ryo; Sano, Yuzou; Kajita, Shinya; Kitano, Hidemi; Katayama, Yoshihiro
2010-11-01
We recently reported that the cwa1 mutation disturbed the deposition and assembly of secondary cell wall materials in the cortical fiber of rice internodes. Genetic analysis revealed that cwa1 is allelic to bc1, which encodes glycosylphosphatidylinositol (GPI)-anchored COBRA-like protein with the highest homology to Arabidopsis COBRA-like 4 (COBL4) and maize Brittle Stalk 2 (Bk2). Our results suggested that CWA1/BC1 plays a role in assembling secondary cell wall materials at appropriate sites, enabling synthesis of highly ordered secondary cell wall structure with solid and flexible internodes in rice. The N-terminal amino acid sequence of CWA1/BC1, as well as its orthologs (COBL4, Bk2) and other BC1-like proteins in rice, shows weak similarity to a family II carbohydrate-binding module (CBM2) of several bacterial cellulases. To investigate the importance of the CBM-like sequence of CWA1/BC1 in the assembly of secondary cell wall materials, Trp residues in the CBM-like sequence, which is important for carbohydrate binding, were substituted for Val residues and introduced into the cwa1 mutant. CWA1/BC1 with the mutated sequence did not complement the abnormal secondary cell walls seen in the cwa1 mutant, indicating that the CBM-like sequence is essential for the proper function of CWA1/BC1, including assembly of secondary cell wall materials.
The causes of the Roman civil war, 49 B.C.: Julia and Crassus
Directory of Open Access Journals (Sweden)
A. P. Koval
2016-03-01
Full Text Available The title of the article is ‘The Causes of the Roman Civil War, 49 B.C.: Julia and Crassus’. The purpose of the article was to examine the theory, provided by ancient writers, according to which deaths of Julia and Marcus Licinius Crassus are interpreted as one of the causes of the Roman Civil war in 49 B.C. This theory wasn’t an object of the special research and many modern scholars take on trust accounts of the ancient writers, following Mommsen’s view. According to the sources, Julia was the «pledge of consent» between Pompey and Caesar, while Crassus was their mediator. In contrast, E. Gruen believed, that the deaths of Julia and Crassus had not been so ruinous for relations of Pompey and Caesar. For example, Julia had died in 54 B.C., but the Civil war started in 49 B.C. – according to the sources, it should have been started immediately after Julia’s death. The study tested, that the main source of such interpretation of Julia’s and Crassus’ deaths was Lucan’s ‘Pharsalia’. Such characterization of those is the most full in his poem. Textual analysis proves, that Lucan’s poem was a source of this theory for many other ancient writers. For example, Plutarch’s and Appian’s characterizations of Julia and Crassus are the same, as in ‘Pharsalia’, considering the translation from Latin to Greek. Further examination established that Lucan was the main propagandist of such characterization, but he wasn’t its author. Julia was described as the «pledge of consent» in writings of Velleius Paterculus and Valerius Maximus that had been written in a few decades before ‘Pharsalia’. However, there is no such characterization in writings of Cicero and Livius, who were the eyewitnesses of the Civil war. As a result, it was concluded, that such characterization had been formed among Roman writers of the early principate and retailed by Lucan. As a conclusion it must be emphasized, that close study of the ancient
Introducing the CEFR in BC: Questions and Challenges
Directory of Open Access Journals (Sweden)
Meike Wernicke
2011-12-01
Full Text Available Abstract In 2010, the British Columbia Ministry of Education introduced an updated version of its international languages curricula titled Additional Languages (AL draft curriculum which set out a clear articulation of the province's language education as conceived and developed over the past 15 years. The strength of the draft curriculum lies in its emphasis on plurilingualism as a guiding pedagogical principle, a response to recent recommendations of the Council of Ministers of Canada to adopt the Common European Framework of Reference for Languages (CEFR in a Canadian context. The CEFR framing has been retained in the latest revision of the AL draft curriculum, the 2011 French curriculum, which has recently replaced the original 2010 draft document. Despite this latest revision, the original AL draft curriculum maintains historical relevance for language education in BC by highlighting the province’s linguistic diversity and the choice to value more than one language in different ways. In its original conception, the AL draft curriculum operationalized the recognition of linguistic plurality within an officially bilingual context and thus represented a concrete attempt to acknowledge the very dynamic language practices of British Columbians. In this paper we examine how the draft curriculum sought to negotiate historical, political, cultural, and linguistic questions with regard to language education in BC, by first considering the historical development of BC language education within the context of official bilingualism, followed by a thematic discourse analysis of the document text to highlight the clearest yet also most challenging articulation of plurilingual language education in BC to date. Résumé En 2010, le ministère de l’Éducation de Colombie-Britannique a introduit une version révisée de ses programmes de langues internationales, sous la forme d'un projet de curriculum pour les langues additionnelles qui définissait une
Tracing the 5000-year recorded history of inorganic thin films from ˜3000 BC to the early 1900s AD
Greene, J. E.
2014-12-01
Gold is very likely the first metal discovered by man, more than 11 000 years ago. However, unlike copper (˜9000 BC), bronze (˜3500 BC), and wrought iron (˜2500-3000 BC), gold is too soft for fabrication of tools and weapons. Instead, it was used for decoration, religious artifacts, and commerce. The earliest documented inorganic thin films were gold layers, some less than 3000 Å thick, produced chemi-mechanically by Egyptians approximately 5000 years ago. Examples, gilded on statues and artifacts (requiring interfacial adhesion layers), were found in early stone pyramids dating to ˜2650 BC in Saqqara, Egypt. Spectacular samples of embossed Au sheets date to at least 2600 BC. The Moche Indians of northern Peru developed electroless gold plating (an auto-catalytic reaction) in ˜100 BC and applied it to intricate Cu masks. The earliest published electroplating experiments were ˜1800 AD, immediately following the invention of the dc electrochemical battery by Volta. Chemical vapor deposition (CVD) of metal films was reported in 1649, atmospheric arc deposition of oxides (Priestley) in the mid-1760s, and atmospheric plasmas (Siemens) in 1857. Sols were produced in the mid-1850s (Faraday) and sol-gel films synthesized in 1885. Vapor phase film growth including sputter deposition (Grove, 1852), vacuum arc deposition ("deflagration," Faraday, 1857), plasma-enhanced CVD (Barthelot, 1869) and evaporation (Stefan, Hertz, and Knudsen, 1873-1915) all had to wait for the invention of vacuum pumps whose history ranges from ˜1650 for mechanical pumps, through ˜1865 for mercury pumps that produce ballistic pressures in small systems. The development of crystallography, beginning with Plato in 360 BC, Kepler in 1611, and leading to Miller indices (1839) for describing orientation and epitaxial relationships in modern thin film technology, was already well advanced by the 1780s (Haüy). The starting point for the development of heterogeneous thin film nucleation theory was
Observation of an excited Bc+/- meson state with the ATLAS detector
Czech Academy of Sciences Publication Activity Database
Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav
2014-01-01
Roč. 113, č. 21 (2014), "2120041"-"212004-5" ISSN 0031-9007 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : error * statistical * p p * scattering * B/c+ * ATLAS * meson * mass difference * CERN LHC Coll * excited state * ground state * J/psi(3100) * pi+ pi- Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.512, year: 2014
New Evidence for a Substellar Luminosity Problem: Dynamical Mass for the Brown Dwarf Binary Gl 417BC
Dupuy, Trent J.; Liu, Michael C.; Ireland, Michael J.
2014-08-01
We present new evidence for a problem with cooling rates predicted by substellar evolutionary models that implies that model-derived masses in the literature for brown dwarfs and directly imaged planets may be too high. Based on our dynamical mass for Gl 417BC (L4.5+L6) and a gyrochronology system age from its young, solar-type host star, commonly used models predict luminosities 0.2-0.4 dex lower than we observe. This corroborates a similar luminosity-age discrepancy identified in our previous work on the L4+L4 binary HD 130948BC, which coincidentally has nearly identical component masses (≈50-55 M Jup) and age (≈800 Myr) as Gl 417BC. Such a luminosity offset would cause systematic errors of 15%-25% in model-derived masses at this age. After comparing different models, including cloudless models that should not be appropriate for mid-L dwarfs like Gl 417BC and HD 130948BC but actually match their luminosities better, we speculate the observed overluminosity could be caused by opacity holes (i.e., patchy clouds) in these objects. Moreover, from hybrid substellar evolutionary models that account for cloud disappearance, we infer the corresponding phase of overluminosity may extend from a few hundred million years up to a few gigayears and cause masses to be overestimated by up to 25%, even well after clouds disappear from view entirely. Thus, the range of ages and spectral types affected by this potential systematic shift in luminosity evolution would encompass most known directly imaged gas-giants and field brown dwarfs. Data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.
Directory of Open Access Journals (Sweden)
P. S. Praveen
2012-01-01
Full Text Available Project Surya has documented indoor and outdoor concentrations of black carbon (BC from traditional biomass burning cook stoves in a rural village located in the Indo-Gangetic Plains (IGP region of N. India from November 2009–September 2010. In this paper, we systematically document the link between local scale aerosol properties and column averaged regional aerosol optical properties and atmospheric radiative forcing. We document observations from the first phase of Project Surya and estimate the source dependent (biomass and fossil fuels aerosol optical properties from local to regional scale. Data were collected using surface based observations of BC, organic carbon (OC, aerosol light absorption, scattering coefficient at the Surya village (SVI_1 located in IGP region and integrated with satellite and AERONET observations at the regional scale (IGP. The daily mean BC concentrations at SVI_1 showed a large increase of BC during the dry season (December to February with values reaching 35 μg m−3. Space based LIDAR data revealed how the biomass smoke was trapped within the first kilometer during the dry season and extended to above 5 km during the pre-monsoon season. As a result, during the dry season, the variance in the daily mean single scattering albedo (SSA, the ratio of scattering to extinction coefficient, and column aerosol optical properties at the local IGP site correlated (with slopes in the range of 0.85 to 1.06 and R2>0.4 well with the "IGP_AERONET" (mean of six AERONET sites. The statistically significant correlation suggested that in-situ observations can be used to derive spatial mean forcing, at least for the dry season. The atmospheric forcing due to BC and OC exceeded 20 Wm−2 during all months from November to May, supporting the deduction that elimination of cook stove smoke emissions through clean cooking technologies will likely have a major positive impact not only on human
Energy Technology Data Exchange (ETDEWEB)
Shoveller, J.; Goldenberg, S.; Koehoorn, M.; Ostry, A. [British Columbia Univ., Vancouver, BC (Canada). Dept. of Health Care and Epidemiology
2007-03-15
Sexually transmitted infection (STI) rates in Canada are high and rising, especially amongst youth living in northern areas of British Columbia (BC). There is a strong public health impetus to promote STI testing among the younger populations. Northeastern BC is undergoing rapid changes associated with the in-migration of young people attracted by the booming oil and gas industries. The northeast contains the largest proportion of the BC population directly employed by these industries. These activities have progressed at an unprecedented pace, with many of the region's reserves untapped, positioning the northeast for major supply growth, which may have serious health impacts such as health service capacities and sexual behavior of migratory populations yet to be addressed. Little is known about the sexual health impacts of the oil/gas industry in North America. This report presented a study that was conducted in Fort St. John, which is the centre of Northeastern BC's oil and gas industry. The study documented STI rates and service provision patterns, as well as eight weeks of ethnographic fieldwork including observations and informal conversations with youth, health, education, and social service providers, and other community members. Participants were asked to describe their experiences with sexual health and STI testing, and completed a brief socio-demographic survey. The report provided background information on the study and discussed the methods as well as the results. It was concluded that service providers and youth indicated that the current models of service provision did not facilitate the establishment of rapport and shut down opportunities for youth to ask questions, seek advice, and/or develop skills related to STI prevention. 12 refs., 2 figs.
Roman Policies towards Antiochus III and the Greeks from Winter 197/196 B.C. to Autumn 196 B.C.
Directory of Open Access Journals (Sweden)
Deutschmann, Eike Hellmut
2012-01-01
Full Text Available In the Second Macedonian War (200-196 B.C., the res publica reduced the strength of the enemy King Philip V apparently to establish a new political order in Southern Balkans: Assumedly a pro-Roman balance of forces should prevail there, untainted by influence of another major power. A particular senatorial policy towards the Greeks probably did not exist before the fighting in Hellas came to an end in summer 197 B.C. In the same year, the Seleucid king Antiochus III brought large parts of the west coast of Asia Minor under control and set about crossing the Hellespont. Rome subsequently stylized itself as the guardian of freedom for the Greeks living in Hellas and Asia Minor. The statesmen of the res publica could have perceived Antiochus’ expansion as a threat to the mentioned new order. Therefore, the Roman Policy of Freedom was possibly applied primarily to take action against the Seleucid king. Die res publica verminderte im Zweiten Makedonischen Krieg (200-196 a.c. die Macht des gegnerischen Königs Philipp V - anscheinend um eine neue politische Ordnung im südlichen Balkanraum zu etablieren: Vermutlich sollte dort ein romfreundliches Kräftegleichgewicht vorherrschen, auf das keine andere Großmacht Einfluß hat. Eine speziell an die Griechen gerichtete Politik seitens des römischen Senats gab es wahrscheinlich nicht vor Ende der Kampfhandlungen in Hellas im Sommer 197 a.c. In dem Jahr erweiterte der seleukidische König Antiochos III. seinen Einflussbereich auf große Teile der kleinasiatischen Westküste und schickte sich an, den Hellespont zu überqueren. Rom stilisierte sich in der Folgezeit zum Freiheitsgarant der in Hellas und Kleinasien lebenden Griechen. Antiochos Expansion könnte von den Staatsmännern der res publica als Bedrohung der genannten neuen Ordnung angesehen worden sein. Demzufolge wurde die römische Freiheitspolitik möglicherweise in erster Linie angewendet, um gegen den seleukidischen König vorzugehen.
The fall of a meteorite at Aegos Potami in 467/6 BC
Theodossiou, E. Th; Niarchos, P. G.; Manimanis, V. N.; Orchiston, W.
2002-12-01
Cosmic catastrophes have been associated from time to time with the fall of celestial objects to Earth. From the writings of ancient Greek authors we know that during the second year of the 78th Olympiad, that is the year corresponding to 467/6 BC, a very large meteorite fell at Aegos Potami, in the Gallipoli Peninsula (in Eastern Thrace). This event was predicted by Anaxagoras, and the meteorite was worshipped by the Cherronesites until at least the first Century AD. The fall of the Aegos Potami Meteorite was not associated with any cosmic catastrophe, but it was believed to have foretold the terminal defeat of the Athenians by the Spartans in 405 BC near Aegos Potami, which brought to an end the Peloponnesian War in favour of Sparta. In addition, according to the Latin author Pliny the Elder, during the first century AD the inhabitants of Avydus in Asia Minor worshipped another meteorite that was displayed in the city's sports centre, The fall of this meteorite is also said to have been predicted by Anaxagoras.
Energy Technology Data Exchange (ETDEWEB)
Yongchun, Xiang [Institute of Nuclear Physics and Chemistry, China and Academy of Engineer Physics, Mianyang 621900 (China); School of Physics, Peking University, Beijing 100080 (China); Tieshuan, Fan [School of Physics, Peking University, Beijing 100080 (China); Chuanfei, Zhang; Fei, Luo; Qian, Wang; Rende, Ze [Institute of Nuclear Physics and Chemistry, China and Academy of Engineer Physics, Mianyang 621900 (China); Qingpei, Xiang, E-mail: xiangqingpei@163.com [Institute of Nuclear Physics and Chemistry, China and Academy of Engineer Physics, Mianyang 621900 (China)
2017-03-01
The phoswich coincidence detector is used to verify the CTBT treaty by measuring radioxenon and as such needs to possess high detection sensitivity. However, residual xenon adsorbed onto the surface of β detectors greatly influences subsequent measurements of weak samples. In this study, we investigate the adsorption-desorption behavior of xenon on BC-404 scintillator surfaces with different coating thicknesses using the soaking method. The results present the desorption behavior of xenon on a BC-404 surface for the first time. The calculated adsorption capacity for an uncoated surface is consistent with that from previous studies. However, due to factors such as limitations in coating technology, the effectiveness of coating on reducing the “memory effect” of the detector was poor. The proposed method is suitable for studying the adsorption-desorption behavior of gases on solid surfaces due to its simplicity and flexibility. - Highlights: • We investigate the adsorption-desorption of xenon on coated BC-404 surfaces. • The calculated adsorption capacity on an uncoated surface agrees with other results. • The method can be used to simulate xenon adsorption in phoswich detectors.
A vertex including emission of spin fields for an arbitrary bc system
International Nuclear Information System (INIS)
Di Vecchia, P.; Madsen, R.A.; Roland, K.
1990-01-01
We construct the (N+2M) Point Vertex involving the emission of N Neveu-Schwarz and 2M Ramond states for a bosonic and fermionic bc system with a bockground charge Q. From it one can compute correlation functions on the sphere involving any number of spin fields. We show in detail that the vertex satisfies overlap conditions. (orig.)
Search for $B_c^+$ decays to the $p\\overline p\\pi^+$ final state
Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hongming, Li; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusardi, Nicola; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Niess, Valentin; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavomira; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhong, Liang; Zhukov, Valery; Zucchelli, Stefano
2016-08-10
A search for the decays of the $B_c^+$ meson to $p\\overline p\\pi^+$ is performed for the first time using a data sample corresponding to an integrated luminosity of 3.0 $\\mathrm{fb}^{-1}$ collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of $7$ and $8$ TeV. No signal is found and an upper limit, at 95$\\%$ confidence level, is set, $\\frac{f_c}{f_u}\\times\\mathcal{B}(B_c^+\\to p\\overline p\\pi^+)<3.6\\times10^{-8}$ in the kinematic region $m(p\\overline p)<2.85\\mathrm{\\,Ge\\kern -0.1em V\\!/}c^2$, $p_{\\rm T}(B)<20\\mathrm{\\,Ge\\kern -0.1em V\\!/}c$ and $2.0< {y}(B)<4.5$, where $\\mathcal{B}$ is the branching fraction and $f_c$ ($f_u$) is the fragmentation fraction of the $b$ quark into a $B_c^+$ ($B^+$) meson.
Findings of negligence followed communication lapses in BC aneurysm case
Capen, K
1997-01-01
Negligence is sometimes established on the basis of lapses in communication and patient care management that, in hindsight, could have been avoided. A recent BC court case concerned a patient who died because of a ruptured aneurysm. A Supreme Court judge found that some of the physicians involved had failed in their duty to diagnose the patient's condition properly, or failed to communicate to one another significant signs of the patient's illness, and failed to refer him in time to the medic...
Ji, Weina; Lytken, Else
2010-01-01
This thesis contains two main aspects of my research work towards physics in proton-proton collisions in the ATLAS experiment at the LHC. First, a Monte Carlo based analysis of the event yield and the mass shape for the ground state of the B_c meson in the hadronic decay channel B_c -> J/psi + pi was studied. The selection criteria have been optimised, the total number of signal events, and the significance of the observation have been estimated for the detector configuration and backgrounds ...
Causes of death among the Caesars (27 BC-AD 476) | Retief | Acta ...
African Journals Online (AJOL)
The Roman Empire was ruled by 77 emperors between 27 BC and AD 476 (503 years); 18 (23,4%) of them held sway during the Early Empire (27 BC–AD 193, 220 years), and 59 (76,6%) during the Late Empire (193-476, 283 years). On the average emperors in the Early Empire ruled for a longer period (12,7 years as ...
Measurement of Bc+ Production in Proton-Proton Collisions at √[s]=8 TeV.
Aaij, R; Adeva, B; Adinolfi, M; Affolder, A; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Anderson, J; Andreassen, R; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Borsato, M; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; Brett, D; Britsch, M; Britton, T; Brodzicka, J; Brook, N H; Brown, H; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Campana, P; Campora Perez, D; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chefdeville, M; Chen, S; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collazuol, G; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Corvo, M; Counts, I; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dalseno, J; David, P; David, P N Y; Davis, A; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Dean, C-T; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Donleavy, S; Dordei, F; Dorigo, M; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dreimanis, K; Dujany, G; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Ely, S; Esen, S; Evans, H-M; Evans, T; Falabella, A; Färber, C; Farinelli, C; Farley, N; Farry, S; Fay, R; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fol, P; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Fu, J; Furfaro, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; García Pardiñas, J; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gavardi, L; Gazzoni, G; Geraci, A; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianelle, A; Gianì, S; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Henry, L; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Hussain, N; Hutchcroft, D; Hynds, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Karodia, S; Kelsey, M; Kenyon, I R; Ketel, T; Khanji, B; Khurewathanakul, C; Klaver, S; Klimaszewski, K; Kochebina, O; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanfranchi, G; Langenbruch, C; Langhans, B; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Likhomanenko, T; Liles, M; Lindner, R; Linn, C; Lionetto, F; Liu, B; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lowdon, P; Lucchesi, D; Luo, H; Lupato, A; Luppi, E; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Malinin, A; Manca, G; Mancinelli, G; Mapelli, A; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marino, P; Märki, R; Marks, J; Martellotti, G; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Moggi, N; Molina Rodriguez, J; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Morris, A-B; Mountain, R; Muheim, F; Müller, K; Mussini, M; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, C J G; Orlandea, M; Otalora Goicochea, J M; Otto, A; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Pistone, A; Playfer, S; Plo Casasus, M; Polci, F; Poluektov, A; Polyakov, I; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Price, E; Price, J D; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rama, M; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redi, F; Reichert, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rotondo, M; Rouvinet, J; Ruf, T; Ruiz, H; Ruiz Valls, P; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Silva Coutinho, R; Simi, G; Sirendi, M; Skidmore, N; Skillicorn, I; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Steinkamp, O; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Stroili, R; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Tellarini, G; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Todd, J; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wilkinson, G; Williams, M P; Williams, M; Wilschut, H W; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L
2015-04-03
Production of Bc+ mesons in proton-proton collisions at a center-of-mass energy of 8 TeV is studied with data corresponding to an integrated luminosity of 2.0 fb-1 recorded by the LHCb experiment. The ratio of production cross sections times branching fractions between the Bc+→J/ψπ+ and B+→J/ψK+ decays is measured as a function of transverse momentum and rapidity in the regions 0
DEFF Research Database (Denmark)
Kaszuba, K.; Postila, P. A.; Cramariuc, O.
2013-01-01
studied in large-scale classical molecular dynamics (MD) simulations. In part, this is due to lack of suitable force field parameters, centered atomic point charges in particular, for the complex's prosthetic redox centers. Accurate redox center charges are needed to depict realistically the inter-molecular...... interactions at different redox stages of the cyt bc(1) complex. Accordingly, here we present high-precision atomic point charges for the metal centers of the cyt bc(1) complex of Rhodobacter capsulatus derived from extensive density functional theory calculations, fitted using the restrained electrostatic...
Social complexity in the third millennium cal BC in southern Portugal
Soares, Joaquina
2016-01-01
The starting point of this paper is the extensive archaeological fieldwork developed at the Chalcolithic fortification of Porto das Carretas on the left bank of the Middle Guadiana River (Soares, 2013). The well-preserved stratigraphy and correlated radiocarbon dates of Porto das Carretas enabled a new and deep insight into the third millennium cal BC, displaying environmental, economic and social transformations from the first to the second half of the millenium. Furhermore, the integration ...
Study of n-γ discrimination with NE213 and BC501A liquid scintillators of different size
International Nuclear Information System (INIS)
Moszynski, M.; Costa, G.J.; Guillaume, G.; Heusch, B.; Huck, A.; Mouatassim, S.
1994-01-01
A comparative study of n-γ discrimination by the digital charge comparison method was carried out for NE213 and BC501A scintillators of different size coupled to a 130 mm diameter XP4512B photomultiplier. Particularly, the scintillators of diameter 50 mmx50 mm size are compared with those of 4 l volume (160 mm in diameter and 200 mm in depth). The figure of merit, M, of 3.81 measured with the diameter 50 mmx50 mm BC501A scintillator at 1 MeV energy lost by recoil electrons, is much better than M of 2.05 as observed with the 4 l volume cell. This is the effect of the reduced photoelectron yield by about 50% determined for the 4 l volume scintillator. Moreover, the slowing down of the light pulse and multiscattering of neutrons have a further influence on the lowering of the M factor. The study of the M factor versus the initial delay and width of the gate set at the slow component showed that the early light of the slow component represented often by the intermediate component with the decay time constant of about 30 ns is of great importance for the n-γ discrimination. Particularly, for the 4 l volume cells it is sufficient to limit the width of the gate at the slow component to about 300 ns. The comparison of the NE213 and BC501A scintillators showed that the BC501A scintillator exhibits a larger light yield evidently observed for the 4 l volume cell and thus giving a better n-γ discrimination. ((orig.))
Half metallicity in bare BC{sub 2}N nanoribbons with zigzag edges
Energy Technology Data Exchange (ETDEWEB)
Li, Hong, E-mail: lihong@ncut.edu.cn [College of Mechanical and Material Engineering, North China University of Technology, Beijing 100144 (China); Xiao, Xiang; Tie, Jun [College of Mechanical and Material Engineering, North China University of Technology, Beijing 100144 (China); Lu, Jing [State Key Laboratory of Mesoscopic Physics and Department of Physics, Peking University, Beijing 100871 (China)
2017-06-09
We study the electronic and magnetic properties of bare zigzag BC{sub 2}N nanoribbons (ZBC{sub 2}NNRs) by using first principles calculations. The ZBC{sub 2}NNRs which we studied are assigned to four edge types, and we carefully examine the size effect and edge magnetic coupling orders. We find that the N edge and the C edge adjacent to N atoms have a ferromagnetic coupling, while the B edge and the C edge adjacent to B atoms have an anti-ferromagnetic coupling. These novel properties arise from the unsaturated edge with specific edge determined magnetic moment distribution. All the investigated ribbons exhibit magnetic ground states with room-temperature accessible half-metallic character, irrespective of the ribbon width. Our results suggest that ZBC{sub 2}NNRs can have potential applications in spintronics. - Highlights: • DFT study on bare zigzag BC{sub 2}N nanoribbons (ZBC{sub 2}NNRs). • All the studied bare ZBC{sub 2}NNRs are half-metals at room temperature. • The half-metal characters come from specific spin couplings on the edge atoms. • We predict bare ZBC{sub 2}NNRs as practical candidate for spintronics.
13C NMR spectra and bonding situation of the B-C bond in alkynylboranes
International Nuclear Information System (INIS)
Yamamoto, Yoshinori; Moritani, Ichiro
1975-01-01
13 C NMR spectra of boron substituted alkynes reveal that the β-carbon is deshielded by ca. 21 ppm by a B(O-n-C 4 H 9 ) 2 group. This clearly indicates the presence of a B-C π-bonding in alkynylboranes. (auth.)
Santorini eruption radiocarbon dated to 1627-1600 B.C.
Friedrich, Walter L; Kromer, Bernd; Friedrich, Michael; Heinemeier, Jan; Pfeiffer, Tom; Talamo, Sahra
2006-04-28
Precise and direct dating of the Minoan eruption of Santorini (Thera) in Greece, a global Bronze Age time marker, has been made possible by the unique find of an olive tree, buried alive in life position by the tephra (pumice and ashes) on Santorini. We applied so-called radiocarbon wiggle-matching to a carbon-14 sequence of tree-ring segments to constrain the eruption date to the range 1627-1600 B.C. with 95.4% probability. Our result is in the range of previous, less precise, and less direct results of several scientific dating methods, but it is a century earlier than the date derived from traditional Egyptian chronologies.
Jiang, Yan-Ling; Bai, Wen-Wei; Qu, Fan-Wei; Ma, Hua; Jiang, Run-Sheng; Shen, Bao-Sheng
2016-03-01
This study aimed to investigate the biological characterization of HIV type 1 (HIV-1) CRF07_BC infection among men who have sex with men (MSM). From November 2011 to November 2013, a total of 66 blood samples were collected from MSM with acute HIV-1 infection with CRF07_BC subgroup strains. Deletion in the gag p6 region was detected by sequence alignment and comparative analysis. Peripheral blood mononuclear cells (PBMCs) of HNXX1301-1307 samples were separated by density gradient centrifugation. Nested polymerase chain reaction (nPCR) was used to amplify the viral DNA. The near full-length HIV-1 DNA products were ligated to the long terminal repeat (LTR) vector plasmid (07BCLTR) to construct a full-length HIV clone. The molecular clone was transfected into HEK-293T cells, TZM-b1 cells and patients' PBMCs. The pregenome of an infectious molecular clone of HIV-1 (pNL4-3) was amplified, and a subclone with CRF07_BC was developed to construct the full-length chimeric molecular clone pNL4-3/07BCLTR. Detection of p24 antigen and luciferase activity was used to measure the in vitro infectivity of pNL4-3/07BCLTR. Among the 66 MSM patients infected with CRF07_BC strains, deletion mutations of the Gag P6 proteins were found in 7 of 18CRF07_BC strains; deletion mutations of 2-13 amino acids in different regions were discovered in 6 strains; and the remaining 42 strains did not show deletions. Seven strains with amino acids deficiency in the P6 protein accounted for 27% of all strains and 75% of all deletion genotype strains. A total of 186 full-length molecular clones of CRF07_BC were constructed. There were 5, 9, 10 and 11 clones of HNXX1302, HNXX1304, HNXX1305 and HNXX1306 that resulted in p24-positive supernatant when transfected into HEK-293T cells. Full-length clones of HNXX1302, HNXX1304, HNXX1305 and HNXX1306 showed slight infection in the transfected TZM-b1 cells, as judged by the fluorescence values of TZM-b1 cells 48h post-transfection. However, we were unable to
Directory of Open Access Journals (Sweden)
Sungroul Kim
2017-11-01
Full Text Available We evaluated the spatiotemporal distributions of black carbon (BC and particulate matters with aerodynamic diameters of less than 2.5 m (PM2.5 concentrations at urban diesel engine emission (DEE hotspots of South Korea. Concentrations of BC and PM2.5 were measured at the entrance gate of two diesel bus terminals and a train station, in 2014. Measurements were conducted simultaneously at the hotspot (Site 1 and at its adjacent, randomly selected, residential areas, apartment complex near major roadways, located with the same direction of 300 m (Site 2 and 500 m (Site 3 away from Site 1 on 4 different days over the season, thrice per day; morning (n = 120 measurements for each day and site, evening (n = 120, and noon (n = 120. The median (interquartile range PM2.5 ranged from 12.6 (11.3–14.3 to 60.1 (47.0–76.0 μg/m3 while those of BC concentrations ranged from 2.6 (1.9–3.7 to 6.3 (4.2–10.3 μg/m3. We observed a strong relationship of PM2.5 concentrations between sites (slopes 0.89–0.9, the coefficient of determination 0.89–0.96 while the relationship for BC concentrations between sites was relatively weak (slopes 0.76–0.85, the coefficient of determination 0.54–0.72. PM2.5 concentrations were changed from 4% to 140% by unit increase of BC concentration, depending on site and time while likely supporting the necessity of monitoring of BC as well as PM2.5, especially at urban DEE related hotspot areas.
Rai, Avinash Chandra; Singh, Major; Shah, Kavita
2013-01-01
Efficient genetic transformation of cotyledonary explants of tomato (Solanum lycopersicum, cv. H-86, Kashi vishesh) was obtained. Disarmed Agrobacterium tumifaciens strain GV 3101 was used in conjugation with binary vector pBinAR containing a construct consisting of the coding sequence of the BcZAT12 gene under the regulatory control of the stress inducible Bclea1a promoter. ZAT12 encodes a C₂H₂ zinc finger protein which confers multiple abiotic stress tolerance to plants. Integration of ZAT12 gene into nuclear genome of individual kanamycin resistant transformed T₀ tomato lines was confirmed by Southern blot hybridization with segregation analysis of T(1) plants showing Mendelian inheritance of the transgene. Expression of ZAT12 in drought-stressed transformed tomato lines was verified in T₂ generation plants using RT-PCR. Of the six transformed tomato lines (ZT1-ZT6) the transformants ZT1 and ZT5 showed maximum expression of BcZAT12 gene transcripts when exposed to 7 days drought stress. Analysis of relative water content (RWC), electrolyte leakage (EL), chlorophyll colour index (CCI), H₂O₂ level and catalase activity suggested that tomato BcZAT12 transformants ZT1 and ZT5 have significantly increased levels of drought tolerance. These results suggest that BcZAT12 transformed tomato cv. H-86 has real potential for molecular breeding programs aimed at augmenting yield of tomato in regions affected with drought stress. Copyright © 2012 Elsevier Ltd. All rights reserved.
De Groef, An; Van Kampen, Marijke; Moortgat, Peter; Anthonissen, Mieke; Van den Kerckhove, Eric; Christiaens, Marie-Rose; Neven, Patrick; Geraerts, Inge; Devoogdt, Nele
2018-01-01
To investigate the concurrent, face and content validity of an evaluation tool for Myofascial Adhesions in Patients after Breast Cancer (MAP-BC evaluation tool). 1) Concurrent validity of the MAP-BC evaluation tool was investigated by exploring correlations (Spearman's rank Correlation Coefficient) between the subjective scores (0 -no adhesions to 3 -very strong adhesions) of the skin level using the MAP-BC evaluation tool and objective elasticity parameters (maximal skin extension and gross elasticity) generated by the Cutometer Dual MPA 580. Nine different examination points on and around the mastectomy scar were evaluated. 2) Face and content validity were explored by questioning therapists experienced with myofascial therapy in breast cancer patients about the comprehensibility and comprehensiveness of the MAP-BC evaluation tool. 1) Only three meaningful correlations were found on the mastectomy scar. For the most lateral examination point on the mastectomy scar a moderate negative correlation (-0.44, p = 0.01) with the maximal skin extension and a moderate positive correlation with the resistance versus ability of returning or 'gross elasticity' (0.42, p = 0.02) were found. For the middle point on the mastectomy scar an almost moderate positive correlation with gross elasticity was found as well (0.38, p = 0.04) 2) Content and face validity have been found to be good. Eighty-nine percent of the respondent found the instructions understandable and 98% found the scoring system obvious. Thirty-seven percent of the therapists suggested to add the possibility to evaluate additional anatomical locations in case of reconstructive and/or bilateral surgery. The MAP-BC evaluation tool for myofascial adhesions in breast cancer patients has good face and content validity. Evidence for good concurrent validity of the skin level was found only on the mastectomy scar itself.
Ham, Walter; Vijayan, Abhilash; Schulte, Nico; Herner, Jorn D.
2017-10-01
This study was designed to estimate and compare the air pollution exposures experienced by commuters in six common transportation modes utilized by California residents, and to evaluate the impact of practical exposure mitigation strategies in reducing commute exposures. We measured concentrations of fine particle matter (PM2.5), black carbon (BC), and ultrafine particles (UFP) for 161 commutes between April 2014 and November 2015 in Sacramento, CA. We collected measurements for six modes including single occupancy vehicles, high occupancy vehicles (multiple occupants), buses, light rail, train, and bicycling. The largest average concentrations for most pollutants were measured during train commutes and the lowest average concentrations were observed during light-rail commutes. Mitigation options were explored for personal vehicles, bicycling, and train commute modes. We found that ventilation settings of personal vehicles can reduce in-vehicle PM2.5, BC, and UFP concentrations by up to 75%. Similarly, bicycle route choice can reduce exposures by 15-75% with the lowest concentrations observed during commutes on dedicated bicycle paths away from traffic sources. Train commuters experienced UFP concentrations an order of magnitude greater when the locomotive engine was pulling the rail cars versus pushing the rail cars. We found that UFP concentrations during bus, bicycling, and train commutes were 1.6-5.3 times greater than personal vehicle commutes, while light rail commutes had 30% lower UFP concentrations than personal vehicle commutes. The largest exposure per mile occurred during bicycle commutes with PM2.5, BC, and UFP exposures of 1.312 μg/mile, 0.097 μg/mile, and 3.0 × 109 particles/mile, respectively. Train commutes experienced the largest exposure per mile of all of the combustion-derived transportation commute modes. BC accounted for 5-20% of total PM mass across all commute modes with an average fraction of ∼7% of PM2.5.
Sinkhole investigated at B.C. Hydro's Bennett Dam
International Nuclear Information System (INIS)
Anon.
1996-01-01
The cause of a sinkhole which appeared in a roadway crossing an earth filled dam in B. C., was discussed. The hole measured 6 ft. across and 20 ft. deep, and occurred in B.C. Hydro's W.A.C. Bennett Dam which measures 600 ft. high, 2,600 ft. wide at the base and 35 ft. wide at the crest. The cause of the sinkhole is not known, but it is believed that a weakness in the dam may have found its way to the surface via a pipe connected to a bedrock settlement gauge buried within the dam. Sonar and ground penetrating radar were used to examine the area. The hole has been filled with gravel and monitoring continues. Experts do not anticipate immediate risk of dam failure. 1 fig
Association Study of MiR-34b/c Genetic Variation and Ulcerative Colitis in Guilan Province
Directory of Open Access Journals (Sweden)
Zeynab Hosseinpour
2017-04-01
Full Text Available Abstract Background: Ulcerative colitis (UC is a chronic disease that specifically affects the mucosa of the rectum and colon. The pathogenesis of UC is not well defined, but it is proposed that genetic and environmental factors result in an aberrant immune response to a subset of commensal enteric bacteria.The aim of this study was to investigate whether miR-34b/c rs4938723 T/C polymorphism is associated with UC risk. Materials and Methods: Blood samples were collected from 50 patients diagnosed with UC and 100 healthy control subjects. Genomic DNA was extracted from peripheral blood. Genetic variation of miR34b/c was determined by tetra-primers ARMS-PCR (amplification refractory mutation system-polymerase chain reaction. All statistical analyses were conducted using the MedCalc version 12.1. Results: There was a significant difference in genotype and allele distributions between cases and controls. It was observed that the CT heterozygotes had a 2.29-fold increase in risk of UC (OR=2.29, 95%CI=1.08-4.82, p=0.02. Conclusion: It is suggested that the miR34b/c (rs4938723 T>C polymorphism may be associated with the risk of UC. However, larger studies with more patients and controls are needed to confirm this result.
Cross-talk between malarial cysteine proteases and falstatin: the BC loop as a hot-spot target.
Directory of Open Access Journals (Sweden)
Srinivasan Sundararaj
Full Text Available Cysteine proteases play a crucial role in the development of the human malaria parasites Plasmodium falciparum and Plasmodium vivax. Our earlier studies demonstrated that these enzymes are equipped with specific domains for defined functions and further suggested the mechanism of activation of cysteine proteases. The activities of these proteases are regulated by a new class of endogenous inhibitors of cysteine proteases (ICPs. Structural studies of the ICPs of Trypanosoma cruzi (chagasin and Plasmodium berghei (PbICP indicated that three loops (termed BC, DE, and FG are crucial for binding to target proteases. Falstatin, an ICP of P. falciparum, appears to play a crucial role in invasion of erythrocytes and hepatocytes. However, the mechanism of inhibition of cysteine proteases by falstatin has not been established. Our study suggests that falstatin is the first known ICP to function as a multimeric protein. Using site-directed mutagenesis, hemoglobin hydrolysis assays and peptide inhibition studies, we demonstrate that the BC loop, but not the DE or FG loops, inhibits cysteine proteases of P. falciparum and P. vivax via hydrogen bonds. These results suggest that the BC loop of falstatin acts as a hot-spot target for inhibiting malarial cysteine proteases. This finding suggests new strategies for the development of anti-malarial agents based on protease-inhibitor interactions.
Radioiodination of the protein complex of the VA-MENGOC-BC vaccine
International Nuclear Information System (INIS)
Caso, R.; Lastre, M.; Alvarez, L.
1996-01-01
In this work was made the labelling of the protein complex of the vaccine VA-MEMGOC-BC with I-125 in order to study its immunological responses. These proteins were in both forms: dissolved and conjugated with polisacarids of the C-group. There were used three methods of iodination: chloramine-T iodogen and lactoperoxidase. Was found out that dissolved proteins can be iodinated using these methods with 0,1 mCi of I-125, and the obtained specific activities were similar
Impact of cruise ship emissions in Victoria, BC, Canada
Poplawski, Karla; Setton, Eleanor; McEwen, Bryan; Hrebenyk, Dan; Graham, Mark; Keller, Peter
2011-02-01
Characterization of the effects of cruise ship emissions on local air quality is scarce. Our objective was to investigate community level concentrations of fine particulate matter (PM 2.5), nitrogen dioxide (NO 2) and sulphur dioxide (SO 2) associated with cruise ships in James Bay, Victoria, British Columbia (BC), Canada. Data obtained over four years (2005-2008) at the nearest air quality network site located 3.5 km from the study area, a CALPUFF modeling exercise (2007), and continuous measurements taken in the James Bay community over a three-month period during the 2009 cruise ship season were examined. Concentrations of PM 2.5 and nitrogen oxide (NO) were elevated on weekends with ships present with winds from the direction of the terminal to the monitoring station. SO 2 displayed the greatest impact from the presence of cruise ships in the area. Network data showed peaks in hourly SO 2 when ships were in port during all years. The CALPUFF modeling analysis found predicted 24-hour SO 2 levels to exceed World Health Organization (WHO) guidelines of 20 μg m -3 for approximately 3% of 24-hour periods, with a maximum 24-hour concentration in the community of 41 μg m -3; however, the CALPUFF model underestimated concentrations when predicted and measured concentrations were compared at the network site. Continuous monitoring at the location in the community predicted to experience highest SO 2 concentrations measured a maximum 24-hour concentration of 122 μg m -3 and 16% of 24-hour periods were above the WHO standard. The 10-minute concentrations of SO 2 reached up to 599 μg m -3 and exceeded the WHO 10-minute SO 2 guideline (500 μg m -3) for 0.03% of 10-minute periods. No exceedences of BC Provincial or Canadian guidelines or standards were observed.
WR 120bb and WR 120bc: a pair of WN9h stars with possibly interacting circumstellar shells
Burgemeister, S.; Gvaramadze, V. V.; Stringfellow, G. S.; Kniazev, A. Y.; Todt, H.; Hamann, W.-R.
2013-03-01
Two optically obscured Wolf-Rayet (WR) stars have been recently discovered by means of their infrared (IR) circumstellar shells, which show signatures of interaction with each other. Following the systematics of the WR star catalogues, these stars obtain the names WR 120bb and WR 120bc. In this paper, we present and analyse new near-IR, J-, H- and K-band spectra using the Potsdam Wolf-Rayet model atmosphere code. For that purpose, the atomic data base of the code has been extended in order to include all significant lines in the near-IR bands. The spectra of both stars are classified as WN9h. As their spectra are very similar the parameters that we obtained by the spectral analyses hardly differ. Despite their late spectral subtype, we found relatively high stellar temperatures of 63 kK. The wind composition is dominated by helium, while hydrogen is depleted to 25 per cent by mass. Because of their location in the Scutum-Centaurus Arm, WR 120bb and WR 120bc appear highly reddened, A_{K_s} ≈ 2 mag. We adopt a common distance of 5.8 kpc to both stars, which complies with the typical absolute K-band magnitude for the WN9h subtype of -6.5 mag, is consistent with their observed extinction based on comparison with other massive stars in the region, and allows for the possibility that their shells are interacting with each other. This leads to luminosities of log ({textit {L}/L}_{odot }) = 5.66 and 5.54 for WR 120bb and WR 120bc, with large uncertainties due to the adopted distance. The values of the luminosities of WR 120bb and WR 120bc imply that the immediate precursors of both stars were red supergiants (RSG). This implies in turn that the circumstellar shells associated with WR 120bb and WR 120bc were formed by interaction between the WR wind and the dense material shed during the preceding RSG phase.
Honda, Harue; Gibson, Glenn R; Farmer, Sean; Keller, David; McCartney, Anne L
2011-02-01
Single-stage continuous fermentation systems were employed to examine the effects of GanedenBC(30) supplementation on the human gastrointestinal microbiota in relation to pathogen challenge in vitro. Denaturing gradient gel electrophoresis analysis demonstrated that GanedenBC(30) supplementation modified the microbial profiles in the fermentation systems compared with controls, with profiles clustering according to treatment. Overall, GanedenBC(30) supplementation did not elicit major changes in bacterial population counts in vitro, although notably higher Bcoa191 counts were seen following probiotic supplementation (compared to the controls). Pathogen challenge did not elicit significant modification of the microbial counts in vitro, although notably higher Clit135 counts were seen in the control system post-Clostridium difficile challenge than in the corresponding GanedenBC(30)-supplemented systems. Sporulation appears to be associated with the anti-microbial activity of GanedenBC(30), suggesting that a bi-modal lifecycle of GanedenBC(30)in vivo may lead to anti-microbial activity in distal regions of the gastrointestinal tract. Copyright © 2011 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Capron, J.M.
2008-01-01
The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River
Ramana, M V; Devi, Archana
2016-08-02
Significant quantities of carbon soot aerosols are emitted into pristine parts of the atmosphere by marine shipping. Soot impacts the radiative balance of the Earth-atmosphere system by absorbing solar-terrestrial radiation and modifies the microphysical properties of clouds. Here we examined the impact of black carbon (BC) on net warming during monsoon season over southern Bay-of-Bengal, using surface and satellite measurements of aerosol plumes from shipping. Shipping plumes had enhanced the BC concentrations by a factor of four around the shipping lane and exerted a strong positive influence on net warming. Compiling all the data, we show that BC atmospheric heating rates for relatively-clean and polluted-shipping corridor locations to be 0.06 and 0.16 K/day respectively within the surface layer. Emissions from maritime ships had directly heated the lower troposphere by two-and-half times and created a gradient of around 0.1 K/day on either side of the shipping corridor. Furthermore, we show that ship emitted aerosol plumes were responsible for increase in the concentration of cloud condensation nuclei (CCN) by an order of magnitude that of clean air. The effects seen here may have significant impact on the monsoonal activity over Bay-of-Bengal and implications for climate change mitigation strategies.
Directory of Open Access Journals (Sweden)
Shawn Larson
2015-06-01
Full Text Available A total of 77 giant Pacific octopus, Enteroctopus dofleini, tissue samples were collected from the Oregon Coast (OR, Neah Bay Washington (NB, Puget Sound Washington (PS and the southeast coast of Vancouver Island, British Columbia, Canada (BC for genetic analyses. A suite of eight variable microsatellite markers developed from giant Pacific octopuses were amplified in these samples to determine population diversity, structure, relatedness and paternity. The majority of loci met Hardy-Weinberg equilibrium expectations within each population. We found moderate genetic diversity (average observed heterozygosity = 0.445, range = 0.307–0.515 and average expected heterozygosity = 0.567, range = 0.506–0.696 and moderate population structuring with distinct separation of groups (FST values ranged from 0.101 between BC and PS to 0.237 between BC and NB. Several egg strings from the BC population were collected from three female octopus dens for relatedness and paternity analyses. Results suggest strong support for multiple paternity within one egg clutch with progeny sired by between two to four males.
Microglia and neurons in the hippocampus of migratory sandpipers
Directory of Open Access Journals (Sweden)
C.G. Diniz
2016-01-01
Full Text Available The semipalmated sandpiper Calidris pusilla and the spotted sandpiper Actitis macularia are long- and short-distance migrants, respectively. C. pusilla breeds in the sub-arctic and mid-arctic tundra of Canada and Alaska and winters on the north and east coasts of South America. A. macularia breeds in a broad distribution across most of North America from the treeline to the southern United States. It winters in the southern United States, and Central and South America. The autumn migration route of C. pusilla includes a non-stop flight over the Atlantic Ocean, whereas autumn route of A. macularia is largely over land. Because of this difference in their migratory paths and the visuo-spatial recognition tasks involved, we hypothesized that hippocampal volume and neuronal and glial numbers would differ between these two species. A. macularia did not differ from C. pusilla in the total number of hippocampal neurons, but the species had a larger hippocampal formation and more hippocampal microglia. It remains to be investigated whether these differences indicate interspecies differences or neural specializations associated with different strategies of orientation and navigation.
Directory of Open Access Journals (Sweden)
Szu-Wei Huang
Full Text Available The usefulness of ultra-deep pyrosequencing (UDPS for the diagnosis of HIV-1 drug resistance (DR remains to be determined. Previously, we reported an explosive outbreak of HIV-1 circulating recombinant form (CRF 07_BC among injection drug users (IDUs in Taiwan in 2004. The goal of this study was to characterize the DR of CRF07_BC strains using different assays including UDPS. Seven CRF07_BC isolates including 4 from early epidemic (collected in 2004-2005 and 3 from late epidemic (collected in 2008 were obtained from treatment-naïve patient's peripheral blood mononuclear cells. Viral RNA was extracted directly from patient's plasma or from cultural supernatant and the pol sequences were determined using RT-PCR sequencing or UDPS. For comparison, phenotypic drug susceptibility assay using MAGIC-5 cells (in-house phenotypic assay and Antivirogram were performed. In-house phenotypic assay showed that all the early epidemic and none of the late epidemic CRF07_BC isolates were resistant to most protease inhibitors (PIs (4.4-47.3 fold. Neither genotypic assay nor Antivirogram detected any DR mutations. UDPS showed that early epidemic isolates contained 0.01-0.08% of PI DR major mutations. Furthermore, the combinations of major and accessory PI DR mutations significantly correlated with the phenotypic DR. The in-house phenotypic assay is superior to other conventional phenotypic assays in the detection of DR variants with a frequency as low as 0.01%.
Lanctôt, Dominique; Dupuis, Gilles; Marcaurell, Roger; Anestin, Annélie S; Bali, Madan
2016-12-01
Background Several cognitive behavioral interventions have been reported to reduce psychological symptoms in breast cancer (BC) patients. The goal of this study was to evaluate the effects of a yoga intervention in reducing depression and anxiety symptoms in BC patients. Methods This study was a randomized, partially blinded, controlled trial comparing a standardized yoga intervention to standard care. It was conducted at three medical centers in Montreal, Canada. Eligible patients were women diagnosed with stage I-III BC receiving chemotherapy. Participants were randomly assigned to receive yoga intervention immediately (experimental group, n=58) or after a waiting period (n=43 control group). The Bali Yoga Program for Breast Cancer Patients (BYP-BC) consisted of 23 gentle Hatha asanas (poses), 2 prayanamas (breathing techniques), shavasanas (relaxation corpse poses) and psychoeducational themes. Participants attended eight weekly sessions lasting 90 min each and received a DVD for home practice with 20- and 40-min sessions. Participants in the wait list control group received standard care during the 8-week waiting period. Results A total of 101 participants took part in the final intention-to-treat analyses. The repeated measures analyses demonstrated that depression symptoms increased in the control group (p=0.007), while no change was reported in the BYP-BC group (p=0.29). Also, depression symptoms decreased in the WL control group after receiving the BYP-BC intervention (p=0.03). Finally, there was no statistical significance in terms of anxiety symptoms (p=0.10). Conclusions Results support the BYP-BC intervention as a beneficial means of reducing and preventing the worsening of depression symptoms during chemotherapy treatment.
Directory of Open Access Journals (Sweden)
Gabriela Mera
2011-11-01
Full Text Available Bulk B-C-N materials were synthesized under static high thermobaric conditions (20 GPa and 2,000 °C in a multianvil apparatus from a polymer derived t-BC1.97N ceramic. The bulk samples were characterised using X-ray synchrotron radiation and analytical transmission electron microscopy in combination with electron energy loss spectroscopy. Polycrystalline B-C-N materials with a cubic type structure were formed under the applied reaction conditions, but the formation of a ternary cubic diamond-like c-BC2N compound, could not be unambiguously confirmed.
Matizamhuka, Wallace R.; Sigalas, Iakovos; Herrmann, Mathias; Dubronvinsky, Leonid; Dubrovinskaia, Natalia; Miyajima, Nobuyoshi; Mera, Gabriela; Riedel, Ralf
2011-01-01
Bulk B-C-N materials were synthesized under static high thermobaric conditions (20 GPa and 2,000 °C) in a multianvil apparatus from a polymer derived t-BC1.97N ceramic. The bulk samples were characterised using X-ray synchrotron radiation and analytical transmission electron microscopy in combination with electron energy loss spectroscopy. Polycrystalline B-C-N materials with a cubic type structure were formed under the applied reaction conditions, but the formation of a ternary cubic diamond-like c-BC2N compound, could not be unambiguously confirmed. PMID:28824124
Energy Technology Data Exchange (ETDEWEB)
Mahoney, J.
2009-01-15
Flaring is widely used to dispose of natural gas liberated during oil production and processing in remote areas where there is no pipeline on site to make use of the gas. Sources of flaring include well testing, solution gas from oil wells, underbalanced drilling, gas gathering systems and gas processing plants. Flaring is a source of pollution and a waste of energy. This article described Petro-Canada's efforts to eliminate flaring. In the late 1990s, the company began environmental assessments of its flare pits in British Columbia (BC). Since 2005, the producer has decommissioned 106 of its 108 pits in the province and ring-fenced the other 2. As the staff advanced the task of decommissioning, it often consolidated flaring hardware, installing a single, vertical flare stack to serve where 3 or 4 flare pits had previously served as many well sites. Before decommissioning began, Petro-Canada carried out its own environmental protocol and assessed its pits for the presence of contaminants and for their potential to leach into local waterways. Monitoring of groundwater through wells drilled on the company's BC flare pit sites will continue for some time, particularly on sites with bodies of water. BC's Oil and Gas Commission estimated that between 1996 and 2006, conservation of solution gas rose from 87 to 97 per cent among the province's producers. Petro-Canada was commended for being among the first to secure all flare pits under its control in BC. It was estimated that 49 per cent of all flare pits decommission in BC by 2007 were completed by Petro-Canada. 2 refs., 2 figs.
LHCb : Measurement of the $B_c$ Lifetime in semileptonic decays at LHCb
Anderlini, Lucio
2014-01-01
The lifetime of the $B_c^+$ meson is measured using semileptonic decays having a $J\\!/\\!\\psi$ meson and a muon in the final state. The data, corresponding to an integrated luminosity of $2\\mathrm{fb^{-1}}$, are collected by the LHCb detector in $pp$ collisions at a centre-of-mass energy of $8\\,\\mathrm{TeV}$. The measured lifetime is $$\\tau = 509 \\pm 8 \\pm 12 \\mathrm{~fs},$$ where the first uncertainty is statistical and the second is systematic.
General characteristics of Bc-mesons. Production mechanisms and decays
International Nuclear Information System (INIS)
Gershtein, S.S.; Likhoded, A.K.; Slabospitsky, S.R.
1989-01-01
Using Martin potential, independent of b- and c-quark flavour, the mass spectrum of B c (bc-bar)-mesons and widths of electromagnetic transition between them are calculated. The estimations of the production cross section at e + e - colliders, in hadronic and neutrino interactions are obtained. A real possibility to observed B c mesons at LEP and also at hadron colliders (σ(B c )/σ(bb-bar)∼10 -3 ) has been pointed out. The importance of observing the annihilation decay channels of B c -mesons: B c →τν τ (Br(B c →τν τ )=1.5-2%), and B c →ΦD s , B C →DK etc, has been emphasized. 25 refs.; 16 figs.; 5 tabs
Zhang, Qiwei; Zhang, Xiaomin; Wu, Hao; Seto, Donald; Zhang, Hao-Jie; Chen, Zhiwei; Wan, Chengsong; Zheng, Bo-Jian
2012-01-01
Circulating recombinant forms (CRFs) of HIV-1 have been identified in southern China in recent years. CRF08_BC is one of the most predominant subtypes circulating in China. In order to study HIV subtype biology and to provide a tool for biotechnological applications, the first full-length replication-competent infectious molecular clone harboring CRF08_BC is reported. The construction of this clone pBRGX indicates that a moderate-copy number vector is required for its amplification in E. coli. In addition, it is shown that the parental CRF08_BC LTRs are important for generating this efficient replication-competent infectious clone. These observations may aid in the construction of infectious clones from other subtypes. Both the pBRGX-derived virus and its parental isolate contain CCR5 tropism. Their full-length genomes were also sequenced, analyzed, compared and deposited in GenBank (JF719819 and JF719818, respectively). The availability of pBRGX as the first replication-competent molecular clone of CRF08_BC provides a useful tool for a wide range of studies of this newly emergent HIV subtype, including the development of HIV vaccine candidates, antiviral drug screening and drug resistance analysis.
Wu, Jianjun; Guo, Hongxiong; Zhang, Jing; Liu, Xiaoming; Ayoupu, Aideaierli; Shen, Yuelan; Miao, Lifeng; Tang, Jihai; Lei, Yanhua; Su, Bin
2017-04-01
CRF07_BC is one of the most prevalent HIV-1 strains in China, and Xinjiang Uygur Autonomous Region has ever been considered to be a second epidemic center after Yunnan Province in previous studies. Here we use HIV-1 pol gene sequences identified from Hetian Prefecture located in Xinjiang Autonomous Region to reconstruct the epidemic history of HIV CRF07_BC strain circulating in this region. We found that CRF07_BC is the predominant HIV-1 form in Hetian Prefecture, and the estimated tMRCA analysis shows that there is no enough evidence supporting Xinjiang Autonomous Region as a second epidemic center of spreading HIV-1. It may imply that every city may be only a point among the HIV spreading network because of the frequent migration of population in the whole country nowadays.
International Nuclear Information System (INIS)
Campbell, C.R.
2008-08-01
Greenhouse gas (GHG) emissions reduction strategies are needed in order to prevent rises in global temperatures. This report presented 6 GHG emission scenarios conducted to understand the kind of contribution that the province of British Columbia (BC) might make towards reducing global warming in the future. Short, medium, and longer term GHG reduction targets were benchmarked. The University of Victoria earth system climate model was used to calculate emission pathways where global average temperature did not exceed 2 degrees C above pre-industrial values, and where atmospheric GHGs were stabilized at 400 ppm of carbon dioxide equivalent (CO 2 e). Global carbon emission budgets of the total amount of GHG emissions permissible between now and 2100 were identified. A carbon emission budget for 2008 to 2100 was then developed based on the population of BC. Average annual emission reduction rates for the world and for BC were also identified. It was concluded that dramatically reduced emissions will be insufficient to achieve an equilibrium temperature less than 2 degrees C above pre-industrial levels. Global reductions of greater than 80 per cent are needed to prevent unacceptable levels of ocean acidification. Results suggested that carbon sequestration technologies may need to be used to remove CO 2 from the atmosphere by artificial means. 38 refs., 5 tabs., 4 figs
Močnik, Griša; Ferrero, Luca; Castelli, Mariapina; Ferrini, Barbara S.; Moscatelli, Marco; Grazia Perrone, Maria; Sangiorgi, Giorgia; Rovelli, Grazia; D'Angelo, Luca; Moroni, Beatrice; Scardazza, Francesco; Bolzacchini, Ezio; Petitta, Marcello; Cappelletti, David
2016-04-01
Black carbon (BC), and its vertical distribution, affects the climate. Global measurements of BC vertical profiles are lacking to support climate change research. To fill this gap, a campaign was conducted over three Italian basin valleys, Terni Valley (Appennines), Po Valley and Passiria Valley (Alps), to characterize the impact of BC on the radiative budget under similar orographic conditions. 120 vertical profiles were measured in winter 2010. The BC vertical profiles, together with aerosol size distribution, aerosol chemistry and meteorological parameters, have been determined using a tethered balloon-based platform equipped with: a micro-Aethalometer AE51 (Magee Scientific), a 1.107 Grimm OPC (0.25-32 μm, 31 size classes), a cascade impactor (Siuotas SKC), and a meteorological station (LSI-Lastem). The aerosol chemical composition was determined from collected PM2.5 samples. The aerosol absorption along the vertical profiles was measured and optical properties calculated using the Mie theory applied to the aerosol size distribution. The aerosol optical properties were validated with AERONET data and then used as inputs to the radiative transfer model libRadtran. Vertical profiles of the aerosol direct radiative effect, the related atmospheric absorption and the heating rate were calculated. Vertical profile measurements revealed some common behaviors over the studied basin valleys. From below the mixing height to above it, a marked concentration drop was found for both BC (from -48.4±5.3% up to -69.1±5.5%) and aerosol number concentration (from -23.9±4.3% up to -46.5±7.3%). These features reflected on the optical properties of the aerosol. Absorption and scattering coefficients decreased from below the MH to above it (babs from -47.6±2.5% up to -71.3±3.0% and bsca from -23.5±0.8% up to -61.2±3.1%, respectively). Consequently, the Single Scattering Albedo increased above the MH (from +4.9±2.2% to +7.4±1.0%). The highest aerosol absorption was
The finding of eggs of Diphyllobothrium in human coprolites (4.100-1.950 BC from Northern Chile
Directory of Open Access Journals (Sweden)
Luiz Fernando Ferreira
1984-06-01
Full Text Available Twenty six coprolites from an archaeological site in the province of Iquique, northern Chile, were examined for parasites. Coprolites were found in two excavation units, I and II (Tiliviche site, dated respectively at 5,900 B.C. to 4,110 B.C. and 4,110 B.C. to 1,950 B.C., and identified as of human origin. Only at the unit II coprolites containing helminth eggs identified as Diphyllobothrium pacificum were found. The presence of this tapeworm, a parasite of the American Sea Lion, in human coprolites, points to a diet which included marine fishes and provides information on the antiquity of infection by Diphyllobothrium pacificum. It is interesting to note that Baer (1969 suggests the presence of this tapeworm in pre-Columbian populations when diagnosing the first human cases in today's population in Peru.Os autores realizaram exame parasitológico de vinte e seis coprólitos encontrados em um sítio arqueológico no norte do Chile, Província de Iquique.O material foi colhido em duas unidades de escavação, I e II (sitio Tiliviche datados respectivamente de 5.900 a.C. a 4.100 a.C. e 4.110 a.C. a 1.950 a.C. e identificados como de origem humana.Na unidade II foram observados ovos de helmintos diagnosticados como de Diphyllobothrium pacificum. Esse achado nos informa sobre a antiguidade da infecção bem como sobre os hábitos alimentares dessas populações, uma vez que a contaminação se da por ingestão de peixes marinhos. E interessante assinalar que Baer (1969, ao descrever pela primeira vez a infecção humana por esse cestódeo em populações atuais do Peru, sugere a sua presença nas populações pré-colombianas.
A proposal for an unusually stiff and moderately ductile hard coating material: Mo2BC
International Nuclear Information System (INIS)
Emmerlich, J; Music, D; Braun, M; Fayek, P; Schneider, J M; Munnik, F
2009-01-01
The elastic properties of Mo 2 BC were studied using ab initio calculations. The calculated bulk modulus of 324 GPa is 45% larger than that of Ti 0.25 Al 0.75 N and 14% smaller than that of c-BN, indicating a highly stiff material. The bulk modulus (B) to shear modulus (G) ratio is 1.72 at the transition from brittle to ductile behaviour. This, in combination with a positive Cauchy pressure (c 12 - c 44 ), suggests moderate ductility. When compared with a typical hard protective coating such as Ti 0.25 Al 0.75 N (B = 178 GPa; B/G = 1.44; negative Cauchy pressure), Mo 2 BC displays considerable potential as protective coating for metal cutting applications. In order to test this proposal, Mo 2 BC thin films were synthesized using dc magnetron sputtering from three plasma sources on Al 2 O 3 (0 0 0 1) at a substrate temperature of ∼900 0 C. The calculated lattice parameters are in good agreement with values determined from x-ray diffraction. The measured Young's modulus values of ∼460 ± 21 GPa are in excellent agreement with the 470 GPa value obtained by calculations. Scanning probe microscopy imaging of the residual indent revealed no evidence for crack formation as well as significant pile-up, which is consistent with the moderate plasticity predicted. The apparent contradiction between moderate ductility on the one hand and indentation hardness values of 29 GPa can be understood by considering the electronic structure particularly the extreme anisotropy. The presence of stiff Mo-C and Mo-B layers with metallic interlayer bonding enables this intriguing and unexpected property combination.
Insurgency in Ancient Times: The Jewish Revolts Against the Seleucid and Roman Empires, 166 BC-73 AD
National Research Council Canada - National Science Library
Sorrells, William T
2005-01-01
This monograph examines two insurgencies conducted by the Jews in ancient times: the Maccabee Revolt against the Seleucid Empire from 166-164 BC, and the Revolt against the Roman Empire from 66-70 AD...
Transformation from Al3BC phase to doped TiB2 or TiC particles in Al–Ti melts
International Nuclear Information System (INIS)
Tian, Wenjie; Li, Pengting; Gao, Tong; Nie, Jinfeng; Liu, Xiangfa
2013-01-01
Highlights: ► The reaction of phase Al 3 BC with Ti was investigated. ► The transformation leads to the formation of C-doped TiB 2 and B-doped TiC. ► The doped particles show macroporous and lamellar morphologies. ► A model was proposed to illustrate the transformation mechanism. ► Grain refinement performance of the Al–5Ti–0.8B–0.2C on A356 alloy is excellent. -- Abstract: An Al–8B–2C master alloy was added into Al–Ti melts to study the reaction of Al 3 BC phase with Ti. As a result, a new Al–5Ti–0.8B–0.2C master alloy was fabricated. The microstructures were studied by field emission scanning electron microscope (FESEM), X-ray diffraction (XRD) and transmission electron microscope (TEM). The analysis indicates that C-doped TiB 2 and B-doped TiC which show macroporous and lamellar morphologies are transformed from Al 3 BC. The transformation mechanism is also discussed in this work. Furthermore, the grain refinement performance of the Al–5Ti–0.8B–0.2C on A356 alloy was investigated
Uram, Łukasz; Szuster, Magdalena; Filipowicz, Aleksandra; Gargasz, Krzysztof; Wołowiec, Stanisław; Wałajtys-Rode, Elżbieta
2015-01-01
The intracellular localization and colocalization of a fluorescently labeled G3 amine-terminated cationic polyamidoamine (PAMAM) dendrimer and its biotin–pyridoxal (BC-PAMAM) bioconjugate were investigated in a concentration-dependent manner in normal human fibroblast (BJ) and squamous epithelial carcinoma (SCC-15) cell lines. After 24 hours treatment, both cell lines revealed different patterns of intracellular dendrimer accumulation depending on their cytotoxic effects. Cancer cells exhibited much higher (20-fold) tolerance for native PAMAM treatment than fibroblasts, whereas BC-PAMAM was significantly toxic only for fibroblasts at 50 µM concentration. Fibroblasts accumulated the native and bioconjugated dendrimers in a concentration-dependent manner at nontoxic range of concentration, with significantly lower bioconjugate loading. After reaching the cytotoxicity level, fluorescein isothiocyanate-PAMAM accumulation remains at high, comparable level. In cancer cells, native PAMAM loading at higher, but not cytotoxic concentrations, was kept at constant level with a sharp increase at toxic concentration. Mander’s coefficient calculated for fibroblasts and cancer cells confirmed more efficient native PAMAM penetration as compared to BC-PAMAM. Significant differences in nuclear dendrimer penetration were observed for both cell lines. In cancer cells, PAMAM signals amounted to ~25%–35% of the total nuclei area at all investigated concentrations, with lower level (15%–25%) observed for BC-PAMAM. In fibroblasts, the dendrimer nuclear signal amounted to 15% at nontoxic and up to 70% at toxic concentrations, whereas BC-PAMAM remained at a lower concentration-dependent level (0.3%–20%). Mitochondrial localization of PAMAM and BC-PAMAM revealed similar patterns in both cell lines, depending on the extracellular dendrimer concentration, and presented significantly lower signals from BC-PAMAM, which correlated well with the cytotoxicity. PMID:26379435
Four Closely Related HIV-1 CRF01_AE/CRF07_BC Recombinant Forms Identified in East China.
Li, Fan; Li, Yuxueyun; Feng, Yi; Hu, Jing; Ruan, Yuhua; Xing, Hui; Shao, Yiming
2017-07-01
Five near full-length genomes of novel second-generation HIV-1 recombinant virus (JS150021, JS150029, JS150129, JS150132, and AH150183) were identified from five HIV-positive people in Jiangsu and Anhui province, east China. Phylogenic analyses showed that these five sequences are all composed of two well-established circulating recombinant forms (CRFs) CRF07_BC and CRF01_AE, grouped into four new discovered recombinant forms, which show several very similar but not identical recombinant breakpoints. The four recombinant forms are also identified to be a sort of family or related viruses, seems to be the results of different recombination events. The emergence of a serious new closely related CRF07_BC/CRF01_AE recombinant strain indicates the increasing complexity of sexual transmission of the HIV-1 epidemic in China.
A Living Landscape : Bronze Age settlement sites in the Dutch river area (c. 2000-800 BC)
Arnoldussen, Stijn
2008-01-01
"A Living Landscape. Bronze Age settlements in the Dutch river area (c. 2000-800 BC)" Academisch proefschrift over de aard en dynamiek van bronstijdnederzettingen in het rivierengebied. Het bevat een introductie op de geologische processen en de paleogeografie van de Nederlandse rivierdelta als
McConnell, Keiron
2015-01-01
This thesis explores the structure, demographics, and history of gangs in British Columbia (BC), Canada, through a social constructionist lens. The purpose of this research is for the reader to consider the current state of gangs in BC as inherently different from other places in the world, to assist in understanding why there may be misconceptions, and to promote the research and implementation of more appropriate context-specific interventions. Building on previous work conducted as a Vanco...
International Nuclear Information System (INIS)
Routt, T.M.
2000-01-01
This document provides the preliminary hazard classification for the sampling and characterization activities to be conducted at the 100-B/C confirmatory sampling effort sites in support of remedial design and eventual remediation of these sites
Giastas, Petros; Andreou, Athena; Papakyriakou, Athanasios; Koutsioulis, Dimitris; Balomenou, Stavroula; Tzartos, Socrates J; Bouriotis, Vassilis; Eliopoulos, Elias E
2018-02-06
The cell wall peptidoglycan is recognized as a primary target of the innate immune system, and usually its disintegration results in bacterial lysis. Bacillus cereus, a close relative of the highly virulent Bacillus anthracis, contains 10 polysaccharide deacetylases. Among these, the peptidoglycan N-acetylglucosamine deacetylase Bc1974 is the highest homologue to the Bacillus anthracis Ba1977 that is required for full virulence and is involved in resistance to the host's lysozyme. These metalloenzymes belong to the carbohydrate esterase family 4 (CE4) and are attractive targets for the development of new anti-infective agents. Herein we report the first X-ray crystal structures of the NodB domain of Bc1974, the conserved catalytic core of CE4s, in the unliganded form and in complex with four known metalloenzyme inhibitors and two amino acid hydroxamates that target the active site metal. These structures revealed the presence of two conformational states of a catalytic loop known as motif-4 (MT4), which were not observed previously for peptidoglycan deacetylases, but were recently shown in the structure of a Vibrio clolerae chitin deacetylase. By employing molecular docking of a substrate model, we describe a catalytic mechanism that probably involves initial binding of the substrate in a receptive, more open state of MT4 and optimal catalytic activity in the closed state of MT4, consistent with the previous observations. The ligand-bound structures presented here, in addition to the five Bc1974 inhibitors identified, provide a valuable basis for the design of antibacterial agents that target the peptidoglycan deacetylase Ba1977.
Churchwell, Roy T.
Avian migration is one of the wonders of the natural world. Stored fats are the main source of nutrients and fuel for avian migration and it is assumed the fat deposition at stopover sites is a critical component of a successful migration. Stopover sites are crucial in the successful migration of many birds, but particularly for arctic-breeding shorebirds that migrate long distances from breeding to wintering grounds. Despite the importance of stopover sites, it is often difficult to determine the importance of these sites to migrating shorebirds. I investigated three aspects of stopover ecology of Semipalmated Sandpipers (Calidris pusilla) foraging at coastal deltas on the Beaufort Sea coast, Alaska. First, I quantified the spatial and temporal distribution and abundance of the benthic macroinvertebrate community living within the mudflats. I found that there were two ecological groups of macroinvertebrates using river deltas, one originated in terrestrial freshwater habitats and most importantly could withstand freezing in delta sediments over the winter, and the other originated from the marine environment, could not withstand freezing and had to migrate to intertidal habitats each summer from deeper water areas that did not freeze over the winter. Stable isotope analysis allowed me to describe the origin of carbon consumed by invertebrates in intertidal habitats. I predicted freshwater invertebrates would consume terrestrial carbon, and marine invertebrates would consume marine carbon, but I found that both groups utilized the same carbon, which was a mixture of terrestrial and marine sources. My second research question determined the importance of delta foraging habitat for fall migrating Semipalmated Sandpipers. I mapped the temporal distribution and abundance of birds and quantified this relationship to invertebrate distribution and abundance. I researched fattening rates of shorebirds by measuring triglycerides in the blood of shorebirds I captured. I
Scaling the State: Egypt in the Third Millennium BC
Directory of Open Access Journals (Sweden)
Richard Bussmann
2014-10-01
Full Text Available Discussions of the early Egyptian state suffer from a weak consideration of scale. Egyptian archaeologists derive their arguments primarily from evidence of court cemeteries, elite tombs, and monuments of royal display. The material informs the analysis of kingship, early writing, and administration but it remains obscure how the core of the early Pharaonic state was embedded in the territory it claimed to administer. This paper suggests that the relationship between centre and hinterland is key for scaling the Egyptian state of the Old Kingdom (ca. 2,700-2,200 BC. Initially, central administration imagines Egypt using models at variance with provincial practice. The end of the Old Kingdom demarcates not the collapse, but the beginning of a large-scale state characterized by the coalescence of central and local models.
Sinkhole investigated at B.C. Hydro`s Bennett Dam
Energy Technology Data Exchange (ETDEWEB)
Anon.
1996-07-01
The cause of a sinkhole which appeared in a roadway crossing an earth filled dam in B. C., was discussed. The hole measured 6 ft. across and 20 ft. deep, and occurred in B.C. Hydro`s W.A.C. Bennett Dam which measures 600 ft. high, 2,600 ft. wide at the base and 35 ft. wide at the crest. The cause of the sinkhole is not known, but it is believed that a weakness in the dam may have found its way to the surface via a pipe connected to a bedrock settlement gauge buried within the dam. Sonar and ground penetrating radar were used to examine the area. The hole has been filled with gravel and monitoring continues. Experts do not anticipate immediate risk of dam failure. 1 fig.
Gamma radiation effects on the cuban antimeningococcic BC vaccine
International Nuclear Information System (INIS)
Padron Soler, E.; Romay Penabad, Z.; Le Riveran Morales, E.; Campa Huergo, C.; Sierra Gonzalez, G.; Alfalla Valdes, L.; Prieto Miranda, E.
1994-01-01
The effects of gamma rays on the Cuban antimeningococcic BC vaccine properties were studied. These were performanced by simulation with different bio burden of microbial pollutants. The isolated spores of the pollutants of non- aseptic areas were used. Its D10 was determined as 2.045 Gy. On that basis, the sterilization dose setting was performed. The quality of the irradiated vaccine was performed according to the Cuban standards: sterility, protein and polysaccharide concentration, immunogenicity, per cent of protein adsorption, nonspecific innocuousness. There were observed non negative effects on the vaccine of the radiation process in the dose range of 0-25 Gy. It was also studied the preservation of the properties of the irradiated vaccine, by storing it during one year at four celsius grade. The results were satisfactory
Energy Technology Data Exchange (ETDEWEB)
Aguilar Dumas, Alvaro [Comision Federal de Electricidad, Gerencia de Proyectos Geotermoelectricos, Residencia General de Cerro Prieto, Mexicali, Baja California (Mexico)]. E-mail: alvaro.aguilar@cfe.gob.mx
2009-07-15
Exploration plays an important role in tapping underground natural resources-whether water, oil, natural gas or minerals. Exploratory data allow us to learn reservoir conditions, increasing probable reserves and reservoir life span. Around the Cerro Prieto geothermal field, BC, and in the Mexicali Valley in general, exploration had almost stopped but recently was resumed by the Studies Division of Comision Federal de ELectricidad (CFE)'s Gerencia de Proyectos Geotermoelectricos. The division sent technical personnel to structurally map the northern and eastern portions of Laguna Salada. The paper offers a general outline of the main zones undergoing exploratory studies-studies perhaps culminating in siting exploratory wells to locate more geothermal resources (and ultimately producing them using binary power plants). CFE also wants to site injection wells west of the current production zone, and this is covered, as well. All activities are meant to increase the productive lifespan of the geothermal reservoir. [Spanish] Cuando se trata de la explotacion de recursos naturales del subsuelo, sea agua, gas, petroleo o minerales, la exploracion juega un papel muy importante, ya que permite conocer las condiciones del yacimiento que pudieran llevar a incrementar las reservas de los recursos explotados y extender su vida util. En las zonas aledanas al campo geotermico de Cerro Prieto, BC, y en general en el Valle de Mexicali, la exploracion estaba practicamente detenida habiendose reactivado a raiz de que la Subgerencia de Estudios de la Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad (CFE) envio personal para realizar mapeos estructurales en las porciones norte y oriente de la Laguna Salada. Este trabajo presenta un panorama general de las areas prioritarias para realizar estudios exploratorios y poder programar, con mas bases, pozos exploratorios enfocados a localizar mas recursos geotermicos, inclusive para generar energia por medio
Observations concerning the quinol oxidation site of the cytochrome bc{sub 1} complex
Energy Technology Data Exchange (ETDEWEB)
Berry, Edward A.; Huang, Li-Shar
2003-09-07
A direct hydrogen bond between ubiquinone/quinol bound at the QO site and a cluster-ligand histidine of the iron-sulfur protein (ISP) is described as a major determining factor explaining much experimental data on position of the ISP ectodomain, EPR lineshape and midpoint potential of the iron-sulfur cluster, and the mechanism of the bifurcated electron transfer from ubiquinol to the high and low potential chains of the bc1 complex.
The archaeology of drill hole U20bc, Nevada Test Site, Nye County, Nevada
International Nuclear Information System (INIS)
McLane, A.R.; Hemphill, M.L.; Livingston, S.J.; Pippin, L.C.; Walsh, L.A.
1992-01-01
Impacts to four sites near drill hole U20bc on Pahute Mesa in the northwestern part of the Nevada Test Site were mitigated through data recovery. The work was done during 1988 by the Desert Research Institute for the Department of Energy, Nevada Field Office (DOE/NV)- The four sites that warranted data recovery were 26NY3171, 26NY3173, 26NY5561 and 26NY5566. These sites had previously been determined eligible to the National Register of Historic Places. They were temporary camps that contained lithic debitage, projectile points, milling stones and pottery, and therefore contributed significant information concerning the prehistory of the area. The study of the archaeological remains shows that the prehistoric people subsisted on plant foods and game animals as determined by the artifacts including manos, metates, pottery, lithic scrapers, and projectile points. The time sensitive arfifacts (pottery and diagnostic points) suggest that the region was used from about 12,000 B.P. to just before the historic period, possibly 150 years ago. DOE/NV has met its obligation to mitigate adverse impacts to the cultural resources at U20bc. Therefore, it is recommended that this project proceed as planned
'Demystifying the hydrogen and fuel cell industry. Where are the investment opportunities in B.C.?'
International Nuclear Information System (INIS)
Kettlewell, D.
2004-01-01
Human civilization has advanced through history by moving from one finite source of energy to the next. Wood and coal fueled the industrial revolution, while oil and natural gas powered us to a technological age. Exploration and innovation have provided tools to fuel rapid economic growth. However, our seemingly endless appetite for resources and power sources have left barren land, polluted waterways and a contaminated atmosphere. Our explorative human nature and global population growth trends ensures that our appetite for energy will continue to grow exponentially. Embracing sustainable development and integrating eco-efficiencies into industrial development will enable us to reduce and re-use our finite natural resources. The challenge for humanity is to ensure that we do not suffocate on the waste by-product of our economic growth. The world's ninety-year 'production affair' with oil will peak in 2020 as accessible supply begins to decline. Similarly, supply issues with natural gas will force production to decline after 2040. Finite supply forces and carbon pollution concerns are forcing energy alternatives to be considered. Hydrogen is a potential energy elixir considering its ability to generate more concentrated powerful energy with clean water as its only effluent. British Columbia (B.C.) is uniquely positioned to participate in a clean energy solution. This conference paper is a synopsis of a full consulting report that was undertaken on behalf of a Vancouver-based seed capital firm, Renewal Partners. The objective of the report was to examine the history, cycles and future of investments in B.C.'s hydrogen and fuel cell sectors within a macro financial outlook. With a critical eye towards global development, investment recommendations are offered from a B.C. sector perspective. The paper is divided into the following sections: Research Methodology; Hydrogen Overview; Financial Outlook; Canadian Perspective; B.C. Perspective; What Leading Experts Think
Rare radiative decay of the $B_{c}$ meson
Barik, N; Kar, S; Dash, P C
2001-01-01
We study the decays B/sub c/ to D* gamma and B/sub c/ to D/sub s/* gamma in the relativistic independent quark model based on the confining potential in the scalar-vector harmonic form. Out of the two competing mechanisms contributing to these decays, we find that the weak annihilation contribution dominates the electromagnetic penguin one. Considering contributions from both mechanisms, total decay widths and branching ratios are predicted as Gamma (B/sub c/ to D* gamma )=5.22*10/sup -18/ GeV, Gamma (B/sub c/ to D/sub s/* gamma ) =1.98*10/sup -16/ GeV and Br(B/sub c/ to D* gamma ) approximately =3.64*10/sup -6/, Br(B/sub c/ to D/sub s/* gamma ) approximately =1.39*10/sup -4/ with tau /sub Bc/=0.46 ps. The decays B/sub c/ to D /sub s/* gamma can well be studied at CERN LHC in the near future. (33 refs).
To Duc, Khanh
2017-11-18
Receiver operating characteristic (ROC) surface analysis is usually employed to assess the accuracy of a medical diagnostic test when there are three ordered disease status (e.g. non-diseased, intermediate, diseased). In practice, verification bias can occur due to missingness of the true disease status and can lead to a distorted conclusion on diagnostic accuracy. In such situations, bias-corrected inference tools are required. This paper introduce an R package, named bcROCsurface, which provides utility functions for verification bias-corrected ROC surface analysis. The shiny web application of the correction for verification bias in estimation of the ROC surface analysis is also developed. bcROCsurface may become an important tool for the statistical evaluation of three-class diagnostic markers in presence of verification bias. The R package, readme and example data are available on CRAN. The web interface enables users less familiar with R to evaluate the accuracy of diagnostic tests, and can be found at http://khanhtoduc.shinyapps.io/bcROCsurface_shiny/ .
Juengst, Sara L; Chávez, Sergio J
2015-06-01
This paper presents three trepanned skulls from the Copacabana Peninsula in the Titicaca Basin, dating from 800 BC to AD 1000. Trepanation has been practiced for two millennia in the Andes, with the earliest specimens coming from the coastal Paracas culture (circa 400 BC). Trepanned skulls have been found throughout the Andes, displaying a variety of techniques. This modification was practiced as surgical intervention after injury and treatment for headaches and other ailments, among other reasons (Verano, 2003: 234). With the exception of four examples from the Island of the Sun, few early cases of trepanation have been found in the Titicaca Basin of Peru and Bolivia. The three skulls presented here are important for several reasons: (1) they originate from a region under-represented in the literature on Andean trepanation, (2) they represent a variety of trepanation techniques, and (3) they confirm the practice of trepanation in the lake basin during the Early Horizon. Copyright © 2014 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Blinkov, V.N.; Melikhov, O.I.; Melikhov, V.I.; Davydov, M.V.; Wolff, H.; Arndt, S.
2012-01-01
In the frame of Tacis Project R2.01/99, which was running from 2003 to 2005, the bubble condenser system of Kola NPP (unit 3) was qualified at the integral test facility BC V-213. Three LB LOCA tests, two MSLB tests, and one SB LOCA test were performed. The appropriate test scenarios for BC V-213 test facility, modeling accidents in the Kola NPP unit 3, were determined with pretest calculations. Analysis of test results has shown that calculated initial conditions and test scenarios were properly reproduced in the tests. The detailed posttest analysis of the tests performed at BC V-213 test facility was aimed to validate the COCOSYS code for the calculation of thermohydraulic processes in the hermetic compartments and bubble condenser. After that the validated COCOSYS code was applied to NPP calculations for Kola NPP (unit 3). Results of Tacis R2.01/99 Project confirmed the bubble condenser functionality during large and small break LOCAs and MSLB accidents. Maximum loads were reached in the LB LOCA case. No condensation oscillations were observed.
Xiao, Yang; Li, Yunkai; Ning, Zigong; Li, Pengxiang; Yang, Peiling; Liu, Chengcheng; Liu, Zhongwei; Xu, Feipeng; Hynds, Paul Dylan
2018-03-01
Wastewater reclamation now represents an effective measure for sustainable water resource management in arid regions, however wastewater components (organic micropollutants) may potentially impact local ecological and/or human health. Previous studies have shown that sodium bentonite/natural clay (BC) mixes may be used to effectively reduce riverbed infiltration in regions characterized by excessively high hydraulic conductivity. Accordingly, the current study sought to investigate the contaminant removal efficiency (Re) of several BC mass ratios in simulated dry riverbeds. Results indicate that the measured Re of NH4+-N, CODcr and BOD5 increased in concurrence with an increasing sodium bentonite ratio, up to a maximum Re of 97.4% (NH4+-N), 55.2% (CODcr), and 51.5% (BOD5). The primary contaminant removal site was shown to be the infiltration-reducing (BC) layer, accounting for approximately 40%, 60%, and 70% of NH4+-N, CODcr and BOD5 removal, respectively. Conversely, the removal efficiency of NO3-N was found to be low (managing recharge of non-potable aquifers with reclaimed wastewater.
Climatic change and contemporaneous land-use phases north and south of the Alps 2300 BC to 800 AD
Tinner, Willy; Lotter, André F.; Ammann, Brigitta; Conedera, Marco; Hubschmid, Priska; van Leeuwen, Jacqueline F. N.; Wehrli, Michael
2003-06-01
Fluctuations in the Δ 14C curve and subsequent gaps of archaeological findings at 800-650 and 400-100 BC in western and central Europe may indicate major climate-driven land-abandonment phases. To address this hypothesis radiocarbon-dated sediments from four lakes in Switzerland were studied palynologically. Pollen analysis indicates contemporaneous phases of forest clearances and of intensified land-use at 1450-1250 BC, 650-450 BC, 50 BC-100 AD and around 700 AD. These land-use expansions coincided with periods of warm climate as recorded by the Alpine dendroclimatic and Greenland oxygen isotope records. Our results suggest that harvest yields would have increased synchronously over wide areas of central and southern Europe during periods of warm and dry climate. Combined interpretation of palaeoecological and archaeological findings suggests that higher food production led to increased human populations. Positive long-term trends in pollen values of Cerealia and Plantago lanceolata indicate that technical innovations during the Bronze and Iron Age (e.g. metal ploughs, scythes, hay production, fertilising methods) gradually increased agricultural productivity. The successful adoption of yield-increasing advances cannot be explained by climatic determinism alone. Combined with archaeological evidence, our results suggest that despite considerable cycles of spatial and demographic reorganisation (repeated land abandonments and expansions, as well as large-scale migrations and population decreases), human societies were able to shift to lower subsistence levels without dramatic ruptures in material culture. However, our data imply that human societies were not able to compensate rapidly for harvest failures when climate deteriorated. Agriculture in marginal areas was abandoned, and spontaneous reforestations took place on abandoned land south and north of the Alps. Only when the climate changed again to drier and warmer conditions did a new wide-spread phase of
Energy Technology Data Exchange (ETDEWEB)
Corringer, P J; Durieux, C; Ruiz-Gayo, M; Roques, B P [UA498 CNRS, U266 INSERM, UFR des Sciences Pharmaceutiques et Biologiques, 75 - Paris (France)
1992-06-01
Among the CCK-B receptor agonists reported to date, the two modified peptides BC 264 and BC 254 display a high affinity and selectivity for this binding site and are highly protected from enzymatic degradation. Recently, we reported the biological properties of a tritiated analog of this agonist, [[sup 3]H]pBC 264, which fullfils all the criteria required for in vitro as well as in vivo studies of the CCK-B receptor. On the other hand, BC 254 displays a high affinity for the CCK-B binding sites in the guinea-pig (K[sub i] = 0.56 nM) while its affinity in the rat is more than 60-fold lower, a difference which could be due to the occurrence of CCK-B receptor subtypes. In the present paper, we report the synthesis of [[sup 3]H]pBC 264 and of the new tritiated ligand [[sup 3]H]pBC 254 using [[sup 3]H] NPS (N-succinimidyl[2,3-[sup 3]H]propionate) as labelling agent. These two probes have high specific activity (70-100 Ci/mmol) and will enable extensive studies of the CCK-B receptors to be carried out. (author).
2012-01-01
Background E. coli O157:H7 (EHEC) is an important human pathogen. The antibiotic treatment of EHEC reportedly results in release of Shiga toxin and is therefore discouraged. Consequently, alternative preventive or therapeutic strategies for EHEC are required. The objective of the current study was to investigate the effect of citrus limonoids on cell-cell signaling, biofilm formation and type III secretion system in EHEC. Results Isolimonic acid and ichangin were the most potent inhibitors of EHEC biofilm (IC25=19.7 and 28.3 μM, respectively) and adhesion to Caco-2 cells. The qPCR analysis revealed that isolimonic acid and ichangin repressed LEE encoded genes by ≈3 to 12 fold. In addition, flhDC was repressed by the two limonoids (≈3 to 7 fold). Further studies suggested that isolimonic acid interferes with AI-3/epinephrine activated cell-cell signaling pathway. Loss of biofilm inhibitory activity of isolimonic acid in ΔqseBC mutant, which could be restored upon complementation, suggested a dependence on functional QseBC. Additionally, overexpression of qseBC in wild type EHEC abated the inhibitory effect of isolimonic acid. Furthermore, the isolimonic acid failed to differentially regulate ler in ΔqseA mutant, while plasmid borne expression of qseA in ΔqseA background restored the repressive effect of isolimonic acid. Conclusions Altogether, results of study seem to suggest that isolimonic acid and ichangin are potent inhibitors of EHEC biofilm and TTSS. Furthermore, isolimonic acid appears to interfere with AI-3/epinephrine pathway in QseBC and QseA dependent fashion. PMID:23153211
The Bernades herbarium in the Botanic Institute of Barcelona (BC
Directory of Open Access Journals (Sweden)
Ibáñez, N.
2009-12-01
Full Text Available The BC-Bernades herbarium is one of the oldest collections conserved in the Botanical Institute of Barcelona. It contains part of the field collections of Miquel Bernades i Mainader and Miquel Bernades i Clarís, doctors of medicine and botanists of Catalonian origin living in Madrid in the 18th century. The collection consists of 817 sheets, the complete list provided in the annexe. We also present information concerning the localities of certain specific recollections, the taxonomic groups and families, as well as a list of sheets of special interest. This list contains witness of cornfield weed now very rare or extinct in Iberian lands, such as Hymenocarpos circinatus (L. Savi or Securigera securidaca (L. Degen & Dörfl , and also some of the first witness known from Spain of introduced plants, such as Aster cordifolius L. or Bidens bipinnata L.
[es] El herbario BC-Bernades es una de las colecciones más antiguas conservadas en el Instituto Botánico de Barcelona. Contiene parte de las recolecciones de Miquel Bernades y Mainader y Miquel Bernades y Clarís, médicos y botánicos catalanes del siglo XVIII establecidos en Madrid. Consta de 817 pliegos, la relación de los cuales presentamos en un anexo. También mostramos datos sobre las localidades de recolección, grupos taxonómicos y familias presentes, y una relación de pliegos de interés. Entre estos aparecen testimonios de plantas arvenses extinguidas o muy raras en tierras ibéricas como Hymenocarpos circinatus (L. Savi o Securigera securidaca (L. Degen & Dörfl , y también algunos de los primeros testimonios conocidos en España de plantas introducidas como Aster cordifolius L. o Bidens bipinnata L.
[ct] L’herbari BC-Bernades és una de les col·leccions més antigues de les conservades a l’Institut Botànic de Barcelona. Conté part de les recol·leccions de Miquel Bernades i Mainader i Miquel Bernades
Monkman, B.C., area shaping up as world class gas play
International Nuclear Information System (INIS)
Anon.
1992-01-01
This paper reports that Canadian operators are expanding a world class natural gas play in the Monkman area of eastern British Columbia. The area, in the foothills of the Canadian Rockies near Fort St. John, B.C., has yielded a string of significant gas discoveries. A number of companies-the most active BP Resources Canada Ltd. and Ocelot Energy Inc., Calgary-are playing a 30 mile wide by 50 mile long trend centering on two main producing horizons. The new successes are being scored in an area that first attracted the attention of explorationists in the 1950s. And the play's extent is still far form defined
Technical basis and radiological release plan for Trackhoes used at 100 BC-1 and 100 DR-1
International Nuclear Information System (INIS)
De Mers, S.K.
1997-06-01
To develop a method for the radiological release of tracked heavy equipment vehicles used in the excavation of the 100-BC-1 and 100-DR remedial action sites, including the technical basis for selection of release criteria and the instrumentation to be used for surveys
Directory of Open Access Journals (Sweden)
Jorge M. C. Marques
2003-10-01
Full Text Available The general methodology of classical trajectories as applied to elementary chemical reactions of the A+BC type is presented. The goal is to elucidate students about the main theoretical features and potentialities in applying this versatile method to calculate the dynamical properties of reactive systems. Only the methodology for two-dimensional (2D case is described, from which the general theory for 3D follows straightforwardly. The adopted point of view is, as much as possible, that of allowing a direct translation of the concepts into a working program. An application to the reaction O(¹D+H2->O+OH with relevance in atmospheric chemistry is also presented. The FORTRAN codes used are available through the web page www.qqesc.qui.uc.pt.
Non-Indigenous Marine Species (NIMS) in Biofouling on RAN Vessels: Threat Analysis
2015-09-01
Gulf of Mexico, and its range extends from the Caribbean to Brazil and Hawaii. It was first recorded in Australia on the German barque “Gorch Flock” in...4.2.2.10 Paracaprella pusilla (caprellid) P. pusilla is a tropical species native to Rio de Janeiro, Brazil and now common along the Atlantic coast...is found predominately in mangrove areas common to this region. This species was identified on HMAS Wewak (May 2004) on its return to HMAS Cairns
Directory of Open Access Journals (Sweden)
Zhenhua Deng
Full Text Available Baligang is a Neolithic site on a northern tributary of the middle Yangtze and provides a long archaeobotanical sequence from the Seventh Millennium BC upto the First Millennium BC. It provides evidence for developments in rice and millet agriculture influenced by shifting cultural affiliation with the north (Yangshao and Longshan and south (Qujialing and Shijiahe between 4300 and 1800 BC. This paper reports on plant macro-remains (seeds, from systematic flotation of 123 samples (1700 litres, producing more than 10,000 identifiable remains. The earliest Pre-Yangshao occupation of the sites provide evidence for cultivation of rice (Oryza sativa between 6300-6700 BC. This rice appears already domesticated in on the basis of a dominance of non-shattering spikelet bases. However, in terms of grain size changes has not yet finished, as grains are still thinner than more recent domesaticated rice and are closer in grain shape to wild rices. This early rice was cultivated alongside collection of wild staple foods, especially acorns (Quercus/Lithicarpus sensu lato. In later periods the sites has evidence for mixed farming of both rice and millets (Setaria italica and Panicum miliaceum. Soybean appears on the site in the Shijiahe period (ca.2500 BC and wheat (Triticum cf. aestivum in the Late Longshan levels (2200-1800 BC. Weed flora suggests an intensification of rice agriculture over time with increasing evidence of wetland weeds. We interpret these data as indicating early opportunistic cultivation of alluvial floodplains and some rainfed rice, developing into more systematic and probably irrigated cultivation starting in the Yangshao period, which intensified in the Qujialing and Shijiahe period, before a shift back to an emphasis on millets with the Late Longshan cultural influence from the north.
Maike Achterberg, Inke Elisabeth; Eckstein, Jan; Birkholz, Bernhard; Bauerochse, Andreas; Leuschner, Hanns Hubert
2018-01-01
The investigated northwest German mire site at Totes Moor is densely covered with subfossil pine stumps (Pinus sylvestris L.) from the fen-bog transition. This facilitates the spatio-temporal reconstruction of mire development, which is based on 212 in situ tree stumps in the case study presented here. Six dendrochronologically dated site chronologies together cover 2345 years between 6703 and 3403 BC. The gaps in between are 6 to 550 years long. Additionally, a floating chronology of 309 years, containing 30 trees, was radiocarbon-dated to the beginning of the 7th millennium cal BC. Peat-stratigraphical survey was carried out additionally, and elevations a.s.l. were determined at several locations. Tree dying-off phases, which indicate water level rise at the site, mostly in context of the local fen-bog transition, are evident for ca. 6600-6450, ca. 6350-5750, ca. 5300-4900, ca. 4700-4550, ca. 3900-3850, ca. 3700-3600, ca. 3500-3450 and ca. 3400 BC. The spatial distribution of the dated in situ trees illustrates the phase-wise expansion of raised bog over fen peat at the site. The documented bog expansion pulses likely correspond to climatic wet sifts.
Arnaud-Fassetta, Gilles; De Beaulieu, Jacques-Louis; Suc, Jean-Pierre; Provansal, Mireille; Williamson, David; Leveau, Philippe; Aloïsi, Jean-Claude; Gadel, François; Giresse, Pierre; Oberlin, Christine; Duzer, Danièle
The overall objective of this paper is to describe the late Holocene (1640-100 BC) sedimentary and biological evolution of the Rhône-delta-plain, to interpret the sedimentary facies and palynofacies as the result of the effects of fluvial dynamic fluctuations and relative sea level change and to evaluate the paleohydrological constraints in the development of the land use and settlements of the Camargue. Focus is made on the upper part of V III core drilled on NE of the Vaccarès lagoon. By combining sedimentology, palynology, magnetic susceptibility and archeological data, this study allowed to identify the superposition of three types of paleo-environments (marsh, fluvial floodplain, levee/crevasse splay). This sequence indicates a gradual extension of fluvial environments between the end of the second millennium BC and the 1st century BC. The variability of fluvial dynamic is evident during this period with important flood events which contrast with periods of low flow. Pollen record can be a good marker of the fluvial dynamic variability. The expression of the riparian tree pollen grains in the coarser floodplain deposits could correspond to increased fluvial influence and probably to erosion of riverbank during flood events. The local plants are associated to the low energy sedimentary environments. Focuses are made on the relations between the evolution of the environment and land use. The development of the cereal culture in the floodplain of the Rhône delta has been demonstrated between 1640-1410 and 100 BC. The last alluviation of the Rhône perturbs the research of the archaeological sites in the central part of the delta but the existence of the rural villages from the first part of the first millennium BC is highly possible.
Guidance document to the BC emission offsets regulation
International Nuclear Information System (INIS)
2010-11-01
British Columbia's (BC) emission offset regulations were established under the Greenhouse Gas Reduction Targets Act passed in 2007. Targets for greenhouse gas (GHG) emission reductions included a 6 percent reduction by 2012; an 18 percent reduction by 2016; a 33 percent reduction by 2020; and an 80 percent reduction by 2050. Carbon neutral agreements began in 2008, and covered emissions produced from government business travel and by provincial government ministries and agencies. This report presented a list of key recommendations developed by the Pacific Carbon Trust for use in future carbon offset projects. Recommendations included the use of correct emission factors when quantifying projected emission reductions from an offset project; the use of a robust data management system; and the use of evidence in supporting additionality arguments. The document outlined planning procedures for project baseline selection processes, protocol selections, and the identification of sources sinks and reservoirs. Issues related to quantification and measurements, emissions factors, and accuracy and uncertainty were also addressed. Validation, verification, and contracting options were also presented. 6 tabs., 3 figs.
Distribution automation at BC Hydro : a case study
Energy Technology Data Exchange (ETDEWEB)
Siew, C. [BC Hydro, Vancouver, BC (Canada). Smart Grid Development Program
2009-07-01
This presentation discussed a distribution automation study conducted by BC Hydro to determine methods of improving grid performance by supporting intelligent transmission and distribution systems. The utility's smart grid program includes a number of utility-side and customer-side applications, including enabled demand response, microgrid, and operational efficiency applications. The smart grid program will improve reliability and power quality by 40 per cent, improve conservation and energy efficiency throughout the province, and provide enhanced customer service. Programs and initiatives currently underway at the utility include distribution management, smart metering, distribution automation, and substation automation programs. The utility's automation functionality will include fault interruption and locating, restoration capability, and restoration success. A decision support system has also been established to assist control room and field operating personnel with monitoring and control of the electric distribution system. Protection, control and monitoring (PCM) and volt VAR optimization upgrades are also planned. Reclosers are also being automated, and an automation guide has been developed for switches. tabs., figs.
Power system data communication architecture at BC Hydro
Energy Technology Data Exchange (ETDEWEB)
Struyk, E.
2001-07-01
Development of a power system data communication architecture (PSDCA) at British Columbia Hydro that enables authorized corporate users to access station-intelligent electronic devices (IEDs) for power system data in non real-time, without compromising the reliability and availability of the real-time SCADA systems, is described. Also discussed is the development of major upgrade initiatives for expanding the use of intelligent electronic devices and remote terminal units (RTUs) which report to the main System Control Centre at Burnaby, BC, and to the four Area Control Centres located throughout the province. The network architecture that incorporates industry standards for PSDCA also provides an opportunity to existing network security systems against electronic threats such as hackers and saboteurs, beyond the simple methods of single or two-level passwords of existing protection control and monitoring equipment systems. The virtual private network (VPN) technology built into the PSDCA will allow secure access to station IED data by corporate users to access their own power data in a secure and reliable fashion. 4 figs.
Mining lore : Chinese labourers in BC's coal mines
Energy Technology Data Exchange (ETDEWEB)
Baldwin, C.
2010-09-15
This article presented a historical review of Chinese labourers in Canada's industries and how they were often exploited and treated poorly. The 1860 gold rush in British Columbia attracted the first labourers from China. More labourers followed, the majority male, to work in the coal mines around Nanaimo. More than half the employees at coal baron Robert Dunsmuir's Wellington mine on Vancouver Island were Chinese labourers who worked under conditions and wages that other miners would not accept. During a large strike at the Wellington Mine in 1883, the striking white miners were replaced with Chinese from Victoria, which contributed to a brewing anti-Chinese sentiment. The striking miners eventually withdrew their demand for higher wages, insisting only that Dunsmuir rid his mine of the Chinese. Dunsmuir refused, held out, and broke the strike. When an anti-immigration bill was passed in 1884 by the British Columbia (BC) Legislative Assembly, the Canadian government stepped in, only to hire thousands of Chinese labourers to work on the railway. Their low wages saved contractors $3 million, making construction economically feasible. However, just a few weeks after blocking BC's anti-immigration bill, the Canadian government passed a Chinese Immigration Act that would come into effect only after construction was completed. The Act restricted and regulated Chinese immigration, and imposed a head tax on any Chinese entering the country, making it unaffordable to bring a wife and family to Canada. When the railroad was completed, thousands of Chinese labourers were left unemployed with nowhere to go. In 1887, an explosion at a Nanaimo mine killed 150 employees. The miners blamed the Chinese, claiming that their lack of English made them a safety hazard. By the early 1920s, the Chinese community in Victoria formed the Chinese Benevolent Association to provide general welfare assistance and oppose discriminatory laws. In 2006, the Canadian government
Digital Repository Service at National Institute of Oceanography (India)
Gaur, A.S.; Sundaresh; Tripati, S.
Poompuhar, a celebrated port town of Sangam period (300 BC to 400 AD) was the capital of famous Chola dynasty during early centuries of Christian Era. Onshore explorations brought to light a few brick structures and terracotta ring wells, besides a...
Análisis filogénetico del género Pseudopaludicola (Anura: Leptodactylidae
Directory of Open Access Journals (Sweden)
Lobo, Fernando
1995-01-01
Full Text Available Las relaciones filogenéticas entre las especies del género Pseudopaludicola son analizadas en base a caracteres externos y osteológicos. Se estudiaron once especies de Physalaemus las que fueron empleadas como grupo externo en análisis donde se trataron ambos géneros en conjunto. Se hicieron corridas enraizando alternativamente en las distintas especies de Physalaemus y sumando además a Leplodactylus en la matriz verificándose la monofilia del género Pseudopaludicola. Como resultado de este análisis se obtuvieron tres topologias de relaciones entre las especies del género, siendo el consenso estricto: (ternelsi mineira (sallica falcipes(myslacalis (pusilla (boliviana (ceralophyes /lanera. En este trabajo se apoya la monofilia del grupo pusilla proponiéndose una hipótesis distinta de relaciones entre sus integrantes a la propuesta por Lynch (1989. Phylogenetics relationships between ftogs of the leptodactylid genus Pseudopaludicola are analyzed using both osteological and external characters. Some species of Physalaemus (eleven are included in the analysis with Pseudopaludicola. Rooting with Leptodactylus or with any species of Physalaemus the monophyly ofthe genus is maintained. Three different trees for Pseudopaludicola were obtained, their strict consensus is: (temetzi mineira (saltica falcipes (mystacalis (pusilla (boliviana (ceratophyes /lanera. According to Lynch (1989 the pusilla group is monophyletic, but the internal arrangement among its species is different in this analysis.
Heritable Variation in Quinone-Induced Haustorium Development in the Parasitic Plant Triphysaria1
Jamison, Denneal S.; Yoder, John I.
2001-01-01
We are using the facultative hemiparasite, Triphysaria, as a model for studying host-parasite signaling in the Scrophulariaceae. Parasitic members of this family form subterranean connections, or haustoria, on neighboring host roots to access host water and nutrients. These parasitic organs develop in response to haustorial-inducing factors contained in host root exudates. A well-characterized inducing factor, 2, 6-dimethoxy-p-benzoquinone (DMBQ), can be used to trigger in vitro haustorium formation in the roots of Triphysaria. We have assayed three species, Triphysaria eriantha (Benth.) Chuang and Heckard, Triphysaria pusilla (Benth.) Chuang and Heckard, and Triphysaria versicolor Fischer and C. Meyer, for haustorium development in response to DMBQ. There were significant differences between the species in their ability to recognize and respond to this quinone. Ninety percent of T. versicolor individuals responded, whereas only 40% of T. pusilla and less than 10% of T. eriantha formed haustoria. Within field collections of self-pollinating T. pusilla, differential responsiveness to DMBQ was seen in distinct maternal families. Assaying haustorium development in subsequent generations of self-pollinated T. pusilla showed that DMBQ responsiveness was heritable. Reciprocal crosses between T. eriantha and T. versicolor demonstrated that DMBQ responsiveness was influenced by maternal factors. These results demonstrate heritable, natural variation in the recognition of a haustorial-inducing factor by a parasitic member of the Scrophulariaceae. PMID:11299366
Neutron detection and applications using a BC454/BGO array
Energy Technology Data Exchange (ETDEWEB)
Miller, M.C.; Biddle, R.S.; Bourret, S.C.; Byrd, R.C.; Ensslin, N.; Feldman, W.C.; Kuropatwinski, J.J.; Longmire, J.L.; Krick, M.S.; Mayo, D.R.; Russo, P.A.; Sweet, M.R
1999-02-11
Neutron detection and multiplicity counting has been investigated using a boron-loaded plastic scintillator/bismuth germanate phoswich detector array. The boron-loaded plastic combines neutron moderation (H) and detection ({sup 10}B) at the molecular level, thereby physically coupling increasing detection efficiency and decreasing die-away time with detector volume. Separation of the phoswich response into its plastic scintillator and bismuth germanate components was accomplished on an event-by-event basis using custom integrator and timing circuits, enabling a prompt coincidence requirement between the BC454 and BGO to be used to identify neutron captures. In addition, a custom time-tag module was used to provide a time for each detector event. Time-correlation analysis was subsequently performed on the filtered event stream to obtain shift-register-type singles and doubles count rates.
Neutron detection and applications using a BC454/BGO array
International Nuclear Information System (INIS)
Miller, M.C.; Biddle, R.S.; Bourret, S.C.; Byrd, R.C.; Ensslin, N.; Feldman, W.C.; Kuropatwinski, J.J.; Longmire, J.L.; Krick, M.S.; Mayo, D.R.; Russo, P.A.; Sweet, M.R.
1999-01-01
Neutron detection and multiplicity counting has been investigated using a boron-loaded plastic scintillator/bismuth germanate phoswich detector array. The boron-loaded plastic combines neutron moderation (H) and detection ( 10 B) at the molecular level, thereby physically coupling increasing detection efficiency and decreasing die-away time with detector volume. Separation of the phoswich response into its plastic scintillator and bismuth germanate components was accomplished on an event-by-event basis using custom integrator and timing circuits, enabling a prompt coincidence requirement between the BC454 and BGO to be used to identify neutron captures. In addition, a custom time-tag module was used to provide a time for each detector event. Time-correlation analysis was subsequently performed on the filtered event stream to obtain shift-register-type singles and doubles count rates
Haeyen, S.W.; Hooren, S. van; Hutschemaekers, G.J.M.
2015-01-01
Art therapy (AT) is frequently used in the treatment of patients diagnosed with cluster B/C personality disorders, but there is little evidence for its efficacy. This study aimed to provide insight into the perceived effects of AT. We interviewed 29 adult patients in individual and focus-group
Kluiving, S.J.; Bekkema, M.; Roymans, N.G.A.M.
2015-01-01
Long-term archaeological data gathering in the southern Netherlands may deliver an unprecedented regional comparison that could be exemplary for the Pleistocene sand areas of the Northwest European Plain. On a micro-scale level, it has become clear that Bronze Age (2000-800 BC) and Iron Age (800-12
Directory of Open Access Journals (Sweden)
Irfan Hussain
2018-06-01
Full Text Available This research work aims at realizing a new compliant robotic actuator for safe human-robotic interaction. In this paper, we present the modeling, control, and numerical simulations of a novel Binary-Controlled Variable Stiffness Actuator (BcVSA aiming to be used for the development of a novel compliant robotic manipulator. BcVSA is the proof of concept of the active revolute joint with the variable recruitment of series-parallel elastic elements. We briefly recall the basic design principle which is based on a stiffness varying mechanism consisting of a motor, three inline clutches, and three torsional springs with stiffness values (K0, 2K0, 4K0 connected to the load shaft and the motor shaft through two planetary sun gear trains with ratios (4:1, 4:1 respectively. We present the design concept, stiffness and dynamic modeling, and control of our BcVSA. We implemented three kinds of Multiple Model Predictive Control (MPC to control our actuator. The main motivation of choosing this controller lies in the fact that working principle of multiple MPC and multiple states space representation (stiffness level of our actuator share similar interests. In particular, we implemented Multiple MPC, Multiple Explicit MPC, and Approximated Multiple Explicit MPC. Numerical simulations are performed in order to evaluate their effectiveness for the future experiments on the prototype of our actuator. The simulation results showed that the Multiple MPC, and the Multiple Explicit MPC have similar results from the robustness point of view. On the other hand, the robustness performance of Approximated Multiple Explicit MPC is not good as compared to other controllers but it works in the offline framework while having the capability to compute the sub-optimal results. We also performed the comparison of MPC based controllers with the Computed Torque Control (CTC, and Linear Quadratic Regulator (LQR. In future, we are planning to test the presented approach on the
International Nuclear Information System (INIS)
Druce, D.
2004-01-01
BC Hydro's installed generation capacity as of March 31, 2003 was 11,103 MW, of which 90 per cent was hydro power, 9 per cent was gas-fired and 1 per cent was non-integrated. The hydroelectric plants belong to one of three groups, the Peace River, Columbia River or small hydro which includes small to moderate sized-plants. Small hydro is controlled by hydrologic regime and storage limitations rather than by system requirements. The installed capacity for the 4 plants on the Columbia River totals 4,722 MW. The installed capacity at the 2 plants on the Peace River totals 3,424 MW. Both watersheds are subject to interior climate conditions with significant inflows from snowmelt and rainfall runoff. This presentation addressed the issue of mid-term hydro scheduling and its impact on markets. For the past 15 years, BC Hydro has used the marginal cost model for electricity trade and for operations planning. The model considers system loads and resources, and maximizes the expected net revenue over a planning horizon of 6 years. A marginal value of water stored in the Williston Reservoir has been established using the marginal cost model. The affect of weather, natural gas prices and water supply on hydro generation was also discussed. It was noted that information on spot market electricity prices has significantly improved since the electric power industry was deregulated in 1996. tabs., figs
Xu, Cheng; Yang, Chunxia; Zhang, Aixia; Xu, Yong; Li, Xinrong; Liu, Zhifen; Liu, Sha; Sun, Ning; Zhang, Kerang
2017-06-09
Previous studies have shown that microRNAs(miRNAs) are involved in the pathogenesis of MDD; in particular, miR-34b/c has been implicated in MDD risk and found to exert antidepressant effects. However, the effects of miR-34b/c polymorphisms on MDD risk have not been investigated. In this study, we evaluated the effect of miR-34b/c gene polymorphisms and their interaction with negative life events in relation to MDD, using data from 381 Han Chinese patients with MDD and 291 healthy volunteers. Allelic, genotypic, haplotypic, and gene-environment associations were analyzed using UNPHASED and SPSS software. After discarding data with extremely severe negative life events in our study population, we found an association between rs4938723, rs2187473 polymorphisms and MDD in the dominant models (TC/CC vs. TT, OR=1.45, P=0.027; TC/CC vs. TT, OR=3.32, P=0.030). In haplotype analysis, the C-G haplotype (rs4938723/rs28757623) showed the strongest association with MDD (OR=1.95, P=0.026). Additionally, we found significant gene-environment combination rs4938723 C allele, rs28757623 G allele and high level of negative life events (C-G-HN) was significantly associated with MDD (OR, 3.85; 95% CI, 1.62-9.13). In addition, the combination of (C-C-HN) is of significance (OR, 2.99; 95% CI, 1.36-6.60), indicating that the rs28757623 C allele may contribute to the risk of MDD as well. The sample size was small and the role of miR-34b/c polymorphisms for MDD should be assessed using independent samples from other ethnic populations. Our results suggest that miR-34b/c is a susceptibility factor for MDD stratified by negative life events and that rs4938723 is a significant association locus for gene-environment interaction in relation to MDD risk. Copyright © 2017 Elsevier B.V. All rights reserved.
DEFF Research Database (Denmark)
Poyry, S.; Cramariuc, O.; Postila, P. A.
2013-01-01
by both ensuring the structural integrity of the protein complex and also by taking part in the proton uptake. Yet, the atom-scale understanding of these highly charged four-tail lipids in the cyt bc(1) function has remained quite unclear. We consider this issue through atomistic molecular dynamics...... the description of the role of the surrounding lipid environment: in addition to the specific CL-protein interactions, we observe the protein domains on the positive side of the membrane to settle against the lipids. Altogether, the simulations discussed in this article provide novel views into the dynamics...... simulations that are applied to the entire cyt bc(1) dimer of the purple photosynthetic bacterium Rhodobacter capsulatus embedded in a lipid bilayer. We find CLs to spontaneously diffuse to the dimer interface to the immediate vicinity of the higher potential heme b groups of the complex's catalytic Q...
Deng, Zhenhua; Qin, Ling; Gao, Yu; Weisskopf, Alison Ruth; Zhang, Chi; Fuller, Dorian Q.
2015-01-01
Baligang is a Neolithic site on a northern tributary of the middle Yangtze and provides a long archaeobotanical sequence from the Seventh Millennium BC upto the First Millennium BC. It provides evidence for developments in rice and millet agriculture influenced by shifting cultural affiliation with the north (Yangshao and Longshan) and south (Qujialing and Shijiahe) between 4300 and 1800 BC. This paper reports on plant macro-remains (seeds), from systematic flotation of 123 samples (1700 litres), producing more than 10,000 identifiable remains. The earliest Pre-Yangshao occupation of the sites provide evidence for cultivation of rice (Oryza sativa) between 6300–6700 BC. This rice appears already domesticated in on the basis of a dominance of non-shattering spikelet bases. However, in terms of grain size changes has not yet finished, as grains are still thinner than more recent domesaticated rice and are closer in grain shape to wild rices. This early rice was cultivated alongside collection of wild staple foods, especially acorns (Quercus/Lithicarpus sensu lato). In later periods the sites has evidence for mixed farming of both rice and millets (Setaria italica and Panicum miliaceum). Soybean appears on the site in the Shijiahe period (ca.2500 BC) and wheat (Triticum cf. aestivum) in the Late Longshan levels (2200–1800 BC). Weed flora suggests an intensification of rice agriculture over time with increasing evidence of wetland weeds. We interpret these data as indicating early opportunistic cultivation of alluvial floodplains and some rainfed rice, developing into more systematic and probably irrigated cultivation starting in the Yangshao period, which intensified in the Qujialing and Shijiahe period, before a shift back to an emphasis on millets with the Late Longshan cultural influence from the north. PMID:26460975
Atmospheric CO2 promoted synthesis of N-containing heterocycles over B(C6F5)3 catalyst
International Nuclear Information System (INIS)
Xiang Gao; Bo Yu; Qingqing Mei; Zhenzhen Yang; Yanfei Zhao; Hongye Zhang; Leiduan Hao, Zhimin Liu
2016-01-01
B(C 6 F 5 ) 3 combined with atmospheric CO 2 was found to be highly effective for the cyclization of ortho substituted aniline derivatives with N,N-dimethylformamide (DMF), and a series of N-containing heterocycles including benzothiazoles, benzimidazoles, quinazolinone and benzoxazole were obtained in good to excellent yields. (authors)
Ronmark, Tracy
2005-01-01
BC's protected areas system has recently doubled in size as a result of land use planning across the province. Managing protected areas to meet many goals requires thoughtful planning that involves stakeholder participation and dispute resolution through the plan development and implementation stages. This research identifies the best practices for planning and evaluates protected areas management planning processes based on those criteria. Evaluative criteria were developed from a literature...
Energy Technology Data Exchange (ETDEWEB)
Thomas, J. L. [LATMOS/IPSL, UPMC University Paris 6 Sorbonne Universités, UVSQ, CNRS, Paris France; Polashenski, C. M. [USACE-CRREL, Fort Wainwright Alaska USA; Thayer School of Engineering, Dartmouth College, Hanover New Hampshire USA; Soja, A. J. [National Institute of Aerospace, NASA Langley Research Center, Hampton Virginia USA; Marelle, L. [Center for International Climate and Environmental Research-Oslo (CICERO), Oslo Norway; Casey, K. A. [Thayer School of Engineering, Dartmouth College, Hanover New Hampshire USA; Cryospheric Sciences Laboratory, NASA Goddard Space Flight Center, Greenbelt Maryland USA; Choi, H. D. [National Institute of Aerospace, NASA Langley Research Center, Hampton Virginia USA; Raut, J. -C. [LATMOS/IPSL, UPMC University Paris 6 Sorbonne Universités, UVSQ, CNRS, Paris France; Wiedinmyer, C. [National Center for Atmospheric Research, Boulder Colorado USA; Emmons, L. K. [National Center for Atmospheric Research, Boulder Colorado USA; Fast, J. D. [Pacific Northwest National Laboratory, Richland Washington USA; Pelon, J. [LATMOS/IPSL, UPMC University Paris 6 Sorbonne Universités, UVSQ, CNRS, Paris France; Law, K. S. [LATMOS/IPSL, UPMC University Paris 6 Sorbonne Universités, UVSQ, CNRS, Paris France; Flanner, M. G. [Department of Climate and Space Sciences and Engineering, University of Michigan, Ann Arbor Michigan USA; Dibb, J. E. [Earth Systems Research Center, EOS, University of New Hampshire, Durham New Hampshire USA
2017-08-05
We identify an important Black Carbon (BC) aerosol deposition event that was observed in snow stratigraphy and dated to between 27 July 2013 – 2 August 2013. This event comprises a significant portion (~60%) of total deposition over a 10 month period (July 2013 – April 2014). Here we link this event to forest fires burning in Canada during summer 2013 using modeling and remote sensing tools. Aerosols were detected by both the CALIOP and MODIS instruments during transport between Canada and Greenland, confirming that this event involved emissions from forest fires in Canada. We use high-resolution regional chemical transport mod-eling (WRF-Chem) combined with high-resolution fire emissions (FINNv1.5) to study aerosol emissions, transport, and deposition during this event. The model accurately captures the timing of the BC deposition event and shows that the major contribution to deposition during this event is emissions originating from fires in Canada. However, the model under-predicts aerosol deposition compared to measurements at all sites by a factor of 2–100. Under-prediction of modeled BC deposition originates from uncertainties in fire emissions combined with uncertainties in aerosol scavenging by clouds. This study suggests that it is possible to describe the transport of an exceptional smoke event on regional and continental scales. Improvements in model descriptions of precipitation scavenging and emissions from wildfires are needed to correctly predict deposition, which is critical for determining the climate impacts of aerosols that originate from fires.
International Nuclear Information System (INIS)
Tamura, N.; Agrawal, D.K.; Townley, R.G.
1987-01-01
The authors studied the characteristics of the leukotriene (LT) C 4 and D 4 receptors on a cultured smooth muscle cell line, BC3H-1. Specific [ 3 H]LTC 4 binding to the cell membrane was greater than 80% of total binding and saturable at a density of 3.96 +/- 0.39 pmol/mg protein, with an apparent dissociation constant(Kd) of 14.3 +/- 2.0 nM (n=9). The association and dissociation of [ 3 H]LTC 4 binding were rapid and apparent equilibrium conditions were established within 5 min. Calculated Kd value of [ 3 H]LTC binding from the kinetic analysis was 9.9 nM. From the competition analysis, calculated Ki value of unlabeled LTC 4 to compete for the specific binding of [ 3 H]LTC 4 was 9.2 nM and was in good agreement with the Kd value obtained from the Scatchard plots or kinetic analysis. The maximum number of binding sites (Bmax) of [ 3 H]LTD 4 in the membrane of BC3H-1 cell line was about 11 times lower than that of the [ 3 H]LTC 4 . The calculated values of Kd and Bmax of [ 3 H]LTD 4 binding were 9.3 +/- 0.8 nM and 0.37 +/- 0.04 pmol/mg proteins, respectively (n=3). These findings demonstrate that BC3H-1 cell line possess both LTC 4 and LTD 4 receptors with a predominance of LTC 4 receptors. Thus, BC3H-1 cell line is a good model to study the regulation of LTC 4 and LTD 4 receptors. 34 references, 5 figures, 1 table
Hadzi-Petrushev, Nikola; Bogdanov, Jane; Krajoska, Jovanka; Ilievska, Jovana; Bogdanova-Popov, Biljana; Gjorgievska, Elizabeta; Mitrokhin, Vadim; Sopi, Ramadan; Gagov, Hristo; Kamkin, Andre; Mladenov, Mitko
2018-03-15
To test the antioxidant properties of the newly synthesized (2E,6E)-2,6-bis(2-bromobenzylidene)cyclohexanone (B2BrBC) in parallel with C66 in rats with cardiac hypertrophy. The protective effects of both C66 and B2BrBC against oxidative stress in rats with cardiac hypertrophy, was studied by evaluating the activity of antioxidant enzymes, the relationship between the ratio of the activities of the antioxidant enzymes R = SOD/(GPx + CAT) and levels of thiols and lipid peroxidation in the heart. In order to gain better understanding of the antioxidant properties of the studied compounds, computational methods were utilized. The properties of selected structurally related derivatives were obtained on optimized geometries for ground states, using semi-empirical PM3 quantum mechanical calculations. The ratio R shows disequilibrium in rats with induced hypertrophy (p antioxidant. The obtained results indicated that the antioxidant ability of B2BrBC is positively associated with the catalytic SOD and GPx activities expressed through preserved t-SH levels. It seems plausible that for a compound to exhibit antioxidant activity, as most of the 2,6-bis(benzylidene)cyclohexanones do, they should be good electron donors. Understanding the relationship between cardiac hypertrophy induced oxidative injuries and supporters of endogenous reparatory machinery will help in establishing the beneficial role of adequate antioxidant supplementation. In this study reliable data on the preventive effects of newly synthesized symmetric monocarbonyl curcumin analogue B2BrBC and its role in the prevention of oxidative injuries on three levels (enzymatic, protein and lipid), in the heart hypertrophic onset, were obtained. Copyright © 2018 Elsevier Inc. All rights reserved.
Wei, Yangdou; Shih, Jenny; Li, Jieran; Goodwin, Paul H
2002-07-01
Two pectin lyase genes, designated pnl-1 and pnl-2, were cloned from Colletotrichum gloeosporioides f. sp. malvae, a pathogen of round-leaved mallow (Malva pusilla). pnl-1 was isolated using cDNA from infected plant material; pnl-2 was isolated using cDNA from 3-day-old mycelia grown in mallow-cell-wall extract (MCWE) broth. pnl-1 is the first pectinase gene described thus far to encode a cellulose-binding domain (CBD), which is common in cellulases and xylanases, whereas pnl-2 encodes a pectin lyase that lacks a CBD. In pure culture, pnl-1 expression could be detected when purified pectin or glucose was the sole carbon source, but not when MCWE was the sole carbon source. The lack of pnl-1 expression appeared to be due to gene repression by some unknown factor(s) in the cell-wall extract. In contrast, expression of pnl-2 was detected in cultures when MCWE, but not when purified pectin or glucose, was the sole carbon source. In infected tissue, detection of pnl-1 expression by Northern-blot hybridization and by RT-PCR began with the onset of the necrotrophic phase of infection. Expression ofpnl-2 was not detectable by Northern-blot hybridization, but was observed byRT-PCR in both the biotrophic and necrotrophic phases of infection. The differences between pnl-1 and pnl-2 (i.e. pnl-1 encoding a CBD and differences in the expression patterns of both genes) may be related to the requirements of C. gloeosporioides f. sp. malvae to be able to grow in host tissue under the different conditions present during the biotrophic and necrotrophic phases of infection.
Clarke, Joanne; Brooks, Nick; Banning, Edward B.; Bar-Matthews, Miryam; Campbell, Stuart; Clare, Lee; Cremaschi, Mauro; di Lernia, Savino; Drake, Nick; Gallinaro, Marina; Manning, Sturt; Nicoll, Kathleen; Philip, Graham; Rosen, Steve; Schoop, Ulf-Dietrich; Tafuri, Mary Anne; Weninger, Bernhard; Zerboni, Andrea
2016-03-01
This paper explores the possible links between rapid climate change (RCC) and social change in the Near East and surrounding regions (Anatolia, central Syria, southern Israel, Mesopotamia, Cyprus and eastern and central Sahara) during the 'long' 4th millennium (∼4500-3000) BC. Twenty terrestrial and 20 marine climate proxies are used to identify long-term trends in humidity involving transitions from humid to arid conditions and vice versa. The frequency distribution of episodes of relative aridity across these records is calculated for the period 6300-2000 BC, so that the results may be interpreted in the context of the established arid episodes associated with RCC around 6200 and 2200 BC (the 8.2 and 4.2 kyr events). We identify two distinct episodes of heightened aridity in the early-mid 4th, and late 4th millennium BC. These episodes cluster strongly at 3600-3700 and 3100-3300 BC. There is also evidence of localised aridity spikes in the 5th and 6th millennia BC. These results are used as context for the interpretation of regional and local archaeological records with a particular focus on case studies from western Syria, the middle Euphrates, southern Israel and Cyprus. Interpretation of the records involves the construction of plausible narratives of human-climate interaction informed by concepts of adaptation and resilience from the literature on contemporary (i.e. 21st century) climate change and adaptation. The results are presented alongside well-documented examples of climatically-influenced societal change in the central and eastern Sahara, where detailed geomorphological studies of ancient environments have been undertaken in tandem with archaeological research. While the narratives for the Near East and Eastern Mediterranean remain somewhat speculative, the use of resilience and adaptation frameworks allows for a more nuanced treatment of human-climate interactions and recognises the diversity and context-specificity of human responses to climatic
Pertussis toxin treatment attenuates some effects of insulin in BC3H-1 murine myocytes
International Nuclear Information System (INIS)
Luttrell, L.M.; Hewlett, E.L.; Romero, G.; Rogol, A.D.
1988-01-01
The effects of pertussis toxin (PT) treatment on insulin-stimulated myristoyl-diacylglycerol (DAG) generation, hexose transport, and thymidine incorporation were studied in differentiated BC3H-1 mycocytes. Insulin treatment caused a biphasic increase in myristoyl-DAG production which was abolished in myocytes treated with PT. There was no effect of PT treatment on basal (nonstimulated) myristoyl-DAG production. Insulin-stimulated hydrolysis of a membrane phosphatidylinositol glycan was blocked by PT treatment. ADP-ribosylation of BC3H-1 plasma membranes with [ 32 P]NAD revealed a 40-kDa protein as the major PT substrate in vivo and in vitro. The time course and dose dependence of the effects of PT on diacylglycerol generation correlated with the in vivo ADP-ribosylation of the 40-kDa substrate. Pertussis toxin treatment resulted in a 71% attenuation of insulin-stimulated hexose uptake without effect on either basal or phorbol ester-stimulated uptake. The stimulatory effects of insulin and fetal calf serum on [ 3 H]thymidine incorporation into quiescent myocytes were attenuated by 61 and 59%, respectively, when PT was added coincidently with the growth factors. Nonstimulated and EGF-stimulated [ 3 H]thymidine incorporation was unaffected by PT treatment. These data suggest that a PT-sensitive G protein is involved in the cellular signaling mechanisms of insulin
Directory of Open Access Journals (Sweden)
Uram Ł
2015-09-01
Full Text Available Łukasz Uram,1 Magdalena Szuster,1 Aleksandra Filipowicz,2 Krzysztof Gargasz,3 Stanisław Wołowiec,3 Elżbieta Wałajtys-Rode4 1Bioorganic Chemistry Laboratory, Faculty of Chemistry, Rzeszow University of Technology, 2Cosmetology Department, University of Information Technology and Management in Rzeszow, 3Institute of Nursery and Health Sciences, Faculty of Medicine, University of Rzeszow, Rzeszow, 4Department of Drug Technology and Biotechnology, Faculty of Chemistry, Warsaw University of Technology, Warsaw, Poland Abstract: The intracellular localization and colocalization of a fluorescently labeled G3 amine-terminated cationic polyamidoamine (PAMAM dendrimer and its biotin–pyridoxal (BC-PAMAM bioconjugate were investigated in a concentration-dependent manner in normal human fibroblast (BJ and squamous epithelial carcinoma (SCC-15 cell lines. After 24 hours treatment, both cell lines revealed different patterns of intracellular dendrimer accumulation depending on their cytotoxic effects. Cancer cells exhibited much higher (20-fold tolerance for native PAMAM treatment than fibroblasts, whereas BC-PAMAM was significantly toxic only for fibroblasts at 50 µM concentration. Fibroblasts accumulated the native and bioconjugated dendrimers in a concentration-dependent manner at nontoxic range of concentration, with significantly lower bioconjugate loading. After reaching the cytotoxicity level, fluorescein isothiocyanate-PAMAM accumulation remains at high, comparable level. In cancer cells, native PAMAM loading at higher, but not cytotoxic concentrations, was kept at constant level with a sharp increase at toxic concentration. Mander’s coefficient calculated for fibroblasts and cancer cells confirmed more efficient native PAMAM penetration as compared to BC-PAMAM. Significant differences in nuclear dendrimer penetration were observed for both cell lines. In cancer cells, PAMAM signals amounted to ~25%–35% of the total nuclei area at all
The Origins of Greek Civilization: From the Bronze Age to the Polis ca. 2500-600 B.C.
Himmell, Rhoda; And Others
This document consists of three units in which students study and compare the two civilizations of ancient Greece, that of the Greek kingdoms of the second millennium B.C. and the city states of historical Greece, and learn how historians use archaeological evidence to reconstruct the history of Mycenaean Greece. Suggestions are included for…
Janjua, Naveed Zafar; Kuo, Margot; Chong, Mei; Yu, Amanda; Alvarez, Maria; Cook, Darrel; Armour, Rosemary; Aiken, Ciaran; Li, Karen; Mussavi Rizi, Seyed Ali; Woods, Ryan; Godfrey, David; Wong, Jason; Gilbert, Mark; Tyndall, Mark W; Krajden, Mel
2016-01-01
The British Columbia (BC) Hepatitis Testers Cohort (BC-HTC) was established to assess and monitor hepatitis C (HCV) epidemiology, cost of illness and treatment effectiveness in BC, Canada. In this paper, we describe the cohort construction, data linkage process, linkage yields, and comparison of the characteristics of linked and unlinked individuals. The BC-HTC includes all individuals tested for HCV and/or HIV or reported as a case of HCV, hepatitis B (HBV), HIV or active tuberculosis (TB) in BC linked with the provincial health insurance client roster, medical visits, hospitalizations, drug prescriptions, the cancer registry and mortality data using unique personal health numbers. The cohort includes data since inception (1990/1992) of each database until 2012/2013 with plans for annual updates. We computed linkage rates by year and compared the characteristics of linked and unlinked individuals. Of 2,656,323 unique individuals available in the laboratory and surveillance data, 1,427,917(54%) were included in the final linked cohort, including about 1.15 million tested for HCV and about 1.02 million tested for HIV. The linkage rate was 86% for HCV tests, 89% for HCV cases, 95% for active TB cases, 48% for HIV tests and 36% for HIV cases. Linkage rates increased from 40% for HCV negatives and 70% for HCV positives in 1992 to ~90% after 2005. Linkage rates were lower for males, younger age at testing, and those with unknown residence location. Linkage rates for HCV testers co-infected with HIV, HBV or TB were very high (90-100%). Linkage rates increased over time related to improvements in completeness of identifiers in laboratory, surveillance, and registry databases. Linkage rates were higher for HCV than HIV testers, those testing positive, older individuals, and females. Data from the cohort provide essential information to support the development of prevention, care and treatment initiatives for those infected with HCV.
Sunahori, Fumie X.; Nagarajan, Ramya; Clouthier, Dennis J.
2015-12-01
The cold boron carbide free radical (BC X 4Σ-) has been produced in a pulsed discharge free jet expansion using a precursor mixture of trimethylborane in high pressure argon. High resolution laser induced fluorescence spectra have been obtained for the B 4Σ--X 4Σ- and E 4Π-X 4Σ- band systems of both 11BC and 10BC. An optical-optical double resonance (OODR) scheme was implemented to study the finer details of both band systems. This involved pumping a single rotational level of the B state with one laser and then recording the various allowed transitions from the intermediate B state to the final E state with a second laser by monitoring the subsequent E-X ultraviolet fluorescence. In this fashion, we were able to prove unambiguously that, contrary to previous studies, the spin-spin constant λ is negative in the ground state and positive in the B 4Σ- excited state. It has been shown that λ″ expected based on a semiempirical second order perturbation theory calculation of the magnitude of the spin-spin constant. The OODR spectra have also been used to validate our assignments of the complex and badly overlapped E 4Π-X 4Σ- 0-0 and 1-0 bands of 11BC. The E-X 0-0 band of 10BC was found to be severely perturbed. The ground state main electron configuration is …3σ24σ25σ11π22π0 and the derived bond lengths show that there is a 0.03 Å contraction in the B state, due to the promotion of an electron from the 4σ antibonding orbital to the 5σ bonding orbital. In contrast, the bond length elongates by 0.15 Å in the E state, a result of promoting an electron from the 5σ bonding orbital to the 2π antibonding orbitals.
Directory of Open Access Journals (Sweden)
Naveed Zafar Janjua
Full Text Available The British Columbia (BC Hepatitis Testers Cohort (BC-HTC was established to assess and monitor hepatitis C (HCV epidemiology, cost of illness and treatment effectiveness in BC, Canada. In this paper, we describe the cohort construction, data linkage process, linkage yields, and comparison of the characteristics of linked and unlinked individuals.The BC-HTC includes all individuals tested for HCV and/or HIV or reported as a case of HCV, hepatitis B (HBV, HIV or active tuberculosis (TB in BC linked with the provincial health insurance client roster, medical visits, hospitalizations, drug prescriptions, the cancer registry and mortality data using unique personal health numbers. The cohort includes data since inception (1990/1992 of each database until 2012/2013 with plans for annual updates. We computed linkage rates by year and compared the characteristics of linked and unlinked individuals.Of 2,656,323 unique individuals available in the laboratory and surveillance data, 1,427,917(54% were included in the final linked cohort, including about 1.15 million tested for HCV and about 1.02 million tested for HIV. The linkage rate was 86% for HCV tests, 89% for HCV cases, 95% for active TB cases, 48% for HIV tests and 36% for HIV cases. Linkage rates increased from 40% for HCV negatives and 70% for HCV positives in 1992 to ~90% after 2005. Linkage rates were lower for males, younger age at testing, and those with unknown residence location. Linkage rates for HCV testers co-infected with HIV, HBV or TB were very high (90-100%.Linkage rates increased over time related to improvements in completeness of identifiers in laboratory, surveillance, and registry databases. Linkage rates were higher for HCV than HIV testers, those testing positive, older individuals, and females. Data from the cohort provide essential information to support the development of prevention, care and treatment initiatives for those infected with HCV.
Janjua, Naveed Zafar; Kuo, Margot; Chong, Mei; Yu, Amanda; Alvarez, Maria; Cook, Darrel; Armour, Rosemary; Aiken, Ciaran; Li, Karen; Mussavi Rizi, Seyed Ali; Woods, Ryan; Godfrey, David; Wong, Jason; Gilbert, Mark; Tyndall, Mark W.; Krajden, Mel
2016-01-01
Background The British Columbia (BC) Hepatitis Testers Cohort (BC-HTC) was established to assess and monitor hepatitis C (HCV) epidemiology, cost of illness and treatment effectiveness in BC, Canada. In this paper, we describe the cohort construction, data linkage process, linkage yields, and comparison of the characteristics of linked and unlinked individuals. Methods The BC-HTC includes all individuals tested for HCV and/or HIV or reported as a case of HCV, hepatitis B (HBV), HIV or active tuberculosis (TB) in BC linked with the provincial health insurance client roster, medical visits, hospitalizations, drug prescriptions, the cancer registry and mortality data using unique personal health numbers. The cohort includes data since inception (1990/1992) of each database until 2012/2013 with plans for annual updates. We computed linkage rates by year and compared the characteristics of linked and unlinked individuals. Results Of 2,656,323 unique individuals available in the laboratory and surveillance data, 1,427,917(54%) were included in the final linked cohort, including about 1.15 million tested for HCV and about 1.02 million tested for HIV. The linkage rate was 86% for HCV tests, 89% for HCV cases, 95% for active TB cases, 48% for HIV tests and 36% for HIV cases. Linkage rates increased from 40% for HCV negatives and 70% for HCV positives in 1992 to ~90% after 2005. Linkage rates were lower for males, younger age at testing, and those with unknown residence location. Linkage rates for HCV testers co-infected with HIV, HBV or TB were very high (90–100%). Conclusion Linkage rates increased over time related to improvements in completeness of identifiers in laboratory, surveillance, and registry databases. Linkage rates were higher for HCV than HIV testers, those testing positive, older individuals, and females. Data from the cohort provide essential information to support the development of prevention, care and treatment initiatives for those infected with HCV
Data validation summary report for the 100-BC-5 Operable Unit Round 8 Groundwater Sampling
International Nuclear Information System (INIS)
Kearney, A.T.
1996-03-01
The information provided in this validation summary report includes data from the chemical analyses of samples from the 100-BC-5 Operable Unit Round 8 Groundwater Sampling Investigation. All of the data from this sampling event and their related quality assurance samples were reviewed and validated to verify that the reported sample results were of sufficient quality to support decisions regarding remedial actions performed at this site. Sample analyses included metals, general chemistry and radiochemistry
BEEC: An event generator for simulating the Bc meson production at an e+e- collider
Yang, Zhi; Wu, Xing-Gang; Wang, Xian-You
2013-12-01
The Bc meson is a doubly heavy quark-antiquark bound state and carries flavors explicitly, which provides a fruitful laboratory for testing potential models and understanding the weak decay mechanisms for heavy flavors. In view of the prospects in Bc physics at the hadronic colliders such as Tevatron and LHC, Bc physics is attracting more and more attention. It has been shown that a high luminosity e+e- collider running around the Z0-peak is also helpful for studying the properties of Bc meson and has its own advantages. For this purpose, we write down an event generator for simulating Bc meson production through e+e- annihilation according to relevant publications. We name it BEEC, in which the color-singlet S-wave and P-wave (cb¯)-quarkonium states together with the color-octet S-wave (cb¯)-quarkonium states can be generated. BEEC can also be adopted to generate the similar charmonium and bottomonium states via the semi-exclusive channels e++e-→|(QQ¯)[n]>+Q+Q¯ with Q=b and c respectively. To increase the simulation efficiency, we simplify the amplitude as compact as possible by using the improved trace technology. BEEC is a Fortran program written in a PYTHIA-compatible format and is written in a modular structure, one may apply it to various situations or experimental environments conveniently by using the GNU C compiler make. A method to improve the efficiency of generating unweighted events within PYTHIA environment is proposed. Moreover, BEEC will generate a standard Les Houches Event data file that contains useful information of the meson and its accompanying partons, which can be conveniently imported into PYTHIA to do further hadronization and decay simulation. Catalogue identifier: AEQC_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/AEQC_v1_0.html Program obtainable from: CPC Program Library, Queen’s University, Belfast, N. Ireland Licensing provisions: Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.html No. of lines in
Pérez, Oliver; Lastre, Miriam; Lapinet, José; Bracho, Gustavo; Díaz, Miriam; Zayas, Caridad; Taboada, Carlos; Sierra, Gustavo
2001-01-01
This report explores the participation of some afferent mechanisms in the immune response induced by the Cuban anti-meningococcal vaccine VA-MENGOC-BC. The induction of delayed-type hypersensitivity in nursing babies and lymphocyte proliferation after immunization is demonstrated. The presence of gamma interferon IFN-γ and interleukin-2 (IL-2) mRNAs but absence of IL-4, IL-5, and IL-10 mRNAs were observed in peripheral blood mononuclear cells from immunized subjects after in vitro challenge with outer membrane vesicles. In addition, some effector functions were also explored. The presence of opsonic activity was demonstrated in sera from vaccinees. The role of neutrophils as essential effector cells was shown. In conclusion, we have shown that, at least in the Cuban adult population, VA-MENGOC-BC induces mechanisms with a T-helper 1 pattern in the afferent and effector branches of the immune response. PMID:11401992
Directory of Open Access Journals (Sweden)
Gous Miah
2015-03-01
Full Text Available The BC2F1 population was derived from a cross between rice variety, MR219 (susceptible to blast and Pongsu Seribu 1 (resistant to blast. The objectives of this research were to know the inheritance pattern of blast resistance and to identify the linked markers associated with blast resistance in BC2F1 population. Sixteen microsatellite markers were found as polymorphic between the parents related to blast resistant genes (Pi-genes. Among the selected blast resistant linked markers, two markers RM6836 and RM8225 showed expected testcross ratio (1:1 for single-gene model in the BC2F1 population with the association between resistant and susceptible progeny. A total of 333-BC2F1 plants were challenged with the most virulent pathotype P7.2 of Magnaporthe oryzae. Chi-square (χ2 analysis for phenotypic segregation in single-gene model showed goodness of fit (P = 0.4463 to the expected segregation ratio (1:1. In marker segregation analysis, two polymorphic markers (RM6836 and RM8225 clearly showed goodness of fit to the expected segregation testcross ratio (1:1 for the single-gene model. The marker RM8225 and RM6836 showed significant R2 values higher than 10 for the trait of the blast lesions degree (BLD. The positions of RM6836 and RM8225 markers on rice chromosome 6 and the distance between these two markers is 0.2 cM. We conclude that single dominant gene control the blast resistance in Pongsu Seribu 1 located on chromosome 6, which is linked to RM8225 and RM6836 microsatellite markers. This information could be useful in marker-assisted selection for blast resistance in rice breeding involving Pongsu Seribu 1.
International Nuclear Information System (INIS)
Handa, Daishi; Nakajima, Hitomi; Arakaki, Takemitsu; Kumata, Hidetoshi; Shibata, Yasuyuki; Uchida, Masao
2010-01-01
We determined the 14 C/ 12 C ratio and concentrations of black carbon (BC) and organic carbon (OC) in airborne particulate matter (APM) with diameter 10 ) collected in Okinawa, Japan, between March and June 2008. During Asian dust events in March and April, APM and OC concentrations in PM 10 aerosols were approximately threefold and twofold higher than those during the non-Asian-dust period in June. 'Refractory' BC concentrations (i.e., because of refraction, 10 aerosols collected during the Asian dust events (mean = 41.5% and 62.3%, respectively) than for those collected in the non-Asian-dust period (mean = 67.2% and 93.8%, respectively), indicating a strong influence of fossil-fuel-derived carbon during Asian dust events. One sample showed high OC concentration but relatively low BC concentration, suggesting formation during the long-range transport of biogenic organic compounds. The results suggest that not only fossil-fuel-derived air pollutants but also organic compounds derived from biomass in Asia should be considered to better characterize long-range transported aerosols.
Biundo, Fabrizio; Ishiwari, Keita; Del Prete, Dolores; D'Adamio, Luciano
2016-03-15
Mutations in BRI2/ITM2b genes cause Familial British and Danish Dementias (FBD and FDD), which are pathogenically similar to Familial Alzheimer Disease (FAD). BRI2 inhibits processing of Amyloid precursor protein (APP), a protein involved in FAD pathogenesis. Accumulation of a carboxyl-terminal APP metabolite -ß-CTF- causes memory deficits in a knock-in mouse model of FDD, called FDDKI.We have investigated further the pathogenic function of ß-CTF studying the effect of Aph1B/C deletion on FDDKI mice. This strategy is based on the evidence that deletion of Aph1B/C proteins, which are components of the γ-secretase that cleaves ß-CTF, results in stabilization of ß-CTF and a reduction of Aβ. We found that both the FDD mutation and the Aph1B/C deficiency mildly interfered with spatial long term memory, spatial working/short-term memory and long-term contextual fear memory. In addition, the Aph1BC deficiency induced deficits in long-term cued fear memory. Moreover, the two mutations have additive adverse effects as they compromise the accuracy of spatial long-term memory and induce spatial memory retention deficits in young mice. Overall, the data are consistent with a role for β-CTF in the genesis of memory deficits.
International Nuclear Information System (INIS)
Bolvardi, H; Emmerlich, J; To Baben, M; Music, D; Schneider, J M; Von Appen, J; Dronskowski, R
2013-01-01
In this work the electronic structure and mechanical properties of the phases X 2 BC with X =Ti, V, Zr, Nb, Mo, Hf, Ta, W (Mo 2 BC-prototype) were studied using ab initio calculations. As the valence electron concentration (VEC) per atom is increased by substitution of the transition metal X, the six very strong bonds between the transition metal and the carbon shift to lower energies relative to the Fermi level, thereby increasing the bulk modulus to values of up to 350 GPa, which corresponds to 93% of the value reported for c-BN. Systems with higher VEC appear to be ductile as inferred from both the more positive Cauchy pressure and the larger value of the bulk to shear modulus ratio (B/G). The more ductile behavior is a result of the more delocalized interatomic interactions due to larger orbital overlap in smaller unit cells. The calculated phase stabilities show an increasing trend as the VEC is decreased. This rather unusual combination of high stiffness and moderate ductility renders X 2 BC compounds with X = Ta, Mo and W as promising candidates for protection of cutting and forming tools.
Energy Technology Data Exchange (ETDEWEB)
Miranda Herrera, Carlos A.; Canchola Felix, Ismael; Raygoza Flores, Joaquin; Mora Perez, Othon [Comision Federal de Electricidad, Residencia General de Cerro Prieto, Mexicali, Baja California (Mexico)]. E-mail: carlos.miranda02@cfe.gob.mx
2009-07-15
In the area called Poligono Hidalgo, inside the Cerro Prieto IV zone in the Cerro Prieto geothermal field, BC, corrosion has occurred in the last few years on well casings and pipelines used for geothermal fluids. Corrosion test results are presented here for pipes, type API L-80 and ASTM A-53 grade B, which were subjected to condensate from wells 403 and 424. These wells have thrown corroded material from their respective casings. With these data we pinpoint corrosive conditions in this field area and determine which pipes are adequate to case wells in similar chemical, production conditions to minimize adverse effects and extend the life of the well, allowing more efficient exploitation of the deepest production zones in the reservoir. [Spanish] En el campo geotermico de Cerro Prieto, BC, dentro del area del Poligono Hidalgo en el sector conocido como Cerro Prieto IV, algunos pozos han presentado en los ultimos anos desgastes en sus tuberias de revestimiento y en las tuberias de linea para el transporte del fluido geotermico. Se presentan resultados de pruebas de corrosion con tuberias tipo API L-80 y ASTM A-53 grado B al ser sometidas al condensado de los pozos 403 y 424, los cuales han estado arrojando material de sus respectivas tuberias de revestimiento. Con estos datos se pretende conocer las condiciones corrosivas de esa zona del campo y determinar cual seria la tuberia ideal a utilizar en pozos con condiciones quimicas de produccion semejantes a fin de minimizar este efecto adverso y prolongar la vida de los pozos, a la vez que se permita la explotacion eficiente de las zonas productoras mas profundas del yacimiento.
Directory of Open Access Journals (Sweden)
Joanna Burger
2018-05-01
Full Text Available It is essential to understand contaminant exposure and to compare levels of contaminants in organisms at different ages to determine if there is bioaccumulation, and to compare levels encountered in different geographical areas. In this paper, we report levels of mercury, lead, cadmium, cobalt, arsenic and selenium in the blood of semipalmated sandpipers (Calidris pusilla wintering in Suriname as a function of age, and compare them to blood levels in northbound migrants at a stopover in Delaware Bay, New Jersey. We found (1 young birds had higher levels of cadmium, cobalt, and lead than adults (after second year birds; (2 there were no age-related differences for arsenic, mercury and selenium; (3 only four of the possible 16 inter-metal correlations were significant, at the 0.05 level; (4 the highest correlation was between cadmium and lead (Kendall tau = 0.37; and (5 the adult sandpipers had significantly higher levels of cadmium, mercury and selenium in Suriname than in New Jersey, while the New Jersey birds had significantly higher levels of arsenic. Suriname samples were obtained in April, after both age classes had spent the winter in Suriname, which suggests that sandpipers are accumulating higher levels of trace elements in Suriname than in Delaware Bay. The levels of selenium may be within a range of concern for adverse effects, but little is known about adverse effect levels of trace elements in the blood of wild birds.
Preparation and oxidation protection of CVD SiC/a-BC/SiC coatings for 3D C/SiC composites
International Nuclear Information System (INIS)
Liu Yongsheng; Zhang Litong; Cheng Laifei; Yang Wenbin; Zhang Weihua; Xu Yongdong
2009-01-01
An amorphous boron carbide (a-BC) coating was prepared by LPCVD process from BCl 3 -CH 4 -H 2 -Ar system. XPS result showed that the boron concentration was 15.0 at.%, and carbon was 82.0 at.%. One third of boron was distributed to a bonding with carbon and 37.0 at.% was dissolved in graphite lattice. A multiple-layered structure of CVD SiC/a-BC/SiC was coated on 3D C/SiC composites. Oxidation tests were conducted at 700, 1000, and 1200 deg. C in 14 vol.% H 2 O/8 vol.% O 2 /78 vol.% Ar atmosphere up to 100 h. The 3D C/SiC composites with the modified coating system had a good oxidation resistance. This resulted in the high strength retained ratio of the composites even after the oxidation.
The Socratics and the Logos Protreptikos in the Fourth Century BC
Directory of Open Access Journals (Sweden)
Olga Alieva
2012-06-01
Full Text Available The so-called Socratic protreptikos is usually seen as a kind of transitory genre departing from the epideictic oratory of the Sophists and leading into the early dialogues of Plato. The aim of this article is to examine various examples of Socratic protreptikoi and to further define whether we can speak of a type of genre in formation and of the transitory nature of this genre. The author also wishes to draw the reader’s attention to a few problems of methodology which are related to our understanding of the protreptik corpus which dates from the fourth century BC to the time of the birth of Our Lord. The article also examines the differences between the explicitly named protreptikoi (Cleitophon, Euthydemos and those generally known under the name of Socratic protreptikoi
DEFF Research Database (Denmark)
Postila, P. A.; Kaszuba, K.; Sarewicz, M.
2013-01-01
of the cyt bc(1) function have remained unclear especially regarding the substrate binding at the Q(o)-site. In this work we address this issue by performing extensive atomistic molecular dynamics simulations with the cyt bc(1) complex of Rhodobacter capsulatus embedded in a lipid bilayer. Based...... on the simulations we are able to show the atom-level binding modes of two substrate forms: quinol (QH(2)) and quinone (Q). The QH(2) binding at the Q(o)-site involves a coordinated water arrangement that produces an exceptionally close and stable interaction between the cyt b and iron sulfur protein subunits...
GENXICC: A generator for hadronic production of the double heavy baryons ΞccΞcc, ΞbcΞbc and ΞbbΞbb
Chang, Chao-Hsi; Wang, Jian-Xiong; Wu, Xing-Gang
2007-09-01
-number (GM-VFN) scheme. Specially, to deal with the amplitude and in order to save CPU time as much as possible, the 'improved helicity-approach' is applied for the most complicated gluon-gluon fusion mechanism. The code with a proper option can generate weighted and unweighted events accordingly as user's wish. Moreover, an interface to PYTHIA is provided to meet ones' needs to generate the 'complete events' of Ξ, i.e. to do the 'showers' of the partons appearing in the initial and final states of the subprocess, and the hadronization for final obtained 'showers', etc. Restrictions:In GENXICC, the approach to the hadronic production in terms of a 'complete αs4 calculation' via the production of a binding diquark state either (QQ)[3]3¯ or (QQ)[1]6 ( Q=c,b) for Ξ and Ξ production, and via that of a binding diquark state of (bc)[3]3¯ or (bc)[1]3¯ or (bc)[3]6 or (bc)[1]6 for Ξ is available, but the contributions from the other higher Fock states of the diquark states are not involved. Considering the needs of comparisons and applications in most cases, three mechanisms and their consistent summation for the hadronic production of Ξ are available. But for most purposes and applications to the baryons Ξ and Ξ, which contain b-quark(s) (much heavier than c-quark), only the 'gluon-gluon fusion' mechanism for the production is accurate enough, therefore, here only the 'gluon-gluon fusion' mechanism is available. Moreover, since the polarization of the double-heavy baryons is also strongly effected by hadronization of the double-heavy diquark produced via the mechanisms considered here, so in the present generator only the unpolarized production for the baryons are available. Running time:It depends on which option one chooses to match PYTHIA when generating the events and also on which mechanism is chosen for generating the events. Typically, for the most complicated case via gluon-gluon mechanism to generate the mixed events via the intermediate diquark in (cc)[3]3¯ and
The textile industry at Krševica (Southeast Serbia in the fourth-third centuries B.C.
Directory of Open Access Journals (Sweden)
Popović Petar
2006-01-01
Full Text Available The site of Kale at Krševica, with significant remains of a settlement dating to the late Classical and early Hellenistic periods, has yielded, in addition to other finds, more than a thousand loom weights, spindle whorls and spools of which 1038 pieces are typologically classified. This material provides evidence for the craft of weaving in the settlement in the fourth and early third centuries B.C.
Measurement of the ratio of $B_c^+$ branching fractions to $J/\\psi\\pi^+$ and $J/\\psi\\mu^+\
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander
2014-01-01
The first measurement that relates semileptonic and hadronic decay rates of the $B_c^+$ meson is performed using proton-proton collision data corresponding to 1.0 fb$^{-1}$ of integrated luminosity collected with the LHCb detector. The measured value of the ratio of branching fractions, ${\\cal B}(B_c^+ \\to J/\\psi \\pi^+)/{\\cal B}(B_c^+\\to J/\\psi\\mu^+\
Yutsis-Akimova, Stanislava; Gallet, Yves; Amirov, Shahmardan
2018-01-01
We present new archeointensity results from a series of groups of pottery fragments that were collected from the multi-layered archeological site Yarim Tepe II in Northern Iraq (Northern Mesopotamia) dated to the 6th millennium BC. This site comprises a 7-m-thick sequence of archeological deposits encompassing the Middle Halaf, Late Halaf and the Halaf-Ubaid Transitional (HUT), between ∼5750 and ∼5000 BC according to the chronology currently considered for the Halafian archeological period. Three new radiocarbon dates obtained from bone fragments confirm that Yarim Tepe II was likely not occupied before the Middle Halaf, as was independently established from archeological constraints. Archeointensity determinations were carried out using the protocol developed for the Triaxe magnetometer. This procedure takes into account thermoremanent magnetization anisotropy and cooling rate effects. 114 fragments fulfilled our set of archeointensity selection criteria, with intensity data obtained from at least two but most often three specimens per fragment. Mean archeointensity values were estimated for 23 groups of fragments well distributed across the entire stratigraphic sequence from the averaging of the data obtained from a minimum of three fragments per group. These values were dated using a bootstrap procedure relying on the stratigraphic position of the different groups of fragments and on the different age constraints available inside the Yarim Tepe II sequence. The new data show a significant decrease in geomagnetic field intensity by ∼12 μT between the Middle Halaf and the Late Halaf-HUT time interval. This decrease was accompanied by a short intensity peak, which may have lasted only a few decades, around the Middle Halaf-Late Halaf boundary, at ∼5500 BC. This evolution is quite similar to that observed from Syrian and Bulgarian archeointensity data, even though the precise duration of the intensity peak is presently questionable. The Bulgarian data set
Preliminary review of fisheries conservation gains within BC Hydro's water use planning process
International Nuclear Information System (INIS)
Orr, C.; Clayton, G.; Lewis, R.; Louie, R.; McAdam, S.; McFarlane, S.; Munro, J.; Ptolemy, R.; Werring, J.; Wightman, C.
2004-05-01
In 1998, the Government of British Columbia requested that BC Hydro review the water use and operating conditions of its power generation facilities. A water use plan (WUP) was to be produced for each of the facilities. As a supporter of processes that improve water management, Watershed Watch has been actively involved in British Columbia's WUP process. In the past 4 years, it has participated in the Coquitlam-Buntzen WUP consultative committee, the Coquitlam fish technical committee, the First Nations WUP committee, the fisheries advisory team on WUP, and the green hydro working group. Watershed Watch commissioned Quadra Planning Consultants to prepare this first independent assessment of the largest water restoration project undertaken in British Columbia. This report is an overview level analysis of the results thus far, of the WUP process from a fisheries conservation perspective, including First Nations expectations and interests related to fisheries. It focuses on the fish conservation gains that result from the WUP initiative. The report also examines how successfully the WUP incorporate First Nations' traditional ecological knowledge. An environmental lawyer examined whether the WUP process satisfies the expectations of the North American Free Trade Agreement (NAFTA). This report indicates that the WUP has improved the knowledge base and better defined the flow requirements for fish conservation at BC Hydro facilities. The outcomes for fish conservation have been mostly positive. The following 7 operating alternatives were recommended: reduced flows; rapid flow fluctuation; adequate flushing flows; altered water quality; entrainment of fish; flow diversion; and, reservoir drawdown. An ongoing monitoring program was also recommended. 11 refs., 16 tabs., 1 appendix
Energy Technology Data Exchange (ETDEWEB)
Gouge, B.; Ries, F.; Reynolds, C.; Mazzi, E. [British Columbia Univ., Vancouver, BC (Canada). Inst. for Resources, Environment and Sustainability; Lim, C. [British Columbia Univ., Vancouver, BC (Canada). Dept. of Civil Engineering, Bureau of Intelligent Transportation Systems and Freight Security; Dowlatabadi, H. [British Columbia Univ., Vancouver, BC (Canada). Inst. for Resources, Environment and Sustainability; British Columbia Univ., Vancouver, BC (Canada). Liu Inst. for Global Issues
2008-11-15
This paper presented an integrated assessment for the design of greenhouse gas (GHG) emission reduction policies in British Columbia (BC) with particular reference to the drivers of GHG emissions from the transportation sector. Transportation services are central to the movement of goods and people in modern economies and their provision involves tradeoffs between economic benefits, health effects, and social and environmental impacts. More than a dozen BC initiatives were reviewed, with a specific focus on freight movement. The paper emphasized that consequences of proposals such as low carbon fuel standards need to be carefully assessed, along with mandated vehicle technologies, congestion fees and investment in alternative transportation infrastructure. The Activity, Modal Share, Intensity and Fuel (ASIF) framework was shown to provide insight into drivers of GHG emissions and the potential impact of policy decisions. The framework refers to factors such as the amount of kilometres traveled, share of activity per mode of travel, energy intensity, and GHG emissions per unit of energy for fuel type used in the transportation mode. The relationship between factors indicates that GHG emissions increase as energy intensity increases and as the carbon intensity of fuel increases. The overall intensity of the fleet depends greatly on vehicle composition and the share of travel between different modes. refs., tabs., figs.
Oil and gas development and the potential for contamination of moose (Alces alces) in northeast BC
International Nuclear Information System (INIS)
Maundrell, C.; Roe, N.
2007-01-01
Traditional sources of food for meat, berries, and fish are relied upon by First Nations of northern Canada. Hunting and trapping in traditional areas are the primary sources of protein consumption by First Nations. In the Northwest Territories and northeast British Columbia (BC), moose meat (Alces alces) is one of the most sought after meats. Therefore, an important consideration needing documentation was to determine if animals in areas of high oil and gas development were unhealthy compared to animals living in areas of low or no oil and gas activity. This paper presented the results of a study that documented the presence of contaminants in harvested moose. The main purpose of the study was to analyze moose tissue samples for extractable petroleum hydrocarbons, heavy metals and polycyclic hydrocarbons. The paper also discussed the methodology used in harvesting the moose which involved shooting them with a high powered rifle to collect tissue samples. Levels of concentration in tissues between two areas with noticeably different levels of oil and gas activity were then compared. Significantly higher levels of heavy metal concentrations were found in tissues sampled from the treatment area. It was therefore concluded that oil and gas activity may have negative impacts on the health of moose in northeast BC. 8 refs., 2 tabs
Alternative surfacing materials for weed control at BC Hydro substations
International Nuclear Information System (INIS)
Wells, T.C.; Shrimpton, G.M.
1997-01-01
A two year study was conducted by BC Hydro in which a variety of surfacing materials were tested for their suitability for use in substations. Ideally, surfacing materials should have the following characteristics: high electrical resistivity in both dry and wet conditions, resistance to invasion by weeds, good driveability, good drainage, non-flammable, reasonably priced, no dust to foul conductors, and be aesthetically pleasing. Trials at Vernon Koksilah, and Ingledow substations were conducted to test the materials. A qualitative estimate of the amount of weed control provided by each material was recorded. The trials were meant to provide operational recommendations and screening information to allow for future testing of promising materials or combination of materials. Results showed that no single material meets all the desired criteria. The surfaces that best combined good weed control, electrical resistance and surface stability was a 15 cm deep layer of crushed gravel, especially if underlain by a layer of geotextile. 4 refs., 3 tabs., 1 fig
Salceda, Emilio; López, Omar; Zaharenko, André J; Garateix, Anoland; Soto, Enrique
2010-03-01
Sea anemone toxins bind to site 3 of the sodium channels, which is partially formed by the extracellular linker connecting S3 and S4 segments of domain IV, slowing down the inactivation process. In this work we have characterized the actions of BcIII, a sea anemone polypeptide toxin isolated from Bunodosoma caissarum, on neuronal sodium currents using the patch clamp technique. Neurons of the dorsal root ganglia of Wistar rats (P5-9) in primary culture were used for this study (n=65). The main effects of BcIII were a concentration-dependent increase in the sodium current inactivation time course (IC(50)=2.8 microM) as well as an increase in the current peak amplitude. BcIII did not modify the voltage at which 50% of the channels are activated or inactivated, nor the reversal potential of sodium current. BcIII shows a voltage-dependent action. A progressive acceleration of sodium current fast inactivation with longer conditioning pulses was observed, which was steeper as more depolarizing were the prepulses. The same was observed for other two anemone toxins (CgNa, from Condylactis gigantea and ATX-II, from Anemonia viridis). These results suggest that the binding affinity of sea anemone toxins may be reduced in a voltage-dependent manner, as has been described for alpha-scorpion toxins. (c) 2009 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Sunahori, Fumie X. [Department of Chemistry and Physics, Franklin College, Franklin, Indiana 46131 (United States); Nagarajan, Ramya; Clouthier, Dennis J., E-mail: dclaser@uky.edu [Department of Chemistry, University of Kentucky, Lexington, Kentucky 40506-0055 (United States)
2015-12-14
The cold boron carbide free radical (BC X {sup 4}Σ{sup −}) has been produced in a pulsed discharge free jet expansion using a precursor mixture of trimethylborane in high pressure argon. High resolution laser induced fluorescence spectra have been obtained for the B {sup 4}Σ{sup −}–X {sup 4}Σ{sup −} and E {sup 4}Π–X {sup 4}Σ{sup −} band systems of both {sup 11}BC and {sup 10}BC. An optical-optical double resonance (OODR) scheme was implemented to study the finer details of both band systems. This involved pumping a single rotational level of the B state with one laser and then recording the various allowed transitions from the intermediate B state to the final E state with a second laser by monitoring the subsequent E–X ultraviolet fluorescence. In this fashion, we were able to prove unambiguously that, contrary to previous studies, the spin-spin constant λ is negative in the ground state and positive in the B {sup 4}Σ{sup −} excited state. It has been shown that λ″ < 0 is in fact expected based on a semiempirical second order perturbation theory calculation of the magnitude of the spin-spin constant. The OODR spectra have also been used to validate our assignments of the complex and badly overlapped E {sup 4}Π–X {sup 4}Σ{sup −} 0-0 and 1-0 bands of {sup 11}BC. The E–X 0-0 band of {sup 10}BC was found to be severely perturbed. The ground state main electron configuration is …3σ{sup 2}4σ{sup 2}5σ{sup 1}1π{sup 2}2π{sup 0} and the derived bond lengths show that there is a 0.03 Å contraction in the B state, due to the promotion of an electron from the 4σ antibonding orbital to the 5σ bonding orbital. In contrast, the bond length elongates by 0.15 Å in the E state, a result of promoting an electron from the 5σ bonding orbital to the 2π antibonding orbitals.
Directory of Open Access Journals (Sweden)
Podushkin Aleksandr Nikolaevich
2015-12-01
Full Text Available The publication is devoted to archaeological research of monuments of the catacomb of Arys culture of Southern Kazakhstan (1st Century B.C. - 3rd Century A.D.. Now scientists have a complete understanding of the range and typology, periodization and chronology of monuments of this culture. There are three stages: Karaultobe (4th century B.C. - 1st century A.D.; Karatobe (1st Century B.C. - 4th century A.D.; Altintobe (4th-6th centuries A.D.. These stages are characterized by specific clusters of signs in the form of artifacts. The author also carried out the ethnic attribution of the Arys culture in association with the ancient state Kangiuj. As a result of this work, the ethnicity of the state Kangiuj was revealed: in particular, late Saka’s, Sarmatian, Huns and Kangiuj ethnic components which are relevant to archaeological complexes, were identified. In the Arys monuments of culture the author discovered complexes of findings which associated with the Sarmatian world of Eurasia by their ethno-cultural parameters. They include typical for the Sarmatians list of ritual action and the funerary equipment, including weapons, bronze mirrors, ritual and religious objects, signs-tamgas, jewelry (including Egyptian faience, articles in “animal”, gold-turquoise and polychrome style. The characteristics of the burial complexes of catacombs of the Arys culture discussed in the publication and corresponding to chronological calculations and ethno-cultural interpretations, allow to speak about presence in the territory of South Kazakhstan of the Asian Sarmatians or any local branch of the Union of the Sarmatian tribes in the 1st century B.C. - 3rd century A.D.
Protein (Viridiplantae): 203761 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 017 ... 38832:3226 ... 38833:3539 ... 564608:3539 predicted protein Micromonas pusilla CCMP1545 MHPPLTLENHPLCKDVVIALKRCHRDNPWARAWGACNEQKWALDDCLKKQKLFKFRANHAKAKAQQDRLRRRVEKYGHATTNGQFKG
International Nuclear Information System (INIS)
Adam, W.J.; Lehrschall, R.R.; Oestreich, D.K.
1996-07-01
The purpose of this report is to document the preliminary hazard classification (PHC) for the initial group of sites to be remediated by the 100-B/C Site Remediation Project. The project is targeted at excavation of contaminated solid from seven waste sites, and the transportation and disposal of these wastes at the Environmental Restoration Disposal Facility. The PHC for these remediation activities is rated as radiological
Vostrovská Ivana
2008-01-01
Recenze představuje publikaci P. Akkermanse a G. Schwartze, ve které souhrnně přibližují archeologii Sýrie od paleolitu po rok 300BC. Mimo chronologický přehled v daných obdobích se autoři blíže věnují neolitizaci a vzniku urbánních společností. The review represents a study by P. Akkermans a G. Schwartz where totaly converge the archeology of Syria from paleolithic to 300BC. Beyond chronologically overview in given periods authors pay attention process of neolitisation and development of ...
Hasan, N; Rafii, M Y; Abdul Rahim, H; Nusaibah, S A; Mazlan, N; Abdullah, S
2017-01-23
Rice (Oryza sativa L.) blast disease is one of the most destructive rice diseases in the world. The fungal pathogen, Magnaporthe oryzae, is the causal agent of rice blast disease. Development of resistant cultivars is the most preferred method to achieve sustainable rice production. However, the effectiveness of resistant cultivars is hindered by the genetic plasticity of the pathogen genome. Therefore, information on genetic resistance and virulence stability are vital to increase our understanding of the molecular basis of blast disease resistance. The present study set out to elucidate the resistance pattern and identify potential simple sequence repeat markers linked with rice blast disease. A backcross population (BC 2 F 1 ), derived from crossing MR264 and Pongsu Seribu 2 (PS2), was developed using marker-assisted backcross breeding. Twelve microsatellite markers carrying the blast resistance gene clearly demonstrated a polymorphic pattern between both parental lines. Among these, two markers, RM206 and RM5961, located on chromosome 11 exhibited the expected 1:1 testcross ratio in the BC 2 F 1 population. The 195 BC 2 F 1 plants inoculated against M. oryzae pathotype P7.2 showed a significantly different distribution in the backcrossed generation and followed Mendelian segregation based on a single-gene model. This indicates that blast resistance in PS2 is governed by a single dominant gene, which is linked to RM206 and RM5961 on chromosome 11. The findings presented in this study could be useful for future blast resistance studies in rice breeding programs.
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Rodriguez, Marco Helio [Comision Federal de Electricidad, Gerencia de Proyectos Geotermoelectricos, Residencia General de Cerro Prieto, Mexicali, Baja California (Mexico)]. E-mail: marco.rodriguez01@cfe.gob.mx
2011-01-15
During the development of Cerro Prieto geothermal field, BC, exploitation has increased gradually, causing a continuous drop in pressure to almost 100 bars in the central and eastern parts of the field. This has occurred despite the high natural recharge induced by the reservoir exploitation and helped by the high permeability of the reservoir and the wide availability of natural recharge of low-temperature water in the vicinity. The strata above the production zones have significantly lower temperatures than these zones, but due to the particular characteristics of the reservoir, do not have pressure drops. As the pressure of producing strata declines, the hydraulic pressure differential between them and the overlying strata increases. Thus in recent years the phenomenon of cross flow occurs with greater frequency and severity. In this paper, this phenomenon is analyzed, detailing the specific mechanisms favoring it and identifying the stage (drilling or workover) in which it commonly occurs. Rigorous supervision during these stages is crucial to identifying cross flow and to taking necessary measures to save the well. Cross flow cases are presented at different stages in the history of a well: during drilling, repair, before and during the stimulation, and during production. [Spanish] Durante el desarrollo del campo geotermico de Cerro Prieto, BC, la explotacion se ha incrementado en forma gradual provocando una continua caida de presion, que en las porciones central y oriente ha sido de casi 100 bars. Esto ha ocurrido a pesar de la enorme recarga natural inducida por la explotacion, favorecida por la alta permeabilidad del yacimiento y la gran disponibilidad de recarga natural de agua de baja temperatura en los alrededores del mismo. Los estratos ubicados encima de las zonas productoras presentan temperaturas significativamente menores que estos, pero debido a las caracteristicas particulares del yacimiento, no han presentado abatimiento en su presion. En la
Shi-Jean Susana Sung; Stacy L. Clark; Scott Schlarbaum; Daniel C. Dey; Daniel J. Leduc
2016-01-01
Seedlings from two families of the BC3F3 backcross generation of the American chestnut (Castanea dentata) and Chinese chestnut (C. mollissima) were cultured in 2013 in Missouri using the Root Production Method®, a container-based system used to avoid disease problems associated with...
Protein (Viridiplantae): 746637 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 218 ... 38832:274 ... 38833:414 ... 564608:414 predicted protein Micromonas pusilla CCMP1545 MAQLPSYEVDDGEDSMPGAPGEGPMTDSMQGPPVEVPTSDSM...PGAPGEVPTMDSMHGPPVEVPTMDSMHGAPVEVPMMDSMPGAPVEVPTMDSMQGPPVEVPTMDSMQGAPGEGPMTDSMHGAPGEGPTMDSMNSGNPTKCVVPDWCSTYPPEMQKSKPECQCPDDSHP
Energy Technology Data Exchange (ETDEWEB)
Lejay, P.; Chevalier, B.; Etourneau, J.; Hagenmuller, P. [Bordeaux-1 Univ., 33 - Talence (France)
1981-11-15
The superconducting properties of the Mosub(2-x)Msub(x)BC borocarbides (M equivalent to Zr, Nb, Rh, Hf, Ta, W) are reported. They have an Mo/sub 2/BC-type structure with orthorhombic symmetry and the space group Cmcm. Stoichiometric powder samples were prepared by arc melting. A large single crystal of Mo/sub 2/BC was obtained by a Czochralski-type method. The upper limit of x depends mainly on the size of the M atoms. A study of the magnetization as a function of field at different temperatures shows that all borocarbides are type II superconductors. Resistivity measurements give generally a critical temperature Tsub(cr) above 4.2 K. Tsub(cr) and the critical fields Hsub(c2) increase for rhodium substitution but decrease in other cases. For comparison the superconducting properties are discussed in terms of the valence electron concentration and the molar volume.
Gray, K A; Dutton, P L; Daldal, F
1994-01-25
Folding models suggest that the highly conserved histidine 217 of the cytochrome b subunit from the cytochrome bc1 complex is close to the quinone reductase (Qi) site. This histidine (bH217) in the cytochrome b polypeptide of the photosynthetic bacterium Rhodobacter capsulatus has been replaced with three other residues, aspartate (D), arginine (R), and leucine (L). bH217D and bH217R are able to grow photoheterotrophically and contain active cytochrome bc1 complexes (60% of wild-type activity), whereas the bH217L mutant is photosynthetically incompetent and contains a cytochrome bc1 complex that has only 10% of the wild-type activity. Single-turnover flash-activated electron transfer experiments show that cytochrome bH is reduced via the Qo site with near native rates in the mutant strains but that electron transfer between cytochrome bH and quinone bound at the Qi site is greatly slowed. These results are consistent with redox midpoint potential (Em) measurements of the cytochrome b subunit hemes and the Qi site quinone. The Em values of cyt bL and bH are approximately the same in the mutants and wild type, although the mutant strains have a larger relative concentration of what may be the high-potential form of cytochrome bH, called cytochrome b150. However, the redox properties of the semiquinone at the Qi site are altered significantly. The Qi site semiquinone stability constant of bH217R is 10 times higher than in the wild type, while in the other two strains (bH217D and bH217L) the stability constant is much lower than in the wild type. Thus H217 appears to have major effects on the redox properties of the quinone bound at the Qi site. These data are incorporated into a suggestion that H217 forms part of the binding pocket of the Qi site in a manner reminiscent of the interaction between quinone bound at the Qb site and H190 of the L subunit of the bacterial photosynthetic reaction center.
Binary Star Orbits. V. The Nearby White Dwarf/Red Dwarf Pair 40 Eri BC
Mason, Brian D.; Hartkopf, William I.; Miles, Korie N.
2017-11-01
A new relative orbit solution with new dynamical masses is determined for the nearby white dwarf-red dwarf pair 40 Eri BC. The period is 230.09 ± 0.68 years. It is predicted to close slowly over the next half-century, getting as close as 1.″32 in early 2066. We determine masses of 0.575 ± 0.018 {{ M }}⊙ for the white dwarf and 0.2041 ± 0.0064 {{ M }}⊙ for the red dwarf companion. The inconsistency of the masses determined by gravitational redshift and dynamical techniques, due to a premature orbit calculation, no longer exists.
New and interesting marine and littoral diatoms from sea point, near Cape Town, South Africa
CSIR Research Space (South Africa)
Giffen, MH
1970-01-01
Full Text Available Steenbras, South Western Cape and mentions that the species had not until then been re corded from South African waters. ? 591, 592. C. serpentina var. pusilla (GREvILLE) PERAGALLO. ? Small individuals of this variety, sometimes less than the 25?SO... ~ given for length (1-lusTaD 1. C.: 50) are easily overlooked when both C. serpentina var. pusilla and C. an,gu/osa are present in a sample. They can only be distin guished by counting the striae viz. 14?20 in 10 it for C. angulosa and 22?25 in 10...
Slama, Nawel; Leiba, Jade; Eynard, Nathalie; Daffé, Mamadou; Kremer, Laurent; Quémard, Annaïk; Molle, Virginie
2011-09-02
The type II fatty acid synthase system of mycobacteria is involved in the biosynthesis of major and essential lipids, mycolic acids, key-factors of Mycobacterium tuberculosis pathogenicity. One reason of the remarkable survival ability of M. tuberculosis in infected hosts is partly related to the presence of cell wall-associated mycolic acids. Despite their importance, the mechanisms that modulate synthesis of these lipids in response to environmental changes are unknown. We demonstrate here that HadAB and HadBC dehydratases of this system are phosphorylated by Ser/Thr protein kinases, which negatively affects their enzymatic activity. The phosphorylation of HadAB/BC is growth phase-dependent, suggesting that it represents a mechanism by which mycobacteria might tightly control mycolic acid biosynthesis under non-replicating condition. Copyright © 2011 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Cline, J.F.; Uresk, D.W.; Rickard, W.H.
1975-01-01
The plant communities at the Hanford B-C Cribs controlled area and REDOX study areas are characterized. It is concluded that they are probably very much like the communities that existed prior to 1943 when the Hanford Reservation was established. (CH)
Energy Technology Data Exchange (ETDEWEB)
Druce, D. [British Columbia Hydro, Vancouver, BC (Canada)
2004-07-01
BC Hydro's installed generation capacity as of March 31, 2003 was 11,103 MW, of which 90 per cent was hydro power, 9 per cent was gas-fired and 1 per cent was non-integrated. The hydroelectric plants belong to one of three groups, the Peace River, Columbia River or small hydro which includes small to moderate sized-plants. Small hydro is controlled by hydrologic regime and storage limitations rather than by system requirements. The installed capacity for the 4 plants on the Columbia River totals 4,722 MW. The installed capacity at the 2 plants on the Peace River totals 3,424 MW. Both watersheds are subject to interior climate conditions with significant inflows from snowmelt and rainfall runoff. This presentation addressed the issue of mid-term hydro scheduling and its impact on markets. For the past 15 years, BC Hydro has used the marginal cost model for electricity trade and for operations planning. The model considers system loads and resources, and maximizes the expected net revenue over a planning horizon of 6 years. A marginal value of water stored in the Williston Reservoir has been established using the marginal cost model. The affect of weather, natural gas prices and water supply on hydro generation was also discussed. It was noted that information on spot market electricity prices has significantly improved since the electric power industry was deregulated in 1996. tabs., figs.
Directory of Open Access Journals (Sweden)
Denis V. Maryksin
2017-03-01
Full Text Available The article focuses on one of the burial mounds – Alebastrovo I, which is situated in the middle reaches of the Ural river. The analysis of the burial rite and grave goods reveals the combination of features peculiar of the culture of early nomads from the 6th to the 4th centuries BC and later features typical for the 3rd – 1st centuries BC. The collective nature of the burial in a large square pit (burial no. 2 relates to early features. Such burials are typical for the 5th and 4th centuries BC. But a dagger with a direct crosshair and a crescent-shaped pommel found in the burial belongs to the 3rd – 1st centuries BC. Findings of a mirror, a spoon and a whorl also deserve special attention. On formal grounds a mirror belongs to the type “Skripkin 1.6” – with a flat disk without roll and stick in the form of a triangular stem. They appeared in Sauromatian time, but were not widespread. Most of these mirrors refer to the turn of the eras – the first centuries AD. However, in our view the mirror from Alebastrovo I has the greatest similarity with the mirror disks of the so-called “musical” mirrors, which date back to the 2nd half of the 4th century BC. The bone spoon belongs to the type I, peculiar of the Sauromatian-time things of the 6th – 4th centuries BC. However, the pattern is similar to that on the handle of the bone products of later time – the 3rd – 2nd centuries BC. Clay whorl has a pattern in the form of 4 sectors, decorated with grooves and pits. Analogies are available on this ornament spindles from the 3rd – 2nd centuries BC of the Kara-Abyz culture in the Southern Urals. According to the set of attributes, this burial mound dated to the second half of the 3rd - 2nd centuries BC. The finds from this burial mound confirm the conclusion of the first explorer B. F. Zhelezchikov about continuity of the development of the early nomadic culture of this region in the 6th – 3rd centuries BC.
International Nuclear Information System (INIS)
Benyamin, David; Piran, Tsvi; Shaviv, Nir J.; Nakar, Ehud
2016-01-01
The boron to carbon (B/C) and sub-Fe/Fe ratios provide an important clue on cosmic ray (CR) propagation within the Galaxy. These ratios estimate the grammage that the CRs traverse as they propagate from their sources to Earth. Attempts to explain these ratios within the standard CR propagation models require ad hoc modifications and even with those these models necessitate inconsistent grammages to explain both ratios. As an alternative, physically motivated model, we have proposed that CRs originate preferably within the galactic spiral arms. CR propagation from dynamic spiral arms has important imprints on various secondary to primary ratios, such as the B/C ratio and the positron fraction. We use our spiral-arm diffusion model with the spallation network extended up to nickel to calculate the sub-Fe/Fe ratio. We show that without any additional parameters the spiral-arm model consistently explains both ratios with the same grammage, providing further evidence in favor of this model.
Energy Technology Data Exchange (ETDEWEB)
Benyamin, David; Piran, Tsvi; Shaviv, Nir J. [The Racah Institute of Physics, The Hebrew University of Jerusalem, Jerusalem 91904 (Israel); Nakar, Ehud [Raymond and Beverly Sackler School of Physics and Astronomy, Tel Aviv University, Tel Aviv 69978 (Israel)
2016-07-20
The boron to carbon (B/C) and sub-Fe/Fe ratios provide an important clue on cosmic ray (CR) propagation within the Galaxy. These ratios estimate the grammage that the CRs traverse as they propagate from their sources to Earth. Attempts to explain these ratios within the standard CR propagation models require ad hoc modifications and even with those these models necessitate inconsistent grammages to explain both ratios. As an alternative, physically motivated model, we have proposed that CRs originate preferably within the galactic spiral arms. CR propagation from dynamic spiral arms has important imprints on various secondary to primary ratios, such as the B/C ratio and the positron fraction. We use our spiral-arm diffusion model with the spallation network extended up to nickel to calculate the sub-Fe/Fe ratio. We show that without any additional parameters the spiral-arm model consistently explains both ratios with the same grammage, providing further evidence in favor of this model.
Protein (Viridiplantae): 780231 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 401 ... 38832:1362 ... 38833:877 ... 564608:877 predicted protein Micromonas pusilla CCMP1545 MQDSMHDTMHDSIQDSMHDSIQDSMQDSM...AKEEEEPAEPPAKEEEAHAEPPAKEEEAHAEPPAKEEDYAEPPAKEEDYAEPPAKEEAHSMDSMDSMDSMDSMDSMDSMHSMDSMDSMDSMDSMHSMDSMDSMDSM...DSMHSMDSMDSMDSMDSMDSMDSMHSMDTSIDAVDAAANVTDAADTAGAAANVTDAADTAGAAAEEKPPENASVDSLDSLLDG
Historic (1940 to present) changes in Lillooet River planform (BC, Canada)
Zei, Caterina
2017-04-01
Historic (1940 to present) changes in Lillooet River planform (BC, Canada) Zei C.*, Giardino M.*, Perotti L.*, Roberti G.***, **Ward B.C.**, Clague J.J.** *Department of Earth Sciences, Geositlab, Università degli Studi di Torino, Torino, Italia; **Department of Earth Sciences, Simon Fraser University, Burnaby, British Columbia, Canada ***Université Blaise Pascal - Laboratoire Magmas et Volcans Clermont-Ferrand, France We conducted a geomorphological study of changes in the planform of Lillooet River (Coast Mountain, British Columbia, Canada) over the past 75 years. The study involved identification and interpretations of channel changes in the reach of the river between Mount Meager (the source of the landslide) and Pemberton Meadows. Lillooet River flows about 95 km southeast from its headwaters at Lillooet Glacier to Lillooet Lake near Pemberton, the largest community in the valley. Between the mouth of Meager Creek and Pemberton Meadows, the river is unregulated and has a braided planform resulting from the very high delivery of sediment due to frequent landslides and debris flows sourced on the Mount Meager volcanic complex. Below Pemberton Meadows, the river occupies a single channel confined between dikes. A rich archive of historical vertical aerial photographs exists for the study area, In addition, a high-resolution digital elevation model was produced from LiDAR data acquired in 2015. We processed each set of photos dating back to 1940 with the software Agisoft Photoscan to produce high resolution orthophotos. Analysis of these datasets, complemented with field investigation, showed that the river channel in the braided reach shifted laterally up to 550 m between 1981 and 2010; likely caused in part by five floods with peak discharges of more than 800 m^3/s and four landslides on the flanks of Mount Meager massif with volumes up to 13 x 106 m^3. Channel avulsions were probably triggered by accumulation of in-channel rafts of coarse woody debris and are
“New” Scythian Complex of the 3rd Century BC on the Right Bank of the Lower Dniester Region
Directory of Open Access Journals (Sweden)
Sergey N. Razumov
2017-09-01
Full Text Available The article deals with the new attribution of the materials from barrow 20, excavated in 1975 near Semenovka village on the right bank of the Dniester liman, Belgorod-Dnesterovsky district, Odessa region, Ukraine. The only burial of this barrow was still considered as the monument of Babino culture (aka Multi-Cordoned Ware culture of the first quarter of the 2nd millennium BC. The ceramic and metal artifacts found under the barrow were considered during the study of the material culture of the Scythians of the last third of the 1st millennium BC. The thorough analysis of the stratigraphy, planigraphy, funeral rite and artifacts showed that barrow 20 near Semenovka village was built instantaneously, and in fact it is Scythian. A cenotaph was the main complex of the barrow. It came with not only the armament items (iron-socketed arrowheads, spearheads and sockets of spears, horse harness (bronze frontlet with axe-shaped blade and a hook, bronze ringed beads, iron bits and iron snaffle ring, iron round pendants, glass cup, remains of the funeral feast as a ceramic breakage (Rhodes, Sinop, Cos, Cnidus amphorae, two pottery jars and molded vessel, but also with the burial of a dependent person lying crouched on his left side, his head in the eastern sector, in the catacomb. Depth of the fixing of these findings corresponded to the level of the ancient horizon on which the two-sided mainland ejected from the burial construction. Based on the Rhodes amphora marked with the eponym Άγήσιππος of - manufacturer - Έπίγονος 1, the barrow dates back to the last third or last quarter of the 3rd century BC.
Excited state mass spectra of doubly heavy baryons Ω{sub cc}, Ω{sub bb} and Ω{sub bc}
Energy Technology Data Exchange (ETDEWEB)
Shah, Zalak; Rai, Ajay Kumar [Sardar Vallabhbhai National Institute of Technology, Department of Applied Physics, Surat, Gujarat (India); Thakkar, Kaushal [GIDC Degree Engineering college, Department of Applied Sciences and Humanities, Abrama, Navsari (India)
2016-10-15
We discuss the mass spectrum of Ω baryon with two heavy quarks and one light quark (ccs, bbs, and bcs). The main goal of the paper is to calculate the ground state masses and after that, the positive and negative parity excited states masses are also obtained within a hypercentral constituent quark model, using Coulomb plus linear potential framework. We also added a first order correction to the potential. The mass spectra up to 5S for radial excited states and 1P-5P, 1D-4D, and 1F-2F states for orbital excited states are computed for Ω{sub cc}, Ω{sub bb} and Ω{sub bc} baryons. Our obtained results are compared with other theoretical predictions, which could be a useful complementary tool for the interpretation of experimentally unknown heavy baryon spectra. The Regge trajectory is constructed in both the (n{sub r}, M{sup 2}) and the (J, M{sup 2}) planes for Ω{sub cc}, Ω{sub bb} and Ω{sub bc} baryons and their slopes and intercepts are also determined. Magnetic moments of doubly heavy Ω{sup '}s are also calculated. (orig.) 8.
DEFF Research Database (Denmark)
Dienemann, Christian; Bøggild, Andreas; Winther, Kristoffer S.
2011-01-01
the crystal structure of the intact Shigella flexneri VapBC TA complex, determined to 2.7 Å resolution. Both in solution and in the crystal structure, four molecules of each protein combine to form a large and globular hetero-octameric assembly with SpoVT/AbrB-type DNA-binding domains at each end and a total...
Directory of Open Access Journals (Sweden)
Bernhard Weninger
2014-12-01
Full Text Available In extension of the recently established ‘Rapid Climate Change (RCC Neolithisation Model’ (Clare 2013, in the present paper we demonstrate the existence of a remarkable coincidence between the exact (decadel-scale entry and departure dates of the Neolithic into/from the Aegean (~6600/6050 calBC with begin/end of RCC-conditions.
Gallet, Yves; Molist Montaña, Miquel; Genevey, Agnès; Clop García, Xavier; Thébault, Erwan; Gómez Bach, Anna; Le Goff, Maxime; Robert, Béatrice; Nachasova, Inga
2015-01-01
We present new archeomagnetic intensity data from two Late Neolithic archeological sites (Tell Halula and Tell Masaïkh) in Syria. These data, from 24 groups of potsherds encompassing 15 different time levels, are obtained using the Triaxe experimental protocol, which takes into account both the thermoremanent magnetization anisotropy and cooling rate effects on intensity determinations. They allow us to recover the geomagnetic intensity variations in the Middle East, between ∼7000 BC and ∼5000 BC, i.e. during the so-called pre-Halaf, proto-Halaf, Halaf and Halaf-Ubaid Transitional cultural phases. The data are compared with previous archeointensity results of similar ages from Northern Iraq (Yarim Tepe II and Tell Sotto) and Bulgaria. We find that previous dating of the Iraqi material was in error. When corrected, all northern Mesopotamian data show a relatively good consistency and also reasonably match with the Bulgarian archeointensity dataset. Using a compilation of available data, we construct a geomagnetic field intensity variation curve for the Middle East encompassing the past 9000 years, which makes it presently the longest known regional archeomagnetic intensity record. We further use this compilation to constrain variations in dipole field moment over most of the Holocene. In particular, we discuss the possibility that a significant dipole moment maximum occurred during the third millennium BC, which cannot easily be identified in available time-varying global geomagnetic field reconstructions.
International Nuclear Information System (INIS)
1997-03-01
BC Hydro is one of the sponsors involved in the construction of a thermal electric power plant in Raiwind, Pakistan. As a Crown corporation, BC Hydro and its participation in the project is subject to the policies and priorities of the provincial government. This document describes the circumstances surrounding the creation of the International Power Corporation (IPC) and its joint venture with BC Hydro for the development of international power projects including the Raiwind project. The project has provoked much public discussion in British Columbia because of the involvement of Cayman Island companies in the project structure. There is concern with the intermingling of public and private interests in the project, including allegations that an IPC share offering benefited insiders of government and BC Hydro. A description of the history and structure of the Raiwind project and detailed information on the British Columbia participants is provided. Directors and shareholders of the principal corporate participants are listed. The development process in Pakistan, the key features of the project and the underlying agreements among the participants are described. An assessment of potential conflicts of interest and a review of public sector standards and guidelines regarding conflicts of interest is presented. 60 refs., 39 tabs., 6 figs
Sato, Kanna; Suzuki, Ryu; Nishikubo, Nobuyuki; Takenouchi, Sachi; Ito, Sachiko; Nakano, Yoshimi; Nakaba, Satoshi; Sano, Yuzou; Funada, Ryo; Kajita, Shinya; Kitano, Hidemi; Katayama, Yoshihiro
2010-06-01
The plant secondary cell wall is a highly ordered structure composed of various polysaccharides, phenolic components and proteins. Its coordinated regulation of a number of complex metabolic pathways and assembly has not been resolved. To understand the molecular mechanisms that regulate secondary cell wall synthesis, we isolated a novel rice mutant, cell wall architecture1 (cwa1), that exhibits an irregular thickening pattern in the secondary cell wall of sclerenchyma, as well as culm brittleness and reduced cellulose content in mature internodes. Light and transmission electron microscopy revealed that the cwa1 mutant plant has regions of local aggregation in the secondary cell walls of the cortical fibers in its internodes, showing uneven thickness. Ultraviolet microscopic observation indicated that localization of cell wall phenolic components was perturbed and that these components abundantly deposited at the aggregated cell wall regions in sclerenchyma. Therefore, regulation of deposition and assembly of secondary cell wall materials, i.e. phenolic components, appear to be disturbed by mutation of the cwa1 gene. Genetic analysis showed that cwa1 is allelic to brittle culm1 (bc1), which encodes the glycosylphosphatidylinositol-anchored COBRA-like protein specifically in plants. BC1 is known as a regulator that controls the culm mechanical strength and cellulose content in the secondary cell walls of sclerenchyma, but the precise function of BC1 has not been resolved. Our results suggest that CWA1/BC1 has an essential role in assembling cell wall constituents at their appropriate sites, thereby enabling synthesis of solid and flexible internodes in rice.
Engaging patients as partners in health research: Lessons from BC, Canada.
Holmes, Bev J; Bryan, Stirling; Ho, Kendall; McGavin, Colleen
2018-03-01
Canada is seeing increased interest in engaging patients in health research, recognizing the potential to improve its relevance and quality. The momentum is promising, but there may be a tendency to ignore the challenges inherent when lay people and professionals collaborate. We address some of these challenges as they relate to recruitment, training, and support for patients at the British Columbia (BC) Support for People and Patient-Oriented Research Unit, part of Canada's Strategy for Patient-Oriented Research. A retrospective review of a telehealth project demonstrates that, as well as the practical elements of recruitment, training, and support, attention must be paid to issues of credibility, legitimacy, and power when engaging patients. We propose that all patient-oriented research projects would benefit from using a similar framework to guide patient engagement planning and implementation, helping to anticipate and mitigate challenges from the outset. Projects would ideally also include the study of patient engagement methods, to add to this important body of knowledge.
Proceedings of the Ocean Industries BC conference : the next wave. Online ed.
International Nuclear Information System (INIS)
2006-01-01
Ocean Industries BC is a non-profit society that aims to promote the responsible development of British Columbia's ocean industries by working to ensure that people and businesses in British Columbia obtain the maximum possible benefits from the opportunities presented by new developments in the region. This conference discussed recent developments in both the natural gas, nuclear and petroleum industries. Renewable energy source development was also discussed. Helicopters and submarines used by various industries were reviewed, as well as new technologies for modelling. New developments in oceanography and basin research were also presented, as well as various modelling approaches now used by researchers in the petroleum industry. Issues concerning the construction of liquefied natural gas (LNG) facilities were also discussed. The conference featured 23 presentations, of which 1 has been catalogued separately for inclusion in this database. refs., tabs., figs
Directory of Open Access Journals (Sweden)
Prokopenko Yuriy A.
2016-10-01
Full Text Available The article is devoted to the semantic and chronological analysis of the images on the plate of white tuff discovered in the city of Stavropol. The central part of the relief is occupied with the image of table – an altar with hoisted bull head (in the background and the hanging part of bull skin (in the foreground. Between the protruding edges of the hanging skin and lower to the ground (between the legs of the altar an ancient Greek phrase carved in three lines. The composition is completed by flanking images of two figures in long robes depicted in profile, symmetrically turned to the head of the bull. The figure at the right is an image of a man with a long beard, the lower edge of which is bent forward (priest or king. The figure at the left is a female (queen. Both the man and the woman are holding ritual vessels in hands. The plot of bull sacrifice is typical for the cultural traditions of ancient Greece as well as for ancient eastern states. The fact of combining images and inscriptions peculiar of the Hellenistic culture and ancient Iranian mythology on the Stavropol altar should be associated with the religious policy pursued by the Pontic kings since the second half of the 3rd century BC till the Common Era. This policy was focused on the gradual replacement of local cults by Greek ones in the official pantheon. The reasons for the Asia Minor altar existence in the Stavropol Upland include: 1 the military expeditions of the Sarmatians to Asia Minor in 2nd – 1st centuries BC; 2 the establishment of political and economic ties by the North Caucasus population with the state of Seleucids in the 2nd century BC, with Parthia in the 2nd – 1st centuries BC, and especially with the kingdom of Pontus in the 1st century BC.
International Nuclear Information System (INIS)
Cape, Jonathan L.; Strahan, Jeff R.; Lenaeus, Michael J.; Yuknis, Brook A.; Le, Trieu T.; Shepherd, Jennifer; Bowman, Michael K.; Kramer, David M.
2005-01-01
The mitochondrial cytochrome bc1 complex catalyzes the transfer of electrons from ubiquinol to cyt c, while generating a proton motive force for ATP synthesis, via the ''Qcycle'' mechanism. Under certain conditions, electron flow through the Q-cycle is blocked at the level of a reactive intermediate in the quinol oxidase site of the enzyme, resulting in ''bypass reactions'', some of which lead to superoxide production. Using analogs of the respiratory substrates, ubiquinol-3 and rhodoquinol-3, we show that the relative rates of Q-cycle bypass reactions in the Saccharomyces cerevisiae cyt bc1 complex are highly dependent, by a factor of up to one hundred-fold, on the properties of the substrate quinol. Our results suggest that the rate of Q-cycle bypass reactions is dependent on the steady state concentration of reactive intermediates produced at the quinol oxidase site of the enzyme. We conclude that normal operation of the Q-cycle requires a fairly narrow window of redox potentials, with respect to the quinol substrate, to allow normal turnover of the complex while preventing potentially damaging bypass reactions
Huang, Li-Shar; Cobessi, David; Tung, Eric Y; Berry, Edward A
2005-08-19
Antimycin A (antimycin), one of the first known and most potent inhibitors of the mitochondrial respiratory chain, binds to the quinone reduction site of the cytochrome bc1 complex. Structure-activity relationship studies have shown that the N-formylamino-salicyl-amide group is responsible for most of the binding specificity, and suggested that a low pKa for the phenolic OH group and an intramolecular H-bond between that OH and the carbonyl O of the salicylamide linkage are important. Two previous X-ray structures of antimycin bound to vertebrate bc1 complex gave conflicting results. A new structure reported here of the bovine mitochondrial bc1 complex at 2.28 A resolution with antimycin bound, allows us for the first time to reliably describe the binding of antimycin and shows that the intramolecular hydrogen bond described in solution and in the small-molecule structure is replaced by one involving the NH rather than carbonyl O of the amide linkage, with rotation of the amide group relative to the aromatic ring. The phenolic OH and formylamino N form H-bonds with conserved Asp228 of cytochrome b, and the formylamino O H-bonds via a water molecule to Lys227. A strong density, the right size and shape for a diatomic molecule is found between the other side of the dilactone ring and the alphaA helix.
Energy Technology Data Exchange (ETDEWEB)
Huang, Li-shar; Cobessi, David; Tung, Eric Y.; Berry, Edward A.
2005-05-10
Antimycin A (antimycin), one of the first known and most potent inhibitors of the mitochondrial respiratory chain, binds to the quinone reduction site of the cytochrome bc1 complex.Structure-activity-relationship studies have shown that the N-formylamino-salicyl-amide group is responsible for most of the binding specificity, and suggested that a low pKa for the phenolic OH group and an intramolecular H-bond between that OH and the carbonyl O of the salicylamide linkage are important. Two previous X-ray structures of antimycin bound to vertebrate bc1 complex gave conflicting results. A new structure reported here of the bovine mitochondrial bc1 complex at 2.28Angstrom resolution with antimycin bound, allows us for the first time to reliably describe the binding of antimycin and shows that the intramolecular hydrogen bond described in solution and in the small-molecule structure is replaced by one involving the NH rather than carbonyl O of the amide linkage, with rotation of the amide group relative to the aromatic ring. The phenolic OH and formylamino N form H-bonds with conserved Asp228 of cyt b, and the formylamino O H-bonds via a water molecule to Lys227. A strong density the right size and shape for a diatomic molecule is found between the other side of the dilactone ring and the alpha-A helix.
100-BC-1 Operable Unit focused feasibility study
International Nuclear Information System (INIS)
Day, R.E.
1994-01-01
The standard Comprehensive Environmental Response, Compensation, and Liability Act feasibility study includes development and screening of alternatives (Phases 1 and 2) and the detailed analysis of alternatives (Phase 3). This focused feasibility study constitutes the Phase 3 portion of the feasibility study process for the remedial alternatives initially developed and screened in the 100 Area Feasibility Study Phases 1 and 2 (DOE-RL 1993a). The focused feasibility study process is conducted in two stages, a Process Document (DOE-RL 1994a) and an operable unit-specific focused feasibility study document, such as this one. The focused feasibility study process is performed by implementing a ''plug-in'' style approach; as defined in greater detail in the Process Document, which is a companion to this document. The objective of this focused feasibility study is to provide decision makers with sufficient information to allow appropriate and timely selection of interim remedial measures for candidate waste sites associated with the 100-BC-1 Operable Unit which is located in the north-central part of the Hanford Site. The interim remedial measure candidate waste sites are determined in the Limited Field Investigation (DOE-RL 1993b). Site profiles are developed for each of these waste sites. The site profiles are used in the application of the plug-in approach. The waste site either plugs into the analysis of the alternatives for the group, or deviations from the developed group alternatives are described and documented
Engineering evaluation cost analysis for the 100-B/C area ancillary facilities at the 108-F Building
International Nuclear Information System (INIS)
1996-10-01
In 1995, the US Department of Energy (DOE), Richland Operations Office (RL) conducted a removal site evaluation of selected facilities in the 100 Area of the Hanford Site in accordance with CERCLA and 40 Code of Federal Regulations (CFR) 300.410. The scope of the evaluation included the aboveground portions of the 108-F Biology Laboratory in the 100-F Area and all inactive ancillary buildings and structures in the 100-B/C Area, excluding the reactor building and the river outfall. Based on the evaluation, RL determined that hazardous substances in the 108-F Biology Laboratory and five of the 100-B/C Area facilities may present a potential threat to human health or the environment, and that a non-time critical removal action at these facilities is warranted. This determination was documented in an engineering evaluation/cost analysis (EE/CA) approval memorandum. The EE/CA approval memorandum is the basis on which to proceed with the performance of an EE/CA to determine the appropriate removal action. This report presents the results of the EE/CA for removal alternatives for final disposition of these six facilities. The EE/CA was conducted pursuant to the requirements of CERCLA and 40 CFR 300.415 and is intended to aid RL and the EPA in selecting a preferred removal action
International Nuclear Information System (INIS)
Sibghat-Ullah; Sancar, Z.
1990-01-01
Human cell free extract prepared by the method of Manley et al. carries out repair synthesis on UV-irradiated DNA. Removal of pyrimidine dimers by photoreactivation with DNA photolyase reduces repair synthesis by about 50%. With excess enzyme in the reaction mixture photolyase reduced the repair signal by the same amount even in the absence of photoreactivating light, presumably by binding to pyrimidine dimers and interfering with the binding of human damage recognition protein. Similarly, the UvrB subunit of Escherichia coli (A)BC excinuclease when loaded onto UV-irradiated or psoralen-adducted DNA inhibited repair synthesis by cell-free extract by 75-80%. The opposite was true also as HeLa cell free extract specifically inhibited the photorepair of a thymine dimer by DNA photolyase and its removal by (A)BC excinuclease. Cell-free extracts from xeroderma pigmentosum (XP) complementation groups A and C were equally effective in blocking the E. coli repair proteins, while extracts from complementation groups D and E were ineffective in blocking the E. coli enzyme. These results suggest that XP-D and XP-E cells are defective in the damage recognition subunits(s) of human excision nuclease
Haeyen, S.W.; Hooren, S. van; Hutschemaekers, G.J.M.
2015-01-01
Art therapy (AT) is frequently used in the treatment of patients diagnosed with cluster B/C personality disorders, but there is little evidence for its efficacy. This study aimed to provide insight into the perceived effects of AT. We interviewed 29 adult patients in individual and focus-group in-depth interviews, including a ‘negative case’, starting with a topic list coming from the literature study. Data were gathered and analysed using the Grounded Theory Approach in order to generate con...
Directory of Open Access Journals (Sweden)
Rayza Carla Lopes Della Colleta
2008-12-01
Full Text Available Analisou-se a morfoanatomia foliar de Ornithocephalus bicornis Lindl. ex Benth., Ornithocephalus myrticola Lindl., Psygmorchis pusilla (L. e Psygmorchis glossomystax (Rchb. f., a fim de identificar caracteres de valor taxonômico e significado ecológico. Folhas expandidas foram coletadas na região de Alta Floresta, MT. As amostras foram incluídas em metacrilato, cortadas em micrótomo de mesa e corados com azul de toluidina. As lâminas foram montadas em resina sintética ou gelatina glicerinada. Epidermes foliares foram dissociadas e testes histoquímicos aplicados. As plantas observadas neste estudo são epífitas, carnosas e não apresentam pseudobulbos. A epiderme é uniestratificada e delgada com exceção de O. bicornis que é espessa, apresentando cutícula delgada e lisa. As espécies estudadas apresentam folhas anfiestomáticas com os estômatos presentes no mesmo nível das células epidérmicas. Os estômatos geralmente são anomocíticos e tetracíticos em O. myrticola, P. pusilla e P. glossomystax. Em O. bicornis ocorrem tetracítico, anisocítico e actinocítico. As células-guarda são de paredes periclinais espessas e as câmaras subestomática são pequenas, exceto em P. pusilla. Com exceção de O. bicornis, o mesofilo das espécies é heterogêneo, sendo constituído de diferentes tipos de parênquima. Os feixes vasculares são colaterais. As espécies foram consideradas mesófilas.Leaf anatomy of O. bicornis Lindl. ex Benth., O. myrticola Lindl., P. pusilla (L. and P. glossomystax (Rchb. f. was analyzed to identify valuable taxonomic and ecological traits. Expanded leaves were collected in the Alta Floresta, Mato Grosso State, region. Leaf samples embedded in methacrylate were cut with a table microtome and stained with toluidine blue. Slides were mounted in synthetic resin or in glycerin gelatin. Leaf tissues were dissociated and histochemical tests applied. Plants observed in this study are succulent epiphytes without
Directory of Open Access Journals (Sweden)
David Quixal Santos
2016-11-01
Full Text Available Archaeological evidences date the expansion of grape vineyards in the territory of the Iberian Iron Age city of Kelin from the 5th to 3rd centuries BC; although the origins are documented in the 7th BC. One of the singularities of this territory is the existence of outdoors stone structures for the production of wine and oil. All are located in a specific area of the territory (la Alcantarilla and Los Morenos ravines (Requena, Valencia, and are associated with archaeological materials that allow date them as Iberian. In this paper we approach the rural settlement pattern in la Alcantarilla ravine and we present in detail the archaeological sites of Rambla de la Alcantarilla and Solana de Cantos 2.
Krasilenko, Vladimir G.; Lazarev, Alexander A.; Nikitovich, Diana V.
2017-10-01
The paper considers results of design and modeling of continuously logical base cells (CL BC) based on current mirrors (CM) with functions of preliminary analogue and subsequent analogue-digital processing for creating sensor multichannel analog-to-digital converters (SMC ADCs) and image processors (IP). For such with vector or matrix parallel inputs-outputs IP and SMC ADCs it is needed active basic photosensitive cells with an extended electronic circuit, which are considered in paper. Such basic cells and ADCs based on them have a number of advantages: high speed and reliability, simplicity, small power consumption, high integration level for linear and matrix structures. We show design of the CL BC and ADC of photocurrents and their various possible implementations and its simulations. We consider CL BC for methods of selection and rank preprocessing and linear array of ADCs with conversion to binary codes and Gray codes. In contrast to our previous works here we will dwell more on analogue preprocessing schemes for signals of neighboring cells. Let us show how the introduction of simple nodes based on current mirrors extends the range of functions performed by the image processor. Each channel of the structure consists of several digital-analog cells (DC) on 15-35 CMOS. The amount of DC does not exceed the number of digits of the formed code, and for an iteration type, only one cell of DC, complemented by the device of selection and holding (SHD), is required. One channel of ADC with iteration is based on one DC-(G) and SHD, and it has only 35 CMOS transistors. In such ADCs easily parallel code can be realized and also serial-parallel output code. The circuits and simulation results of their design with OrCAD are shown. The supply voltage of the DC is 1.8÷3.3V, the range of an input photocurrent is 0.1÷24μA, the transformation time is 20÷30nS at 6-8 bit binary or Gray codes. The general power consumption of the ADC with iteration is only 50÷100μW, if the
This land is their land : an audit of the regulation of the oil and gas industry in BC
Energy Technology Data Exchange (ETDEWEB)
Howard, T.; Parfitt, B.; King, J.; Milligan, J. [Sierra Legal Defence Fund, Vancouver, BC (Canada)
2005-06-01
This paper presents an audit of the regulation of the oil and gas industry in British Columbia (BC) with a particular look at the following 5 areas: landowner rights; strength and independence of the regulator, the Oil and Gas Commission (OGC); environmental protection; protection of First Nations' rights; and management of revenues. It provides an analysis of the province's progress in each area, along with a final grade for each category. The audit includes a comparison between BC, Alberta and Colorado, and showed that unlike Alberta, landowners in British Columbia cannot appeal a decision, such as pipeline approval, even if it directly affects their land. They have no right to compensation if seismic surveys damage their water wells, they can have polluted waste spread on their lands without their permission, and run the risk of having to pay for clean-up of a contaminated well site. Landowners are exposed to unacceptable levels of risk by rules that allow a company to site a sour gas well as close as 80 metres to a family home. The grade assigned for landowner rights was an F. In terms of strength and independence of the regulator, the audit showed that the OGC budget and staffing have not kept pace with industry growth. Industry expenditures have grown by 271 per cent from 1999 to 2003, while OGC staff have only increased by 46 per cent in the same time period. Joint federal-provincial field audits show that 20 per cent of operations are either in disregard for the law, or pose an immediate threat to the environment. OGC field audit statistics reveal a non-compliance rate of 64 per cent. In addition, the OGC Commissioner has ruled against landowners and First Nations on every complaint that has been recommended for dispute resolution. The grade assigned for the OGC was a C +. The audit showed that most of BC's environmental protection rules are not enforceable because they have never been made into laws. The province gives less protection to
International Nuclear Information System (INIS)
Yuan Xuhao; Ke Hongwei; Ding Yibing; Li Xueqian
2012-01-01
We indicated in our previous work that for QED the role of the scalar potential which appears at the loop level is much smaller than that of the vector potential and is in fact negligible. But the situation is different for QCD, one reason is that the loop effects are more significant because α s is much larger than α, and second the non-perturbative QCD effects may induce a sizable scalar potential. In this work, we study phenomenologically the contribution of the scalar potential to the spectra of charmonia, bottomonia and bc-bar (b-bar c) families. Taking into account both vector and scalar potentials, by fitting the well measured charmonia and bottomonia spectra, we re-fix the relevant parameters and test them by calculating other states of not only the charmonia and bottomonia families, but also the bc-bar family. We also consider the Lamb shift of the spectra. (authors)
[A space for women in the Etruscan and Roman houses (VI-I cent. B.C.)?].
Jolivet, Vincent
2011-01-01
The article analyzes the scientific discussion about the existence of a domestic space reserved to women in Etruscan and Roman houses. The hypotesis regarding the existence of a 'gynaeceum' has been recently proposed for the Etruscan houses built on Palatino in Rome (VI cent. B.C.) and for the ancient phase of the Centaurus Protodomus in Pompei. Considering the specific role of Roman matronae as laniferae, and also a substantial equality of social role between Etruscan men and women, it is possible to advance the hypotesis of the existence of a room originally reserved to women (oecus) on one side of the tablinum, the symmetrical room being reserved to men (triclinium).
Ros, Macarena; Tierno de Figueroa, José Manuel; Guerra-García, José Manuel; Navarro-Barranco, Carlos; Lacerda, Mariana Baptista; Vázquez-Luis, Maite; Masunari, Setuko
2014-02-01
The trophic ecology of non-native species is a key aspect to understand their invasion success and the community effects. Despite the important role of caprellid amphipods as trophic intermediates between primary producers and higher levels of marine food webs, there is very little information on their feeding habits. This is the first comprehensive study on the trophic strategies of two co-occurring introduced caprellids in the Spanish coasts: Caprella scaura and Paracaprella pusilla. The diet of 446 specimens of C. scaura and 230 of P. pusilla was analyzed to investigate whether there were differences in the feeding habits in relation to habitat characteristics (natural vs artificial hard substrata), type of host substrata (bryozoans and hydroids) and native vs introduced distribution ranges (Brazil vs Spain). Results revealed differences in diet preferences of the two species that have important implications for their trophic behaviour and showed a limited food overlap, which may favour their coexistence in introduced areas. In general terms, P. pusilla is a predator species, showing preference by crustacean prey in all of its life stages, while C. scaura feeds mainly on detritus. Although no sex-related diet shifts were observed in either of the species, evidence of ontogenetic variation in diet of C. scaura was found, with juveniles feeding on more amount of prey than adults. No diet differences were found between native and introduced populations within the same habitat type. However, P. pusilla exhibited a shift in its diet when different habitats were compared in the same distribution area, and C. scaura showed a flexible feeding behaviour between different host substrata in the same habitat type. This study shows that habitat characteristics at different scales can have greater influence on the feeding ecology of exotic species than different distribution ranges, and support the hypothesis that a switch between feeding strategies depending on habitat
Kroesen, BJ; Jacobs, Susan; Pettus, BJ; Sietsma, H; Kok, JW; Hannun, YA; de Leij, LFMH
2003-01-01
In this study, we describe an ordered formation of long- and very long-chain ceramide species in relation to the progression of B-cell receptor (BcR) triggering induced apoptosis. An early and caspase-independent increase in long-chain ceramide species, in which C-24-ceramide predominated, was
Borodin, V. A.; Vladimirov, P. V.
2017-12-01
The determination of primary damage production efficiency in metals irradiated with fast neutrons is a complex problem. Typically, the majority of atoms are displaced from their lattice positions not by neutrons themselves, but by energetic primary recoils, that can produce both single Frenkel pairs and dense localized cascades. Though a number of codes are available for the calculation of displacement damage from fast ions, they commonly use binary collision (BC) approximation, which is unreliable for dense cascades and thus tend to overestimate the number of created displacements. In order to amend the radiation damage predictions, this work suggests a combined approach, where the BC approximation is used for counting single Frenkel pairs only, whereas the secondary recoils able to produce localized dense cascades are stored for later processing, but not followed explicitly. The displacement production in dense cascades is then determined independently from molecular dynamics (MD) simulations. Combining contributions from different calculations, one gets the total number of displacements created by particular neutron spectrum. The approach is applied here to the case of beryllium irradiation in a fusion reactor. Using a relevant calculated energy spectrum of primary knocked-on atoms (PKAs), it is demonstrated that more than a half of the primary point defects (˜150/PKA) is produced by low-energy recoils in the form of single Frenkel pairs. The contribution to the damage from the dense cascades as predicted using the mixed BC/MD scheme, i.e. ˜110/PKA, is remarkably lower than the value deduced from uncorrected SRIM calculations (˜145/PKA), so that in the studied case SRIM tends to overpredict the total primary damage level.
Air quality overview assessment of thermal power generation in Vancouver, BC
International Nuclear Information System (INIS)
Caton, R.B.; Brotherston, A.E.
1992-01-01
B.C. Hydro is preparing a 25 year utilization plan for Burrard Thermal Generating Plant, a 900 MW natural gas fired steam boiler facility near Vancouver. Historical emissions from the plant and ambient air quality in the region were reviewed to place plant operations in context of the technological modifications which have been made over the past 10 years. Environmental effects criteria and regulatory developments which may constrain planning were reviewed and evaluated. Unit emission rates at Burrard have been reduced by 40% since 1989, by extensive combustion modifications, to ca 40 ng/J of NOx. Nevertheless, anticipated regulatory requirements of emissions reductions nationally and in the Vancouver region will necessitate further reductions, or equivalent strategies, over the next ten years. The findings of the Burrard Thermal air quality review are summarized, including historical emissions in the Lower Mainland, transport and transformation of oxidants and acidic deposition, human health impacts, and vegetation impacts. The difficulties that arise in evaluating the imapct of an isolated source of NOx in an urban area are discussed. 30 refs., 5 figs., 6 tabs
BC Hydro's integrated approach on replacing underground feeder cables
Energy Technology Data Exchange (ETDEWEB)
Tarampi, D. [BC Hydro, Burnaby, BC (Canada)
2008-07-01
BC Hydro's integrated approach on replacing underground feeder cables was discussed. The feeder cables were all in ducts encased in concrete and splices were identified in concrete manholes. The feeder cables averaged 35 to 40 failures per year, with a large majority of failures occurring in manholes or near terminations. The age of the cables was not known. A graphical representation of a condition assessment was presented with reference to an electrical test, metallurgical test, hardness test, and dye penetrating test. Prioritization steps were also listed, including a condition index and replacement threshold. Steps in prioritizing the condition index included determining the insulation index based on electrical test results; determining the manhole condition based on metallurgical test results; determining the customer importance factor and feeder load factor; and calculating the overall condition index based on the indices. A process flowchart was also illustrated. A replacement strategy was then discussed and a cost comparison of two options was described. Option 1 was to replace only the unjacketed cables while option two involved selective replacement. tabs., figs.
Akimova, S.; Gallet, Y.; Amirov, S.; Petrova, N.
2016-12-01
The main objective of this study is to recover the geomagnetic field intensity variations in the Middle East during the 7th and 6th millennia BC, with a particular focus on rapid fluctuations. We will report on new archeointensity data obtained from two ancient Late Neolithic settlements called Yarim Tepe I and II, located today in Northern Iraq, which were excavated by Soviet archeologists in the seventies. Yarim Tepe II, comprising a 7-m thick sequence of cultural deposits divided into nine successive levels, is dated from the Halaf period ( 5950-5300 BC). Yarim Tepe I is dated from the Pre-Halaf period ( 6300-5950 BC), with three recognized cultural phases referred to as Hassuna I, II and III. There, the deposits form a sequence of 6.5 m, which were divided into 12 archeological levels. Most of the archeological artifacts discovered during the excavations, in particular thousands of potsherds, are stored at the repository of Archeological Institute in Moscow, where our sampling was undertaken. We collected 29 groups of potsherds from Yarim Tepe II and 22 groups from Yarim Tepe I from superimposed stratigraphic layers having on average a thickness of about 20 cm. Each group consists of at least 3 (up to 10) fragments. All analyses were carried out using the three-axis vibrating sample magnetometer Triaxe, which allows magnetization measurements of a small sample (developed for the Triaxe magnetometer takes into account both the anisotropy and cooling rate effects on thermoremanent magnetization acquisition. Together with other data previously obtained from Syria and Bulgaria, the new archeointensity results show the occurrence of rapid geomagnetic field fluctuations in the Middle East during the Late Neolithic period, in particular during the 6th millennium BC. The data from Yarim Tepe II indeed confirm the occurrence of a short-lasting intensity peak around 5500 BC, with intensity variation rates as high as 0.35 - 0.15 µT/year over a few decades. We will also
Garcia-Martínez, I; Sánchez-Mora, C; Pagerols, M; Richarte, V; Corrales, M; Fadeuilhe, C; Cormand, B; Casas, M; Ramos-Quiroga, J A; Ribasés, M
2016-08-30
Attention deficit and hyperactivity disorder (ADHD) is a prevalent neurodevelopmental disorder characterized by impairment to sustain attention and inability to control impulses and activity level. The etiology of ADHD is complex, with an estimated heritability of 70-80%. Under the hypothesis that alterations in the processing or target binding of microRNAs (miRNAs) may result in functional alterations predisposing to ADHD, we explored whether common polymorphisms potentially affecting miRNA-mediated regulation are involved in this psychiatric disorder. We performed a comprehensive association study focused on 134 miRNAs in 754 ADHD subjects and 766 controls and found association between the miR-34b/c locus and ADHD. Subsequently, we provided preliminary evidence for overexpression of the miR-34c-3p mature form in peripheral blood mononuclear cells of ADHD subjects. Next, we tested the effect on gene expression of single-nucleotide polymorphisms within the ADHD-associated region and found that rs4938923 in the promoter of the pri-miR-34b/c tags cis expression quantitative trait loci for both miR-34b and miR-34c and has an impact on the expression levels of 681 transcripts in trans, including genes previously associated with ADHD. This gene set was enriched for miR-34b/c binding sites, functional categories related to the central nervous system, such as axon guidance or neuron differentiation, and serotonin biosynthesis and signaling canonical pathways. Our results provide preliminary evidence for the contribution to ADHD of a functional variant in the pri-miR-34b/c promoter, possibly through dysregulation of the expression of mature forms of miR-34b and miR-34c and some target genes. These data highlight the importance of abnormal miRNA function as a potential epigenetic mechanism contributing to ADHD.
Alexandrovskiy, AL; van der Plicht, J; Belinskiy, AB; Khokhlova, OS
2001-01-01
Chrono-sequences of paleosols buried under different mounds of the large Ipatovo Kurgan, constructed during the Bronze Age, have been studied to reconstruct climatic changes in the dry steppe zone of the Northern Caucasus, Russia. Abrupt climatic and environmental changes in the third millennium BC
Pu, Maoping; Privalov, Timofei
2013-04-01
Activation of H2 by a "frustrated Lewis pair" (FLP) composed of B(C6F5)3 and P(tBu)3 species has been explored with high level direct ab initio molecular dynamics (AIMD) simulations at finite temperature (T = 300 K) in gas phase. The initial geometrical conditions for the AIMD trajectory calculations, i.e., the near attack conformations of FLP + H2, were devised using the host-guest model in which suitable FLP conformations were obtained from the dynamics of the B(C6F5)3/P(tBu)3 pair in gas phase. AIMD trajectory calculations yielded microscopic insight into effects which originate from nuclear motion in the reacting complex, e.g., the alternating compression/elongation of the boron-phosphorous distance and the change of the pyramidality of boron in B(C6F5)3. The ensemble averaged trajectory analysis has been compared with the minimum energy path (MEP) description of the reaction. Similar to MEP, AIMD shows that an attack of the acid/base pair on the H-H bond gives rise to the polarization of the H2 molecule and as a consequence generates a large dipole moment of the reacting complex. The MEP and AIMD portrayals of the reaction are fundamentally different in terms of the magnitude of the motion of nuclei in B(C6F5)3 and P(tBu)3 during the H2 cleavage. In the AIMD trajectory simulations, geometries of B(C6F5)3 and P(tBu)3 appear as nearly "frozen" on the short time scale of the H2 cleavage. This is contrary to the MEP picture. Several of the concepts which arise from this work, e.g., separation of time scales of nuclear motion and the time-dependence of the donor-acceptor interactions in the reacting complex, are important for the understanding of chemical reactivity and catalysis.
The Efficiency of the BC-720 Scintillator in a High-Energy (20--800 MeV) Accelerator Neutron Field
Energy Technology Data Exchange (ETDEWEB)
Miles, Leslie H. [Univ. of Missouri, Columbia, MO (United States)
2005-12-01
High-energy neutron doses (>20 MeV) are of little importance to most radiation workers. However, space and flight crews, and people working around medical and scientific accelerators receive over half of their radiation dose from high-energy neutrons. Unfortunately, neutrons are difficult to measure, and no suitable dosimetry has yet been developed to measure this radiation. In this paper, basic high-energy neutron interactions, characteristics of high-energy neutron environments, present neutron dosimetry, and quantities used in neutron dosimetry are discussed before looking into the potential of the BC-720 scintillator to improve dosimetry. This research utilized 800 MeV protons impinging upon the WNR Facility spallation neutron source at Los Alamos National Laboratory. Time-of-flight methods and a U-238 Fission Chamber were used to aid evaluation of the efficiency of the BC-720. Results showed that the efficiency is finite over the 20–650 MeV energy region studied, although it decreases by a factor of ten between 40 and 100 MeV. This limits the use of this dosimeter to measure doses at sitespecific locations. It also encourages modifications to use this dosimeter for any unknown neutron field. As such, this dosimeter has the potential for a small, lightweight, real-time dose measurement, which could impact neutron dosimetry in all high-energy neutron environments.
Directory of Open Access Journals (Sweden)
CUBAS, M., BOLADO DEL CASTILLO, R., PEREDA ROSALES, E.M. y FERNÁNDEZ VEGA, P.A.
2013-01-01
En este artículo se presenta una visión diacrónica de la cerámica en la actual provincia de Cantabria desde su aparición (V milenio cal BC hasta el momento en el que finaliza lo que tradicionalmente se ha considerado como Prehistoria (siglo I cal BC. Se señalan las características tecnológicas, morfológicas y decorativas, resaltando aquellos rasgos comunes de los conjuntos cerámicos documentados durante este intervalo cronológico.
Principles and applications of knowledge management in the BC industry (with examples
Directory of Open Access Journals (Sweden)
Igor Bizjak
2006-01-01
Full Text Available Many definitions define Knowledge Management as capturing, organizing and storing knowledge by different methods from various sources and transforming it into enduring value. The knowledge management is one of the most important principles that companies must explore and use to gain the competitive advantage, even in buildings and construction industry. There are various projects of knowledge management for the BC industry. One such project is e-COGNOS. Its key issues are knowledge management in the construction domain and documents interdependencies and consistency across projects and between enterprises. At the Urban Planning Institute of the Republic of Slovenia we are using very crude methods of knowledge management or we even can not call it a knowledge management. It is more or less information services or document management. With new technologies like Microsoft SharePoint services, we are hoping that we will be able to advance these old methods and use accumulated knowledge in a more sophisticated way.
Resultados del Programa Nacional de Inmunización Antimeningocócica BC en menores de 1 año en Cuba
Directory of Open Access Journals (Sweden)
Antonio Pérez Rodríguez
1998-09-01
Full Text Available La enfermedad meningocócica (EM constituye en la actualidad un importante problema de salud en todo el mundo. La vacuna VA-MENGOC-BC ha sido aplicada en Cuba desde 1991 a niños menores de 1 año mediante el Programa Nacional de Inmunizaciones (PMI, cuyos resultados se decidieron valorar con el presente estudio. Se realizó un estudio descriptivo de morbilidad y mortalidad por EM y de acuerdo con los antecedentes vacunales de los 237 casos diagnosticados entre el 1ro. de enero de 1991 y el 31 de diciembre de 1996, y se estimó también la efectividad vacunal. Entre los resultados más importantes aparece la tasa de EM en este grupo de edad la cual ha disminuido de 49,9 a 13/100 000 habitantes, mientras la cobertura vacunal se ha incrementado por encima del 95 %, para alcanzar una efectividad vacunal por encima del 90 %. Fue desplazada la mayor incidencia a los 3 meses de edad, con una mayor frecuencia de enfermos en no vacunados. La letalidad general fue de 15,2 %. Se concluyó en que la aplicación de la VA-MENGOC-BC, como parte del PNI, disminuyó la morbilidad y mortalidad por la enfermedad meningocócica de los menores de 1 año de edad.The meningococcal disease (MD is currently an important health problem all around the world. The VA-MENGOC-BC vaccin has been used in Cuba since 1991, in children under 1 year of age, through the National Immunization Program (NIP, and its results were assessed in this study. A descriptive study was carried out on morbidity and mortality due to MD, and in concordance with the vaccine backgrounds of 237 cases diagnosed between January 1st., 1991, and December 31st., 1996; the vaccine effectiveness was also estimated. Among the most important results there is the MD rate in this age group, which has decreased from 49,9 to 13/100 000 inhabitants, while the vaccine coverage has increased over the 95 % to reach a vaccine effectiveness over the 90 %. The major incidence at 3 months of age was displaced, with
International Nuclear Information System (INIS)
BENECKE, M.W.
2005-01-01
A geophysical characterization project was conducted at the BC Cribs and Trenches Area, located south of 200 East at the Hanford Site. The area consists of 26 waste disposal trenches and cribs, which received approximately 30 million gallons of liquid waste from the uranium recovery process and the ferrocyanide processes associated with wastes generated by reprocessing nuclear fuel. Waste discharges to BC Cribs contributed perhaps the largest liquid fraction of contaminants to the ground in the 200 Areas. The site also includes possibly the largest inventory of Tc-99 ever disposed to the soil at Hanford with an estimated quantity of 400 Ci. Other waste constituents included high volumes of nitrate and U-238. The geophysical characterization at the 50-acre site primarily included high resolution resistivity (HRR). The resistivity technique is a non-invasive method by which electrical resistivity data are collected along linear transects, and data are presented as continuous profiles of subsurface electrical properties. The transects ranged in size from about 400-700 meters and provided information down to depths of 60 meters. The site was characterized by a network of 51 HRR lines with a total of approximately 19.7 line kilometers of data collected parallel and perpendicular to the trenches and cribs. The data were compiled to form a three-dimensional representation of low resistivity values. Low resistivity, or high conductivity, is indicative of high ionic strength soil and porewater resulting from the migration of nitrate and other inorganic constituents through the vadose zone. High spatial density soil data from a single borehole, that included coincident nitrate concentrations, electrical conductivity. and Tc-99, were used to transform the electrical resistivity data into a nitrate plume. The plume was shown to extend laterally beyond the original boundaries of the waste site and, in one area, to depths that exceeded the characterization strategy
International Nuclear Information System (INIS)
Devanathan, S.; Salamon, Z.; Tollin, G.; Fitch, J.C.; Meyer, T.E.; Berry, E.A.; Cusanovich, M.A.
2007-01-01
The dissociation constants for the binding of Rhodobacter capsulatus cytochrome c2 and its K93P mutant to the cytochrome bc1 complex embedded in a phospholipid bilayer were measured by plasmon waveguide resonance spectroscopy in the presence and absence of the inhibitor stigmatellin. The reduced form of cytochrome c2 strongly binds to reduced cytochrome bc1 (Kd = 0.02 M) but binds much more weakly to the oxidized form (Kd = 3.1 M). In contrast, oxidized cytochrome c2 binds to oxidized cytochrome bc1 in a biphasic fashion with Kd values of 0.11 and 0.58 M. Such a biphasic interaction is consistent with binding to two separate sites or conformations of oxidized cytochrome c2 and/or cytochrome bc1. However, in the presence of stigmatellin, we find that oxidized cytochrome c2 binds to oxidized cytochrome bc1 in a monophasic fashion with high affinity (Kd = 0.06 M) and reduced cytochrome c2 binds less strongly (Kd = 0.11 M) but ∼30-fold more tightly than in the absence of stigmatellin. Structural studies with cytochrome bc1, with and without the inhibitor stigmatellin, have led to the proposal that the Rieske protein is mobile, moving between the cytochrome b and cytochrome c1 components during turnover. In one conformation, the Rieske protein binds near the heme of cytochrome c1, while the cytochrome c2 binding site is also near the cytochrome c1 heme but on the opposite side from the Rieske site, where cytochrome c2 cannot directly interact with Rieske. However, the inhibitor, stigmatellin, freezes the Rieske protein iron-sulfur cluster in a conformation proximal to cytochrome b and distal to cytochrome c1. We conclude from this that the dual conformation of the Rieske protein is primarily responsible for biphasic binding of oxidized cytochrome c2 to cytochrome c1. This optimizes turnover by maximizing binding of the substrate, oxidized cytochrome c2, when the iron-sulfur cluster is proximal to cytochrome b and minimizing binding of the product, reduced cytochrome c
Mechanisms whereby insulin increases diacylglycerol in BC3H-1 myocytes.
Farese, R V; Cooper, D R; Konda, T S; Nair, G; Standaert, M L; Davis, J S; Pollet, R J
1988-01-01
We previously suggested that insulin increases diacylglycerol (DAG) in BC3H-1 myocytes, both by increases in synthesis de novo of phosphatidic acid (PA) and by hydrolysis of non-inositol-containing phospholipids, such as phosphatidylcholine (PC) and phosphatidylethanolamine (PE). We have now evaluated these insulin effects more thoroughly, and several potential mechanisms for their induction. In studies of the effect on PA synthesis de novo, insulin stimulated [2-3H]glycerol incorporation into PA, DAG, PC/PE and total glycerolipids of BC3H-1 myocytes, regardless of whether insulin was added simultaneously with, or after 2 h or 3 or 10 days of prelabelling with, [2-3H]glycerol. In prelabelled cells, time-related changes in [2-3H]glycerol labelling of DAG correlated well with increases in DAG content: both were maximal in 30-60 s and persisted for 20-30 min. [2-3H]Glycerol labelling of glycerol 3-phosphate, on the other hand, was decreased by insulin, presumably reflecting increased utilization for PA synthesis. Glycerol 3-phosphate concentrations were 0.36 and 0.38 mM before and 1 min after insulin treatment, and insulin effects could not be explained by increases in glycerol 3-phosphate specific radioactivity. In addition to that of [2-3H]glycerol, insulin increased [U-14C]glucose and [1,2,3-3H]glycerol incorporation into DAG and other glycerolipids. Effects of insulin on [2-3H]glycerol incorporation into DAG and other glycerolipids were half-maximal and maximal at 2 nM- and 20 nM-insulin respectively, and were not dependent on glucose concentration in the medium, extracellular Ca2+ or protein synthesis. Despite good correlation between [3H]DAG and DAG content, calculated increases in DAG content from glycerol 3-phosphate specific radioactivity (i.e. via the pathway of PA synthesis de novo) could account for only 15-30% of the observed increases in DAG content. In addition to increases in [3H]glycerol labelling of PC/PE, insulin rapidly (within 30 s) increased PC
BC4GO: a full-text corpus for the BioCreative IV GO task.
Van Auken, Kimberly; Schaeffer, Mary L; McQuilton, Peter; Laulederkind, Stanley J F; Li, Donghui; Wang, Shur-Jen; Hayman, G Thomas; Tweedie, Susan; Arighi, Cecilia N; Done, James; Müller, Hans-Michael; Sternberg, Paul W; Mao, Yuqing; Wei, Chih-Hsuan; Lu, Zhiyong
2014-01-01
Gene function curation via Gene Ontology (GO) annotation is a common task among Model Organism Database groups. Owing to its manual nature, this task is considered one of the bottlenecks in literature curation. There have been many previous attempts at automatic identification of GO terms and supporting information from full text. However, few systems have delivered an accuracy that is comparable with humans. One recognized challenge in developing such systems is the lack of marked sentence-level evidence text that provides the basis for making GO annotations. We aim to create a corpus that includes the GO evidence text along with the three core elements of GO annotations: (i) a gene or gene product, (ii) a GO term and (iii) a GO evidence code. To ensure our results are consistent with real-life GO data, we recruited eight professional GO curators and asked them to follow their routine GO annotation protocols. Our annotators marked up more than 5000 text passages in 200 articles for 1356 distinct GO terms. For evidence sentence selection, the inter-annotator agreement (IAA) results are 9.3% (strict) and 42.7% (relaxed) in F1-measures. For GO term selection, the IAAs are 47% (strict) and 62.9% (hierarchical). Our corpus analysis further shows that abstracts contain ∼ 10% of relevant evidence sentences and 30% distinct GO terms, while the Results/Experiment section has nearly 60% relevant sentences and >70% GO terms. Further, of those evidence sentences found in abstracts, less than one-third contain enough experimental detail to fulfill the three core criteria of a GO annotation. This result demonstrates the need of using full-text articles for text mining GO annotations. Through its use at the BioCreative IV GO (BC4GO) task, we expect our corpus to become a valuable resource for the BioNLP research community. Database URL: http://www.biocreative.org/resources/corpora/bc-iv-go-task-corpus/. Published by Oxford University Press 2014. This work is written by US
Energy Technology Data Exchange (ETDEWEB)
BENECKE, MN.W.
2006-02-22
A geophysical characterization project was conducted at the BC Cribs and Trenches Area, located south of 200 East at the Hanford Site. The area consists of 26 waste disposal trenches and cribs, which received approximately 30 million gallons of liquid waste from the uranium recovery process and the ferrocyanide processes associated with wastes generated by reprocessing nuclear fuel. Waste discharges to BC Cribs contributed perhaps the largest liquid fraction of contaminants to the ground in the 200 Areas. The site also includes possibly the largest inventory of Tc-99 ever disposed to the soil at Hanford with an estimated quantity of 400 Ci. Other waste constituents included high volumes of nitrate and U-238. The geophysical characterization at the 50 acre site primarily included high resolution resistivity (HRR). The resistivity technique is a non-invasive method by which electrical resistivity data are collected along linear transects, and data are presented as continuous profiles of subsurface electrical properties. The transects ranged in size from about 400-700 meters and provided information down to depths of 60 meters. The site was characterized by a network of 51 HRR lines with a total of approximately 19.7 line kilometers of data collected parallel and perpendicular to the trenches and cribs. The data were compiled to form a three-dimensional representation of low resistivity values. Low resistivity, or high conductivity, is indicative of high ionic strength soil and porewater resulting from the migration of nitrate and other inorganic constituents through the vadose zone. High spatial density soil data from a single borehole, that included coincident nitrate concentrations, electrical conductivity, and Tc-99, were used to transform the electrical resistivity data into a nitrate plume. The plume was shown to extend laterally beyond the original boundaries of the waste site and, in one area, to depths that exceeded the characterization strategy. It is
Evaluation of six NEHRP B/C crustal amplification models proposed for use in western North America
Boore, David; Campbell, Kenneth W.
2016-01-01
We evaluate six crustal amplification models based on National Earthquake Hazards Reduction Program (NEHRP) B/C crustal profiles proposed for use in western North America (WNA) and often used in other active crustal regions where crustal properties are unknown. One of the models is based on an interpolation of generic rock velocity profiles previously proposed for WNA and central and eastern North America (CENA), in conjunction with material densities based on an updated velocity–density relationship. A second model is based on the velocity profile used to develop amplification factors for the Next Generation Attenuation (NGA)‐West2 project. A third model is based on a near‐surface velocity profile developed from the NGA‐West2 site database. A fourth model is based on velocity and density profiles originally proposed for use in CENA but recently used to represent crustal properties in California. We propose two alternatives to this latter model that more closely represent WNA crustal properties. We adopt a value of site attenuation (κ0) for each model that is either recommended by the author of the model or proposed by us. Stochastic simulation is used to evaluate the Fourier amplification factors and their impact on response spectra associated with each model. Based on this evaluation, we conclude that among the available models evaluated in this study the NEHRP B/C amplification model of Boore (2016) best represents median crustal amplification in WNA, although the amplification models based on the crustal profiles of Kamai et al. (2013, 2016, unpublished manuscript, see Data and Resources) and Yenier and Atkinson (2015), the latter adjusted to WNA crustal properties, can be used to represent epistemic uncertainty.
Lancelotti, Carla
2018-01-01
Ancient civilisations depended heavily on natural fuel resources for a wide array of activities, and this had an impact on such resources that can be traced in the archaeological record. At its urban apex, the populations of the Indus Civilisation (2600-1900 BC) produced a wide range of objects and crafts, several of which involved highly specialised pyrotechnology. In the wake of increasing aridity and a period of weakened monsoon rainfall that affected South Asia from 2100 BC, these activities potentially put pressure on the natural resource base that may have had to be counterbalanced by differentiation in fuel use. The combined analysis of archaeobotanical and geoarchaeological remains from four Indus urban phase archaeological sites, has enable an assessment of the mechanisms through which people exploited wood, and diversified their fuel resources to adapt to the arid to semi-arid environments in which they lived. The combined use of local wood species with alternative fuels, such as dung and crop-processing leftovers, are evidence for resilient socio-ecological practices during the 700 years of Indus urbanism and perhaps beyond.
Garfinkel, Yosef; Klimscha, Florian; Shalev, Sariel; Rosenberg, Danny
2014-01-01
The beginning of metallurgy in the ancient Near East attracts much attention. The southern Levant, with the rich assemblage of copper artifacts from the Nahal Mishmar cave and the unique gold rings of the Nahal Qanah cave, is regarded as a main center of early metallurgy during the second half of the 5th millennium CalBC. However, a recently discovered copper awl from a Middle Chalcolithic burial at Tel Tsaf, Jordan Valley, Israel, suggests that cast metal technology was introduced to the region as early as the late 6th millennium CalBC. This paper examines the chemical composition of this item and reviews its context. The results indicate that it was exported from a distant source, probably in the Caucasus, and that the location where it was found is indicative of the social status of the buried individual. This rare finding indicates that metallurgy was first diffused [corrected] to the southern Levant through exchange networks and only centuries later involved local productionThis copper awl, the earliest metal artifact found in the southern Levant, indicates that the elaborate Late Chalcolithic metallurgy developed from a more ancient tradition.
Tsoucalas, Gregory; Karamanou, Marianna; Kousoulis, Antonis A; Androutsos, George
2012-01-01
Democritus was born in Abdera, Thrace, in the 5th century BC. He travelled to the East while being the student of famous philosophers. His philosophical ideas and the establishment of particles, "the atoms", gave him a leading position in world history. However, his medical knowledge was vast especially in the field of pediatric pharmacology. Numerous are also the reports of his passion for anatomy. Democritus' views regarding the issue of Human Nature and Anatomy are depicted in a letter he sent to Hippocrates of Kos. He died in old age, possibly of infection after having totally neglected his personal hygiene.
Falla, Abby M; Veldhuijzen, Irene K; Ahmad, Amena A; Levi, Miriam; Richardus, Jan Hendrik
2017-02-20
Language support for linguistic minorities can improve patient safety, clinical outcomes and the quality of health care. Most chronic hepatitis B/C infections in Europe are detected among people born in endemic countries mostly in Africa, Asia and Central/Eastern Europe, groups that may experience language barriers when accessing health care services in their host countries. We investigated availability of interpreters and translated materials for linguistic minority hepatitis B/C patients. We also investigated clinicians' agreement that language barriers are explanations of three scenarios: the low screening uptake of hepatitis B/C screening, the lack of screening in primary care, and why cases do not reach specialist care. An online survey was developed, translated and sent to experts in five health care services involved in screening or treating viral hepatitis in six European countries: Germany, Hungary, Italy, the Netherlands, Spain and the United Kingdom (UK). The five areas of health care were: general practice/family medicine, antenatal care, health care for asylum seekers, sexual health and specialist secondary care. We measured availability using a three-point ordinal scale ('very common', 'variable or not routine' and 'rarely or never'). We measured agreement using a five-point Likert scale. We received 238 responses (23% response rate, N = 1026) from representatives in each health care field in each country. Interpreters are common in the UK, the Netherlands and Spain but variable or rare in Germany, Hungary and Italy. Translated materials are rarely/never available in Hungary, Italy and Spain but commonly or variably available in the Netherlands, Germany and the UK. Differing levels of agreement that language barriers explain the three scenarios are seen across the countries. Professionals in countries with most infrequent availability (Hungary and Italy) disagree strongest that language barriers are explanations. Our findings show pronounced
THE STORY OF THE BC FAMILY JUSTICE INNOVATION LAB
Directory of Open Access Journals (Sweden)
Jane Morley
2017-12-01
Full Text Available Many in the justice system know that fundamental change is needed but few know the best way to do it. Previous attempts using strategic planning approaches have not achieved meaningful change. Something different is needed. The BC Family Justice Innovation Lab (the Lab is experimenting with a different approach drawing on complexity science, the experience of other jurisdictions and disciplines and incorporating human-centred design as a way of focusing on the well-being of families going through the transition of separation and divorce. This article is the story of the first few years of the Lab’s life. It has been a fascinating and challenging path so far, and it remains to be seen whether it will ultimately succeed. The story is offered so that others with similar ambitions can learn from the Lab’s experience – its successes and its failures. It is the nature and strength of stories that the reader will take from them what they will. For the authors, one overriding theme that emerges from this story is that transforming a complex social system, such as the family justice system in British Columbia, requires embracing the complexity of paradox and refusing to be defeated by the tension of opposites and a multitude of wicked, unanswerable questions. Bon nombre d’intervenants du système de justice savent qu’un changement fondamental s’impose, mais peu connaissent la meilleure façon de le réaliser. Dans le passé, l’utilisation d’approches de planification stratégique n’a pas donné les résultats escomptés. Une approche différente est nécessaire. S’inspirant de l’expérience vécue dans d’autres ressorts et d’autres disciplines, le BC Family Justice Innovation Lab (le Lab expérimente actuellement une approche différente fondée sur la science de la complexité, et s’efforce d’intégrer une conception axée sur la personne afin de mettre de l’avant le bien-être des familles
DEFF Research Database (Denmark)
Vandkilde, Helle
2014-01-01
The breakthrough of the Nordic Bronze Age (NBA) c. 1600 bc as a koiné within Bronze Age Europe can be historically linked to the Carpathian Basin. Nordic distinctiveness entailed an entanglement of cosmology and warriorhood, albeit represented through different media in the hotspot zone (bronze) ...... momentous creativity that drew upon Carpathian originals, contacts and a pool of Carpathian ideas, but ultimately drawing on emergent Mycenaean hegemonies in the Aegean. This provided the incentive for a cosmology-rooted resource from which the NBA could take its starting point....
Measurement of $B_c^+$ production in proton-proton collisions at $\\sqrt{s}=8$ TeV
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew Christopher; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skillicorn, Ian; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilschut, Hans; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang
2015-01-01
Production of $B_c^+$ mesons in proton-proton collisions at a center-of-mass energy of 8 TeV is studied with data corresponding to an integrated luminosity of $2.0~{\\rm fb^{-1}}$ recorded by the LHCb experiment. The ratio of production cross-sections times branching fractions between the $B_c^+\\to J/\\psi \\pi^+$ and $B^+\\to J/\\psi K^+$ decays is measured as a function of transverse momentum and rapidity in the regions $0 < p_{\\rm T} < 20{\\rm GeV}/c$ and $2.0 < y < 4.5$. The ratio integrated within this kinematic range is measured to be $(0.683\\,\\pm\\,0.018\\,\\pm\\,0.009)\\%$, where the first uncertainty is statistical and the second systematic.
International Nuclear Information System (INIS)
Anon
2004-01-01
Opening of a new propane terminal in Surrey, BC by Canwest Propane Ltd., is reported. The facility is the first rail terminal opened by Canwest, and is intended to serve the greater Vancouver area, Vancouver island and the US Northwest, specifically Washington State. The Surrey location allows the company to service its business by rail, the most efficient method of getting product to the Lower Mainland. The facility sits on 4.5 acres of land; a CN rail track runs alongside the site, where six 30,000 gallon storage tanks are located. About 60 million litres of propane is expected to be distributed from the terminal, with further expansion anticipated both on Vancouver Island and in the US Northwest. photos
International Nuclear Information System (INIS)
Civici, N.; Gjongecaj, Sh.; Stamati, F.; Dilo, T.; Pavlidou, E.; Polychroniadis, E.K.; Smit, Z.
2007-01-01
The elemental composition of 122 silver coins from a hoard of the 3rd century BC, minted by the Illyrian king Monounios and the ancient cities of Dyrrachion and Korkyra was determined by EDXRF. The results showed that the different groups of coins were made of a similar Ag-Cu alloy with Ag concentration in the range 94-98%. The examination of the contents of minor elements Pb, Au and Bi showed that the coins minted by the Illyrian king Monounios have similar composition with the largest part of Dyrrachion coins and those from Korkyra. On the other side, two subgroups containing different amounts of Au and Bi can be observed within the general group of coins minted in Dyrrachion
GanedenBC30™ cell wall and metabolites: anti-inflammatory and immune modulating effects
Carter Steve G; Benson Kathleen F; Jensen Gitte S; Endres John R
2010-01-01
Abstract Background This study was performed to evaluate anti-inflammatory and immune modulating properties of the probiotic, spore-forming bacterial strain: Bacillus coagulans: GBI-30, (PTA-6086, GanedenBC30TM). In addition, cell wall and metabolite fractions were assayed separately to address whether biological effects were due to cell wall components only, or whether secreted compounds from live bacteria had additional biological properties. The spores were heat-activated, and bacterial cu...
Directory of Open Access Journals (Sweden)
Mei Chung
2015-03-01
Full Text Available Elevated blood pressure is an indicator of cardiovascular stress and increased risk of cardiovascular-related morbidity and mortality. There is emerging evidence suggesting air pollutants, including particulate matter (PM, could promote hypertension, thereby increasing cardiovascular disease risk. Repeated measurement analyses were conducted to examine the associations of three types of PM with systolic blood pressure (SBP, diastolic blood pressure (DBP, and pulse pressure (PP in 220 participants, (mean age = 58.5 years from the Community Assessment of Freeway Exposure and Health study (CAFEH, most of whom live near a major highway. Ambient levels of air pollutants including particle number concentration (PNC; a measure of ultrafine particle (UFP concentration, fine PM (PM2.5, Particle diameter <2.5 µm, and black carbon (BC were measured at a central site <7 km from the study areas. Central sites are good at capturing short-term temporal trends in pollution associated with meteorological changes over regional areas. Linear mixed-effect models that accounted for repeated measures within one person were used to examine the associations between blood pressure variables and daily average of ambient PNC, PM2.5, or BC, controlling for demographic characteristics and major confounders including temperature. Our PNC model predicted that a higher PNC of 10,000 particles/cm3 was associated with higher DBP of 2.40 mmHg (p = 0.03, independent of other factors in the model. There were no significant associations for PM2.5 or BC. Post hoc subgroup analyses by obesity status showed that positive associations of DBP with PNC were more pronounced among obese individuals than non-obese individuals. These results suggested that PNC levels are associated with increased blood pressure, which may contribute to cardiovascular disease risk. More research is needed to assess the relationship between PNC and blood pressure and to address possible residual confounding.
First-principles calculations of BC{sub 4}N nanostructures: stability and electronic structure
Energy Technology Data Exchange (ETDEWEB)
Freitas, A.; Azevedo, S. [Universidade Federal da Paraiba, CCEN, Departamento de Fisica, Joao Pessoa, PB (Brazil); Machado, M. [Universidade Federal de Pelotas, Departamento de Fisica, Pelotas, RS (Brazil); Kaschny, J.R. [Instituto Federal da Bahia-Campus Vitoria da Conquista, Vitoria da Conquista, BA (Brazil)
2012-07-15
In this work, we apply first-principles methods to investigate the stability and electronic structure of BC{sub 4}N nanostructures which were constructed from hexagonal graphite layers where substitutional nitrogen and boron atoms are placed at specific sites. These layers were rolled up to form zigzag and armchair nanotubes, with diameters varying from 7 to 12 A, or cut and bent to form nanocones, with 60 and 120 disclination angles. The calculation results indicate that the most stable structures are the ones which maximize the number of B-N and C-C bonds. It is found that the zigzag nanotubes are more stable than the armchair ones, where the strain energy decreases with increasing tube diameter D, following a 1/D {sup 2} law. The results show that the 60 disclination nanocones are the most stable ones. Additionally, the calculated electronic properties indicate a semiconducting behavior for all calculated structures, which is intermediate to the typical behaviors found for hexagonal boron nitride and graphene. (orig.)
The eastern oven from level seventh of ‘El Soto de Medinilla’ settlement (VII century BC
Directory of Open Access Journals (Sweden)
Miguel Ángel ARNÁIZ ALONSO
2016-07-01
Full Text Available During excavation works in El Soto de Medinilla archaeological site which were carried out in the last systematic archaeological intervention between 1989-1990 a domestic oven for baking bread was documented in a context dated bay C in 690 BC –Full Phase–. In this paper, on the one hand parallels are sought on basis of its use and form; and on the other, it is related to other documented structures and archaeological data–carpological, anthracological, pollen and faunal– in their level origin. Finally its belonging to El Soto cultural tradition as posed by previous research is put into question and instead an explication that attends alliances and external influences from the peninsular south is proposed.
Fully Integrated 1.7GHz, 188dBc/Hz FoM, 0.8V, 320uW LC-tank VCO and Frequency Divider
DEFF Research Database (Denmark)
Midtgaard, Jesper Stolpe; Jeppesen, Thomas; Christensen, Kåre Tais
2005-01-01
This paper presents a 0.13μm CMOS 1.7GHz VCO with frequency divider, suitable for ultra-low-power hearing-aid applications. The circuit has a 16% tuning range, a minimum power consumption of 320μW from a 0.8V power supply, power-supply and temperature compensation, an excellent 188dBc/Hz figure...
Directory of Open Access Journals (Sweden)
Pascual Izquierdo-Egea
2014-12-01
Full Text Available La aplicación del método de valoración contextual al análisis de los ajuares funerarios hasta ahora publicados de la necrópolis fenicia de Tiro-Al Bass, Líbano, permite aislar las fluctuaciones económicas y los cambios sociales experimentados por la población tiria durante el siglo VIII a. C. En concreto, se detecta una larga prosperidad desde mediados del siglo IX hasta mediados del VIII antes de nuestra era, con un máximo de bonanza a lo largo del periodo 775-750 a. C. En cambio, la segunda mitad del siglo VIII muestra una aguda crisis económica asociada a una elevada conflictividad social. Estos resultados coinciden plenamente con los acontecimientos históricos conocidos a través de las fuentes literarias antiguas, aportando evidencias que las complementan. En todo caso, con este nuevo ejemplo se confirma, una vez más, la universalidad de la metodología empleada y su irrefutable validez científica. ENGLISH: By applying the contextual valuation method to the analysis of grave goods from the Phoenician cemetery of Tyre-Al Bass, Lebanon, we can isolate the economic fluctuations and social changes experienced by the Tyrian population during the 8th century BC. Based on the evidence, the mid-9th to the mid-8th century BC was a period of prosperity, with the most pronounced economic boom between 775-750 BC. In contrast, the second half of the 8th century BC shows a sharp economic crisis associated with a high level of social conflict. These results are fully consistent with the historical events known through ancient literary sources. This new example confirms the universality of this methodology and its irrefutable scientific validity.
Three cryptic new species of Aristea (Iridaceae from southern Africa
Directory of Open Access Journals (Sweden)
P. Goldblatt
2005-08-01
Full Text Available Field work in southern Africa over the past several years has resulted in the discovery of three new species of the sub- Saharan African and Madagascan genus Aristea Aiton, which now comprises some 53 species. Aristea has a pronounced centre in southern Africa and a centre of diversity in the winter rainfall zone of the subcontinent, where all three new species occur, one extending eastward into the adjacent southern edge of the summer rainfall zone. All three novelties have been collected in the past but were confused with related species. A elliptica (subgenus Eucapsulares, confused in the past with A. pusilla (Thunb. Ker Gawl., has a more robust habit, usually with 4 or 5 flower clusters per flowering stem, pale blue flowers, smooth ellipsoid seeds with flattened surface cells, and pollen shed as monads, whereas A. pusilla usually has 1-3 flower clusters per flowering stem, dark blue flowers, pollen shed as tetrads, and globose seeds with faint foveate sculpturing and colliculate surface cells. A. nana (also subgenus Eucapsulares, known from few collections, and also confused with A. pusilla or A. anceps Eckl. ex Klatt. has the unbranched and leafless flowering stem of the latter but has large green floral spathes, flowers borne on long pedicels, and lacks a leaf subtending the single terminal flower cluster in contrast to nearly sessile flowers in A. pusilla and A. anceps, and in the latter, dry, rusty spathes. A. cistiflora (subgenus Pseudaristea closely resembles A. teretifoha Goldblatt & J.C.Manning but has linear to narrowly sword-shaped leaves and ± secund flowers with the outer tepals only slightly smaller than the inner and with small, dark brown markings at the bases of all the tepals. In contrast, A. teretifolia has narrower, sometimes terete leaves and flowers held upright with the outer tepals notice-ably smaller than the inner and bearing dark markings covering the lower half, whereas the inner tepals are unmarked.
Analysis of pulse-shape discrimination techniques for BC501A using GHz digital signal processing
International Nuclear Information System (INIS)
Rooney, B.D.; Dinwiddie, D.R.; Nelson, M.A.; Rawool-Sullivan, Mohini W.
2001-01-01
A comparison study of pulse-shape analysis techniques was conducted for a BC501A scintillator using digital signal processing (DSP). In this study, output signals from a preamplifier were input directly into a 1 GHz analog-to-digital converter. The digitized data obtained with this method was post-processed for both pulse-height and pulse-shape information. Several different analysis techniques were evaluated for neutron and gamma-ray pulse-shape discrimination. It was surprising that one of the simplest and fastest techniques resulted in some of the best pulse-shape discrimination results. This technique, referred to here as the Integral Ratio technique, was able to effectively process several thousand detector pulses per second. This paper presents the results and findings of this study for various pulse-shape analysis techniques with digitized detector signals.
Outlook for B.C. gas production and deliverability in relation to domestic and export markets
International Nuclear Information System (INIS)
Phelps, M.E.J.
1993-01-01
The business outlook for natural gas in British Columbia is discussed. Drilling activity in B.C. is increasing, and it is predicted that reserve additions over 1993-1998 will total 3.4 terra cubic feet. Deliverability in 1993 is 1.9 billion cubic feet/d, and this is expected to rise 30% by 1998. Westcoast is doubling raw gas capacity at the Pine River plant and is constructing new raw gas transmission lines. Growth is expected to continue at 6%/y for the next five years. In the deregulated environment, short term fluctuations in price are to be expected, however consumers are reluctant to tolerate price increases when levels of disposable income are static or decreasing. Regular, predictable and sustained increases in prices are preferable to sudden, significant oscillations, especially for residental customers
Effect of exogenous electron shuttles on growth and fermentative metabolism in Clostridium sp. BC1
Energy Technology Data Exchange (ETDEWEB)
Yarlagadda V. N.; Francis A.; Gupta, A.; Dodge, C. J.
2012-03-01
In this study, the influence exogenous electron shuttles on the growth and glucose fermentative metabolism of Clostridium sp. BC1 was investigated. Bicarbonate addition to mineral salts (MS) medium accelerated growth and glucose fermentation which shifted acidogenesis (acetic- and butyric-acids) towards solventogenesis (ethanol and butanol). Addition of ferrihydrite, anthraquinone disulfonate, and nicotinamide adenine dinucleotide in bicarbonate to growing culture showed no significant influence on fermentative metabolism. In contrast, methyl viologen (MV) enhanced ethanol- and butanol-production by 28- and 12-fold, respectively with concomitant decrease in hydrogen, acetic- and butyric-acids compared to MS medium. The results show that MV addition affects hydrogenase activity with a significant reduction in hydrogen production and a shift in the direction of electron flow towards enhanced production of ethanol and butanol.
DEFF Research Database (Denmark)
Adu, Bright; Jepsen, Micha Phill Grønholm; Gerds, Thomas A
2014-01-01
Immunoglobulin G (IgG) cross-linking with Fc gamma receptor IIIB (FcγRIIIB) triggers neutrophil degranulation, releasing reactive oxygen species with high levels associated with protection against malaria. The FCGR3B-c.233C>A polymorphism thought to influence the interaction between IgG and Fcγ...
TUMULI, ROADS AND PLOTS. DECODING THE MONUMENTAL FUNERARY SPACE OF THE 4TH-3RD CENTURIES BC KALLATIS
Directory of Open Access Journals (Sweden)
Maria Magdalena Ștefan
2017-03-01
Full Text Available The study focusses on the monumental elements of the 4th-3rd centuries BC cemeteries of Kallatis: the use of large tumuli, the implementation of a systematized network of funerary plots, the extent of the burial grounds, the discovery of a series of built chamber tombs under tumuli with elements of decorated architecture, including mural paintings and exceptional presence of a statue topping a tumulus. The detection and morphological characterisation of archaeological features and the recovering of the funerary landscapes’ spatial layout were based on historiographic study, remote-sensing and geophysical investigations.
Core public health functions for BC : evidence review : air quality-indoor
Energy Technology Data Exchange (ETDEWEB)
Copes, R.; Ouellette, V.; Lee, K.S.; Brauer, M. [British Columbia Ministry of Health, Victoria, BC (Canada)
2006-04-15
Indoor sources of pollutants can have a major impact on the health of Canadians, as pollutant concentrations are often higher indoors than outdoors. This paper assessed data compiled by public health indoor air interventions. The aim of the study was to identify the current state of evidence on the impacts of indoor pollution in order to develop performance improvement plans for public health programs in British Columbia (BC). The literature review used several databases to review interventions involving humidity control; ventilation; particulate matter; indoor allergens; and environmental tobacco smoke. Results of the review showed that improving inadequate ventilation can significantly decrease the prevalence of sick building syndrome as well as other self-reported symptoms attributed to indoor air pollution. A review of the literature also demonstrated that many building ventilation systems are not functioning to design specifications. The poor quality of studies on the health impacts of particulate matter or dust made it difficult to fully assess the benefits of particle filtration on human health. Studies investigating the impacts of controlling indoor allergens suggested that the avoidance of dust mites may benefit people with allergies. Evidence gained from studies on environmental tobacco smoke showed that banning or restricting smoking will reduce the burden of illness from pollutants in indoor air. 20 refs., 3 tabs.
Characterization of small mammal populations inhabiting the B-C cribs environs
International Nuclear Information System (INIS)
Hedlund, J.D.; Rogers, L.E.
1976-12-01
The purpose of this study was to document the current status of small mammal populations inhibiting the 200 Area plateau near the B-C Crib management area and to compare them with populations inhabiting a protected (control) area within the confines of the Hanford ALE Reserve. Sampling sessions were conducted over two field seasons (1974 and 1975). A total of five species was detected within intensive study areas. These included the Great Basin pocket mouse (Perognathus parvus), deer mouse (Peromyscus maniculatus), northern grasshopper mouse (Onychomys leucogaster), sagebrush vole (Lagurus curtatus), and western harvest mouse (Reithrodontomys megalotis). These species are probably representative of those found throughout the area at this particular elevation. Townsends ground squirrel (Spermophilus townsendii) also occurs in this area but did not occur on the sampling plots during the study duration. The pocket mouse was the only species present in sufficient numbers to permit a detailed analysis of population parameters. A discussion concerning the role small mammals play in mineral cycling and energy transfer processes is included along with a diagram depicting food web interrelationships for consumers inhabiting the 200 Area plateau region. Estimates of small mammal density and biomass provided in this document are needed for an overall understanding of the role biota play in the transfer of waste nuclides
Core public health functions for BC : evidence review : air quality-indoor
International Nuclear Information System (INIS)
Copes, R.; Ouellette, V.; Lee, K.S.; Brauer, M.
2006-04-01
Indoor sources of pollutants can have a major impact on the health of Canadians, as pollutant concentrations are often higher indoors than outdoors. This paper assessed data compiled by public health indoor air interventions. The aim of the study was to identify the current state of evidence on the impacts of indoor pollution in order to develop performance improvement plans for public health programs in British Columbia (BC). The literature review used several databases to review interventions involving humidity control; ventilation; particulate matter; indoor allergens; and environmental tobacco smoke. Results of the review showed that improving inadequate ventilation can significantly decrease the prevalence of sick building syndrome as well as other self-reported symptoms attributed to indoor air pollution. A review of the literature also demonstrated that many building ventilation systems are not functioning to design specifications. The poor quality of studies on the health impacts of particulate matter or dust made it difficult to fully assess the benefits of particle filtration on human health. Studies investigating the impacts of controlling indoor allergens suggested that the avoidance of dust mites may benefit people with allergies. Evidence gained from studies on environmental tobacco smoke showed that banning or restricting smoking will reduce the burden of illness from pollutants in indoor air. 20 refs., 3 tabs
New records of amphoroid diatoms (Bacillariophyceae from Cachoeira River, Northeast Brazil
Directory of Open Access Journals (Sweden)
KP Cavalcante
Full Text Available Amphoroid taxa have been revised in recent decades. Many species formerly assigned to Amphora have been transferred to other recently proposed genera, as Seminavis (Naviculaceae and Halamphora (Catenulaceae. In Brazil, there are few studies focused on amphoroid taxonomy. This study presents a taxonomic investigation of five uncommon amphoroid taxa from Brazilian diatom flora: Seminavis pusilla, S. strigosa, Amphora ectorii, Halamphora ghanensis and Halamphora sp. Seminavis strigosa is identical in valve morphology and morphometrical data to Amphora twenteana, and its synonymy is proposed. Seminavis pusilla, poorly found in Brazilian waters, has expanded its distribution. Halamphora ghanensis is a new record to American continent while Amphora ectorii are new to Brazilian aquatic systems. Halamphora sp. has distinct ultrastructural features in relation to similar species and is probably new for science.
Matizamhuka, Wallace R.; Sigalas, Iakovos; Herrmann, Mathias; Dubronvinsky, Leonid; Dubrovinskaia, Natalia; Miyajima, Nobuyoshi; Mera, Gabriela; Riedel, Ralf
2011-01-01
Bulk B-C-N materials were synthesized under static high thermobaric conditions (20 GPa and 2,000 °C) in a multianvil apparatus from a polymer derived t-BC1.97N ceramic. The bulk samples were characterised using X-ray synchrotron radiation and analytical transmission electron microscopy in combination with electron energy loss spectroscopy. Polycrystalline B-C-N materials with a cubic type structure were formed under the applied reaction conditions, but the formation of a ternary cubic diamond...
DEFF Research Database (Denmark)
Naderpour, Masoud; Lund, Ole Søgaard; Larsen, Richard
2010-01-01
-3 and bc-u, have been proposed to control resistance to the potyviruses Bean common mosaic virus (BCMV) and Bean common mosaic necrosis virus. In order to identify molecular entities for these genes, we cloned and sequenced P. vulgaris homologues of genes encoding the eIF proteins eIF4E, eIF(iso)4E...
Spatializing 6,000 years of global urbanization from 3700 BC to AD 2000
Reba, Meredith; Reitsma, Femke; Seto, Karen C.
2016-06-01
How were cities distributed globally in the past? How many people lived in these cities? How did cities influence their local and regional environments? In order to understand the current era of urbanization, we must understand long-term historical urbanization trends and patterns. However, to date there is no comprehensive record of spatially explicit, historic, city-level population data at the global scale. Here, we developed the first spatially explicit dataset of urban settlements from 3700 BC to AD 2000, by digitizing, transcribing, and geocoding historical, archaeological, and census-based urban population data previously published in tabular form by Chandler and Modelski. The dataset creation process also required data cleaning and harmonization procedures to make the data internally consistent. Additionally, we created a reliability ranking for each geocoded location to assess the geographic uncertainty of each data point. The dataset provides the first spatially explicit archive of the location and size of urban populations over the last 6,000 years and can contribute to an improved understanding of contemporary and historical urbanization trends.
Place Attachment in a Sustainable Neighbourhood: Comparison of Two Cases in Surrey, B.C
Directory of Open Access Journals (Sweden)
Karim W.F. Youssef
2015-10-01
Full Text Available Scholars have voiced the emphasis of studies in sustainability on environmental sustainability over social sustainability. One of the dimensions of social sustainability is neighbourhood cohesion among residents of a neighbourhood. This paper compares the social sustainability of two neighbourhoods in Vancouver metropolitan area particularly in the city of Surrey, B.C. with respect to the sense of neighbourhood cohesion among their residents. Buckner’s (1988 instrument for measuring neighbourhood cohesion index is used with the addition of a few questions to probe for a new conception of space that may link the degree of accessibility and permeability of a neighbourhood (or degree of gated-ness with the level of neighbourhood cohesion. Results of qualitative and quantitative analysis show that the neighbourhood having an enclosure model had a higher level of neighbourhood cohesion than the neighbourhood with an encounter model on both the affective and interactive dimensions of neighbourhood cohesion.
Panidi, Julianna; Paterson, Alexandra F.; Khim, Dongyoon; Fei, Zhuping; Han, Yang; Tsetseris, Leonidas; Vourlias, George; Patsalas, Panos A.; Heeney, Martin; Anthopoulos, Thomas D.
2017-01-01
Improving the charge carrier mobility of solution-processable organic semiconductors is critical for the development of advanced organic thin-film transistors and their application in the emerging sector of printed electronics. Here, a simple method is reported for enhancing the hole mobility in a wide range of organic semiconductors, including small-molecules, polymers, and small-molecule:polymer blends, with the latter systems exhibiting the highest mobility. The method is simple and relies on admixing of the molecular Lewis acid B(C6F5)(3) in the semiconductor formulation prior to solution deposition. Two prototypical semiconductors where B(C6F5)(3) is shown to have a remarkable impact are the blends of 2,8-difluoro-5,11-bis(triethylsilylethynyl)anthradithiophene:poly(triarylamine) (diF-TESADT:PTAA) and 2,7-dioctyl[1]-benzothieno[3,2-b][1]benzothiophene:poly(indacenodithiophene-co-benzothiadiazole) (C8-BTBT:C16-IDTBT), for which hole mobilities of 8 and 11 cm(2) V-1 s(-1), respectively, are obtained. Doping of the 6,13-bis(triisopropylsilylethynyl)pentacene:PTAA blend with B(C6F5)(3) is also shown to increase the maximum hole mobility to 3.7 cm(2) V-1 s(-1). Analysis of the single and multicomponent materials reveals that B(C6F5)(3) plays a dual role, first acting as an efficient p-dopant, and secondly as a microstructure modifier. Semiconductors that undergo simultaneous p-doping and dopant-induced long-range crystallization are found to consistently outperform transistors based on the pristine materials. Our work underscores Lewis acid doping as a generic strategy towards high performance printed organic microelectronics.
Panidi, Julianna; Paterson, Alexandra F; Khim, Dongyoon; Fei, Zhuping; Han, Yang; Tsetseris, Leonidas; Vourlias, George; Patsalas, Panos A; Heeney, Martin; Anthopoulos, Thomas D
2018-01-01
Improving the charge carrier mobility of solution-processable organic semiconductors is critical for the development of advanced organic thin-film transistors and their application in the emerging sector of printed electronics. Here, a simple method is reported for enhancing the hole mobility in a wide range of organic semiconductors, including small-molecules, polymers, and small-molecule:polymer blends, with the latter systems exhibiting the highest mobility. The method is simple and relies on admixing of the molecular Lewis acid B(C 6 F 5 ) 3 in the semiconductor formulation prior to solution deposition. Two prototypical semiconductors where B(C 6 F 5 ) 3 is shown to have a remarkable impact are the blends of 2,8-difluoro-5,11-bis(triethylsilylethynyl)anthradithiophene:poly(triarylamine) (diF-TESADT:PTAA) and 2,7-dioctyl[1]-benzothieno[3,2-b][1]benzothiophene:poly(indacenodithiophene-co-benzothiadiazole) (C8-BTBT:C16-IDTBT), for which hole mobilities of 8 and 11 cm 2 V -1 s -1 , respectively, are obtained. Doping of the 6,13-bis(triisopropylsilylethynyl)pentacene:PTAA blend with B(C 6 F 5 ) 3 is also shown to increase the maximum hole mobility to 3.7 cm 2 V -1 s -1 . Analysis of the single and multicomponent materials reveals that B(C 6 F 5 ) 3 plays a dual role, first acting as an efficient p-dopant, and secondly as a microstructure modifier. Semiconductors that undergo simultaneous p-doping and dopant-induced long-range crystallization are found to consistently outperform transistors based on the pristine materials. Our work underscores Lewis acid doping as a generic strategy towards high performance printed organic microelectronics.
Panidi, Julianna
2017-10-05
Improving the charge carrier mobility of solution-processable organic semiconductors is critical for the development of advanced organic thin-film transistors and their application in the emerging sector of printed electronics. Here, a simple method is reported for enhancing the hole mobility in a wide range of organic semiconductors, including small-molecules, polymers, and small-molecule:polymer blends, with the latter systems exhibiting the highest mobility. The method is simple and relies on admixing of the molecular Lewis acid B(C6F5)(3) in the semiconductor formulation prior to solution deposition. Two prototypical semiconductors where B(C6F5)(3) is shown to have a remarkable impact are the blends of 2,8-difluoro-5,11-bis(triethylsilylethynyl)anthradithiophene:poly(triarylamine) (diF-TESADT:PTAA) and 2,7-dioctyl[1]-benzothieno[3,2-b][1]benzothiophene:poly(indacenodithiophene-co-benzothiadiazole) (C8-BTBT:C16-IDTBT), for which hole mobilities of 8 and 11 cm(2) V-1 s(-1), respectively, are obtained. Doping of the 6,13-bis(triisopropylsilylethynyl)pentacene:PTAA blend with B(C6F5)(3) is also shown to increase the maximum hole mobility to 3.7 cm(2) V-1 s(-1). Analysis of the single and multicomponent materials reveals that B(C6F5)(3) plays a dual role, first acting as an efficient p-dopant, and secondly as a microstructure modifier. Semiconductors that undergo simultaneous p-doping and dopant-induced long-range crystallization are found to consistently outperform transistors based on the pristine materials. Our work underscores Lewis acid doping as a generic strategy towards high performance printed organic microelectronics.
CMS Collaboration
2018-01-01
Measurements of the differential production cross section times branching fraction of the $B_c^+ \\rightarrow J/\\psi \\pi^+$ and $B^+\\rightarrow J/\\psi K^+$ processes are presented as a function of the $B_c^+$($B^+$) transverse momentum $p_{T}$ and absolute rapidity $|y|$. The measurements are based on data collected by CMS in $2011$ in pp collisions at $\\sqrt{s}=7~\\mathrm{TeV}$, corresponding to an integrated luminosity of $4.77~\\mathrm{fb^{-1}}$. The integrated production cross sections times branching fraction in the kinematic region of $p_{T}(B_c^+,~B^+)>10~\\mathrm{GeV}/c$ and $|y|(B_c^+,~B^+)<1.5$ are measured to be $40.8\\pm4.7{\\rm~(stat.)}\\pm2.8{\\rm~(syst.)}~\\mathrm{pb}$ for $B_c^+ \\rightarrow J/\\psi \\pi^+$ and $5851.3\\pm37.1\\pm{\\rm~(stat.)}\\pm446.4{\\rm~(syst.)}~\\mathrm{pb}$ for $B^+\\rightarrow J/\\psi K^+$. The $B^+\\rightarrow J/\\psi K^+$ production is found to be described reasonably well by FONLL theoretical calculations, while the shape of $B_c^+ \\rightarrow J/\\psi \\pi^+$ production is described wel...
Neutron Signal and Noise Separation of the {sup 6}Li-ZnS(Ag) scintillator (BC702) Using Flash ADC
Energy Technology Data Exchange (ETDEWEB)
Shin, S. G.; Kye, Y. U. [POSTECH, Pohang (Korea, Republic of); Cho, M. H.; Namkung, W. [Pohang Accelerator Laboratory, Pohang (Korea, Republic of); Kim, G. N. [Kyungpook National Univ., Daegu (Korea, Republic of); Lee, M. W. [Dongnam Inst. of radiological and Medical Science, Daejeon (Korea, Republic of)
2013-10-15
This study will apply to nuclear data experiments and improve the quality of nuclear data measured at PNF. We also briefly discuss the future plan to apply our research to different kinds of neutron detectors. The parameters to separate the neutron signals and noises of the {sup 6}Li.ZnS(Ag) scintillator are determined through the upper processes. Three kinds of noise are determined by the parameters as shown in figure.5. The signals at the green (pedestal), red (gamma flash), and blue (gamma flash with big signal area) region are subtracted from the total amount of the counted signals. These algorithms will be applied to next neutron TOF experiments. Two additional neutron detectors will be introduced for neutron TOF experiment. These will measure the neutron flux to get the normalization factor. We will also conduct signal and noise separation of these neutron detectors. Neutron total cross-sections have been measured by using the time-of-flight (TOF) method at Pohang Neutron Facility (PNF). A {sup 6}Li.ZnS(Ag) scintillator BC702 from Bicron (Newbury, OH) with a diameter of 127 mm and a thickness of 6.35 mm mounted on an EMI-93090 photomultiplier was used as a detector for the neutron TOF spectrum measurement. This detector is sensitive to thermal and epithermal neutrons and insensitive to gamma radiation. However, it is required to more accurately separate neutron signal and noise. In the present work, we studied neutron signal and noise separation of the BC702 scintillator to measure the accurate neutron TOF data.
International Nuclear Information System (INIS)
Matscha, G.; Sutherland, D.
2005-06-01
This report summarized a baseline monitoring program for the Lynx Creek, Brenot Creek, and Portage Creek watersheds located near Hudson's Hope, British Columbia (BC). The monitoring program was designed to more accurately determine the effects of potential coalbed gas developments in the region, as well as to assess levels of agricultural and forest harvesting, and the impacts of current land use activities on water quantity and quality. Water quality was sampled at 18 sites during 5 different flow regimes, including summer and fall low flows; ice cover; spring run-off; and high flows after a heavy summer rain event. Sample sites were located up and downstream of both forest and agricultural activities. The water samples were analyzed for 70 contaminants including ions, nutrients, metals, hydrocarbons, and hydrocarbon fractions. Results showed that while many analyzed parameters met current BC water quality guidelines, total organic carbon, manganese, cadmium, E. coli, fecal coliforms, and fecal streptococci often exceeded recommended guidelines. Aluminum and cobalt values exceeded drinking water guidelines. The samples also had a slightly alkaline pH and showed high conductance. A multiple barrier approach was recommended to reduce potential risks of contamination from the watersheds. It was concluded that a more refined bacteria source tracking method is needed to determine whether fecal pollution has emanated from human, livestock or wildlife sources. 1 tab., 9 figs
Energy Technology Data Exchange (ETDEWEB)
Um, Wooyong; Truex, Michael J.; Valenta, Michelle M.; Iovin, Cristian; Kutnyakov, Igor V.; Chang, Hyun-shik; Clayton, Ray E.; Serne, R. Jeffrey; Ward, Anderson L.; Brown, Christopher F.; Geiszler, Keith N.; Clayton, Eric T.; Baum, Steven R.; Smith, David M.
2009-09-25
This technical report documents the results of laboratory geochemical and hydrologic measurements of sediments collected from new borehole 299-E13-65 (C7047) and comparison of the results with those of nearby borehole 299-13E-62 (C5923) both drilled in the BC Cribs and Trenches Area. The total and water-leachable concentrations of key contaminants will be used to update contaminant-distribution conceptual models and to provide more data for improving baseline risk predictions and remedial alternative selections. Improved understanding of subsurface conditions and methods to remediate these principal contaminants can be also used to evaluate the application of specific technologies to other contaminants across the Hanford Site.
Herve, Gwenael; Chauvin, Annick; Lanos, Philippe
2014-05-01
At the regional scale, the dispersion between archaeomagnetic data and especially archaeointensities suggests that some of them may be biased. As a consequence, it appears necessary to perform a selection of available data before to compute mean regional secular variation curves or geomagnetic models. However the definition of suitable selection criteria is not obvious and we need to know how to manage "old" data acquired during the 60-70s. The Western Europe directional and intensity data set from 1500 BC to 200 AD allows to discuss these issues. It has recently been enhanced by 39 new archaeodirections and 23 new archaeointensities (Hervé et al., 2013a and 2013b data sets and 5 unpublished data). First, the whole Western Europe data set was selected but the strong dispersion restricted the accuracy and the reliability of the new Western Europe secular variation curves at Paris. The causes of the dispersion appear different between archaeodirections and archaeointensities. In the directional data set, the main problem comes from some age errors in the oldest published data. Since their publication their archaeological dating may have changed of 50 years or more. For intensity data that were acquired much more recently, the dispersion mainly results from the use of unreliable archaeointensity protocols. We propose a weighting approach based on the number of specimens and the use of pTRM-checks, anisotropy and cooling rate corrections. Only 63% of available archaeodirections and 32% of archaeointensities were used to build the new Western Europe secular variation curves from 1500 BC to 200 AD. These curves reveal that selecting the reference data avoids wrong estimations of the shape of the secular variation curves, the secular variation rate, the dating of archaeomagnetic jerks... Finally, it is worth pointing out that current geomagnetic global models take into account almost all the data that we decided to reject. It could partly explain why their predictions at
African Journals Online (AJOL)
DR. NJ TONUKARI
2012-04-17
Apr 17, 2012 ... 2Plant Biotechnology Institute, National Research Council, Saskatoon, SK, S7N 0W9, Canada. .... pusilla. RNA extraction, first-strand cDNA synthesis and quantitative .... expression in the other four chosen tissues, root, stem,.
International Nuclear Information System (INIS)
Kearney, A.T.
1996-03-01
The information provided in this validation summary report includes chemical analyses of samples from 100-BC-5 Operable Unit Round 9 Groundwater sampling data. Data from this sampling event and their related quality assurance (QA) samples were reviewed and validated in accordance with Westinghouse Hanford Company (WHC) guidelines at the requested level. Sample analyses included metals, general chemistry, and radiochemistry. Sixty metals samples were analyzed by Quanterra Environmental Services (QES) and Lockheed Analytical Services (LAS). The metals samples were validated using WHC protocols specified in Data Validation Procedures for Chemical Analyses. All qualifiers assigned to the metals data were based on this guidance. The Table 1.1 lists the metals sample delivery group (SDG) that were validated for this sampling event