WorldWideScience

Sample records for extract afsc 1c4x1

  1. Occupational Analysis Products: Operations Management- AFSC 3E6X1 (CD-ROM)

    Science.gov (United States)

    computer laser optical disc (CD-ROM); 4 3/4 in.; 23.4 MB. SYSTEMS DETAIL NOTE: ABSTRACT: This is a report of an occupational survey of the Operations ... Management (AFSC 3E6X1, OSSN 2560, Feb 04) career ladder, conducted by the Occupational Analysis Flight, AFOMS. The OSR reports the findings of current

  2. Heating, Ventilation, Air Conditioning, and Refrigeration (HVAC/R), AFSC 3E1X1. OSSN 2368

    National Research Council Canada - National Science Library

    1999-01-01

    Survey Coverage: The Heating, Ventilation, Air Conditioning, and Refrigeration (HVAC/R) career ladder, AFSC 3E1X1, was surveyed to gather data needed to guide the development and evaluation of training...

  3. Aircraft Fuel Systems, AFSC 2A6X4, OSSN 2317

    National Research Council Canada - National Science Library

    1998-01-01

    The Air Force Specialty Code (AFSC) 2A6X4, Aircraft Fuel Systems, career ladder was surveyed to obtain occupational data for use in evaluating and revising current career ladder documents and training programs...

  4. Synthesis IR spectra and crystal structure of N-(4-bromophenyl)-1,1,1-trifluoroacetyl-acetonimine HN(C6H4Br)xC(Me)xCHxC(CF3)xO(HL) and its molecular complex with tungstene(4) oxotetrachloride WOCl4xHL

    International Nuclear Information System (INIS)

    Sergienko, V.S.; Ilyukhin, A.B.; Abramenko, V.L.

    1997-01-01

    Synthesis, IR spectroscopic and X-ray diffraction studies of compound HN(C 6 H 4 Br)xC(Me)xCHxC(CF 3 )xO(HL) (1) and of molecular complex WOCl 4 xHL(2) have been conducted. In 1 and 2 HL molecule exists in ketoamine tautomeric form (acid proton is localized at nitrogen atom). The results of 1 and 2 study are compared with literature data on structures of HL type molecules and Mo(6) molecular complexes with β-enaminevinylketone, as well as with the structure of chelate compound WOCl 3 L 1 , where L 1 - anion of N-phenylacetylacetonimine

  5. Training Extract. AFSC 4D0X1 Diet Therapy (Active Duty)

    Science.gov (United States)

    2002-07-01

    17 22 43 19 24 25 4.28 D0115 Clean broilers 23 10 12 27 9...5.89 L0334 Perform patient carries using hand or litter method 6 2 14 4 7 22 10 5.35 L0335 Prepare...0089 6.4. Use cleaning agents +3c - - D0115 Clean broilers

  6. Training Extract AFSC 791X0 Public Affairs.

    Science.gov (United States)

    1985-09-01

    8217 C I 6 8o9 a Is- LI I I ffm cc I C.~ 11 N * 0- Q * .j I .0 L’ ) t.. Cn IC. C~ OU~ *IC - ~ ONcc N.U- 1 0r N a- I A u z a I . A .. I: n] -j 1.’ I I a... Acca r : 𔃺 0 j4 &. a a 40’ 8. x . 09 a n u a i m W Z 15LW4 4 Sn. z 41 0 C. IS L" W. Sn) WL Sn J 0 V. w i Sn - &A ’~S CC 0 Ct 0: Sn w L. -4 04 0 S 4.0- 0

  7. Human amniotic fluid stem cells (hAFSCs expressing p21 and cyclin D1 genes retain excellent viability after freezing with (dimethyl sulfoxide DMSO

    Directory of Open Access Journals (Sweden)

    Shiva Gholizadeh-Ghaleh Aziz

    2018-04-01

    Full Text Available Human amniotic fluid stem cells (hAFSCs have features intermediate between embryonic and adult SCs, can differentiate into lineages of all three germ layers, and do not develop into tumors in vivo. Moreover, hAFSCs can be easily obtained in routine procedures and there is no ethical or legal limitations regarding their use for clinical and experimental applications. The aim of this study was to assess the effect of slow freezing/thawing and two different concentrations of DMSO (10% DMSO + 90% fetal bovine serum [FBS] and 5% DMSO + 95% FBS on the survival of hAFSCs. hAFSCs were obtained from 5 pregnant women during amniocentesis at 16–22 weeks of gestation. The expression of pluripotency markers (Octamer-binding transcription factor 4 [Oct4] and NANOG by reverse transcription polymerase chain reaction and cell surface markers (cluster of differentiation [CD31], CD44, CD45, and CD90 by flow cytometry was analyzed before and after the slow-freezing. Cell viability was assessed by trypan blue exclusion or MTT assay. Quantitative mRNA expression of Oct4, NANOG, cyclin D1 and p21 was determined by real-time PCR before and after the slow-freezing. Pluripotency of hAFSCs was confirmed by NANOG and POU5F1 (Oct4 gene expression before and after slow-freezing. All hAFSC cultures were positive for CD44 and CD90. A higher viability of hAFSCs was observed after freezing with 90% FBS + 10% DMSO. There was increased expression of NANOG and decreased expression of POU5F1 gene after freezing, compared to control cells (before freezing. DMSO and the process of freezing did not significantly change the expression of p21 and cyclin D1 genes in hAFSCs. Overall, our results indicate the applicability of slow-freezing and DMSO in cryopreservation of SCs.

  8. Services Specialist Career Ladder AFSC 611X0.

    Science.gov (United States)

    1986-06-01

    REQUEST) 52 INSPECT PERSONNEL FOR COMPLIANCE WITH MILITARY STANDARDS 52 INTERPRET POLICIES OR DIRECTIVES FOR SUBORDINATES 52 MAKE ENTRIES ON AF FORMS 1297...67 DETERMINE SUPPLIES REQUIREMENTS 61 INTERPRET POLICIES OR DIRECTIVES FOR SUBORDINATES 61 SUPERVISE MILITARY PERSONNEL IN AFSCs OTHER THAN 611XO 61...m I w c a- ’- a -- I co 0tz ( I co aI o C)-0 a c Ia)aP"o%. B3 C> LO LO qr cnCD C") C"j LA) (1) t.0C) 0 co CD Lo~ -I c)U- LA CY r) zr U’)L r~- r 𔃺 LO

  9. Atmospheric chemistry of n-CxF2x+1CHO (x = 1, 2, 3, 4)

    DEFF Research Database (Denmark)

    Hurley, M. D.; Ball, J. C.; Wallington, T. J.

    2006-01-01

    Smog chamber/FTIR techniques were used to study the atmospheric fate of n-C(x)F(2)(x)(+1)C(O) (x = 1, 2, 3, 4) radicals in 700 Torr O(2)/N(2) diluent at 298 +/- 3 K. A competition is observed between reaction with O(2) to form n-C(x)()F(2)(x)()(+1)C(O)O(2) radicals and decomposition to form n-C(x...... to the atmospheric chemistry of n-C(x)F(2)(x)(+1)C(O) radicals and their possible role in contributing to the formation of perfluorocarboxylic acids in the environment....

  10. Study on lithium extraction from brines based on LiMn2O4/Li1-xMn2O4 by electrochemical method

    International Nuclear Information System (INIS)

    Zhao, Meng-Yao; Ji, Zhi-Yong; Zhang, Yong-Guang; Guo, Zhi-Yuan; Zhao, Ying-Ying; Liu, Jie; Yuan, Jun-Sheng

    2017-01-01

    Highlights: •A recovery system with LiMn 2 O 4 /Li 1-x Mn 2 O 4 as electrodes was used to extract lithium. •The influence sequence of coexisting ions on lithium extraction was Mg 2+ > Na + > Ca 2+ > K + . •The values of α Li-Na , α Li-Mg and α Li-Ca were more than 300, 70 and 110, respectively. •The specific energy consumption was between 18 and 19 W h·mol −1 . -- Abstract: Lithium rechargeable batteries have been used for lithium extraction in recent years. Here, we report on a highly selective lithium recovery system that consists of a LiMn 2 O 4 positive electrode, a Li 1-x Mn 2 O 4 negative electrode and a monovalent selective anion-exchange membrane. The effect of potential, temperature and coexisting ions on lithium extraction were investigated in this paper, and the lithium recovery system was applied to extract lithium from brine and concentrated seawater. The extraction capacity of Li + reached 34.31 mg· (1 g LiMn 2 O 4 ) −1 at 1.2 V. With higher reaction rate and lower energy consumption, 25 °C (room temperature) was considered as the appropriate temperature. The system still remained high selective for Li + even in the presence of impurity ions (K + , Na + , Mg 2+ , Ca 2+ ). With simulated brine and concentrated seawater as source solutions, the concentrations of Na + , Mg 2+ and Ca 2+ were reduced more than 300, 70 and 100 times, consuming 18–19 W h per mole of lithium recovered. And the electrodes still had high separation coefficients of Li + and Me n+ (Na + , Mg 2+ , Ca 2+ ) after five cycles although a slight drop was existing.

  11. Munitions Operations AFSC 465X0

    Science.gov (United States)

    1991-03-01

    DPAL 3 3HQ AFSC/TTA 1 1HQ ATC/DPAE 3 3HQ ATC/TTOA -2 1HQ MAC/DPAT 3 3HQ MAC/TTA 1 1HQ PACAF/DPAT 3 3HQ PACAF/TTA 1 1HQ SAC/DPAT 3 3HQ SAC/TTA 1 IHQ TAC...DPATJ 3 3HQ TAC/TTA 1 1HQ USAF/LGMW 3 3 HQ USAF/DPPE IHQ USAFE/DPAT 3 3HQ USAFE/TTA 1 1NODAC I11 AF/TTA 1 13400 TCHTW/TTGX (LOWRY AFB CO) 5 3 5 53400...32 Training Emphasis (TE) and Task Difficulty ( TD ) Data ...... 32 Specialty Training Standard (STS) .... ............... .... 37

  12. Bismuth on copper (110): analysis of the c(2x2) and p(4x1) structures by surface x-ray diffraction

    DEFF Research Database (Denmark)

    Lottermoser, L.; Buslaps, T.; Johnson, R.L.

    1997-01-01

    Surface X-ray diffraction has been used to analyze the atomic structures of the Cu(110)-c(2 x 2)-Bi and Cu(110)-p(4 x 1)-Bi reconstructions with submonolayer coverages. A quasi-hexagonal c(2 x 2) adlayer structure is formed when half a monolayer of bismuth is deposited; the coverage corresponds...... to 1.08 x 10(-15) atoms cm(-2). There is one Bi atom per c(2 x 2) surface unit cell, and the nearest-neighbor distance on the planar overlayer was found to be 4.43 Angstrom. In the case of the p(4 x 1) reconstruction formed at a coverage of 0.75 monolayers, both the in-plane and out-of-plane data...

  13. An electrochemical study of the systems Li1+-xV2O4 and Li1-xVO2 (0≤x≤1)

    International Nuclear Information System (INIS)

    De Picciotto, L.A.; Thackeray, M.M.; Pistoia, G.

    1988-01-01

    Electrochemical properties of the systems Li 1±x V 2 O 4 (0≤x≤1), Li 1-x VO 2 (0≤x 2 O 4 is reversible, which confirms that lithium may be cycled, topotactically, in and out of the Li 1+x V 2 O 4 spinel structure. Delithiation of the LiV 2 O 4 spinel is irreversible; during this process the vanadium ions migrate through the oxide layers. This results in a defect rocksalt phase, which can, in turn, be relithiated by a different mechanism. Lithium extraction for the layered compound LiVO 2 yields a structure similar to the delithiated LiV 2 O 4 product. The spinel-derived compounds Li 1 +-x/V 2 O 4 (0 -3 Ω -1 cm -1 at x=0 and 10 -6 Ω -1 cm -1 at x=1. Lithium diffusion rates in Li 1±x V 2 O 4 samples increase with lithiation from D=4x10 -10 cm 2 /s in LiV 2 O 4 to D=6x10 -8 cm 2 /s in Li 2 V 2 O 4 . Intermediate values of D are obtained in the delithiated compound Li 0.28 V 2 O 4 and in the layered oxide LiVO 2 ; significantly lower values of D, viz. 1x10 -11 cm 2 /s and 4x10 -11 cm 2 /s , are found in the spinels LiMn 2 O 4 and Fe 3 O 4 respectively. 28 refs.; 5 figs.; 1 table

  14. Preparing high performance of LiFe{sub (1x)}M{sub x}PO{sub 4} by using Fe{sub (1x)}M{sub x}C{sub 2}O{sub 4} as raw material precipitated from ferrochrome alloy leaching solution

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Guo-rong, E-mail: hgrhsj@263.net; Liu, Ji-jun; Du, Ke; Peng, Zhong-dong; Cao, Yan-bing; Wang, Wei-gang; Duan, Jian-guo

    2014-08-01

    To separate ferrum from chromium in the leaching sulfate solution of ferrochrome alloy, the oxalic acid was employed to precipitate the ferrum as the form of FeC{sub 2}O{sub 4} and Cr was left in the solution. In this route, small amount of nickel, cobalt and manganese exited in ferrochrome alloy were also precipitated simultaneously together with ferrous oxalate. Analysis from ICP shows that the molar percent of Fe in oxalic precipitate is 97.9% and the main doped elements are Ni (1.1%) and Mn (0.4%).The mixed metal oxalate Fe{sub (1x)}M{sub x}C{sub 2}O{sub 4} was used as a raw material to prepare doped LiFePO{sub 4} cathode material of lithium ion batteries. The obtained LiFe{sub (1x)}M{sub x}PO{sub 4}/C was a single olivine-type phase with higher crystallinity and presents the well-distributed fine particles. It shows an outstanding electrochemical performance with a discharge capacity of 162 mAh/g at the rate of 0.1 C, 136 mAh/g at 1 C and 103 mAh/g at 5 C. When cycled at 1 C for 50 times, the capacity retention is 98.2%.

  15. Occupational Analysis Products: Space Systems Operations - AFSC 1C6X1 (CD-ROM)

    National Research Council Canada - National Science Library

    Boerstler, Robert E

    2004-01-01

    ...: 1 CD-ROM; 4 3/4 in.; 30.4 MB. SYSTEMS DETAIL NOTE: ABSTRACT: The Space Systems Operations career ladder was surveyed to obtain current task and equipment data for use in evaluating current training programs...

  16. Analysis Extract. AFSC 4D0X1 Diet Therapy (Active Duty)

    Science.gov (United States)

    2002-07-01

    D0114 Assemble food service equipment 43 19 24 0 22 9 D0115 Clean broilers ...Perform patient carries using hand or litter method 4 7 22 0 8 5 L0335 Prepare equipment for deployments...Equipment use/operate - Broilers Active Active Active Active AD AD

  17. Cross sections of neutron production with energies of 7,5-190 MeV in the p+A → n+X reaction at 1-9 GeV/c, π++A → n+X reaction at 1-6 GeV/c, π-+A → n+X reaction at 1,4 and 5 GeV/c

    International Nuclear Information System (INIS)

    Bayukov, Yu.D.; Gavrilov, V.B.; Goryainov, N.A.

    1983-01-01

    The tables of cross sections of neutron production with energies 7.5-190 MeV for reactions p+A→n+X at 1-9 GeV/c, π + +A→n+X at 1-6 GeV/c and π - +A→n+X at 1.4 and 5 GeV/c are presented. A-dependence (for Be, C, Al, Ti, Fe, Cu, Nb, Cd, Sn, Ta, Pb and U targets) for incident 7.5 GeV/c protons and dependence on incident particle momentum (for protons at 1, 1.4, 2, 3, 5, 6, 6.25, 6.5, 7, 7.5, 8.25, 8.5 and 9 GeV/c, for π + -mesons at 1, 1.4, 2, 3, 4, 5 and 6 GeV/c, π - -mesons at 1,4 and 5 GeV/c) for C, Cu, Pb, U targets are measured in detail, for secondary neutrons at 119 deg. Detailed angular dependences in the range from 10 deg to 160 deg are presented for C, Cu, Pb, U targets for incident 7.5 GeV/c protons and 5 GeV/c π - -mesons. Some of typical dependences are illustrated by diagrams

  18. U_xTh_1_-_x(C_2O_4)_2 solide characterisation studies

    International Nuclear Information System (INIS)

    Carrigan, C.; Taylor, R.; Sarsfield, M.

    2016-01-01

    Many advanced reprocessing schemes under development are aimed at co-processing and co-conversion of actinides, unlike current reprocessing plants that produce separate uranium and plutonium products. The most well developed option for the co-conversion stage is probably oxalate co-precipitation, followed by the thermal co-conversion to a mixed oxide product. It is thus envisaged that future processes will avoid separation of plutonium from uranium and instead allow part of the uranium to flow with the plutonium, resulting in co-precipitation as the oxalate, and finally co-conversion to a mixed uranium-plutonium oxide (MOX), which can be fabricated into recycled nuclear fuel for further energy generation. The co-crystallisation of uranium (IV) and plutonium (III) into a single oxalate structure ensures the homogenous distribution of the 2 actinides at the molecular scale. The joint conversion of uranium and plutonium to the oxide form makes it possible to remove the complicated step of blending and grinding the 2 distinct oxide powders, as currently employed for the purposes of MOX fuel fabrication. This concept can also be extended to other actinides, including minor actinides from partitioning processes such as SANEX (Selective Actinide Extraction) and GANEX (Grouped Actinide Extraction) processes or even a thorium containing product from recycle of thorium based fuels. A selection of U_xTh_1_-_x(C_2O_4)_2 solids at varying concentrations of uranium and thorium were prepared by oxalate co-precipitation. Uranium (VI) was conditioned electrochemically at -0.7 V to uranium (IV), in the presence of hydrazine. The reduced uranium (IV) in nitric acid was mixed with thorium nitrate solutions at different concentration ratios with oxalic acid. The mixed tetravalent uranium-thorium oxalate solid products have been characterised by Raman and IR spectroscopies. The influence of thorium substituted into the uranium oxalate structure was evaluated. Several vibrational modes

  19. NMR studies of echinomycin bisintercalation complexes with d(A1-C2-G3-T4) and d(T1-C2-G3-A4) duplexes in aqueous solution: sequence-dependent formation of Hoogsteen A1 x T4 and Watson-Crick T1 x A4 base pairs flanking the bisintercalation site

    International Nuclear Information System (INIS)

    Gao, X.; Patel, D.J.

    1988-01-01

    The authors report on two-dimensional proton NMR studies of echinomycin complexes with the self-complementary d(A1-C2-G3-Tr) and d(T1-C2-G3-A4) duplexes in aqueous solution. The exchangeable and nonexchangeable antibiotic and nucleic acid protons in the 1 echinomycin per tetranucleotide duplex complexes have been assigned from analyses of scalar coupling and distance connectivities in two-dimensional data sets records in H 2 O and D 2 O solution. An analysis of the intermolecular NOE patterns for both complexes combined with large upfield imino proton and large downfield phosphorus complexation chemical shift changes demonstrates that the two quinoxaline chromophores of echinomycin bisintercalate into the minor groove surrounding the dC-dG step of each tetranucleotide duplex. Further, the quinoxaline rings selectively stack between A1 and C2 bases in the d(ACGT) complex and between T1 and C2 bases in the d(TCGA) complex. The intermolecular NOE patterns and the base and sugar proton chemical shifts for residues C2 and G3 are virtually identical for the d(ACGT) and d(TCGA) complexes. A large set of intermolecular contacts established from nuclear Overhauser effects (NOEs) between antibiotic and nucleic acid protons in the echinomycin-tetranucleotide complexes in solution are consistent with corresponding contacts reported for echinomycin-oligonucleotide complexes in the crystalline state. The authors demonstrate that the G x G base pairs adopt Watson-Crick pairing in both d(ACGT) and d(TCGA) complexes in solution. By contrast, the A1 x T4 base pairs adopt Hoogsteen pairing for the echinomycin-d(A1-C2-G3-Tr) complex while the T1 x A4 base pairs adopt Watson-Crick pairing for the echinomycin-d(T1-C2-G3-A4) complex in aqueous solution. These results emphasize the role of sequence in discriminating between Watson-Crick and Hoogsteen pairs at base pairs flanking the echinomycin bisintercalation site in solution

  20. Occupational Survey Report. AFSC 4M0X1 Aerospace Physiology

    Science.gov (United States)

    2002-05-01

    Chamber NCOIC Job Hyperbaric Chamber Specialist Job • Perform Type 2, 4 and 1 chamber flights • Perform inside observer duties during hypobaric ...78% Hyperbaric Chamber Specialist Independent Job 4% Not Grouped 2% U2 Aerospace Physiology Cluster 10% Job Structure Sample size: 168 Aerospace...Altitude Chamber Cluster (N=130) Hypobaric Chamber Instructor/Monitor Job HAAMS Job Altitude Chamber Apprentice Job 78% UPT Parasail Job Altitude

  1. Atmospheric chemistry of perfluorinated aldehyde hydrates (n-C(x)F(2x+1)CH(OH)2, x = 1, 3, 4)

    DEFF Research Database (Denmark)

    Andersen, Mads Peter Sulbæk; Toft, A.; Nielsen, O.J.

    2006-01-01

    . Bubbling CF(3)CHO/air mixtures through liquid water led to >80% conversion of CF(3)CHO into the hydrate within the approximately 2 s taken for passage through the bubbler. These results suggest that OH radical initiated oxidation of C(x)F(2x+1)CH(OH)(2) hydrates could be a significant source...

  2. Thermodynamic study of binary mixture of x1[C6mim][BF4] + x21-propanol: Measurements and molecular modeling

    International Nuclear Information System (INIS)

    Kermanpour, F.; Sharifi, T.

    2012-01-01

    Highlights: ► Densities and viscosities for binary mixture of {x 1 [C 6 mim][BF 4 ] + x 2 1-propanol} were measured at different temperatures. ► The excess molar functions were calculated from the obtained experimental data. ► These data were correlated with the Redlich–Kister equation and PFP model to obtain the coefficients and standard deviations. - Abstract: Densities, ρ, and viscosities, η, of pure 1-hexyl-3-methylimidazoliumtetrafluoro borate ([C 6 mim][BF 4 ]) and 1-propanol, and their binary mixture {x 1 [C 6 mim][BF 4 ] + x 2 1-propanol} were measured at atmospheric pressure and in the temperature range of 293.15–333.15 K. The excess molar volumes, V m E , thermal expansion coefficients, α, and their excess values, α E , isothermal coefficient of excess molar enthalpy, (∂H m E /∂p) T,x and excess viscosities, η E , were calculated from the experimental values of densities and viscosities. The excess molar volumes of the binary mixture are negative over the entire mole fraction range and increase with increasing temperature. Excess viscosities are negative over the entire mole fraction range of the mixture and decrease with increasing temperature. The obtained excess molar volumes and excess viscosities were correlated with the Redlich–Kister equation. The experimental results have also been used to examine the applicability of Prigogine–Flory–Patterson (PFP) theory in predicting the excess molar volume of the binary mixture. It is indicated that agreement between excess molar volumes calculated via PFP theory and the experimental results is good in all temperatures.

  3. Structure determination of two structural analogs, named 3-[1-(2-fluoro-4-biphenyl)ethyl]-6-(4-fluorophenyl)-1,2,4-triazolo[3,4-b]-1,3,4-thiadiazole (C23H16F2N4S) and 3-[1-(2-fluoro-4-biphenyl)ethyl]-6-(4-chlorophenyl)-1,2,4-triazolo[3,4-b]-1,3,4-thiadiazole (C23H16ClFN4S) by synchrotron X-ray powder diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Gündoğdu, Gülsüm; Aytaç, Sevim Peri; Müller, Melanie; Tozkoparan, Birsen; Kaynak, Filiz Betül

    2017-12-01

    Two novel compounds, 3-[1-(2-fluoro-4-biphenyl)ethyl]-6-(4-fluorophenyl)-1,2,4-triazolo[3,4-b]-1,3,4-thiadiazole (C23H16F2N4S) (1) and 3-[1-(2-fluoro-4-biphenyl)ethyl]-6-(4-chlorophenyl)-1,2,4-triazolo[3,4-b]-1,3,4-thiadiazole (C23H16ClFN4S) (2), have been designed and synthesized as cytotoxic agents. The compounds were characterized by infrared, proton nuclear magnetic resonance, mass spectral data, elemental analysis and X-ray powder diffraction. The present study comprises spectral data and crystal structures of these novel compounds determined from synchrotron X-ray powder diffraction data. The structure solutions were obtained by simulated annealing. The final structures were achieved by Rietveld refinement using soft restraints for all bond lengths, bond angles, and planar groups. Both compounds crystallize in space group1' mime-subtype='gif' type='simple'/>$P\\bar 1$,Z= 2, with the unit-cell parametersa= 6.37433(9),b= 11.3641(2),c= 14.09115(19) Å,α= 80.1740(8)°,β= 85.1164(8)°,γ= 80.9831(10)°,V= 991.55(3) Å3of compound (1) anda= 6.53736(6),b= 11.55725(15),c= 14.01373(13) Å,α= 80.3323(7)°,β= 84.8939(6)°,γ= 79.3954(8)°,V= 1024.08(2) Å3of compound (2). Structural analyses reveal that the title compounds are isostructural.

  4. Synthesis of LiNixFe1xPO4 solid solution as cathode materials for lithium ion batteries

    International Nuclear Information System (INIS)

    Qing, Rui; Yang, Ming-Che; Meng, Ying Shirley; Sigmund, Wolfgang

    2013-01-01

    Highlights: • Phase pure LiNi x Fe 1x PO 4 and LiNi x Fe 1x PO 4 /C nanocomposites were obtained via a solid state reaction method. • Crystallite sizes were around 50 nm. Linear relationship was observed between lattice parameters and chemical composition. • Synthesized materials displayed electronic conductivity similar to reported value of LiFePO 4 . Carbon coating increased the conductivity to ∼10 −3 S/cm. • Chemical delithiation via NO 2 BF 4 extracted more than 90% of lithium from the nanocomposites, proving that Ni 2+ /Ni 3+ redox couple was activated. -- Abstract: Nanosize LiNi x Fe 1x PO 4 solid solution and LiNi x Fe 1x PO 4 /C nanocomposites were prepared via a solid state reaction method under argon atmosphere. A single phase olivine-type structure with Pnma space group was determined by X-ray diffraction. Crystallite sizes were found to be around 50 nm. A linear relationship was observed between lattice parameters and chemical composition which follows Vegard's law. Synthesized materials displayed electronic conductivity similar to previous reported values of LiFePO 4 . Carbon coating further increased the overall conductivity of nanocomposites to the order of 10 −3 S/cm. Chemical delithiation via NO 2 BF 4 oxidant extracted more than 95% of lithium from the solid solution material accompanied by a decrease in lattice parameters

  5. Extraction of UO22+ by two highly sterically hindered (X1) (X2) PO(OH) extractants from an aqueous chloride phase

    International Nuclear Information System (INIS)

    Mason, G.W.; Lewey, S.M.; Gilles, D.M.; Peppard, D.F.

    1978-01-01

    The comparative extraction behaviour of tracer-level UO 2 2+ into benzene solutions of two highly sterically hindered extractants, di(2,6-di-iso-propylphenyl) phosphoric acid, HD(2,6-i-PPHI)P and di-tertiary-butyl phosphinic acid, H[Dt-BP], vs an aqueous 1.0 F (NaCl + HCl) phase was studied. The extraction of UO 2 2+ in both systems is directly second-power dependent upon extractant concentration and inversely second-power dependent upon hydrogen ion concentration, the stoichiometry of extraction being UOsub(2A) 2+ + 2(HY)sub(2O) = UO 2 (HY 2 )sub(2O) + 2Hsub(A) + . The expression for the distribution ratio, K is K = Ksub(s)F 2 /[H + ] 2 the general expression for the extraction of any metallic species being K - Ksub(s)Fsup(a)/[H + ]sup(b) where Ksub(s) is a constant characteristic of the system, F the concentration in formality units of extractant in the organic phase, [H + ] the concentration of hydrogen ion in the aqueous phase, and a and b the respective extractant and hydrogen-ion dependencies. Both extractants have a high degree of steric hindrance. The HD(2,6-i-PPHI)P is the more highly acidic, the pKsub(A) value, in 75% ethanol, being 3.2. The pKsub(A), previously reported, for H[Dt-BP] is 6.26. The Ksub(s) for UO 2 2+ in the system HY in benzene diluent vs an aqueous 1.0 F (NaCl + HCl) phase is 2 x 10 4 for H[Dt-BP] and 3 x 10 -1 for HD(2,6-i-PPHI)P; the ratio of the Ksub(s) values nearly 7 x 10 3 , favours the less acidic extractant. For comparative purposes, the Ksub(s) values for UO 2 2+ and for Am 3+ and Eu 3+ in other (X 1 )(X 2 )PO(OH), in benzene diluent, vs 1.0 F (NaCl + HCl) systems are presented. The variations are discussed in terms of the pKsub(A) of the extractant and the steric hindrance within the extractant. (author)

  6. Synergetic Fe substitution and carbon connection in LiMn1xFexPO4/C cathode materials for enhanced electrochemical performances

    International Nuclear Information System (INIS)

    Yan, Su-Yuan; Wang, Cheng-Yang; Gu, Rong-Min; Sun, Shuai; Li, Ming-Wei

    2015-01-01

    Highlights: • LiMn 0.6 Fe 0.4 PO 4 /C cathode material shows enhanced rate capability. • The Fe doped in the partial Mn sites could significantly facilitate the Li ions transfer. • The enhanced Li + ions diffusion contributes to the optimized rate capability of LiMn 0.6 Fe 0.4 PO 4 . • ACM carbonization forms well carbon coating and a 3D carbon network structure. - Abstract: To enhance the rate and cyclic performances of LiMnPO 4 cathode material for lithium-ion batteries, Mn is partially substituted with Fe, and LiMn 1x Fe x PO 4 (x = 0.2, 0.3, 0.4, 0.5) solid solutions are synthesized and investigated. Amphiphilic carbonaceous material (ACM) forms well carbon coating and connects the LiMn 1x Fe x PO 4 crystallites by a three-dimensional (3D) carbon network. The synergetic Fe substitution and carbon connection obviously improve the samples’ rate capacities and cyclic stability. The optimized LiMn 0.6 Fe 0.4 PO 4 /C sample delivers discharge capacities of 160 mA h g −1 at 0.05 C, 148 mA h g −1 at 1 C, and 115 mA h g −1 at 20 C. All samples have well capacity retention (>92%) after 50 charge/discharge cycles at 1 C. The enhanced electrochemical properties are mainly attributed to the improvement of Li ion and electron transport in the LiMn 1x Fe x PO 4 /C samples, respectively mainly resulting from their modified crystal structures caused by Fe substitution and the 3D carbon coating/connection originating from ACM carbonization. LiMn 1x Fe x PO 4 materials exhibit two discharge plateaus at ∼4.0 and ∼3.5 V (vs. Li + /Li), whose heights respectively reflect the redox potentials of Mn 3+ /Mn 2+ and Fe 3+ /Fe 2+ couples. The plateaus’ lengths correspond to the Mn/Fe ratio in LiMn 1x Fe x PO 4 and are affected by the kinetic behavior of samples. Though the ∼4.0 V plateau shrinks with increasing discharge rate, the ∼3.5 V plateau may slightly elongate. Moreover, the Fe substituted in the partial Mn sites could significantly improve

  7. Synergetic Fe substitution and carbon connection in LiMn{sub 1x}Fe{sub x}PO{sub 4}/C cathode materials for enhanced electrochemical performances

    Energy Technology Data Exchange (ETDEWEB)

    Yan, Su-Yuan; Wang, Cheng-Yang [Key Laboratory for Green Chemical Technology of Ministry of Education, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineer (Tianjin), Tianjin University, Tianjin 300072 (China); Gu, Rong-Min [Department of Chemistry, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineer (Tianjin), Tianjin University, Tianjin 300072 (China); Sun, Shuai [Key Laboratory for Green Chemical Technology of Ministry of Education, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineer (Tianjin), Tianjin University, Tianjin 300072 (China); Li, Ming-Wei, E-mail: mingweili@tju.edu.cn [Department of Chemistry, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineer (Tianjin), Tianjin University, Tianjin 300072 (China)

    2015-04-15

    Highlights: • LiMn{sub 0.6}Fe{sub 0.4}PO{sub 4}/C cathode material shows enhanced rate capability. • The Fe doped in the partial Mn sites could significantly facilitate the Li ions transfer. • The enhanced Li{sup +} ions diffusion contributes to the optimized rate capability of LiMn{sub 0.6}Fe{sub 0.4}PO{sub 4}. • ACM carbonization forms well carbon coating and a 3D carbon network structure. - Abstract: To enhance the rate and cyclic performances of LiMnPO{sub 4} cathode material for lithium-ion batteries, Mn is partially substituted with Fe, and LiMn{sub 1x}Fe{sub x}PO{sub 4} (x = 0.2, 0.3, 0.4, 0.5) solid solutions are synthesized and investigated. Amphiphilic carbonaceous material (ACM) forms well carbon coating and connects the LiMn{sub 1x}Fe{sub x}PO{sub 4} crystallites by a three-dimensional (3D) carbon network. The synergetic Fe substitution and carbon connection obviously improve the samples’ rate capacities and cyclic stability. The optimized LiMn{sub 0.6}Fe{sub 0.4}PO{sub 4}/C sample delivers discharge capacities of 160 mA h g{sup −1} at 0.05 C, 148 mA h g{sup −1} at 1 C, and 115 mA h g{sup −1} at 20 C. All samples have well capacity retention (>92%) after 50 charge/discharge cycles at 1 C. The enhanced electrochemical properties are mainly attributed to the improvement of Li ion and electron transport in the LiMn{sub 1x}Fe{sub x}PO{sub 4}/C samples, respectively mainly resulting from their modified crystal structures caused by Fe substitution and the 3D carbon coating/connection originating from ACM carbonization. LiMn{sub 1x}Fe{sub x}PO{sub 4} materials exhibit two discharge plateaus at ∼4.0 and ∼3.5 V (vs. Li{sup +}/Li), whose heights respectively reflect the redox potentials of Mn{sup 3+}/Mn{sup 2+} and Fe{sup 3+}/Fe{sup 2+} couples. The plateaus’ lengths correspond to the Mn/Fe ratio in LiMn{sub 1x}Fe{sub x}PO{sub 4} and are affected by the kinetic behavior of samples. Though the ∼4.0 V plateau shrinks with

  8. MAX phase formation by intercalation upon annealing of TiC{sub x}/Al (0.4 {<=} x {<=} 1) bilayer thin films

    Energy Technology Data Exchange (ETDEWEB)

    Abdulkadhim, Ahmed; Takahashi, Tetsuya [Materials Chemistry, RWTH Aachen University, Kopernikusstrasse 10, 52074 Aachen (Germany); Music, Denis, E-mail: music@mch.rwth-aachen.de [Materials Chemistry, RWTH Aachen University, Kopernikusstrasse 10, 52074 Aachen (Germany); Munnik, Frans [Helmholtz-Zentrum Dresden-Rossendorf, Bautzner Landstrasse 400, 01328 Dresden (Germany); Schneider, Jochen M. [Materials Chemistry, RWTH Aachen University, Kopernikusstrasse 10, 52074 Aachen (Germany)

    2011-09-15

    TiC{sub x}/Al bilayer thin films were synthesized using combinatorial magnetron sputtering to study the influence of C content on the reaction products at different annealing temperatures. Based on energy-dispersive X-ray analysis calibrated by elastic recoil detection analysis data, x in TiC{sub x} was varied from 0.4 to 1.0. Film constitution was studied by X-ray diffraction before and after annealing at temperatures from 500 to 1000 deg. C. The formation of TiC{sub x} and Al in the as-deposited samples over the whole C/Ti range was identified. Upon annealing, TiC{sub x} reacts with Al to form Ti-Al-based intermetallics. At temperatures as low as 700 deg. C, the formation of MAX phases (space group P6{sub 3}/mmc) is observed at x {<=} 0.7. Based on the comparison between the C content induced changes in the lattice spacing of TiC{sub x} and Ti{sub 2}AlC as well as Ti{sub 3}AlC{sub 2}, we infer the direct formation of MAX phases by Al intercalation into TiC{sub x} for x {<=} 0.7.

  9. Analytical representation of the thermal conductivity and electrical resistivity of UC/sub 1 +- x/, PuC/sub 1-x/, and (U/sub y/Pu/sub 1-y/)C/sub 1 +- x/

    International Nuclear Information System (INIS)

    Storms, E.K.

    1982-12-01

    This report uses selected measurements from the literature to construct analytical expressions that describe the electrical and thermal conductivity of pure, high-density UC/sub 1 +- x/, PuC/sub 1-x/, and (U/sub y/Pu/sub 1-y/C/sub 1 +- x/ as a function of x,y, and temperature. The approach shows that many of the differences between the reported measurements can be resolved if the carbon cntent of the single-phase material is taken into account. Analytical expressions are also given that describe the temperature variation of the phase boundaries for these phases. 16 figures

  10. Homoleptic diphosphacyclobutadiene complexes [M(η(4)-P2C2R2)2]x- (M = Fe, Co; x = 0, 1).

    Science.gov (United States)

    Wolf, Robert; Ehlers, Andreas W; Khusniyarov, Marat M; Hartl, František; de Bruin, Bas; Long, Gary J; Grandjean, Fernande; Schappacher, Falko M; Pöttgen, Rainer; Slootweg, J Chris; Lutz, Martin; Spek, Anthony L; Lammertsma, Koop

    2010-12-27

    The preparation and comprehensive characterization of a series of homoleptic sandwich complexes containing diphosphacyclobutadiene ligands are reported. Compounds [K([18]crown-6)(thf)(2)][Fe(η(4)-P(2)C(2)tBu(2))(2)] (K1), [K([18]crown-6)(thf)(2)][Co(η(4)-P(2)C(2)tBu(2))(2)] (K2), and [K([18]crown-6)(thf)(2)][Co(η(4)-P(2)C(2)Ad(2))(2)] (K3, Ad = adamantyl) were obtained from reactions of [K([18]crown-6)(thf)(2)][M(η(4)-C(14)H(10))(2)] (M = Fe, Co) with tBuC[triple bond]P (1, 2), or with AdC[triple bond]P (3). Neutral sandwiches [M(η(4)-P(2)C(2)tBu(2))(2)] (4: M = Fe 5: M = Co) were obtained by oxidizing 1 and 2 with [Cp(2)Fe]PF(6). Cyclic voltammetry and spectro-electrochemistry indicate that the two [M(η(4)-P(2)C(2)tBu(2))(2)](-)/[M(η(4)-P(2)C(2)tBu(2))(2)] moieties can be reversibly interconverted by one electron oxidation and reduction, respectively. Complexes 1-5 were characterized by multinuclear NMR, EPR (1 and 5), UV/Vis, and Mössbauer spectroscopies (1 and 4), mass spectrometry (4 and 5), and microanalysis (1-3). The molecular structures of 1-5 were determined by using X-ray crystallography. Essentially D(2d)-symmetric structures were found for all five complexes, which show the two 1,3-diphosphacyclobutadiene rings in a staggered orientation. Density functional theory calculations revealed the importance of covalent metal-ligand π bonding in 1-5. Possible oxidation state assignments for the metal ions are discussed.

  11. EXAFS analysis of cations distribution in structure of Co_1_−_xNi_xFe_2O_4 nanoparticles obtained by hydrothermal method in aloe vera extract solution

    International Nuclear Information System (INIS)

    Wongpratat, Unchista; Maensiri, Santi; Swatsitang, Ekaphan

    2016-01-01

    Graphical abstract: It is obvious from the M–H curves at room temperature of Co_1_−_xNi_xFe_2O_4 (x = 0, 0.25, 0.50, 0.75 and 1.0) nanoparticles that partially substitution of the lower Bohr magneton (2 μ_B) and smaller atomic radii (0.55 Å at A site, 0.69 Å at B site) of Ni"2"+ ions on the higher Bohr magneton (3 μ_B) and larger atomic radii (0.58 Å at A site, 0.74 Å at B site) of Co"2"+ ions can increase the saturation magnetization (M_s) of sample with x = 0.75 to approximately 1.4 times of sample with x = 0, due to the increase of the aspect ratio (surface to volume) of nanoparticles, as a result of particle size decreasing from 37.03 to 12.63 nm. In addition to this, the ferrimagnetic behavior of CoFe_2O_4 has been changed to superparamagnetic behavior with the dramatic decrease of the coercivity from 1365.60 to 63.15 Oe. - Highlights: • Magnetic behavior of Co_1_−_xNi_xFe_2O_4 NPs depends on Ni content and size of NPs. • Distribution of Co"2"+ and Ni"2"+ ions in the structure results in the increase of M_s. • Superparamagnetic behavior is observed with increasing of the aspect ratio. • M_s is increased by a factor 1.4 to a value of 57.57 emu/g in Co_0_._2_5Ni_0_._7_5Fe_2O_4. • H_c is decreased by a factor 20 to a value of 63.15 Oe in Co_0_._2_5Ni_0_._7_5Fe_2O_4. - Abstract: Effect of cations distribution upon EXAFS analysis on magnetic properties of Co_1_−_xNi_xFe_2O_4 (x = 0, 0.25, 0.50, 0.75 and 1.0) nanoparticles prepared by the hydrothermal method in aloe vera extract solution were studied. XRD analysis confirmed a pure phase of cubic spinel ferrite of all samples. Changes in lattice parameter and particle size depended on the Ni content with partial substitution and site distributions of Co"2"+, Ni"2"+ ions of different ionic radii at both tetrahedral and octahedral sites in the crystal structure. Particle sizes of samples estimated by TEM images were found to be in the range of 10.87–62.50 nm. The VSM results at room

  12. Complex titanates Sr_1_-_xPb_xLi_2Ti_6O_1_4 (0≤x≤1) as anode materials for high-performance lithium-ion batteries

    International Nuclear Information System (INIS)

    Qian, Shangshu; Yu, Haoxiang; Yan, Lei; Li, Peng; Lin, Xiaoting; Wu, Yaoyao; Long, Nengbing; Shui, Miao; Shu, Jie

    2016-01-01

    Highlights: • Sr_1_-_xPb_xLi_2Ti_6O_1_4 (0≤x≤1) is prepared by a simple solid state reaction. • Sr_0_._5Pb_0_._5Li_2Ti_6O_1_4 exhibits enhanced lithium storage capability. • Sr_0_._5Pb_0_._5Li_2Ti_6O_1_4 can deliver a capacity of 141.8 mAh g"−"1 at 700 mA g"−"1. • In-situ XRD is performed to study the reversibility of Sr_1_-_xPb_xLi_2Ti_6O_1_4. - Abstract: With the Pb doping content at Sr-site increasing, a series of Sr_1_-_xPb_xLi_2Ti_6O_1_4 (x = 0, 0.25, 0.50, 0.75, 1.0) are synthesized by a simple solid-state reaction. It is found that the reversible capacity and rate capability experience a parabolic course from SrLi_2Ti_6O_1_4 to PbLi_2Ti_6O_1_4. Among all the as-prepared samples, Sr_0_._5Pb_0_._5Li_2Ti_6O_1_4 shows the best cycling and rate properties. It delivers an initial charge capacity of 163.2 mAh g"−"1 at 100 mA g"−"1 with the capacity retention of 96.08% after 100 cycles. In addition, it can also deliver a reversible capacity of 141.8 mAh g"−"1 at 700 mA g"−"1. The superior electrochemical properties of Sr_0_._5Pb_0_._5Li_2Ti_6O_1_4 are attributed to the reduced charge transfer resistance and increased lithium-ion diffusion coefficient after doping. Besides, in-situ X-ray diffraction is also performed to investigate the lithium-ion insertion/extraction behaviors of SrLi_2Ti_6O_1_4, Sr_0_._5Pb_0_._5Li_2Ti_6O_1_4 and PbLi_2Ti_6O_1_4. The observed results confirm that Sr_0_._5Pb_0_._5Li_2Ti_6O_1_4 has good structural stability and reversibility for repeated lithium storage.

  13. [Study on crystal growth and vibrational spectra of Yb(x) : KY(1-x) (WO4)2].

    Science.gov (United States)

    Liu, Jing-He; Zhang, Ying; Zhang, Li-Jie; Zeng, Fan-Ming; Wang, Cheng-Wei; Zhang, Xue-Jian

    2008-02-01

    Yb(x) : KY(1-x)W (x = 0.05)and KYbW crystals were grown by TSSG method. Both of the structure and spectral properties were compared. The condition for the crystal growth is: the rotation rate 10-15 r x min(-1), the pulling speed 1-2 d(-1), the growing period 10-15 d, cooling growing speed 0.05-0.1 degrees C x h(-1), and the cooling speed 20 degrees C x h(-1). X-ray powder diffraction analysis was performed for the crystal powder. They belong to beta-KYW structure with low thermal phase. The cell parameters of the two crystals were calculated, and they are respectively a1 = 1.063 nm, b1 = 1.034 nm, c1 = 0.755 nm, beta1 = 130.75 degrees, Z1 = 4 and a2 = 1.061 nm, b2 = 1.029 nm, c2 = 0.749 nm, beta2 = 130.65 degrees and Z2 = 4. The infrared spectrum and Raman spectrum of crystal were measured. The sample of Yb(x) : KY(1-x) W (x = 0.05) had stronger infrared absorption peaks at 925, 891, 840, 777 and 749 cm(-1), which were caused by stretching vibration. The sample of KYW had stronger infrared absorption peaks at 484 and 437 cm(-1) caused by bending vibration. The vibration modes were analysed and vibrational frequencies of vibratory activity was assigned. The two crystals had strong Raman activity. The vibration of WOOW and WOW exists from 200 to 1000 cm(-1).

  14. The role of dysprosium on the structural and magnetic properties of (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles

    International Nuclear Information System (INIS)

    Rahimi, Hamed; Ghasemi, Ali; Mozaffarinia, Reza; Tavoosi, Majid

    2017-01-01

    In current work, Nd2Fe14B nanoparticles was synthesized by sol-gel method. Dysprosium powders were added into Nd2Fe14B nanoparticles by mechanical alloying process in order to enhancement of coercivity. The phase analysis, structure, and magnetic properties of annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles with different Dy-content (x=0.1, 0.2, 0.3, 0.4, 0.5, 0.6) were investigated by employing X-ray diffraction, X-ray photoelectron spectroscopy, energy dispersive spectroscopy, field emission scanning electron microscope, transmission electron microscope and vibrating sample magnetometer techniques. The results showed that with an increase in Dy amounts, the coercivity of particles increased from 2.9 kOe to 13.4 kOe and then decreased to 5.6 kOe. By adding an optimum amount of Dy (x=0.4), the coercivity was significantly increased from 2.9 kOe to 13.4 kOe. The average particle size of annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles was below 10 nm. Magnetization reversal studies indicate that the coercivity of milled and annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles is controlled by the nucleation of reversed magnetic domains. The experimental results in the angular dependence of coercivity for (Nd_1_−_xDy_x)_2Fe_1_4B permanent magnets showed that the normalized coercivity of the permanent magnets H_c(θ)/H_c(0) increases from 1 to about 1.2–1.5 with increasing θ from 0 to about π/3, for x=0.4–0.6. - Highlights: • Dy was added to Nd_2Fe_1_4B nanoparticles to improve the coercivity. • A maximum squareness ratio of 0.99 was obtained. • The average particle size decreased with an increase in Dy-content.

  15. Structure and electrochemical performances of LiFe{sub 1−2x}Ti{sub x}PO{sub 4}/C cathode doped with high valence Ti{sup 4+} by carbothermal reduction method

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Chang-ling, E-mail: clfanhd@yahoo.com.cn [College of Materials Science and Engineering, Hunan University, Changsha 410082 (China); Han, Shao-chang [College of Materials Science and Engineering, Hunan University, Changsha 410082 (China); Li, Ling-fang [College of Materials Science and Engineering, Hunan University, Changsha 410082 (China); College of Mechanical Engineering, Hunan University of Art and Science, Changde 415000 (China); Bai, Yong-mei [Equipment Manufacturing College, Hebei University of Engineering, Handan 056038 (China); Zhang, Ke-he; Chen, Jin; Zhang, Xiang [College of Materials Science and Engineering, Hunan University, Changsha 410082 (China)

    2013-11-05

    Highlights: •LiFePO{sub 4}/C and LiFe{sub 1−2x}Ti{sub x}PO{sub 4}/C are prepared by carbothermal reduction method. •Phenol–formaldehyde resin is used as reducing agent and carbon source. •Mechanism of carbothermal reduction reaction is presented on the basis of TG–DSC. •The electrochemical performances of samples are systematically investigated. -- Abstract: LiFePO{sub 4}/C (LFPC) and LiFe{sub 1−2x}Ti{sub x}PO{sub 4}/C (LFTPC) were prepared by carbothermal reduction method using FePO{sub 4}·2H{sub 2}O as iron source and phenol–formaldehyde resin as reducing agent and carbon source. Different ratios of TiO{sub 2} (IV) with high valence and small radius were applied to dope LiFePO{sub 4} to enhance its electrochemical performances. Results show that LFPC and LFTPC are synthesized successfully by carbothermal reduction method. The optimal carbon content in LFPC is 5 wt.% and its discharge capacity at 0.1 C is 150.8 mA h g{sup −1}. The crystallite structure of LFTPC becomes stable. They possess the smaller particle size compared with LiFePO{sub 4}. LFTPC-2 possesses the best C-rate and cycle performances among all the samples. Its discharge capacities at 0.1 C, 1 C and 3 C are 132.7 mA h g{sup −1}, 98.7 mA h g{sup −1} and 83.1 mA h g{sup −1}. The discharge curve can maintain its stable and flat platform of 3.3 V at 3 C. The electronic conductivity of LFTPC, which is coated with carbon and doped with Ti, can reach ∼10{sup −4} S cm{sup −1}. The charge transfer resistance of LFTPC-2 is 33.68 Ω, which is much lower than that of other samples.

  16. United States Air Force Analysis Extract. AFSC 4M0X1 Aerospace Physiology (Active Duty)

    Science.gov (United States)

    2002-05-01

    Perform NCOIC duties during hyperbaric chamber dives 12.50 1.46 .18 76.76 A0004 Maintain hypobaric chamber...during hyperbaric 58.33 1.04 .61 35.39 chamber dives A0003 Maintain hypobaric chamber...8 % 2 % Hyperbaric Chamber Technician 9 % 3 % 6 % 13 % 8 % Hypobaric Chamber Technician

  17. (NH4)[V1-xIIIVxIV(AsO4)F1-xOx]: A new mixed valence vanadium(III,IV) fluoro-arsenate with ferromagnetic interactions and electronic conductivity

    International Nuclear Information System (INIS)

    Berrocal, Teresa; Mesa, Jose L.; Pizarro, Jose L.; Bazan, Begona; Ruiz de Larramendi, Idoia; Arriortua, Maria I.; Rojo, Teofilo

    2009-01-01

    A new mixed valence vanadium(III,IV) fluoro-arsenate compound, with formula (NH 4 )[V 1-x III V x IV (AsO 4 )F 1-x O x ] and KTP structure-type, has been synthesized by mild hydrothermal techniques. The crystal structure has been solved from single crystal X-ray diffraction data in the Pna2 1 orthorhombic space group. The unit-cell parameters are a=13.196(2) A, b=6.628(1) A and c=10.7379(7) A with Z=8. The final R factors were R1=0.0438 and wR2=0.0943 [all data]. The crystal structure consists of a three-dimensional framework formed by (V III,IV O 4 F 2 ) octahedra and (AsO 4 ) 3- tetrahedra arsenate oxoanions. The vanadium(III,IV) cations, from the (V III,IV O 4 F 2 ) octahedra, are linked through the fluorine atoms giving rise to zigzag chains. The ammonium cations are located in the cavities of the structure compensating the anionic charge of the [V 1-x III V x IV (AsO 4 )F 1-x O x ] - inorganic skeleton. The thermal stability limit of the phase is 345 deg. C, around to this temperature the ammonium cation and fluoride anion are lost. The IR spectrum shows the characteristic bands of the (NH 4 ) + and (AsO 4 ) 3- ions. Magnetic measurements indicate the existence of weak ferromagnetic interactions. Electronic conductivity, via a hopping mechanism, occurs with an activation energy of 0.66 eV. - Graphical abstract: Polyhedral view of the crystal structure of (NH 4 )[V III 1-x V IV x (AsO 4 )F 1-x O x

  18. Structural and magnetic properties of the (Ca1-xNax)(Fe2-xTix)O4 solid solution (0 ≤ x1)

    International Nuclear Information System (INIS)

    Zouari, S.; Ranno, L.; Cheikh-Rouhou, A.; Isnard, O.; Wolfers, P.; Bordet, P.; Strobel, P.

    2008-01-01

    New compounds corresponding to the (Ca 1-x Na x )(Fe 2-x Ti x )O 4 formula with 0 ≤ x1 were prepared by solid state reactions at 1100 deg. C in air. A continuous solid solution was found between end members CaFe 2 O 4 and NaFeTiO 4 . The evolution of structural parameters and bonding geometry with composition is discussed in detail. Magnetic measurements show that the antiferromagnetic ordering known in CaFe 2 O 4 is suppressed for all x values investigated (x ≥ 0.2). The absence of crystallographic transition at low temperature was checked by X-ray diffraction down to 10 K. The magnetic structure of CaFe 2 O 4 was redetermined from powder neutron diffraction. Spins on the two iron sites order antiparallel (F z F z spin arrangement), as described previously. The difference in magnetic moments on Fe 1 and Fe 2 sites result in a ferrimagnetic configuration with net moment 2.72μ B at 2 K

  19. Air Traffic Control Officer AFSC 13MX OSSN 2335

    National Research Council Canada - National Science Library

    1999-01-01

    ... of AFSC 13MX officers, determine career intentions of AFSC 1 3MX company grade officers, determine job satisfaction levels of officers, and to ensure that members are receiving the right training for their current jobs...

  20. Training Extract, AFSC 113X0B, Flight Engineer, Helicopter Qualified.

    Science.gov (United States)

    1982-12-01

    SUPLRVISE 0JT , ’ 2 CONDuCT OJT 2.13 .3 12.5 to.2 c.R 5.70 f’ :1 IMPLEMENT OJT PROGRAMS 1.87 .3 b.! 4.8 17., 5.73 12v WRITE TEST QUESTIONS 1.76 .0 18.8 24.0...37.4 T.98 SYSTEM STATIC PORTS .𔃽b INSPECT PRIMARY FL1-1 CjNTROL SYSTEW (PFCS! 0,,? L65. 6-.5 t5.3 7C.4 4.4 Z!7 I’SPECT SEATS, SEAT IELTS . OR S40ULDP...0 31.3 21.2 51.3 5.63 5? WRITE COORESPONOENCE 2.34 .0 6.3 20.2 62.6 5.55 4 z ’Sv1EUEUT s AFET T PquGŚWS- 2.32 .a 17.5 17.3 33.08 2 AASH AND

  1. Synthesis of 1-13C-1-indanone and 2-13C-1,2,3,4-tetrahydroquinoline

    International Nuclear Information System (INIS)

    Pickering, R.E.; Wysocki, M.A.; Eisenbraun, E.J.

    1985-01-01

    The synthesis of 2- 13 C-1,2,3,4-tetrahydroquinoline (5) via 1- 13 C-3-phenylpropanoic acid (1), 1- 13 C-1-indanone (2), 1- 13 C-1-indanone hydrazone (3) and 2- 13 C-3,4-dihydro-2(1H)-quinolinone (4) proceeded in 78, 96, 95, 79, and 85% individual yields respectively for 1, 2, 3, 4, 5 and 61% overall yield of the latter from 1. (author)

  2. Synthesis and structural properties of n = 1 Ruddlesden-Popper manganites Nd1-xCa1+xMnO4

    International Nuclear Information System (INIS)

    Nagai, T.; Yamazaki, A.; Kimoto, K.; Matsui, Y.

    2008-01-01

    Polycrystalline samples of n = 1 Ruddlesden-Popper manganites Nd 1-x Ca 1+x MnO 4 (0.55 ≤ x1.00) were synthesized by a solid-state reaction. X-ray diffraction (XRD) and electron diffraction (ED) measurements confirmed that the fundamental crystal structure at room temperature consists of three distorted K 2 NiF 4 -types: orthorhombic Bmab (64) phase in 0.55 ≤ x 1 /acd (142) phase in 0.85 ≤ x1.00. Furthermore, in a whole range of 0.55 ≤ x ≤ 0.75, low-temperature magnetic and ED measurements revealed charge-orbital ordering (COO) states, which are accompanied by suppression of magnetization and structural modulations with q = (1 - x)a*. The COO transition temperatures are high with a maximum of ∼330 K at x = 0.67, and then higher than those in non-distorted n = 1 Ruddlesden-Popper manganites. The observations suggest that COO states are much stabilized by the distortion in the fundamental structures

  3. (Nbx, Zr1-x)4AlC3 MAX Phase Solid Solutions: Processing, Mechanical Properties, and Density Functional Theory Calculations.

    Science.gov (United States)

    Lapauw, Thomas; Tytko, Darius; Vanmeensel, Kim; Huang, Shuigen; Choi, Pyuck-Pa; Raabe, Dierk; Caspi, El'ad N; Ozeri, Offir; To Baben, Moritz; Schneider, Jochen M; Lambrinou, Konstantina; Vleugels, Jozef

    2016-06-06

    The solubility of zirconium (Zr) in the Nb4AlC3 host lattice was investigated by combining the experimental synthesis of (Nbx, Zr1-x)4AlC3 solid solutions with density functional theory calculations. High-purity solid solutions were prepared by reactive hot pressing of NbH0.89, ZrH2, Al, and C starting powder mixtures. The crystal structure of the produced solid solutions was determined using X-ray and neutron diffraction. The limited Zr solubility (maximum of 18.5% of the Nb content in the host lattice) in Nb4AlC3 observed experimentally is consistent with the calculated minimum in the energy of mixing. The lattice parameters and microstructure were evaluated over the entire solubility range, while the chemical composition of (Nb0.85, Zr0.15)4AlC3 was mapped using atom probe tomography. The hardness, Young's modulus, and fracture toughness at room temperature as well as the high-temperature flexural strength and E-modulus of (Nb0.85, Zr0.15)4AlC3 were investigated and compared to those of pure Nb4AlC3. Quite remarkably, an appreciable increase in fracture toughness was observed from 6.6 ± 0.1 MPa/m(1/2) for pure Nb4AlC3 to 10.1 ± 0.3 MPa/m(1/2) for the (Nb0.85, Zr0.15)4AlC3 solid solution.

  4. Transformation characteristics of LaV/sub x/Nb/sub 1-x/O4 compounds

    International Nuclear Information System (INIS)

    Nevitt, M.V.; Aldred, A.T.

    1983-06-01

    X-ray diffractometry measurements were made as a function of temperature on a series of polycrystalline LaV/sub x/Nb/sub 1-x/O 4 compounds (0 4 compounds that are either candidates or are appropriate models for candidate materials for hosting nuclear-waste ions. Partial substitution of V 5+ on the Nb 5+ site significantly lowers the tetragonal scheelite (I4 1 /a) to monoclinic fergusonite (I2/c) transformation, from 770 0 K in LaNbO 4 to approximately 215 0 K for LaV 0 25 Nb 0 75 O 4 (the solubility limit is close to x = 0.35). The transformation is displacive, of second order, involving two coupled order parameters. Heat capacity measurements on LaV 0 25 Nb 0 75 O 4 showed that the specific heat anamoly at the transformation point is extremely small. It is concluded that the two polymorphic forms of LaV/sub x/Nb/sub 1-x/O 4 have very nearly the same free energies over a substantial range of temperature below the transformation

  5. Structural and electromagnetic characteristics of perovskites in La1–c–xSrc+xMn1xMe4+xO3 systems (Me=Ge, Ti

    Directory of Open Access Journals (Sweden)

    Karpasyuk V.

    2013-01-01

    Full Text Available Experimental data are shown for the influence of substituting quadrivalent ions on the concentration phase transitions “rhombohedral-orthorhombic structure” and “semiconductor-metal” in ceramic manganites of specifically designed system La3+1–c–xSr2+c+xMn3+1–c–xMn4+cMe4+xO3 (c=0.15, 0.17, 0.19; 0.025≤x≤0.125. Regularities in the concentration dependences of unit cell volume, saturation magnetization, Curie point, and resistivity were established. Ge-substituted manganites had essentially higher values of magnetization and Curie temperature than analogous compositions with Ti. The approach to the interpretation of experimental results is discussed in terms of electron configurations and ionic radii of substituents taking into account oxygen nonstoichiometry and cation vacancies.

  6. The Representation of Isometric Operators on C(1)(X)

    International Nuclear Information System (INIS)

    Li Jingke

    2010-01-01

    In this paper,we introduce a new norm on C (1) (X), which is induced by a hexagon on R 2 , and prove that every isometric operator on C (1) (X) can be induced by a homeomorphism of X, where X is a connected subset of R.

  7. The structure and piezoelectric properties of (Ca1-xSrx)Bi4Ti4O15 ceramics

    International Nuclear Information System (INIS)

    Zheng Liaoying; Li Guorong; Zhang Wangzhong; Chen, Daren; Yin Qinrui

    2003-01-01

    In this paper, the structure and piezoelectric properties of (Ca 1-x Sr x )Bi 4 Ti 4 O 15 ceramics (x=0-1.0) are investigated. The formation of single orthorhombic phase is verified by XRD. The dependence of dielectric and piezoelectric properties on x is also determined. The results show that the excellent properties could be found in the composition of x=0.4. In that composition, d 33 =14.9, T C =677 deg. C and the DC resistivity is decuplely higher than that of BST (SrBi 4 Ti 4 O 15 ) and CBT (CaBi 4 Ti 4 O 15 )

  8. Growth and characterization of polycrystalline Ge{sub 1-x}C{sub x} by reactive pulsed laser deposition

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, M.P., E-mail: mayrap@fisica.uh.cu [Instituto de Ciencia y Tecnologia de Materiales, Zapata y G, P.O. Box 10400, Universidad de La Habana (Cuba); Farias, M.H.; Castillon, F.F.; Diaz, Jesus A.; Avalos, M. [Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autonoma de Mexico, Km 107 Carretera Tijuana-Ensenada, C.P. 22800 Ensenada, Baja California (Mexico); Ulloa, L. [Universidad de Guadalajara, (CUCEI) Blvd. Marcelino Garcia Barragan 1421, C.P. 44430 Guadalajara, Jalisco (Mexico); Gallegos, J.A.; Yee-Madeiros, H. [Escuela Superior de Fisica y Matematicas-IPN, UP' ALM' , Colonia Lindavista 07738 (Mexico)

    2011-03-15

    Polycrystalline thin films of Ge-C were grown on Si (1 1 1) substrates by means of reactive pulsed laser deposition with methane pressure of 100 mTorr. Effect substrate temperature, T{sub s}, on C incorporation to substitutional sites (x) in Ge{sub 1-x}C{sub x} was investigated systematically by X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS) analyzes. The substrate temperatures were ranging from 250 to 400 deg. C. The substitutional C composition x in the films by XRD were estimated using the Vegard's linear law. The maximum value of x calculated by XRD was 0.032 for T{sub s} of 350 deg. C. The position of the C 1s peak at 283.4 eV in the XPS spectrum confirmed the germanium-carbon alloys. XRD measurements indicated that x increased with T{sub s} from 250 deg. C to 350 deg. C. At T{sub s} = 400 deg. C, the estimation of x was lowered. However, the C content calculated by XPS analyzes increased with T{sub s} being more these values than substitutional C composition x. XPS and XRD analyzes demonstrate that the remaining C atoms are incorporated to interstitial sites. The use of the T{sub s} plays important roles in the incorporation of substitutional C and in restraining C-cluster formation in the reactive pulsed laser deposition growth of Ge-C/Si.

  9. Cation mobility in NASICON compounds Li1-xZr2-xNbx(PO4)3 and Li1+xZr2-xScx(PO4)3

    International Nuclear Information System (INIS)

    Stenina, I.A.; Yaroslavtsev, A.B.; Aliev, A.D.; Antipov, E.V.; Velikodnyj, Yu.A.; Rebrov, A.I.

    2002-01-01

    Compounds featuring NASICON structure of the composition Li 1-x Zr 2-x Nb x (PO 4 ) 3 and Li 1+x Zr 2-x Sc x (PO 4 ) 3 were studied by the method of X-ray phase analysis and 7 Li and 31 P NMR. Structure of Li 0.8 Zr 1.8 Nb 0.2 (PO 4 ) 3 was refined on the basis of X-ray powder pattern. It is shown that cationic disordering in LiZr 2 (PO 4 ) 3 is stimulated both by cationic vacancies and interstitial atoms formation. The cationic vacancies are characterized by a higher mobility. The level of intrinsic disordering was estimated and the Frenkel constant for the compound was calculated [ru

  10. Structural, vibrational and luminescence properties of the (1x)CaWO{sub 4}−xCdWO{sub 4} system

    Energy Technology Data Exchange (ETDEWEB)

    Taoufyq, A. [Institut Matériaux Microélectronique et Nanosciences de Provence, Aix Marseille Université, CNRS, Université de Toulon, IM2NP UMR 7334, 83957, La Garde (France); Laboratoire Matériaux et Environnement LME, Faculté des Sciences, Université Ibn Zohr, BP 8106, Cité Dakhla, Agadir, Maroc (Morocco); CEA/DEN, Département d’Études des Réacteurs, Laboratoire Dosimétrie Capteurs Instrumentation, CEA Cadarache, 13108, Saint-Paul-lez-Durance (France); Société CESIGMA, Signals and Systems, 1576 Chemin de La Planquette, 83130 La Garde (France); Guinneton, F.; Valmalette, J-C.; Arab, M. [Institut Matériaux Microélectronique et Nanosciences de Provence, Aix Marseille Université, CNRS, Université de Toulon, IM2NP UMR 7334, 83957, La Garde (France); Benlhachemi, A.; Bakiz, B. [Laboratoire Matériaux et Environnement LME, Faculté des Sciences, Université Ibn Zohr, BP 8106, Cité Dakhla, Agadir, Maroc (Morocco); Villain, S. [Institut Matériaux Microélectronique et Nanosciences de Provence, Aix Marseille Université, CNRS, Université de Toulon, IM2NP UMR 7334, 83957, La Garde (France); and others

    2014-11-15

    In the present work, we investigate the structural, microstructural, vibrational and luminescence properties of the system (1x)CaWO{sub 4}−xCdWO{sub 4} with x ranging between 0 and 1. Polycrystalline samples were elaborated using a coprecipitation technique followed by thermal treatment at 1000 °C. The samples were then characterized using X-ray diffraction, scanning electron microscopy, Raman spectroscopy and luminescence analyses. X-ray diffraction profile analyses using Rietveld method showed that two kinds of solid solutions Ca{sub 1x}Cd{sub x}WO{sub 4} having scheelite and wolframite structures, with respectively tetragonal and monoclinic crystal cells, were observed, with a biphasic system for compositions x=0.6 and 0.7. The scanning electron microscopy experiments showed a complex evolution of morphologies and crystallite sizes as x increased. The vibration modes of Raman spectra were characteristic of composition-dependent disordered solid solutions with decreasing wavenumbers as x increased. Luminescence experiments were performed under UV-laser light irradiation. The energies of emission bands increased linearly with cadmium composition x. The integrated intensity of luminescence reached a maximum value for the substituted wolframite phase with composition x=0.8. - Graphical abstract: Luminescence on UV excitation (364.5 nm) of (1x)CaWO{sub 4x}CdWO{sub 4} system, elaborated from coprecipitation technique at 1000 °C, with 0<x<1. (a) Experimental emission bands of the Ca{sub 1x}Cd{sub x}WO{sub 4} polycrystalline phases with 0≤x≤0.5. (b) Maximum of luminescence intensity for the composition x=0.8. - Highlights: • Solid solutions Ca{sub 1x}Cd{sub x}WO{sub 4} are elaborated from coprecipitation technique. • The structures of two types of solid solutions are refined using Rietveld method. • A maximum of luminescence is obtained for an intermediate composition x=0.8.

  11. Gas phase UV and IR absorption spectra of CxF2x+1CHO (x=1-4)

    DEFF Research Database (Denmark)

    Hashikawa, Y; Kawasaki, M; Waterland, RL

    2004-01-01

    The UV and IR spectra of CxF2x+1 CHO (x = 1-4) were investigated using computational and experimental techniques. CxF2x+1CHO (x = 1-4) have broad UV absorption features centered at 300-310 nm. The maximum absorption cross-section increases significantly and shifts slightly to the red with increased...

  12. Enhanced energy storage and pyroelectric properties of highly (100)-oriented (Pb1-x-yLaxCay)Ti1-x/4O3 thin films derived at low temperature

    Science.gov (United States)

    Zhu, Hanfei; Ma, Hongfang; Zhao, Yuyao

    2018-05-01

    Highly (100)-oriented (Pb1-x-yLaxCay)Ti1-x/4O3 (x = 0.15, y = 0.05; x = 0.1, y = 0.1; x = 0.05, y = 0.15) thin films were deposited on Pt/Ti/SiO2/Si substrates at a low temperature of 450 °C via a sol-gel route. It was found that all the (Pb1-x-yLaxCay)Ti1-x/4O3 thin films could be completely crystallized and the content of La/Ca showed a significant effect on the electrical properties of films. Among the three films, the (Pb1-x-yLaxCay)Ti1-x/4O3 (x = 0.1, y = 0.1) thin film exhibited the enhanced overall electrical properties, such as a low dielectric loss (tan ⁡ δ energy density (Wre ∼ 15 J/cm3), as well as a large pyroelectric coefficient (p ∼ 190 μC/m2K) and figure of merit (Fd‧∼ 77 μC /m2K). The findings suggest that the fabricated thin films with a good (100) orientation can be an attractive candidate for applications in Si-based energy storage and pyroelectric devices.

  13. Synthesis and electrochemical properties of xLiMn0.9Fe0.1PO4·yLi3V2(PO4)3/C composite cathode materials for lithium–ion batteries

    International Nuclear Information System (INIS)

    Wu, Ling; Lu, JiaJia; Wei, Gui; Wang, Pengfei; Ding, Hao; Zheng, Junwei; Li, Xiaowei; Zhong, Shengkui

    2014-01-01

    Highlights: • xLiMn 0.9 Fe 0.1 PO4·yLi 3 V 2 (PO 4 ) 3 /C composites are prepared by a solid-state method. • The addition of Li 3 V 2 (PO 4 ) 3 can improve the properties of LiMn 0.9 Fe 0.1 PO 4 . • Mutual doping occurrs between the LiMn 0.9 Fe 0.1 PO 4 and Li 3 V 2 (PO 4 ) 3 phases. • 5LiMn 0.9 Fe 0.1 PO 4 ·Li 3 V 2 (PO 4 ) 3 /C shows the best electrochemical properties. - Abstract: The xLiMn 0.9 Fe 0.1 PO 4 ·yLi 3 V 2 (PO 4 ) 3 /C (x:y=1:0, 9:1 5:1, 3:1, 1:1 and 0:1) cathode materials are synthesized by a ball–milling and post–calcination method. XRD results reveal that the xLiMn 0.9 Fe 0.1 PO 4 ·yLi 3 V 2 (PO 4 ) 3 /C (x,y≠0) composites are composed of LiMn 0.9 Fe 0.1 PO 4 and Li 3 V 2 (PO 4 ) 3 phases, and no impurities are detected. In LiMn 0.9 Fe 0.1 PO 4 –Li 3 V 2 (PO 4 ) 3 system, most of the manganese, iron and vanadium elements in the raw materials tend to form the two major phases, and only small amounts of V, Mn and Fe as dopants enter into the lattice of LiMn 0.9 Fe 0.1 PO 4 and Li 3 V 2 (PO 4 ) 3 . Electrochemical tests show that the xLiMn 0.9 Fe 0.1 PO 4 ·yLi 3 V 2 (PO 4 ) 3 /C (x,y≠0) composites exhibit much better performance than the single LiMn 0.9 Fe 0.1 PO 4 /C. Among the samples, 5LiMn 0.9 Fe 0.1 PO 4 ·Li 3 V 2 (PO 4 ) 3 /C shows the best electrochemical performance. The sample delivers the specific capacities of 158.1, 140.7 and 100.2 mAh g −1 at 0.05, 1 and 4 C rates in the potential range of 2.5–4.5 V, and exhibits very long and flat discharge plateau around 4.0 V up to 1 C rate. The sample also shows good cycling performance at various C–rates

  14. Synthesis and crystal structure of K{sub 2}NiF{sub 4}-type novel Gd{sub 1+x}Ca{sub 1x}AlO{sub 4x}N{sub x} oxynitrides

    Energy Technology Data Exchange (ETDEWEB)

    Masubuchi, Yuji, E-mail: yuji-mas@eng.hokudai.ac.jp; Hata, Tomoyuki; Motohashi, Teruki; Kikkawa, Shinichi

    2014-01-05

    Highlights: • Novel gadolinium calcium aluminum oxynitride was prepared by solid state reaction. • Crystal structure of the oxynitride was refined by using synchrotron X-ray diffraction. • Gd{sub 1.2}Ca{sub 0.8}AlO{sub 3.8}N{sub 0.2} has a layered K{sub 2}NiF{sub 4}-type structure with the I4mm space group. • Nitride ions preferentially occupy the apical site of aluminum octahedron. -- Abstract: Novel gadolinium calcium aluminum oxynitrides, Gd{sub 1+x}Ca{sub 1x}AlO{sub 4x}N{sub x}, were prepared in x = 0.15–0.25 by the solid state reaction of a nitrogen–rich mixture with AlN as an aluminum source; the mixture was sintered twice at 1500 °C for 5 h under 0.5 MPa of nitrogen gas. Shift in the optical absorption edge was observed in their diffuse reflectance spectra from 4.46 eV for the oxide (x = 0) to 2.94 eV for the oxynitride at x = 0.2. The crystal structure of Gd{sub 1.2}Ca{sub 0.8}AlO{sub 3.8}N{sub 0.2} at x = 0.2 was refined using a synchrotron X-ray diffraction data as a layered K{sub 2}NiF{sub 4}-type structure with the I4mm space group. Longer Al–O/N bond lengths in the oxynitride than those in GdCaAlO{sub 4} suggest that the nitride ions are in the apical site of aluminum polyhedron, similar to those in Nd{sub 2}AlO{sub 3}N.

  15. X(3872), IG(JPC) = 0+(1++), as the χc1(2P) charmonium

    Science.gov (United States)

    Achasov, N. N.; Rogozina, E. V.

    2015-09-01

    Contrary to almost standard opinion that the X(3872) resonance is the D∗0D¯0 + c.c. molecule or the qcq¯c¯ four-quark state, we discuss the scenario where the X(3872) resonance is the cc¯ = χc1(2P) charmonium which “sits on” the D∗0D¯0 threshold. We explain the shift of the mass of the X(3872) resonance with respect to the prediction of a potential model for the mass of the χc1(2P) charmonium by the contribution of the virtual D∗D¯ + c.c. intermediate states into the self energy of the X(3872) resonance. This allows us to estimate the coupling constant of the X(7872) resonance with the D∗0D¯0 channel, the branching ratio of the X(3872) → D∗0D¯0 + c.c. decay, and the branching ratio of the X(3872) decay into all non-D∗0D¯0 + c.c. states. We predict a significant number of unknown decays of X(3872) via two gluon: X(3872) →gluon gluon →hadrons. We suggest a physically clear program of experimental researches for verification of our assumption.

  16. Characterization of Carbon Composite LiMn1-xFexPO4 Cathodes

    International Nuclear Information System (INIS)

    Mishima, Y; Honda, S; Sadamura, H; Nakayama, N; Moriyoshi, C; Kuroiwa, Y

    2011-01-01

    The discharge capacities of 148 mAh/g (87 % theoretical value) at C/10 and 114mAh/g at 5C between 2.0 and 4.5 V at 25 deg. C were achieved for the carbon composite LiMn 0.8 Fe 0.2 PO 4 (C-LiMn 0.8 Fe 0.2 PO 4 ) cathode material of lithium-ion batteries (LIB), synthesized by a hydrothermal and annealing process. To improve the battery properties, we investigated the characteristics of C-LiMn 1-x Fe x PO 4 powders (x = 0.2 and 1) and the delithiated compound. While it was easier to form the homogeneous carbon layer on the surface of LiFePO 4 particles from the pyrolysis of sucrose, there was a tendency to form the particulate carbon on the LiMn 0.8 Fe 0.2 PO 4 particles. The lattice distortion of Mn 0.8 Fe 0.2 PO 4 was revealed by electron charge density study because of the Jahn-Teller active Mn 3+ ion associated with the phosphate ion. The surface and size of C- LiMn 0.8 Fe 0.2 PO 4 had to be modified because of these phenomena.

  17. U{sub x}Th{sub 1-x}(C{sub 2}O{sub 4}){sub 2} solide characterisation studies

    Energy Technology Data Exchange (ETDEWEB)

    Carrigan, C.; Taylor, R.; Sarsfield, M. [National Nuclear Laboratory, Sellafield, Seascale, Cumbria, CA20 1PG (United Kingdom)

    2016-07-01

    Many advanced reprocessing schemes under development are aimed at co-processing and co-conversion of actinides, unlike current reprocessing plants that produce separate uranium and plutonium products. The most well developed option for the co-conversion stage is probably oxalate co-precipitation, followed by the thermal co-conversion to a mixed oxide product. It is thus envisaged that future processes will avoid separation of plutonium from uranium and instead allow part of the uranium to flow with the plutonium, resulting in co-precipitation as the oxalate, and finally co-conversion to a mixed uranium-plutonium oxide (MOX), which can be fabricated into recycled nuclear fuel for further energy generation. The co-crystallisation of uranium (IV) and plutonium (III) into a single oxalate structure ensures the homogenous distribution of the 2 actinides at the molecular scale. The joint conversion of uranium and plutonium to the oxide form makes it possible to remove the complicated step of blending and grinding the 2 distinct oxide powders, as currently employed for the purposes of MOX fuel fabrication. This concept can also be extended to other actinides, including minor actinides from partitioning processes such as SANEX (Selective Actinide Extraction) and GANEX (Grouped Actinide Extraction) processes or even a thorium containing product from recycle of thorium based fuels. A selection of U{sub x}Th{sub 1-x}(C{sub 2}O{sub 4}){sub 2} solids at varying concentrations of uranium and thorium were prepared by oxalate co-precipitation. Uranium (VI) was conditioned electrochemically at -0.7 V to uranium (IV), in the presence of hydrazine. The reduced uranium (IV) in nitric acid was mixed with thorium nitrate solutions at different concentration ratios with oxalic acid. The mixed tetravalent uranium-thorium oxalate solid products have been characterised by Raman and IR spectroscopies. The influence of thorium substituted into the uranium oxalate structure was evaluated

  18. 1,4,8,11-Tetra[2-aryl-1-diazenyl]-1,4,8,11-tetraazacyclotetradecanes - synthesis, characterization, and x-ray crystallography of the first tetrakistriazenes to be reported

    Energy Technology Data Exchange (ETDEWEB)

    Clarke, J.D.; Vaughan, K. [Dept. of Chemistry, Saint Mary' s Univ., Halifax, Nova Scotia (Canada)], E-mail: keith.vaughan@smu.ca; Bertolasi, V. [Dipartimento di Chimica and Centro di Strutturistica Diffrattometrica, Universita' di Ferrara, Ferrara (Italy)

    2006-10-15

    The reactions of a series of arene diazonium salts with 1,4,8,11-tetraazacyclotetradecane (cyclam) afford the novel compounds, the 1,4,8,11-tetra[2-aryl-1-diazenyl]-1,4,8,11-tetraazacyclotetradecanes (1a-1f), which are the first examples of tetrakistriazenes to be reported. The tetrakistriazenes were characterized by IR spectroscopy, proton and carbon NMR, elemental analysis, high resolution electrospray mass spectrometry, and X-ray crystallography. The analogous reaction of a diazonium salt with 1,4,7-triazacyclononane or 1,5,9-triazacyclododecane yields the tristriazenes 2, 3a, and 3b. The structures of compounds 1c and 1e were solved by X-ray crystallography at low temperature (150 K). Both molecules display a conformation where the four phenyltriazenyl groups point alternately upwards and downwards with respect to the mean macrocyclic plane. (author)

  19. 1,4,8,11-Tetra[2-aryl-1-diazenyl]-1,4,8,11-tetraazacyclotetradecanes - synthesis, characterization, and x-ray crystallography of the first tetrakistriazenes to be reported

    International Nuclear Information System (INIS)

    Clarke, J.D.; Vaughan, K.; Bertolasi, V.

    2006-01-01

    The reactions of a series of arene diazonium salts with 1,4,8,11-tetraazacyclotetradecane (cyclam) afford the novel compounds, the 1,4,8,11-tetra[2-aryl-1-diazenyl]-1,4,8,11-tetraazacyclotetradecanes (1a-1f), which are the first examples of tetrakistriazenes to be reported. The tetrakistriazenes were characterized by IR spectroscopy, proton and carbon NMR, elemental analysis, high resolution electrospray mass spectrometry, and X-ray crystallography. The analogous reaction of a diazonium salt with 1,4,7-triazacyclononane or 1,5,9-triazacyclododecane yields the tristriazenes 2, 3a, and 3b. The structures of compounds 1c and 1e were solved by X-ray crystallography at low temperature (150 K). Both molecules display a conformation where the four phenyltriazenyl groups point alternately upwards and downwards with respect to the mean macrocyclic plane. (author)

  20. Effect of γ- Ray Irradiation on the Solid Ionic Conductor of (Cul)x(Na3PO4)1-X Materials (x= 0.1 and x= 0.3)

    International Nuclear Information System (INIS)

    Purwanto, P.

    2008-01-01

    Study on the effect of γ- ray irradiation on solid state conductor (Cul) x (Na 3 PO 4 ) 1-X have been done. The solid ionic conductor of (Cul) x (Na 3 PO 4 ) 1-X (x= 0.1 and x= 0.3) had been made by mixing Cul with Na 3 PO 4 by formula of (Cul) x (Na 3 PO 4 ) 1-X where x= 0.1 and x= 0.3 then pressed with 48.26 x 10 6 N/m 2 into pellete in diametre 1.5 x 10 - 2 m. The solid ionic conductor was then γ- ray irradiated with dose of 5 to 30 kGy. The result showed that the structure of (Cul) x (Na 3 PO 4 ) 1-X was Cul and Na 3 PO 4 . Crystall lattice strain of (Cul) x (Na 3 PO 4 ) 1-X were measured stable against the influence of radiation. The conductivity measurement of (Cul) x (Na 3 PO 4 ) 1-X was carried out by LCR at the frequence of 0.1 Hz to 100 kHz. The result showed that the conductivities of (Cul) x (Na 3 PO 4 ) 1-X after irradiation were increasing with radiation dose. (author)

  1. EXAFS analysis of cations distribution in structure of Co{sub 1x}Ni{sub x}Fe{sub 2}O{sub 4} nanoparticles obtained by hydrothermal method in aloe vera extract solution

    Energy Technology Data Exchange (ETDEWEB)

    Wongpratat, Unchista [Materials Science and Nanotechnology Program, Faculty of Science, Khon Kaen University, Khon Kaen 40002 (Thailand); Maensiri, Santi [School of Physics, Institute of Science, Suranaree University, Nakhonratchasima 30000 (Thailand); Swatsitang, Ekaphan, E-mail: ekaphan@kku.ac.th [Materials Science and Nanotechnology Program, Faculty of Science, Khon Kaen University, Khon Kaen 40002 (Thailand); Integrated Nanotechnology Research Center, Department of Physics, Faculty of Science, Khon Kaen University, Khon Kaen 40002 Thailand (Thailand)

    2016-09-01

    Graphical abstract: It is obvious from the M–H curves at room temperature of Co{sub 1x}Ni{sub x}Fe{sub 2}O{sub 4} (x = 0, 0.25, 0.50, 0.75 and 1.0) nanoparticles that partially substitution of the lower Bohr magneton (2 μ{sub B}) and smaller atomic radii (0.55 Å at A site, 0.69 Å at B site) of Ni{sup 2+} ions on the higher Bohr magneton (3 μ{sub B}) and larger atomic radii (0.58 Å at A site, 0.74 Å at B site) of Co{sup 2+} ions can increase the saturation magnetization (M{sub s}) of sample with x = 0.75 to approximately 1.4 times of sample with x = 0, due to the increase of the aspect ratio (surface to volume) of nanoparticles, as a result of particle size decreasing from 37.03 to 12.63 nm. In addition to this, the ferrimagnetic behavior of CoFe{sub 2}O{sub 4} has been changed to superparamagnetic behavior with the dramatic decrease of the coercivity from 1365.60 to 63.15 Oe. - Highlights: • Magnetic behavior of Co{sub 1x}Ni{sub x}Fe{sub 2}O{sub 4} NPs depends on Ni content and size of NPs. • Distribution of Co{sup 2+} and Ni{sup 2+} ions in the structure results in the increase of M{sub s}. • Superparamagnetic behavior is observed with increasing of the aspect ratio. • M{sub s} is increased by a factor 1.4 to a value of 57.57 emu/g in Co{sub 0.25}Ni{sub 0.75}Fe{sub 2}O{sub 4}. • H{sub c} is decreased by a factor 20 to a value of 63.15 Oe in Co{sub 0.25}Ni{sub 0.75}Fe{sub 2}O{sub 4}. - Abstract: Effect of cations distribution upon EXAFS analysis on magnetic properties of Co{sub 1x}Ni{sub x}Fe{sub 2}O{sub 4} (x = 0, 0.25, 0.50, 0.75 and 1.0) nanoparticles prepared by the hydrothermal method in aloe vera extract solution were studied. XRD analysis confirmed a pure phase of cubic spinel ferrite of all samples. Changes in lattice parameter and particle size depended on the Ni content with partial substitution and site distributions of Co{sup 2+}, Ni{sup 2+} ions of different ionic radii at both tetrahedral and octahedral sites in the

  2. Weather, AFSCs 1W0X1/A and 15WX/A

    Science.gov (United States)

    1998-04-01

    their observing tasks. Finally, a small group of Keesler instructors are also included within this job who are teaching in the basic Observer course...CQ CQ Ü 00 00 o ON C- NO 00 «r> m vo vo »-i <-< vo <o c- NO >n PH ’S* a Efl 2 £ a & tu ^ *o £ «a -a .a I3 «.2 g 5 ^3 o 1 fa fa "i s

  3. Hydrogen-induced metallization on Ge(1 1 1) c(2 x 8)

    International Nuclear Information System (INIS)

    Razado, I.C.; Zhang, H.M.; Hansson, G.V.; Uhrberg, R.I.G.

    2006-01-01

    We have studied hydrogen adsorption on the Ge(1 1 1) c(2 x 8) surface using scanning tunneling microscopy (STM) and angle-resolved photoelectron spectroscopy (ARPES). We find that atomic hydrogen preferentially adsorbs on rest atom sites. The neighbouring adatoms appear higher in STM images, which clearly indicates a charge transfer from the rest atom states to the adatom states. The surface states near the Fermi-level have been followed by ARPES as function of H exposure. Initially, there is strong emission from the rest atom states but no emission at the Fermi-level which confirms the semiconducting character of the c(2 x 8) surface. With increasing H exposure a structure develops in the close vicinity of the Fermi-level. The energy position clearly indicates a metallic character of the H-adsorbed surface. Since the only change in the STM images is the increased brightness of the adatoms neighbouring a H-terminated rest atom, we identify the emission at the Fermi-level with these adatom states

  4. Genotype X/C recombinant (putative genotype I) of hepatitis B virus is rare in Hanoi, Vietnam--genotypes B4 and C1 predominate.

    Science.gov (United States)

    Phung, Thi Bich Thuy; Alestig, Erik; Nguyen, Thanh Liem; Hannoun, Charles; Lindh, Magnus

    2010-08-01

    There are eight known genotypes of hepatitis B virus, A-H, and several subgenotypes, with rather well-defined geographic distributions. HBV genotypes were evaluated in 153 serum samples from Hanoi, Vietnam. Of the 87 samples that could be genotyped, genotype B was found in 67 (77%) and genotype C in 19 (22%). All genotype C strains were of subgenotype C1, and the majority of genotype B strains were B4, while a few were B2. The genotype X/C recombinant strain, identified previously in Swedish patients of indigenous Vietnamese origin, was found in one sample. This variant, proposed to be classified as genotype I, has been found recently also by others in Vietnam and Laos. The current study indicates that the genotype X/C recombinant may represent approximately 1% of the HBV strains circulating in Vietnam. (c) 2010 Wiley-Liss, Inc.

  5. Feature Fusion Based Road Extraction for HJ-1-C SAR Image

    Directory of Open Access Journals (Sweden)

    Lu Ping-ping

    2014-06-01

    Full Text Available Road network extraction in SAR images is one of the key tasks of military and civilian technologies. To solve the issues of road extraction of HJ-1-C SAR images, a road extraction algorithm is proposed based on the integration of ratio and directional information. Due to the characteristic narrow dynamic range and low signal to noise ratio of HJ-1-C SAR images, a nonlinear quantization and an image filtering method based on a multi-scale autoregressive model are proposed here. A road extraction algorithm based on information fusion, which considers ratio and direction information, is also proposed. By processing Radon transformation, main road directions can be extracted. Cross interferences can be suppressed, and the road continuity can then be improved by the main direction alignment and secondary road extraction. The HJ-1-C SAR image acquired in Wuhan, China was used to evaluate the proposed method. The experimental results show good performance with correctness (80.5% and quality (70.1% when applied to a SAR image with complex content.

  6. Magnetic phase diagram of Co(Cr1-xA lx) 2O4 (x = 0.0-1.0)

    Science.gov (United States)

    Padam, R.; Sarkar, T.; Mathieu, R.; Thota, S.; Pal, D.

    2017-08-01

    We report the role of Al substitution in the magnetic properties of spinel CoCr2O4 by means of temperature dependent dc and ac magnetization and heat capacity measurements. Various compositions (0.0 ≤ x1.0) of polycrystalline Co(Cr1-xAlx)2O4 samples have been prepared by sol-gel processing and their crystal structure was investigated by X-ray diffraction which was found to crystallize in the normal cubic spinel structure. For x ≤ 0.1, the system exhibits multiple magnetic orderings (long range ferrimagnetic ordering TC, spin-spiral ordering TS, and lock-in transition TL), similar to that of the parent compound, CoCr2O4. However, all the compositions between x = 0.1 and 0.5 exhibit long range ferrimagnetic ordering below TC and also a short range order at low temperature. Spin-glass like ordering was noticed between x = 0.6 and 0.8 due to the diluted B-site occupancy, whereas the end compound CoAl2O4 (x = 1.0) shows antiferromagnetic behavior. On the basis of these results, we propose a magnetic phase diagram for the Co(Cr1-xAlx)2O4 series as a function of the Al content (x) and measuring temperature (T).

  7. Equilibrium studies on butane-1,4-diamine extraction with 4-nonylphenol

    NARCIS (Netherlands)

    Krzyzaniak, Agnieszka; Tansaz, Ashkan; Schuur, Boelo; de Haan, André B.

    2014-01-01

    BACKGROUND: The extraction of butane-1,4-diamine (BDA) from aqueous solutions with undiluted 4-nonylphenol (4NP) has been studied at three temperatures (298 K, 310 K and 323 K) in a batch system. A reactive extraction model based on mass action law was applied to describe the experimental data.

  8. Synthesis and structural characterization of Al4SiC4-homeotypic aluminum silicon oxycarbide, [Al4.4Si0.6][O1.0C2.0]C

    International Nuclear Information System (INIS)

    Kaga, Motoaki; Iwata, Tomoyuki; Nakano, Hiromi; Fukuda, Koichiro

    2010-01-01

    A new quaternary layered oxycarbide, [Al 4.39(5) Si 0.61(5) ] Σ5 [O 1.00(2) C 2.00(2) ] Σ3 C, has been synthesized and characterized by X-ray powder diffraction, transmission electron microscopy and energy dispersive X-ray spectroscopy (EDX). The title compound was found to be hexagonal with space group P6 3 /mmc, Z=2, and unit-cell dimensions a=0.32783(1) nm, c=2.16674(7) nm and V=0.20167(1) nm 3 . The atom ratios Al:Si were determined by EDX, and the initial structural model was derived by the direct methods. The final structural model showed the positional disordering of one of the three types of Al/Si sites. The maximum-entropy methods-based pattern fitting (MPF) method was used to confirm the validity of the split-atom model, in which conventional structure bias caused by assuming intensity partitioning was minimized. The reliability indices calculated from the MPF were R wp =3.73% (S=1.20), R p =2.94%, R B =1.04% and R F =0.81%. The crystal was an inversion twin. Each twin-related individual was isostructural with Al 4 SiC 4 (space group P6 3 mc, Z=2). - Graphical abstract: A new oxycarbide discovered in the Al-Si-O-C system, Al 4 SiC 4 -homeotypic [Al 4.4 Si 0.6 ][O 1.0 C 2.0 ]C. The crystal is an inversion twin, and hence the structure is represented by a split-atom model. The three-dimensional electron density distributions are determined by the maximum-entropy methods-based pattern fitting, being consistent with the disordered structural model.

  9. 26 CFR 1.381(c)(4)-1 - Method of accounting.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Method of accounting. 1.381(c)(4)-1 Section 1... TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(4)-1 Method of accounting. (a... section 381(a) applies, an acquiring corporation shall use the same method of accounting used by the...

  10. 26 CFR 1.381(c)(18)-1 - Depletion on extraction of ores or minerals from the waste or residue of prior mining.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Depletion on extraction of ores or minerals from... Reorganizations § 1.381(c)(18)-1 Depletion on extraction of ores or minerals from the waste or residue of prior... transfer, to an allowance for depletion under section 611 in respect of ores or minerals extracted from...

  11. One-pot solvothermal synthesis of Co{sub 1x}Mn{sub x}C{sub 2}O{sub 4} and their application as anode materials for lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Ang, Wei An Elijah [School of Materials Science and Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore 639798 (Singapore); Energy Research Institute @ NTU (ERI-N), Nanyang Technological University, 50 Nanyang Drive, Singapore 637553 (Singapore); Cheah, Yan Ling; Wong, Chui Ling [Energy Research Institute @ NTU (ERI-N), Nanyang Technological University, 50 Nanyang Drive, Singapore 637553 (Singapore); Hng, Huey Hoon [School of Materials Science and Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore 639798 (Singapore); Madhavi, Srinivasan, E-mail: madhavi@ntu.edu.sg [School of Materials Science and Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore 639798 (Singapore); Energy Research Institute @ NTU (ERI-N), Nanyang Technological University, 50 Nanyang Drive, Singapore 637553 (Singapore); TUM CREATE Center for Electromobility, 1 CREATE Way, #10-02 CREATE Tower, Singapore 138602 (Singapore)

    2015-07-25

    Graphical abstract: MnC{sub 2}O{sub 4} exhibited good cycling stability while CoC{sub 2}O{sub 4} showed severe capacity fading phenomenon after 40 cycles. Notably, mixed solid solution having Co{sub 0.52}Mn{sub 0.48}C{sub 2}O{sub 4} composition improved the specific reversible discharge capacity to a stable value of ∼1000 mA h g{sup −1} (1 C-rate). - Highlights: • Mixed metal oxalates are synthesized by solvothermal method for the first time. • We control morphologies by varying solvent mixtures and transition metal types. • Li/Co{sub 0.52}Mn{sub 0.48}C{sub 2}O{sub 4} is the best capacity and rate-performing cell in this study. • The positive synergistic effect is attributed to optimal Co:Mn mole ratio. • Properties of Co give high capacity values while Mn give good cycling stability. - Abstract: A facile one-pot solvothermal route has been developed to synthesize phase pure M{sub x}C{sub 2}O{sub 4}⋅2H{sub 2}O (M = Mn, Co; 0 < x1) microstructures without employing any hard/soft template and their electrochemical performance in lithium-ion batteries has been systematically investigated. Morphology, microstructure and composition of the synthesized materials are characterized by field emission-scanning electron microscopy, X-ray diffraction and energy-dispersive X-ray spectroscopy. Anhydrous micron-sized MnC{sub 2}O{sub 4} and CoC{sub 2}O{sub 4} exhibits specific reversible discharge capacity of ∼800 and 950 mA h g{sup −1} respectively, at 1 C-rate. MnC{sub 2}O{sub 4} exhibited good cycling stability while CoC{sub 2}O{sub 4} showed severe capacity fading phenomenon after 40 cycles, thereafter attaining 400–600 mA h g{sup −1} for all C-rates. Interestingly, mixed solid solution having Co{sub 0.52}Mn{sub 0.48}C{sub 2}O{sub 4} composition improved the specific reversible discharge capacity to a stable value of ∼1000 mA h g{sup −1} (1 C-rate), which is one of the highest reported values for such oxalates. The cycling stability of this

  12. AFSC Laboratory Management Information Requirements Project

    National Research Council Canada - National Science Library

    1982-01-01

    This document was developed under the auspices of the Laboratory IRM (LIRM) Management Working Group in response to AFSC Program Directive 0008-81-1, Management Information Requirement Project (23 February 1981...

  13. New Insights into Mn1xZnxFe2O4 via Fabricating Magnetic Photocatalyst Material BiVO4/Mn1xZnxFe2O4

    Directory of Open Access Journals (Sweden)

    Taiping Xie

    2018-02-01

    Full Text Available BiVO4/Mn1xZnxFe2O4 was prepared by the impregnation roasting method. XRD (X-ray Diffractometer tests showed that the prepared BiVO4 is monoclinic crystal, and the introduction of Mn1xZnxFe2O4 does not change the crystal structure of BiVO4. The introduction of a soft-magnetic material, Mn1xZnxFe2O4, was beneficial to the composite photocatalyst’s separation from the liquid solution using an extra magnet after use. UV-vis spectra analysis indicated that Mn1xZnxFe2O4 enhanced the absorption intensity of visible light for BiVO4. EIS (electrochemical impedance spectroscopy investigation revealed that the introduction of Mn1xZnxFe2O4 enhanced the conductivity of BiVO4, further decreasing its electron transfer impedance. The photocatalytic efficiency of BiVO4/Mn1xZnxFe2O4 was higher than that of pure BiVO4. In other words, Mn1xZnxFe2O4 could enhance the photocatalytic reaction rate.

  14. Transport properties and spin correlations of La1.85-xSr0.15+xCu1-xFexO4

    DEFF Research Database (Denmark)

    Xu, G.J.; Pu, Q.R.; Liu, B.

    2004-01-01

    A series of double-doped La1.85-xSr0.15+xCu1-xFexO4 (0less than or equal toxless than or equal to1) ceramic samples were prepared by the solid-state reaction method. The structure, transport properties, and spin correlations were studied by means of x-ray diffraction, resistivity, thermoelectric...

  15. Thermochemical Properties Enthalpy, Entropy, and Heat Capacity of C1-C4 Fluorinated Hydrocarbons: Fluorocarbon Group Additivity.

    Science.gov (United States)

    Wang, Heng; Castillo, Álvaro; Bozzelli, Joseph W

    2015-07-23

    Enthalpies of formation for 14 C2–C4 fluorinated hydrocarbons were calculated with nine popular ab initio and density functional theory methods: B3LYP, CBS-QB3, CBS-APNO, M06, M06-2X, ωB97X, G4, G4(MP2)-6X, and W1U via several series of isodesmic reactions. The recommended ideal gas phase ΔHf298° (kcal mol(–1)) values calculated in this study are the following: −65.4 for CH3CH2F; −70.2 for CH3CH2CH2F; −75.3 for CH3CHFCH3; −75.2 for CH3CH2CH2CH2F; −80.3 for CH3CHFCH2CH3; −108.1 for CH2F2; −120.9 for CH3CHF2; −125.8 for CH3CH2CHF2; −133.3 for CH3CF2CH3; −166.7 for CHF3; −180.5 for CH3CF3; −185.5 for CH3CH2CF3; −223.2 for CF4; and −85.8 for (CH3)3CF. Entropies (S298° in cal mol(–1) K(–1)) were estimated using B3LYP/6-31+G(d,p) computed frequencies and geometries. Rotational barriers were determined and hindered internal rotational contributions for S298°, and Cp(T) were calculated using the rigid rotor harmonic oscillator approximation, with direct integration over energy levels of the intramolecular rotation potential energy curve. Thermochemical properties for the fluorinated carbon groups C/C/F/H2, C/C2/F/H, C/C/F2/H, C/C2/F2, and C/C/F3 were derived from the above target fluorocarbons. Previously published enthalpies and groups for 1,2-difluoroethane, 1,1,2-trifluoroethane, 1,1,2,2-tetrafluoroethane, 1,1,1,2-tetrafluoroethane, 1,1,1,2,2-pentafluoroethane, 2-fluoro-2-methylpropane that were previously determined via work reaction schemes are revised using updated reference species values. Standard deviations are compared for the calculation methods.

  16. A computational study on the energetics and mechanisms for the dissociative adsorption of SiH{sub x}(x = 14) on W(1 1 1) surface

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Y.H.; Raghunath, P.; Lin, M.C., E-mail: chemmcl@emory.edu

    2016-01-30

    Graphical abstract: - Highlights: • Behavior of the SiH{sub x} species on the W surface under cat-CVD conditions. • The adsorption and dissociation mechanisms of SiH{sub x}(x = 14) species on W(1 1 1) surface. • H-migration to its neighboring W atoms is more favorable compared to H{sub 2} elimination. - Abstract: The adsorption and dissociation mechanisms of SiH{sub x}(x = 14) species on W(1 1 1) surface have been investigated by using the periodic density functional theory with the projector-augmented wave approach. The adsorption of all the species on four surface sites: top (T), bridge (B), shallow (S), and deep (D) sites have been analyzed. For SiH{sub 4} on a top site, T-SiH{sub 4(a)}, it is more stable with an adsorption energy of 2.6 kcal/mol. For SiH{sub 3}, the 3-fold shallow site is most favorable with adsorption energy of 46.0 kcal/mol. For SiH{sub 2}, its adsorption on a bridge site is most stable with 73.0 kcal/mol binding energy, whereas for SiH and Si the most stable adsorption configurations are on 3-fold deep sites with very high adsorption energies, 111.8 and 134.7 kcal/mol, respectively. The potential energy surfaces for the dissociative adsorption of all SiH{sub x} species on the W(1 1 1) surface have been constructed using the CINEB method. The barriers for H-atom migration from SiH{sub x(a)} to its neighboring W atoms, preferentially on B-sites, were predicted to be 0.4, 1.0, 4.5 and, 8.0 kcal/mol, respectively, for x = 4, 3, 2, and 1, respectively. The adsorption energy of the H atom on a bridge site on the clean W(1 1 1) surface was predicted to be 65.9 kcal/mol, which was found to be slightly affected by the co-adsorption of SiH{sub x−1} within ± 1 kcal/mol.

  17. Glassy behavior in the layered perovskites La{sub 2-x}Sr{sub x}CoO{sub 4}(1.1{<=}x{<=}1.3)

    Energy Technology Data Exchange (ETDEWEB)

    Mukherjee, S., E-mail: sanseb68@yahoo.co.in [Department of Physics, University of Burdwan, Burdwan 713104 (India); Mukherjee, Rajarshi [Department .of Physics, University of Burdwan, Burdwan 713104 (India); Banerjee, S.; Ranganathan, R. [Saha Institute of Nuclear Physics, Kolkata 700 064 (India); Kumar, Uday [Department of Physical Sciences, Indian Institute of Science Education and Research - Kolkata, Mohonpur 741252 (India)

    2012-03-15

    The glassy behavior of the phase segregated state in the layered cobaltite La{sub 2-x}Sr{sub x}CoO{sub 4} has been studied. The role of the inter-cluster interactions as well as the disordered spins at the paramagnetic-ferromagnetic interface, behind the observed glassy behavior have been investigated. The disordered spins at the interface appear to be strongly pinned, and they contribute little to the observed glassy behavior. On the other hand, the inter-cluster interactions play the key role. Both the Co{sup 4+} and Co{sup 3+} ions are in the intermediate spin state. - Highlights: Black-Right-Pointing-Pointer Phase segregated state of cobaltite La{sub 2-x}Sr{sub x}CoO{sub 4} for (1.1{<=}x{<=}1.3) to find the origin of the observed glassy behavior. Black-Right-Pointing-Pointer Result of the frequency dependent ac susceptibility measurement excludes the possibility of any spin glass phase, hints strong inter-cluster interactions. Black-Right-Pointing-Pointer Relaxation experiments confirm the system to be a collection of clusters with two preferred sizes. Black-Right-Pointing-Pointer The glassy behavior originates from strong inter-cluster interactions.

  18. Synthesis of dimethyl-1,1 guanylguanidine-{sup 14}C-2,4 (dimethyl-1-1 biguanide) hydrochloride; Synthese du chlorhydrate de dimethyl-1,1 guanylguanidine {sup 14}C-2,4 (dimethyl-1-1 biguanide)

    Energy Technology Data Exchange (ETDEWEB)

    Herbert, M; Pichat, L [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1961-07-01

    A description of the synthesis of dimethyl-1,1 guanylguanidine-{sup 14}C-2,4 hydrochloride passing through the {sup 14}C{sub 2} dicyandiamide. The overall yield with respect to Ba{sup 14}CO{sub 3} is 38 per cent. (author) [French] Description de la synthese du chlorhydrate de dimethyl-1,1 guanylguanidine {sup 14}C-2,4 par l'intermediaire de la dicyandiamide {sup 14}C{sub 2}. Le rendement global par rapport a {sup 14}CO{sub 3}Ba est de 38 pour cent. (auteur)

  19. Chemokine (C-X-C) ligand 1 (CXCL1) protein expression is increased in aggressive bladder cancers

    International Nuclear Information System (INIS)

    Miyake, Makito; Lawton, Adrienne; Goodison, Steve; Urquidi, Virginia; Gomes-Giacoia, Evan; Zhang, Ge; Ross, Shanti; Kim, Jeongsoon; Rosser, Charles J

    2013-01-01

    Chemokines, including chemokine (C-X-C motif) ligand 1 (CXCL1), may regulate tumor epithelial-stromal interactions that facilitate tumor growth and invasion. Studies have linked CXCL1 expression to gastric, colon and skin cancers, but limited studies to date have described CXCL1 protein expression in human bladder cancer (BCa). CXCL1 protein expression was examined in 152 bladder tissue specimens (142 BCa) by immunohistochemical staining. The expression of CXCL1 was scored by assigning a combined score based on the proportion of cells staining and intensity of staining. CXCL1 expression patterns were correlated with clinicopathological features and follow-up data. CXCL1 protein expression was present in cancerous tissues, but was entirely absent in benign tissue. CXCL1 combined immunostaining score was significantly higher in high-grade tumors relative to low-grade tumors (p = 0.012). Similarly, CXCL1 combined immunostaining score was higher in high stage tumors (T2-T4) than in low stage tumors (Ta-T1) (p < 0.0001). An increase in the combined immunostaining score of CXCL1 was also associated with reduced disease-specific survival. To date, this is the largest study describing increased CXCL1 protein expression in more aggressive phenotypes in human BCa. Further studies are warranted to define the role CXCL1 plays in bladder carcinogenesis and progression

  20. Synthesis and electrochemical properties of Ti4+ doped Li3-xFe2-xTix(PO4)3/C cathode materials

    International Nuclear Information System (INIS)

    Liu Zhanqiang; Huang Fuqiang; Sun Junkang

    2011-01-01

    Highlights: → Li 3-x Fe 2-x Ti x (PO 4 ) 3 /C composite cathodes were prepared by ball-milling method. Ti-doping can improve the electrochemical property of Li 3 Fe 2 (PO 4 ) 3 . → The optimized doping level was found to be x = 0.2. → The second phase of LiTi 2 (PO 4 ) 3 will emerge if the doping level higher than 0.2. - Abstract: Li 3-x Fe 2-x Ti x (PO 4 ) 3 /C (x = 0-0.4) cathodes designed with Fe doped by Ti was studied. Both Li 3 Fe 2 (PO 4 ) 3 /C (x = 0) and Li 2.8 Fe 1.8 Ti 0.2 (PO 4 ) 3 /C (x = 0.2) possess two plateau potentials of Fe 3+ /Fe 2+ couple (around 2.8 V and 2.7 V vs. Li + /Li) upon discharge observed from galvanostatic charge/discharge and cyclic voltammetry. Li 2.8 Fe 1.8 Ti 0.2 (PO 4 ) 3 /C has higher reversibility and better capacity retention than that of the undoped Li 3 Fe 2 (PO 4 ) 3 /C. A much higher specific capacity of 122.3 mAh/g was obtained at C/20 in the first cycle, approaching the theoretical capacity of 128 mAh/g, and a capacity of 100.1 mAh/g was held at C/2 after the 20th cycle.

  1. SU(n)c x SU(m)L x U(1)N generalizations of the standard model

    International Nuclear Information System (INIS)

    Pleitez, V.

    1993-01-01

    Generalizations of the Standard Model which are based on the gauge symmetry SU(n) c x SU(m) L x U(1) N are considered. Although the most interesting possibility occurs when n = 3, it will be considered also the cases n = 4,5, both with m = 3,4. It will also be given possible grand unification scenarios. (author). 18 refs

  2. Magnetic properties of CexY1-xPt compared to CexLa1-xPt ones

    Science.gov (United States)

    Očko, M.; Zadro, K.; Drobac, Đ.; Aviani, I.; Salamon, K.; Mixon, D.; Bauer, E. D.; Sarrao, J. L.

    2018-04-01

    We have investigated the magnetic properties of the CexY1-xPt Kondo ferromagnetic alloy system in the temperature range from 1.8 K to 320 K. The results of these investigations can be summarized as follows: dc-susceptibility can be described by the Curie-Weiss law at higher temperatures down to about 100 K, but also at low temperatures above the ferromagnetic phase transition. At higher temperatures, the extracted Curie-Weiss parameter, θp, is negative and at low temperature θC is positive. The extracted effective magnetic moment above 100 K increases with the Ce content up to almost the theoretical value of the isolated Ce3+ ion, μ = 2.54 μB, for CePt. This suggests an increase of the hybridization with decreasing Ce content, or said equivalently, it means that the increase of the Kondo interaction diminishes effective magnetic moment. These observations confirm the main conclusions inferred from an earlier transport properties investigation of this alloy system. The corresponding θC differs within 1 K from the Curie temperature, TC, which is determined by the resistivity measurements. The most intriguing result of the investigation of CexY1-xPt is the linear concentration dependence of TC vs. x and, moreover, it is the same as in CexLa1-xPt although in the former system the hybridization diminishes considerably the effective magnetic moment per Ce ion, while in the latter system, hybridization is minor and independent of x. We offer the explanations of these intriguing experimental results.

  3. Planar Large Core Polymer Optical 1x2 and 1x4 Splitters Connectable to Plastic Optical Fiber

    Directory of Open Access Journals (Sweden)

    V. Prajzler

    2013-09-01

    Full Text Available We report about new approach to design and fabricate multimode 1 x 2 and 1 x 4 Y optical planar power splitter suitable for low-cost short distance optical network. The splitters were designed by beam propagation method using BeamPROP™ software. The dimensions of the splitters were optimized for connecting standard plastic optical fibre with 1 mm diameter. New Norland Optical Adhesives 1625 glues were used as optical waveguide layers and the design structures were completed by CNC engraving on poly(methyl methacrylate substrate. The best parameters that were achieved with 1x2 splitter were insertion loss around 4.1dB at 650 nm and the coupling ratio 52:48; the best one of the 1x4 splitters had at 650 nm insertion loss around 17.6 dB.

  4. REAuAl{sub 4}Ge{sub 2} and REAuAl{sub 4}(Au{sub x}Ge{sub 1-x}){sub 2} (RE=rare earth element): Quaternary intermetallics grown in liquid aluminum

    Energy Technology Data Exchange (ETDEWEB)

    Xiuni, Wu [Department of Chemistry, Michigan State University, East Lansing, Michigan 48824 (United States); Kanatzidis, Mercouri G [Department of Chemistry, Michigan State University, East Lansing, Michigan 48824 (United States)

    2005-11-15

    The two families of intermetallic phases REAuAl{sub 4}Ge{sub 2} (1) (RE=Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Er, Tm and Yb) and REAuAl{sub 4}(Au{sub x}Ge{sub 1-x}){sub 2} (2) (x=0.4) (RE=Ce and Eu) were obtained by the reactive combination of RE, Au and Ge in liquid aluminum. The structure of (1) adopts the space group R-3m (CeAuAl{sub 4}Ge{sub 2}, a=4.2384(7)A, c=31.613(7)A; NdAuAl{sub 4}Ge{sub 2}, a=4.2258(4)A, c=31.359(5)A; GdAuAl{sub 4}Ge{sub 2}, a=4.2123(6)A, c=30.994(6)A; ErAuAl{sub 4}Ge{sub 2}, a=4.2074(4)A, c=30.717(5)A). The structure of (2) adopts the tetragonal space group P4/mmm with lattice parameters: a=4.3134(8)A, c=8.371(3)A for EuAuAl{sub 4}(Au{sub x}Ge{sub 1-x}){sub 2} (x=0.4). Both structure types present slabs of ''AuAl{sub 4}Ge{sub 2}'' or ''AuAl{sub 4}(Au{sub x}Ge{sub 1-x}){sub 2}'' stacking along the c-axis with layers of RE atoms in between. Magnetic susceptibility measurements indicate that the RE atoms (except for Ce and Eu) possess magnetic moments consistent with +3 species. The Ce atoms in CeAuAl{sub 4}Ge{sub 2} and CeAuAl{sub 4}(Au{sub x}Ge{sub 1-x}){sub 2} (x=0.4) appear to be in a mixed +3/+4 valence state; DyAuAl{sub 4}Ge{sub 2} undergoes an antiferromagnetic transition at 11K and below this temperature exhibits metamagnetic behavior. The Eu atoms in EuAuAl{sub 4}(Au{sub x}Ge{sub 1-x}){sub 2} (x=0.4) appear to be in a 2+ oxidation state.

  5. 1.5 GeV/c multiturn shaving extraction and its transport line for the Brookhaven AGS

    International Nuclear Information System (INIS)

    Weng, W.T.; Blumberg, L.N.; Gill, E.; Soukas, A.; Witkover, R.L.; Egleman, E.; LoSecco, J.; Sulak, L.

    1979-01-01

    A system for fast shaving extraction at 1.5 GeV/c is implemented to extract the circulating beam in five turns. A numerical simulation is first carried out to determine the emittance and the rf structure of the extracted beam. This is followed by several machine study sessions which establish the optimal extraction configuration, confirm the emittance, and modify the transport line for low energy beam. Finally, a one-week run for the Neutrino Oscillation experiment demonstrates that the system is very stable and capable of delivering 7.5 x 10 12 p/sec with 70% extraction efficiency and 95% transport efficiency

  6. New view on In{sub x}Ga{sub 1-x}N{sub y}As{sub 1-y}alloys

    Energy Technology Data Exchange (ETDEWEB)

    Elyukhin, Vyacheslav A. [Departamento de Ingenieria Electrica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Avenida Instituto Politecnico Nacional 2508, 07360, Mexico (Mexico)

    2015-12-15

    Semiconductors with isoelectronic centers are actively studied to fabricate arrays of identical single photon emitters. Self-assembling of 4N10In and 1N4In clusters in GaAs-rich In{sub x}Ga{sub 1-x}N{sub y}As{sub 1-y} is represented. All or almost all In atoms are in 4N10In clusters from 0 to 800 C in In{sub x}Ga{sub 1-x}N{sub y}As{sub 1-y} with x = 1 x 10{sup -4}, y = 1 x 10{sup -4} and x = 1 x 10{sup -5}, y = 1 x 10{sup -5}. All or almost all nitrogen atoms are in 1N4In clusters if x = 0.01, y = 1 x 10{sup -4} and x = 1 x 10{sup -3}, y = 1 x 10{sup -6}. There are both types of clusters in alloys with x = 5 x 10{sup -5}, y = 5 x 10{sup -7}; x = 2 x 10{sup -4}, y = 2 x 10{sup -6}; x = 1 x 10{sup -4}, y = 1 x 10{sup -5} and x = 2 x 10{sup -3}, y = 2 x 10{sup -4} and portions of nitrogen atoms in clusters depend on the composition and temperature. Thus, In{sub x}Ga{sub 1-x}N{sub y}As{sub 1-y} are promising semiconductors to obtain arrays of identical isoelectronic clusters with the desirable density. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Pressure effects in the giant magnetocaloric compounds Gd5(SixGe1-x)4

    International Nuclear Information System (INIS)

    Morellon, L; Arnold, Z; Algarabel, P A; Magen, C; Ibarra, M R; Skorokhod, Y

    2004-01-01

    We report a study of the effect of hydrostatic pressure up to 9 kbar on selected compounds of the Gd 5 (Si x Ge 1-x ) 4 series (x = 0.8, 0.45, 0.1) by means of ac magnetic susceptibility, compressibility, and linear thermal expansion measurements. The pressure-induced increase of the transition temperatures at the second-order boundaries of the phase diagram is rather moderate: dT C /dP ∼ +0.3Kk-bar -1 (x = 0.8) and dT N /P ∼+0.7Kkbar -1 (x = 0.1). This effect is stronger in the 0 C /dP ∼ +3 Kk-bar -1 (x = 0.45,0.1), indicating that the ferromagnetic ordering can be simultaneously driven through a pressure-induced structural transformation. The values of d lnT C /d lnV calculated with the use of the measured value of compressibility (k ∼1.8 M-bar -1 ) are significantly lower than those estimated from the concentration dependence of the lattice cell volume, thus demonstrating that the dependence of the transition temperatures upon changing the Si/Ge ratio across the series cannot be explained by a pure volume effect

  8. The structure and band gap design of high Si doping level Ag1xGa1xSixSe2 (x=1/2)

    International Nuclear Information System (INIS)

    Zhang, Shiyan; Mei, Dajiang; Du, Xin; Lin, Zheshuai; Zhong, Junbo; Wu, Yuandong; Xu, Jingli

    2016-01-01

    Ag 1x Ga 1x Si x Se 2 solutions with high Si doping level (x=1/2) are considered and new compound AgGaSiSe 4 has been synthesized. It crystallizes in space group Aea2 and possesses very long axis of a=63.06(1)Å. The three-dimensional framework in AgGaSiSe 4 is composed of AgSe 3 trigonal planar units, AgSe 4 tetrahedra and MSe 4 (M=Si, Ga) tetrahedra. AgGaSiSe 4 is a congruently melting compound with the melt temperature of 759 °C. The diffuse reflectance measurements reveal the band gap of 2.63 eV in AgGaSiSe 4 and the value is 0.33 eV larger than that of Ag 3 Ga 3 SiSe 8 (2.30 eV). - Graphical abstract: The Ag 1x Ga 1x Si x Se 2 with high Si doping level (x=1/2) has been studied and the new compound AgGaSiSe 4 was synthesized for the first time. AgGaSiSe 4 crystallizes in a new structure type in space group Aea2 and adopts a three-dimensional framework consisting of AgSe 3 trigonal planar units, AgSe 4 tetrahedra and MSe 4 (M=Si, Ge) tetrahedra. Display Omitted - Highlights: • Study of Ag 1x Ga 1x Si x Se 2 with high Si doping level (x=1/2). • Successful synthesis of new compound named AgGaSiSe 4 . • AgGaSiSe 4 crystallizes in space group Aea2 and adopts a three-dimensional framework. • The energy band gap of AgGaSiSe 4 is enlarged compared with Ag 3 Ga 3 SiSe 8 .

  9. Training Extract AFSC 51XX Computer Systems Officer AFPT 90-51X-468.

    Science.gov (United States)

    1983-06-01

    14 0 L53 MONITOR COMPLIANCE WITH TEST PR0CEDURES. PLANS OR CITERIA *30 9.T 2.2 ,4 .0 7 865 REVIEW TEST ANALYSIS REPORTS OR TEST ANALYSES .39 2.0 2.2...EL SSTIS DEVELOPMENT ’Fr:cEOS FCPTCS PAGE U A0MCIAT SAFOC IA ANDOLPA £r B TD ’C L T LT LT LT LT A a C E I rtI TITLES Cr. (mI ( 1 (M M) 42’ ENSUQE...TEST16 2. .01 3:7 5.I:3 1 7.1 3.9 3 .1 3.1 OCTERIE .METER TD SU: OPSLEASE AOP EQUIPMENT 1. 21.3 262 2. 3 a1. ZAk T1.1 I . -~ C38o EVALUATE VE N DOp OR

  10. X-ray structural studies and physicochemical characterization of (E)-6-(3,4-dimethoxyphenyl)-1-ethyl-4-mesitylimino-3-methyl- 3,4-dihydro-2(1H)-pyrimidinone polymorphs.

    Science.gov (United States)

    Miyamae, A; Kitamura, S; Tada, T; Koda, S; Yasuda, T

    1991-10-01

    The polymorphism of (E)-6-(3,4-dimethoxyphenyl)-1-ethyl-4-mesitylimino-3-methyl-3,4-di hydro- 2(1 H)-pyrimidinone (FK664; 1) was characterized by using X-ray powder diffractometry, differential scanning calorimetry (DSC), and IR spectroscopy. Structures of two polymorphs (Forms A and B) were determined by X-ray crystallographic analysis. Form A crystallized in the monoclinic space group P2(1)/c, with a = 13.504(2), b = 6.733(1), c = 24.910(8) A, beta = 96.55(4) degrees, z = 4, and dcal = 1.203 g/cm3, while Form B crystallized in the same space group, with a = 8.067(2), b = 15.128(4), c = 18.657(4) A, beta = 102.34(3) degrees, z = 4, and dcal = 1.216 g/cm3. The conformational features of 1 were very similar between the two polymorphs. Compound 1, in both crystal forms, took an energetically reasonable conformation in three rigid planes, such as 2-pyrimidone, trimethylphenyl, and dimethoxyphenyl rings, but the molecules were packed in different ways between the two polymorphs. In the Form B crystal, a short contact was possible, to form pi-pi interactions between two dimethoxyphenyl groups related with the inversion center in the crystal lattice; this interaction seems to contribute to stabilizing the crystal structure of Form B. Both Forms A and B showed only one endothermic peak due to fusion at 115 and 140 degrees C, respectively, on the DSC thermograms; therefore, it is suggested that there are no transition points between the two polymorphs. The heats of fusion obtained from the DSC thermograms were 33.2(2) kJ/mol for Form A and 36.8(1) kJ/mol for Form B.(ABSTRACT TRUNCATED AT 250 WORDS)

  11. Dielectric studies of Co3-xMnxO4 (x=0.1-1.0) cubic spinel multiferroic

    Science.gov (United States)

    Meena, P. L.; Kumar, Ravi; Prajapat, C. L.; Sreenivas, K.; Gupta, Vinay

    2009-07-01

    A series of Co3-xMnxO4 (x =0.1-1.0) multiferroic cubic spinel ceramics were prepared to study the effect of Mn substitution at Co site on the crystal structures and dielectric properties. No significant change in the structural symmetry was observed with increasing x up to 1.0. A linear increase in lattice parameter with x is attributed to the substitution of Co3+ by Mn3+ (large ionic radii) at the octahedral sites. An antiferromagnetic-type ordering of Co3O4 changes to ferrimagnetic-type order after incorporation of Mn. The effect of Mn substitution on the dielectric constant and loss tangent was studied over a wide range of frequency (75 kHz-5 MHz) and temperature of 150-450 K. The measured value of room temperature ac conductivity at 1.0 MHz was found to increase from 2.0×10-6 to 4.4×10-4 Ω-1 cm-1 and follows power law (σac=Aωs) behavior. The dielectric constant ɛ'(ω) shows a weak frequency dispersion and small temperature dependence below 250 K for all ceramic samples. However, a strong temperature and frequency dependence on ɛ'(ω) was observed at higher temperature (>250 K). The temperature dependent ɛ'(ω) data show the existence of room temperature ferroelectricity in all prepared samples.

  12. Preparation of Ba1-xSrxWO4 and Ba1-xCaxWO4 films on tungsten plate by mechanically assisted solution reaction at room temperature

    International Nuclear Information System (INIS)

    Rangappa, Dinesh; Fujiwara, Takeshi; Watanabe, Tomoaki; Yoshimura, Masahiro

    2008-01-01

    Preparation of the alkaline earth tungstate films such as Ba 1-x Sr x WO 4 and Ba 1-x Ca x WO 4 on the tungsten substrate was studied with a simple solution process assisted with the ball rotation at room temperature. The solid solution formation and limitations, the effect of oxidizing agent H 2 O 2 and alkaline earth ions concentration on the dissolution of W substrate and the growth of Ba 1-x Sr x WO 4 and Ba 1-x Ca x WO 4 films were studied in detail. The ball rotation assistance plays a very important role to enhance the dissolution of the W substrate and mass transport of the reactant species such as alkaline earth ions and WO 4 2- ions onto the solid/solution interface region, where precipitation occurs. Therefore, the rate of film formation was accelerated by the ball rotation assistance to the reaction system. Ba-rich Ba 1-x Sr x WO 4 and Ba 1-x Ca x WO 4 films were formed without high energy or high temperature treatment

  13. Dental Laboratory Career Ladder (AFSC 4Y1X1)

    Science.gov (United States)

    1994-08-01

    occlusions 8 H201 Arrange artificial teeth for monoplane occlusions 9 H202 Arrange artificial teeth for RPDs 10 H203 Arrange artificial teeth opposing natural ...remounting indices 7 H217 Fabricate overdentures for conventional abutments 8 H222 Fabricate teeth for RPDs using tooth-shaded acrylic 0011 ST0102 Medical...and arranging artificial teeth . Representative modules comprising the majority of job time for this cluster are listed below. Accompanying the TM

  14. Hydrothermal synthesis, thermal, structural, spectroscopic and magnetic studies of the Mn5-x Co x (HPO4)2(PO4)2(H2O)4 (x=1.25, 2, 2.5 and 3) finite solid solution

    International Nuclear Information System (INIS)

    Larrea, Edurne S.; Mesa, Jose L.; Pizarro, Jose L.; Arriortua, Maria I.; Rojo, Teofilo

    2007-01-01

    The Mn 5- x Co x (HPO 4 ) 2 (PO 4 ) 2 (H 2 O) 4 (x=1.25, 2, 2.5, 3) finite solid solution has been synthesized by mild hydrothermal conditions under autogeneous pressure. The phases crystallize in the C2/c space group with Z=4, belonging to the monoclinic system. The unit-cell parameters obtained from single crystal X-ray diffraction are: a=17.525(1), b=9.0535(6), c=9.4517(7) A, β=96.633(5) o being R1=0.0436, wR2=0.0454 for Mn75Co25; a=17.444(2), b=9.0093(9), c=9.400(1) A, β=96.76(1) o being R1=0.0381, wR2=0.0490 for Mn60Co40; a=17.433(2), b=8.9989(9), c=9.405(1) A, β=96.662(9) o being R1=0.0438, wR2=0.0515 for Mn50Co50 and a=17.4257(9), b=8.9869(5), c=9.3935(5) A, β=96.685(4) o being R1=0.0296, wR2=0.0460 for Mn40Co60. The structure consists of a three dimensional network formed by octahedral pentameric entities (Mn,Co) 5 O 16 (H 2 O) 6 sharing vertices with the (PO 4 ) 3- and (HPO 4 ) 2- tetrahedra. The limit of thermal stability of these compounds is, approximately, 165 deg. C, near to this mean temperature the phases loose their water content in two successive steps. IR spectra show the characteristic bands of the water molecules and the phosphate and hydrogen-phosphate oxoanions. The diffuse reflectance spectra are consistent with the presence of MO 6 octahedra environments in slightly distorted octahedral geometry, except for the M(3)O 6 octahedron which presents a remarkable distortion and so a higher Dq parameter. The mean value for the Dq and B-Racah parameter for the M(1),(2)O 6 octahedra is 685 and 850 cm -1 , respectively. These parameters for the most distorted M(3)O 6 polyhedron are 825 and 880 cm -1 , respectively. The four phases exhibit antiferromagnetic couplings as the major magnetic interactions. However, a small spin canting phenomenon is observed at low temperatures for the two phases with major content in the anisotropic-Co(II) cation. - Graphical abstract: Crystal structure of the finite solid solution Mn 5-x Co x (HPO 4 ) 2 (PO 4 ) 2 (H

  15. Hyperon polarisation in the reaction p-bar sup 1 sup 2 C -> LAMBDA-bar LAMBDA X

    CERN Document Server

    Pomp, S; Bröders, R; Bunker, B; Dennert, H; Eisenstein, R E; Eyrich, W; Fischer, H; Franklin, G; Franz, J; Geyer, R; Harris, P; Hauffe, J; Hertzog, D; Johansson, T; Jones, T; Kilian, K; Kraft, R A; Meyer, C; Oelert, W; Quinn, B; Röhrich, K; Rössle, E; Sachs, K; Schmitt, H; Schumacher, R; Sefzick, T; Stinzing, F; Tayloe, R; Todenhagen, R; Traneus, E; Wirth, S

    2000-01-01

    Data from the p-bar sup 1 sup 2 C -> LAMBDA-bar LAMBDA X reaction, collected by the PS185 experiment at antiproton momenta around 1.44 GeV/c, 1.66 GeV/c and 1.77 GeV/c, have been analyzed and the LAMBDA and LAMBDA-bar polarisations have been extracted. The events are classified as quasi-free or non-quasi-free and it is found that the polarisations for LAMBDA and LAMBDA-bar differ in the latter case. Such an effect comes from differences in the interaction of the outgoing LAMBDA and LAMBDA-bar with the residual nucleus and the measurement constitutes the first information on LAMBDA-bar interaction with nuclear matter.

  16. Crystal and molecular structures of benzo[4,5]imidazo[1,2-c]quinazolin-6-one and 10-carboxybenzo[4,5]imidazo[1,2-c]quinazolin-6-one: A quantum-chemical study of their tautomerism

    International Nuclear Information System (INIS)

    Koval’chukova, O. V.; Stash, A. I.; Strashnov, P. V.; Neborak, E. V.; Strashnova, S. B.; Zaitsev, B. E.

    2011-01-01

    Benzo[4,5]imidazo[1,2-c]quinazolin-6-one and 10-carboxybenzo[4,5]imidazo[1,2-c]quinazolin-6-one were isolated in the crystalline state and studied by X-ray diffraction. The crystal and molecular structures of these compounds were determined by X-ray diffraction. The energy characteristics of the tautomeric and ionic forms were calculated by the quantum-chemical PM3 method.

  17. Wavelengths of the Ni-like 4d1S0 - 4p1P1 x-ray laser line

    International Nuclear Information System (INIS)

    Li, Y.; Nilsen, J.; Dunn, J.; Osterheld, A.L.; Ryabtsev, A.; Churilov, S.

    1998-01-01

    We measure the wavelengths of the Ni-like 3d 9 4d 1 S 0 - 3d 9 4p 1 P 1 x-ray laser line in several low-Z Ni-like ions ranging from Y (Z=39) to Cd (Z=48). These wavelengths are compared with optimized level calculations using a multiconfiguration Dirac-Fock code. With the help of these results, we identify this line to very high accuracy in nonlasing plasmas from As (Z=33) to Mo (Z=42). Accurate values of these wavelengths are essential for performing plasma imaging and interferometry experiments with multilayer optics that use the x-ray laser to backlight other plasmas. These results also provide important atomic data that are currently missing about the energy of the 4d 1 S 0 level in the NiI sequence. copyright 1998 The American Physical Society

  18. Single-source-precursor synthesis of dense SiC/HfC(x)N(1-x)-based ultrahigh-temperature ceramic nanocomposites.

    Science.gov (United States)

    Wen, Qingbo; Xu, Yeping; Xu, Binbin; Fasel, Claudia; Guillon, Olivier; Buntkowsky, Gerd; Yu, Zhaoju; Riedel, Ralf; Ionescu, Emanuel

    2014-11-21

    A novel single-source precursor was synthesized by the reaction of an allyl hydrido polycarbosilane (SMP10) and tetrakis(dimethylamido)hafnium(iv) (TDMAH) for the purpose of preparing dense monolithic SiC/HfC(x)N(1-x)-based ultrahigh temperature ceramic nanocomposites. The materials obtained at different stages of the synthesis process were characterized via Fourier transform infrared (FT-IR) as well as nuclear magnetic resonance (NMR) spectroscopy. The polymer-to-ceramic transformation was investigated by means of MAS NMR and FT-IR spectroscopy as well as thermogravimetric analysis (TGA) coupled with in situ mass spectrometry. Moreover, the microstructural evolution of the synthesized SiHfCN-based ceramics annealed at different temperatures ranging from 1300 °C to 1800 °C was characterized by elemental analysis, X-ray diffraction, Raman spectroscopy and transmission electron microscopy (TEM). Based on its high temperature behavior, the amorphous SiHfCN-based ceramic powder was used to prepare monolithic SiC/HfC(x)N(1-x)-based nanocomposites using the spark plasma sintering (SPS) technique. The results showed that dense monolithic SiC/HfC(x)N(1-x)-based nanocomposites with low open porosity (0.74 vol%) can be prepared successfully from single-source precursors. The average grain size of both HfC0.83N0.17 and SiC phases was found to be less than 100 nm after SPS processing owing to a unique microstructure: HfC0.83N0.17 grains were embedded homogeneously in a β-SiC matrix and encapsulated by in situ formed carbon layers which acted as a diffusion barrier to suppress grain growth. The segregated Hf-carbonitride grains significantly influenced the electrical conductivity of the SPS processed monolithic samples. While Hf-free polymer-derived SiC showed an electrical conductivity of ca. 1.8 S cm(-1), the electrical conductivity of the Hf-containing material was analyzed to be ca. 136.2 S cm(-1).

  19. Are Nonadiabatic Reaction Dynamics the Key to Novel Organosilicon Molecules? The Silicon (Si(3P))-Dimethylacetylene (C4H6(X1A1g)) System as a Case Study.

    Science.gov (United States)

    Thomas, Aaron M; Dangi, Beni B; Yang, Tao; Kaiser, Ralf I; Lin, Lin; Chou, Tzu-Jung; Chang, Agnes H H

    2018-06-06

    The bimolecular gas phase reaction of ground-state silicon (Si; 3 P) with dimethylacetylene (C 4 H 6 ; X 1 A 1g ) was investigated under single collision conditions in a crossed molecular beams machine. Merged with electronic structure calculations, the data propose nonadiabatic reaction dynamics leading to the formation of singlet SiC 4 H 4 isomer(s) and molecular hydrogen (H 2 ) via indirect scattering dynamics along with intersystem crossing (ISC) from the triplet to the singlet surface. The reaction may lead to distinct energetically accessible singlet SiC 4 H 4 isomers ( 1 p8- 1 p24) in overall exoergic reaction(s) (-107 -20 +12 kJ mol -1 ). All feasible reaction products are either cyclic, carry carbene analogous silylene moieties, or carry C-Si-H or C-Si-C bonds that would require extensive isomerization from the initial collision complex(es) to the fragmenting singlet intermediate(s). The present study demonstrates the first successful crossed beams study of an exoergic reaction channel arising from bimolecular collisions of silicon, Si( 3 P), with a hydrocarbon molecule.

  20. Luminescent and structural properties of Zn_xMg_1_-_xWO_4 mixed crystals

    International Nuclear Information System (INIS)

    Krutyak, N.; Nagirnyi, V.; Spassky, D.; Tupitsyna, I.; Dubovik, A.; Belsky, A.

    2016-01-01

    The structural and luminescent properties of perspective scintillating Zn_xMg_1_-_xWO_4 mixed crystals were studied. The following characteristics were found to depend linearly on x value: the energy of several vibrational modes detected by Raman spectroscopy, the bandgap width deduced from the shift of the excitation spectrum onset of a self-trapped exciton (STE) emission, the position of thermally stimulated luminescence peaks. It is also shown that the thermal stability of the STE luminescence decreases gradually when x decreases. These data indicate that each Zn_xMg_1_-_xWO_4 mixed crystal is not a mixture of two constituents, but possesses its original crystalline structure, as well as optical and luminescent properties. - Highlights: • The structural and luminescent properties of Zn_xMg_1_-_xWO_4 were studied. • The energy of Raman modes, the bandgap width, TSL peak position linearly depend on x. • Each Zn_xMg_1_-_xWO_4 possesses its original crystalline structure.

  1. PHASE EVOLUTION AND MICROWAVE DIELECTRIC PROPERTIES OF (Li0.5Bi0.5)(W1-xMox)O4(0.0 ≤ x1.0) CERAMICS WITH ULTRA-LOW SINTERING TEMPERATURES

    Science.gov (United States)

    Zhou, Di; Guo, Jing; Yao, Xi; Pang, Li-Xia; Qi, Ze-Ming; Shao, Tao

    2012-11-01

    The (Li0.5Bi0.5)(W1-xMox)O4(0.0 ≤ x1.0) ceramics were prepared via the solid state reaction method. The sintering temperature decreased almost linearly from 755°C for (Li0.5Bi0.5)WO4 to 560°C for (Li0.5Bi0.5)MoO4. When the x≤0.3, a wolframite solid solution can be formed. For x = 0.4 and x = 0.6 compositions, both the wolframite and scheelite phases can be formed from the X-ray diffraction analysis, while two different kinds of grains can be revealed from the scanning electron microscopy and energy-dispersive X-ray spectrometer results. High performance of microwave dielectric properties were obtained in the (Li0.5Bi0.5)(W0.6Mo0.4)O4 ceramic sintered at 620°C with a relative permittivity of 31.5, a Qf value of 8500 GHz (at 8.2 GHz), and a temperature coefficient value of +20 ppm/°C. Complex dielectric spectra of pure (Li0.5Bi0.5)WO4 ceramic gained from the infrared spectra were extrapolated down to microwave range, and they were in good agreement with the measured values. The (Li0.5Bi0.5)(W1-xMox)O4(0.0 ≤ x1.0) ceramics might be promising for low temperature co-fired ceramic technology.

  2. Changing structural properties of mixed crystals [N(CH{sub 3}){sub 4}]{sub 2}Zn{sub 1-x}Co{sub x}Cl{sub 4} (x = 0, 0.5, 0.7, 0.9, and 1) by magic angle spinning nuclear magnetic resonance

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Ae Ran, E-mail: aeranlim@hanmail.net [Department of Science Education, Jeonju University, Jeonju 560-759 (Korea, Republic of); Department of Carbon Fusion Engineering, Jeonju University, Jeonju 560-759 (Korea, Republic of)

    2016-03-01

    Temperature dependences of the chemical shift and spin-lattice relaxation time in the rotating frame T{sub 1ρ} were measured for {sup 1}H and {sup 13}C nuclei in mixed crystals of the form [N(CH{sub 3}){sub 4}]{sub 2}Zn{sub 1-x} Co{sub x}Cl{sub 4} (x = 0, 0.5, 0.7, 0.9, and 1). The mixed crystals varied in color according to the amount of Co{sup 2+} ions, whereas the phase transition temperatures remained nearly unchanged. [N(CH{sub 3}){sub 4}]{sub 2}ZnCl{sub 4} and [N(CH{sub 3}){sub 4}]{sub 2}CoCl{sub 4} crystals contain two nonequivalent types of a-N(CH{sub 3}){sub 4} and b-N(CH{sub 3}){sub 4}. The two crystallographically different ions a-N(CH{sub 3}){sub 4} and b-N(CH{sub 3}){sub 4} were distinguished using {sup 13}C CP/MAS NMR spectroscopy. The NMR spectrum and T{sub 1ρ} for {sup 1}H and {sup 13}C in case of x = 0.5 and x = 0.7 were similar to those for [N(CH{sub 3}){sub 4}]{sub 2}ZnCl{sub 4}, whereas those for x = 0.9 were absolutely different. Additionally, [N(CH{sub 3}){sub 4}]{sub 2}Zn{sub 0.1}Co{sub 0.9}Cl{sub 4} exhibited the structural properties of both [N(CH{sub 3}){sub 4}]{sub 2}ZnCl{sub 4} and [N(CH{sub 3}){sub 4}]{sub 2}CoCl{sub 4}. - Highlights: • Chemical shift and spin-lattice relaxation time in rotating frame. • Two crystallographically different ions a-N(CH{sub 3}){sub 4} and b-N(CH{sub 3}){sub 4}. • Structural properties of mixed crystals.

  3. Chemical Constituents from Bombacopsis glabra (Pasq. A. Robyns: Complete 1H and 13C NMR Assignments and X Ray Structure of 5-Hydroxy-3,6,7,8,4'-pentamethoxyflavone

    Directory of Open Access Journals (Sweden)

    Paula Vanderlúcia F.

    2002-01-01

    Full Text Available The flavone 5-hydroxy-3,6,7,8,4'-pentamethoxyflavone (1 and the triterpenes lupenone, 9,19-cyclolanost-23-ene-3beta,25-diol (2, (24R-9,19-cyclolanost-25-ene-3beta,24-diol (3 and (24S-9,19-cyclolanost-25-ene-3beta,24-diol (4 were isolated from the hexane extract of the stem bark of Bombacopsis glabra (Bombacaceae. The structures were determined by 13C and ¹H NMR (1D and 2D and mass spectrometry, and by comparison with literature data for triterpenes. The structure of the flavone 1 was unambiguously confirmed by a X-ray diffraction study. The five substances were isolated for the first time from Bombacaceae species.

  4. X-ray and neutron single-crystal diffraction on [Rbx(NH4)1-x]3H(SO4)2. I. Refinement of crystal structure of phase II with x=0.11 at 300 K

    International Nuclear Information System (INIS)

    Loose, A.; Wozniak, K.; Dominiak, P.; Smirnov, L.S.; Natkaniec, I.; Frontas'eva, M.V.; Pomyakushina, E.V.; Baranov, A.I.; Dolbinina, V.V

    2006-01-01

    The study of [Rb x (NH 4 ) 1-x ] 3 H(SO 4 ) 2 mixed crystals by X-ray single-crystal diffraction is known up to now only for x=0.57 at the temperatures 293 and 180 K. The crystal structures at these temperatures as was determined [1] belong to monoclinic phase II (C2/c sp. gr., Z=4). In accordance with this work, ammonium ions should be considered as deformed tetrahedra. Monoclinic phase II on the x-T phase diagram of [Rb x (NH 4 ) 1-x ] 3 H(SO 4 ) 2 mixed crystals, which has earlier been determined by the dielectric spectroscopy, is stabilized below room temperature if Rb concentration exceeds 9%. The presented results of X-ray and neutron single-crystal diffraction of the [Rb 0.11 (NH 4 ) 0.89 ] 3 H(SO 4 ) 2 mixed crystal at T= 300 K show that ammonium ions could be considered as regular tetrahedra

  5. Tuning of superconductivity by Ni substitution into noncentrosymmetric ThC o1 -xN ixC2

    Science.gov (United States)

    Grant, T. W.; Cigarroa, O. V.; Rosa, P. F. S.; Machado, A. J. S.; Fisk, Z.

    2017-07-01

    The recently discovered noncentrosymmetric superconductor ThCoC2 was observed to show unusual superconducting behavior with a critical temperature of Tc=2.65 K . Here we investigate the effect of nickel substitution on the superconducting state in ThC o1 -xN ixC2 . Magnetization, resistivity, and heat capacity measurements demonstrate Ni substitution has a dramatic effect with critical temperature increased up to Tc=12.1 K for x =0.4 Ni concentration, which is a rather high transition temperature for a noncentrosymmetric superconductor. In addition, the unusual superconducting characteristics observed in pure ThCoC2 appear to be suppressed or tuned with Ni substitution towards a more conventional fully gapped superconductor.

  6. One-pot synthesis of 4,8-dibromobenzo[1,2-c;4,5-c']bis[1,2,5]thiadiazole.

    Science.gov (United States)

    Tam, Teck Lip; Li, Hairong; Wei, Fengxia; Tan, Ke Jie; Kloc, Christian; Lam, Yeng Ming; Mhaisalkar, Subodh G; Grimsdale, Andrew C

    2010-08-06

    A one-step synthesis of 4,8-dibromobenzo[1,2-c;4,5-c']bis[1,2,5]thiadiazole with use of 1,2,4,5-tetraaminobenzene tetrahydrobromide and thionyl bromide in good yield is reported. This unit can then be used in the synthesis of low bandgap materials via palladium-catalyzed coupling reactions. The approach offers a quick and easy way to prepare low bandgap materials as compared to the current literature methods.

  7. Magnetic ordering of Gd/sub x/Er/sub 1-x/Rh4B4 near the superconducting region

    International Nuclear Information System (INIS)

    Kohn, S.; Wang, R.H.; Smith, J.L.; Huang, C.Y.

    1979-01-01

    Gd/sub x/Er/sub 1-x/Rh 4 B 4 exhibits superconductivity at some critical temperature T/sub c/ followed by the onset of long-range ferromagnetic ordering at a lower temperature and a loss of superconductivity for x 2 Oe), the extrema in chi (T) and R(T) are depressed and smeared considerably with a corresponding shift in the temperature at which the extrema occur. (2) The sample is not superconducting down to 0.6 K. (3) In the presence of a dc magnetic field, a second ac chi peak appears at a slightly higher temperature. (4) The field dependence of the ac susceptibility resembles that of a spin glass. Details of the field dependence of these observations and the nature of these phenomena will be presented

  8. Luminescence and optical spectroscopy of charge transfer processes in solid solutions Ni{sub C}Mg{sub 1C}O and Ni{sub x}Zn{sub 1x}O

    Energy Technology Data Exchange (ETDEWEB)

    Sokolov, V.I., E-mail: visokolov@imp.uran.ru [Institute of Metal Physics, Russian Academy of Science, Ural Branch, S. Kovalevskaya Street 18, 620990 Yekaterinburg (Russian Federation); Pustovarov, V.A.; Churmanov, V.N. [Ural Federal University, Mira Street 19, 620002 Yekaterinburg (Russian Federation); Gruzdev, N.B.; Uimin, M.A.; Byzov, I.V.; Druzhinin, A.V. [Institute of Metal Physics, Russian Academy of Science, Ural Branch, S. Kovalevskaya Street 18, 620990 Yekaterinburg (Russian Federation); Mironova-Ulmane, N.A. [Institute of Solid State Physics, University of Latvia, Kengaraga Street 8, LV-1063 Riga (Latvia)

    2016-01-15

    In this work photoluminescence spectra for Ni{sub c}Mg{sub 1c}O and Ni{sub x}Zn{sub 1x}O solid solutions with the rock-salt crystal structure were obtained under synchrotron radiation excitation. Periodical peaks in the photoluminescence excitation spectrum of Ni{sub c}Mg{sub 1c}O (c=0.008) have been discovered for a wide-gap oxide doped with 3d impurities for the first time. They can be considered as LO phonon repetitions of the narrow zero phonon line resulted from the optical transitions into the p–d charge transfer exciton [d{sup 9}h] state. A close coincidence in energy of different peculiarities in the optical absorption and photoluminescence excitation spectra for the Ni{sub c}Mg{sub 1c}O and Ni{sub x}Zn{sub 1x}O solid solutions is due to the practically equal interatomic distances Ni–O in the investigated materials. The bulk of new experimental results is the trustworthy evidence that only the p–d charge transfer transitions manifest themselves in the spectral region of 3.5–6.5 eV. - Highlights: • Emission of Ni{sub c}Mg{sub 1c}O nanocystals excited by synchrotron radiation is obtained. • LO phonon repetitions have been observed in PLE spectra of Ni{sub c}Mg{sub 1c}O firstly for wide gap oxide materials doped with 3d impurities. • The [d{sup 9}h] acceptor exciton state in Ni{sub c}Mg{sub 1c}O (c=0.008) are indirectly revealed. • The begin of PLE spectra of Ni{sub x}Zn{sub 1x}O are not virtually shifted with a change of composition x. • The near energy coincidence of absorption peaks for nanocrystals NiO and single crystal Ni{sub c}Mg{sub 1c}O (c=0.0006) manifests itself.

  9. Mean-field theory for the Tsub(c2)-minimum in the phase diagram of Ersub(1-x)Hosub(x)Rh4B4

    International Nuclear Information System (INIS)

    Schuh, B.; Grewe, N.

    1981-01-01

    The experimentally observed shape of the phase boundary between the superconducting and the ferromagnetically ordered state in the reentrant ferromagnetic superconductor compound Ersub(1-x)Hosub(x)Rh 4 B 4 is explained within a simple Ginsburg-Landau mean field theory as resulting from a competition of two order parameters corresponding to the magnetic Ho- and Er-moments respectively. (author)

  10. Observation of e+e-→ϕ χc 1 and ϕ χc 2 at √{s }=4.600 GeV

    Science.gov (United States)

    Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bai, Y.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, P. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guo, A. Q.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, H. M.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jin, Y.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Khoukaz, A.; Kiese, P.; Kliemt, R.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuessner, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, K. J.; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Meng, Z. X.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Pitka, A.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rolo, M.; Rong, G.; Rosner, Ch.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, L.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, Meng; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhou, Y. X.; Zhu, J.; Zhu, J.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Besiii Collaboration

    2018-02-01

    Using a data sample collected with the BESIII detector operating at the BEPCII storage ring at a center-of-mass energy of √{s }=4.600 GeV , we search for the production of e+e-→ϕ χc 0 ,1 ,2 . A search is also performed for the charmonium-like state X (4140 ) in the radiative transition e+e-→γ X (4140 ) with X (4140 ) subsequently decaying into ϕ J /ψ . The processes e+e-→ϕ χc 1 and ϕ χc 2 are observed for the first time, each with a statistical significance of more than 10 σ , and the Born cross sections are measured to be (4. 2-1.0+1.7±0.3 ) and (6. 7-1.7+3.4±0.5 ) pb , respectively, where the first uncertainties are statistical and the second systematic. No significant signals are observed for e+e-→ϕ χc 0 and e+e-→γ X (4140 ) and upper limits on the Born cross sections at 90% C.L. are provided at √{s }=4.600 GeV .

  11. Synthesis of 1-(4-methylsulfone-phenyl)-5-(4-fluoro-phenyl)-5-[14C]-1,2,3- triazole and 1-(4-sulfonamide-phenyl)-5-(4-fluoro-phenyl)-5-[14C]-1,2,3- triazole as novel carbon-14 anticonvulsant

    International Nuclear Information System (INIS)

    Saemian, N.; Shirvani, G.; Matloubi, H.

    2006-01-01

    Two 1,2,3-triazole anticonvulsants, 1-(4-methylsulfone-phenyl)-5-(4-fluoro-phenyl)-5-[ 14 C]-1,2,3-triazole and 1-(4-sulfonamide-phenyl)-5-(4- fluoro-phenyl)-5-[ 14 C]-1,2,3-triazole, both labeled with carbon-14 in the 5-position were prepared from para-fluoro-benzonitrile-[cyano- 14 C]. (author)

  12. Atomistic Frictional Properties of the C(1002x1-H Surface

    Directory of Open Access Journals (Sweden)

    Paul M. Jones

    2013-01-01

    Full Text Available Density functional theory- (DFT- based ab initio calculations were used to investigate the surface-to-surface interaction and frictional behavior of two hydrogenated C(100 dimer surfaces. A monolayer of hydrogen atoms was applied to the fully relaxed C(1002x1 surface having rows of C=C dimers with a bond length of 1.39 Å. The obtained C(1002x1-H surfaces (C–H bond length 1.15 Å were placed in a large vacuum space and translated toward each other. A cohesive state at a surface separation of 4.32 Å that is stabilized by approximately 0.42 eV was observed. An increase in the charge separation in the surface dimer was calculated at this separation having a 0.04 e transfer from the hydrogen atom to the carbon atom. The Mayer bond orders were calculated for the C–C and C–H bonds and were found to be 0.962 and 0.947, respectively. σ C–H bonds did not change substantially from the fully separated state. A significant decrease in the electron density difference between the hydrogen atoms on opposite surfaces was seen and assigned to the effects of Pauli repulsion. The surfaces were translated relative to each other in the (100 plane, and the friction force was obtained as a function of slab spacing, which yielded a 0.157 coefficient of friction.

  13. The structure and band gap design of high Si doping level Ag{sub 1x}Ga{sub 1x}Si{sub x}Se{sub 2} (x=1/2)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Shiyan [College of Chemistry and Chemical Engineering, Shanghai University of Engineering Science, Shanghai 201620 (China); Mei, Dajiang, E-mail: meidajiang718@pku.edu.cn [College of Chemistry and Chemical Engineering, Shanghai University of Engineering Science, Shanghai 201620 (China); Du, Xin [Beijing National Laboratory for Molecular Sciences and State Key Laboratory of Rare Earth Materials Chemistry and Applications, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); Lin, Zheshuai [Center for Crystal Research and Development, Key Laboratory of Functional Crystals and Laser Technology, Chinese Academy of Sciences, Beijing 100190 (China); Zhong, Junbo [Key Laboratory of Green Catalysis of Higher Education Institutes of Sichuan, College of Chemistry and Pharmaceutical Engineering, Sichuan University of Science and Engineering, Zigong 643000 (China); Wu, Yuandong, E-mail: wuyuandong2013@outlook.com [College of Chemistry and Chemical Engineering, Shanghai University of Engineering Science, Shanghai 201620 (China); Xu, Jingli [College of Chemistry and Chemical Engineering, Shanghai University of Engineering Science, Shanghai 201620 (China)

    2016-06-15

    Ag{sub 1x}Ga{sub 1x}Si{sub x}Se{sub 2} solutions with high Si doping level (x=1/2) are considered and new compound AgGaSiSe{sub 4} has been synthesized. It crystallizes in space group Aea2 and possesses very long axis of a=63.06(1)Å. The three-dimensional framework in AgGaSiSe{sub 4} is composed of AgSe{sub 3} trigonal planar units, AgSe{sub 4} tetrahedra and MSe{sub 4}(M=Si, Ga) tetrahedra. AgGaSiSe{sub 4} is a congruently melting compound with the melt temperature of 759 °C. The diffuse reflectance measurements reveal the band gap of 2.63 eV in AgGaSiSe{sub 4} and the value is 0.33 eV larger than that of Ag{sub 3}Ga{sub 3}SiSe{sub 8} (2.30 eV). - Graphical abstract: The Ag{sub 1x}Ga{sub 1x}Si{sub x}Se{sub 2} with high Si doping level (x=1/2) has been studied and the new compound AgGaSiSe{sub 4} was synthesized for the first time. AgGaSiSe{sub 4} crystallizes in a new structure type in space group Aea2 and adopts a three-dimensional framework consisting of AgSe{sub 3} trigonal planar units, AgSe{sub 4} tetrahedra and MSe{sub 4} (M=Si, Ge) tetrahedra. Display Omitted - Highlights: • Study of Ag{sub 1x}Ga{sub 1x}Si{sub x}Se{sub 2} with high Si doping level (x=1/2). • Successful synthesis of new compound named AgGaSiSe{sub 4}. • AgGaSiSe{sub 4} crystallizes in space group Aea2 and adopts a three-dimensional framework. • The energy band gap of AgGaSiSe{sub 4} is enlarged compared with Ag{sub 3}Ga{sub 3}SiSe{sub 8}.

  14. Thermodynamics of the vaporization of non-stoichiometric thorium monocarbide ThC1±x

    International Nuclear Information System (INIS)

    Yamawaki, Michio; Koyama, Tadafumi; Takahashi, Yoichi

    1989-01-01

    Vaporization thermodynamics of thorium monocarbide phase ThC 1±x was studied by mass spectrometric Knudsen effusion method at the compositions of ThC 0.891 , ThC 0.975 , ThC 1.007 and ThC 1.074 . The partial vapor pressure of Th(g) and activities of Th and C in ThC 1±x were determined at 2060 to 2330 K. Gibbs energies of formation of ThC 1±x were also determined. Congruent vaporization composition of ThC 1±x was evaluated at 2300 K to be ThC 1.09 . Congruent vaporization and congruent effusing compositions were defined explicitly and their characteristics brought out. (orig.)

  15. Neutron single crystal diffraction studies of orientational glass state in the [Rbx(NH4)1-x]3H(SO4)2 mixed crystals

    International Nuclear Information System (INIS)

    Smirnov, L.S.; Reehuis, M.; Loose, A.; Hohlwein, D.; Hoffmann, J.U.; Wozniak, K.; Dominiak, P.; Baranov, A.I.; Dolbinina, V.V.

    2005-01-01

    The [Rb x (NH 4 ) 1-x ] 3 H(SO 4 ) 2 mixed crystal with the concentration x=0.0 at room temperature crystallizes in a monoclinic C2/c with sp.gr. (space group), which is stabilized for x>0.09 down to low temperatures. This system is transformed in the orientational glass state below the freezing temperature T g =30 K. The differential Fourier maps for the [Rb x (NH 4 ) 1-x ] 3 H(SO 4 ) 2 mixed crystals show that if for x=0.0 and 0.11 at 293 K the obtained maps reflect different orientational positions of crystallographically independent NH 4 (1) and NH 4 (2) groups, then the differential Fourier maps for x=0.20 at 9 K in the orientational glass state are similar for both ammonium groups reflecting their static disorder. The existence of the modulated structure in the [Rb x (NH 4 ) 1-x ] 3 H(SO 4 ) 2 mixed crystals with x=0.11 at 2 K is discovered, while the modulated structure for x=0.20 at 2 K is absent. This observation supposes that there should be two different regions of the orientational glass state on x-T phase diagram of the [Rb x (NH 4 ) 1-x ] 3 H(SO 4 ) 2 mixed crystals

  16. Crystal structure of 4,4′-bis[3-(piperidin-1-ylprop-1-yn-1-yl]-1,1′-biphenyl

    Directory of Open Access Journals (Sweden)

    Anqi Walbaum

    2017-06-01

    Full Text Available The title compound, C28H32N2, (I, is one of a second generation of compounds designed and synthesized based on a very potent and selective α9α10 nicotinic acetylcholine receptor antagonist ZZ161C {1,1′-[[1,1′-biphenyl]-4,4′-diylbis(prop-2-yne-3,1-diyl]bis(3,4-dimethylpyridin-1-ium bromide}, which has shown analgesic effects in a chemotherapy-induced neuropathy animal model. Compound (I was synthesized by the reaction of 4,4′-bis(3-bromoprop-1-yn-1-yl-1,1′-biphenyl with piperidine at room temperature in acetonitrile. The single-crystal used for X-ray analysis was obtained by dissolving (I in a mixture of dichloromethane and methanol, followed by slow evaporation of the solvent. In the crystal of (I, the biphenyl moiety has a twisted conformation, with a dihedral angle of 25.93 (4° between the benzene rings. Both piperidine head groups in (I are in the chair conformation and are oriented so that the N-atom lone pairs of each piperidine group point away from the central biphenyl moiety.

  17. Thermal, spectroscopic and magnetic properties of the Co xNi1-x(SeO3).2H2O (x = 0, 0.4, 1) phases

    International Nuclear Information System (INIS)

    Larranaga, A.; Mesa, J.L.; Pizarro, J.L.; Pena, A.; Chapman, J.P.; Arriortua, M.I.; Rojo, T.

    2005-01-01

    The Co x Ni 1-x (SeO 3 ).2H 2 O (x = 0, 0.4, 1) family of compounds has been hydrothermally synthesized under autogeneous pressure and characterized by elemental analysis, infrared and UV-vis spectroscopies and thermogravimetric and thermodiffractometric techniques. The crystal structure of Co 0.4 Ni 0.6 (SeO 3 ).2H 2 O has been solved from single-crystal X-ray diffraction data. This phase is isostructural with the M(SeO 3 ).2H 2 O (M = Co and Ni) minerals and crystallizes in the P2 1 /n space group, with a 6.4681(7), b = 8.7816(7), c = 7.5668(7) A, β = 98.927(9) deg and Z = 4. The crystal structure of this series of compounds consists of a three-dimensional framework formed by (SeO 3 ) 2- selenite oxoanions and edge-sharing M 2 O 10 dimeric octahedra in which the metallic cations are coordinated by the oxygens belonging to both the selenite groups and water molecules. The diffuse reflectance spectra show the essential characteristics of Co(II) and Ni(II) cations in slightly distorted octahedral environments. The calculated values of the Dq and Racah (B and C) parameters are those habitually found for the 3d 7 and 3d 8 cations in octahedral coordination. The magnetic measurements indicate the existence of antiferromagnetic interactions in all the compounds. The magnetic exchange pathways involve the metal orbitals from edge-sharing dimeric octahedra and the (SeO 3 ) 2- anions which are linked to the M 2 O 10 polyhedra in three dimensions

  18. Dicty_cDB: Contig-U06890-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 ) CLLX1301.b1_J13.ab1 CLL(XYZ) lettuce saligna Lact... 38 0.056 2 ( CX084866 ) EHABX22TR E. histolytica Normalized cDNA library...4-storage roo... 50 0.071 1 ( CX089593 ) EHAE127TR E. histolytica Normalized cDNA library...09.T7.185889.ab1 non-sporulating culture o... 54 0.005 1 ( EL926280 ) NY4ThAmp1_1...EST2947 Zea mays sperm cell cDNA library Zea mays... 38 0.21 2 ( BG320461 ) Zm03_10d10_A Zm03_AAFC_ECORC_cold_stre... ( AI438501 ) 486006A05.x4 486 - leaf primordia cDNA library fr... 38 0.21 2 ( AI861145 ) 603012G11.x1 603 - stressed root cDNA libra

  19. Influence of nickel doping on oxygen-ionic conductivity of the n = 1 Ruddlesden-Popper Phases La{sub 1.85}Ca{sub 0.15}(Cu{sub 1x}Ni{sub x})O{sub 4−δ} (δ = 0.0905)

    Energy Technology Data Exchange (ETDEWEB)

    Midouni, Adnene [Useful Materials Valorization Laboratory, National Centre of Research in Materials Science, Technologic Park of Borj Cedria, B.P. 73, 8027 Soliman (Tunisia); Université de Tunis El Manar, Campus Universitaire Farhat Hached, B.P. No 94- Rommana, 1068 Tunis (Tunisia); Houchati, Mohamed Ikbal, E-mail: ikb_med@yahoo.fr [Useful Materials Valorization Laboratory, National Centre of Research in Materials Science, Technologic Park of Borj Cedria, B.P. 73, 8027 Soliman (Tunisia); Unité de Recherche Catalyse et Matériaux pour l’Environnement et les Procédés URCMEP (UR11ES85), Faculté des Sciences de Gabès/Université de Gabès, Campus Universitaire Cité Erriadh, Gabès 6072 (Tunisia); Othman, Walid Belhaj [Laboratoire de Physico-Chimie des Matériaux Minéraux et leurs Applications, CNRSM, Technopole de Borj Cedria, B.P. 95, Hammam-Lif 2050 (Tunisia); Chniba-Boudjada, Nassira [Laboratoire de Cristallographie, CNRS, 25 Avenue des Martyrs, BP 166, 3804 Grenoble Cedex 9 (France); Ceretti, Monica; Paulus, Werner [Institut de Chimie Moléculaire et des Matériaux – UMR 5253 – ICG C2M: Chimie et Cristallochimie des Matériaux, Université de Montpellier 2, Case courrier 01504 Place Eugène Bataillon, Bat 15, F-34095 Montpellier cedex 5 (France); and others

    2016-08-15

    The results of the synthesis and characterization of the optimally doped La{sub 1.85}Ca{sub 0.15}(Cu{sub 1x}Ni{sub x})O{sub 4-δ} solid solution with x = 0, 0.1, 0.2 and 0.3 are reported. The versatility of these La{sub 1.85}Ca{sub 0.15}(Cu{sub 1x}Ni{sub x})O{sub 4−δ} materials is explained on the basis of structural features and the ability to accommodate oxygen nonstoichiometry. According to powder X-ray and neutron diffraction data, La{sub 1.85}Ca{sub 0.15}(Cu{sub 1x}Ni{sub x})O{sub 4−δ} adopts the tetragonal structure with oxygen vacancies occurring preferentially at the O{sub ap} sites within the {(La/Ca)O} layers of the perovskite blocks and the oxygen deviation from stoichiometry δ was found to be δ=0.0905(6). The bulk conductivity indicated an Arrhenius-type thermally activated process and oxygen vacancies are the possible ionic charge carriers at T=270 °C. An increase of the conductivity was detected when Ni was introduced. With nickel ratio variation, a strong correlation was observed between the Cu(Ni)-O{sub ap} apical bond length variation and the conductivity variation through controlling the O{sup 2−} ion migration. - Highlights: • We report the synthesis and structure of the La{sub 1.85}Ca{sub 0.15}(Cu{sub 1x}Ni{sub x})O{sub 4−δ} (0≤x≤0.3; δ=0.0905) compounds. • La{sub 1.85}Ca{sub 0.15}(Cu{sub 1x}Ni{sub x})O{sub 4−δ} (x=0.0, 0.2, 0.3) doped with Ni{sup 2+} have a higher conductivity than undoped La{sub 1.85}Ca{sub 0.15}CuO{sub 4−δ}. • At T=270 °C, sample x=0.3 has the highest conductivity (0.2915 sm{sup −1}).

  20. Ionic conductivity of LISICON solid solutions, Li 2+2 xZn 1- xGeO 4

    Science.gov (United States)

    Bruce, P. G.; West, A. R.

    1982-10-01

    The conductivity of LISICON γII-type solid solutions of general formula Li 2+2 xZn 1- xGeO 4 (-0.36 class of Li + ion conductors, was measured over the temperature range ˜25 to 300°C. Conductivities appear to be very composition dependent near the stoichiometric composition x = 0, but less so in the range 0.15 ≲ x ≲ 0.87. It is shown that interstitial Li + ions rather than cation vacancies give rise to high conductivities. The solid electrolyte properties and possible applications of the solid solutions are evaluated. The LISICON composition, x = 0.75, decomposes readily above ˜300°C by precipitation of Li 4GeO 4, thereby limiting its possible usefulness, but compositions in the range x = 0.45 to 0.55 appear to be stable at all temperatures. However, irreversible decreases in conductivity (aging effects) occur on annealing, even at room temperature. The conductivity data of quenched samples give linear Arrhenius plots, but with anomalously high prefactors, over the range ˜25 to 130°C; at higher temperatures reversible changes of slope to lower activation energies occur. A variety of minor polymorphic transitions occur on annealing γII solid solutions below ˜300°C and their relationship to the conductivity was also determined.

  1. A facile synthesis of Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C composites as cathode materials for lithium-ion batteries

    International Nuclear Information System (INIS)

    Yang, Rong; Wang, Liqing; Deng, Kunfa; Lv, Mengni; Xu, Yunhua

    2016-01-01

    The novel Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C has been successfully synthesized by a feasible solution process in ternary system. The spherical carbon-coated composites are obtained using a heat treatment in the presence of sucrose. X-ray diffraction (XRD) diffractogram displays that the Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C crystallized in an orthorhombic structure with a space group of Pmn21. The energy-dispersive X-ray spectroscopy mappings indicate that Fe, Mn and Ni elements are distributed homogenously in Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C nano-spherical particle with size less than 50 nm. The lithium storage capacity and cycling performance of the Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C presents good results when tested as cathode materials in lithium cells at room temperature. It delivers an initial discharge capacity of 181.4 mAh g"−"1 and a discharge capacity of 172.9 mAh g"−"1 after 20 cycles at 0.1C in the voltage range of 1.5–4.6V. Furthermore, it also exhibits an excellent rate capability with a capacity under different current densities of about 144.0 mAh g"−"1 (0.2 C), 117.9 mAh g"−"1 (0.5 C), 106.1 mAh g"−"1 (1 C), respectively and a good capacity cycling maintenance of 153.7 mAh g"−"1 after 60 cycles. Above results indicate that the spherical Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C becomes a very promising candidate for cathode material in lithium-ion batteries. - Highlights: • Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C was obtained by solution process in a ternary system. • The material was pure phase ternary solid solution with tetrahedral morphology. • The spherical particle size was less than 50 nm with graphitized carbon coating. • The nanocomposite revealed high discharge capacity and excellent rate capability.

  2. Air Traffic Control Officer AFSC 13MX OSSN 2335

    National Research Council Canada - National Science Library

    1999-01-01

    The Air Traffic Control Officer utilization field was surveyed to better understand the utilization of AFSC 1 3MX personnel, validate training requirements, empirically determine career progression...

  3. Polaronic transport and thermoelectricity in Fe1 -xCoxSb2S4 (x =0 , 0.1, and 0.2)

    Science.gov (United States)

    Liu, Yu; Kang, Chang-Jong; Stavitski, Eli; Du, Qianheng; Attenkofer, Klaus; Kotliar, G.; Petrovic, C.

    2018-04-01

    We report a study of Co-doped berthierite Fe1 -xCoxSb2S4 (x =0 , 0.1, and 0.2). The alloy series of Fe1 -xCoxSb2S4 crystallize in an orthorhombic structure with the Pnma space group, similar to FeSb2, and show semiconducting behavior. The large discrepancy between activation energy for conductivity, Eρ (146 ˜270 meV ), and thermopower, ES (47 ˜108 meV ), indicates the polaronic transport mechanism. Bulk magnetization and heat-capacity measurements of pure FeSb2S4 (x =0 ) exhibit a broad antiferromagnetic transition (TN=46 K ) followed by an additional weak transition (T*=50 K ). Transition temperatures (TN and T*) slightly decrease with increasing Co content x . This is also reflected in the thermal conductivity measurement, indicating strong spin-lattice coupling. Fe1 -xCoxSb2S4 shows relatively high value of thermopower (up to ˜624 μ V K-1 at 300 K) and thermal conductivity much lower when compared to FeSb2, a feature desired for potential applications based on FeSb2 materials.

  4. Synthesis of 11-14C-quetiapine, 11-14C-isoclotiapine and 10-(4-methylpiperazin-1-yl)pyrido[4,3-b][1,4]benzothiazepine[10-14C

    International Nuclear Information System (INIS)

    Naghi Saadatjoo; Mohsen Javaheri; Nuclear Science and Technology Research Institute, Tehran; Nader Saemian; Mohsen Amini

    2016-01-01

    Quetiapine is one of the most widely used antipsychotic drug which acts as an antagonist for multiple neurotransmitter receptor sites. 2-[2-(4-(Dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl)ethoxy]ethanol (quetiapine) labeled with carbon-14 in 11-position has been synthesized as part of a 5-step sequence from anthranilic acid-[carboxy- 14 C]. We have presented a convenient synthetic pathway for labeling of quetiapine with carbon-14 by using one-pot procedures from a key thiazepin-11(10H)-one-[11- 14 C] by good radiochemical yield. And also isoclotiapine[11- 14 C], and 10-(4-methylpiperazin-1-yl)pyrido[4,3-b][1,4]benzothiazepine[10- 14 C], synthesized according to this route. (author)

  5. α-Glucosidase inhibition and antioxidant activity of an oenological commercial tannin. Extraction, fractionation and analysis by HPLC/ESI-MS/MS and (1)H NMR.

    Science.gov (United States)

    Muccilli, Vera; Cardullo, Nunzio; Spatafora, Carmela; Cunsolo, Vincenzo; Tringali, Corrado

    2017-01-15

    Two batches of the oenological tannin Tan'Activ R, (toasted oak wood - Quercus robur), were extracted with ethanol. A fractionation on XAD-16 afforded four fractions for each extract. Extracts and fractions were evaluated for antioxidant activity (DPPH), polyphenol content (GAE) and yeast α-glucosidase inhibitory activity. Comparable results were obtained for both columns, fractions X1B and X2B showing the highest antioxidant activity. Fractions X1C and X2C notably inhibited α-glucosidase, with IC50=9.89 and 8.05μg/mL, respectively. Fractions were subjected to HPLC/ESI-MS/MS and (1)H NMR analysis. The main phenolic constituents of both X1B and X2B were a monogalloylglucose isomer (1), a HHDP-glucose isomer (2), castalin (3) gallic acid (4), vescalagin (5), and grandinin (or its isomer roburin E, 6). X1C and X2C showed a complex composition, including non-phenolic constituents. Fractionation of X2C gave a subfraction, with enhanced α-glucosidase inhibitory activity (IC50=6.15μg/mL), with castalagin (7) as the main constituent. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Pycnometric and Spectroscopic Studies of Red Phosphors Ca{sub (1-1.5x)}{sup 2+} WO{sub 4}:Eu{sub x}{sup 3+} Ca{sub (1}-{sub 2x)}{sup 2+} WO{sub 4}:Eu{sub x}{sup 3+},Na{sub x}{sup +}

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Seonwoog [Silla Univ., Busan (Korea, Republic of)

    2013-09-15

    Red phosphors Ca{sub (1-1.5x)}Eu{sub x}WO{sub 4} and Ca{sub (1-2x)}Eu{sub x}Na{sub x}WO{sub 4} were synthesized with various concentrations x of Eu{sup 3+} ions by using a solid-state reaction method. The crystal structure of the red phosphors were found to be a tetragonal scheelite structure with space group I4{sub 1}/a. X-ray diffraction (XRD) results show the (112) main diffraction peak centered at 2θ = 28.71 .deg., and indicate that there is no basic structural deformation caused by the vacancies V{sub Ca}'' or the Eu{sup 3+} (and Na{sup +}) ions in the host crystals. Densities of Ca{sub (1.1.5x)}Eu{sub x}WO{sub 4} were measured on a (helium) gas pycnometer. Comparative results between the experimental and theoretical densities reveal that Eu{sup 3+} (and Na{sup +}) ions replace the Ca{sup 2+} ions in the host CaWO{sub 4}. Also, the photoluminescence (PL) emission and photoluminescence excitation (PLE) spectra show the optical properties of trivalent Eu{sup 3+} ions, not of divalent Eu{sup 2+}. Raman spectra exhibit that, without showing any difference before and after the doping of activators to the host material CaWO{sub 4}, all the gerade normal modes occur at the identical frequencies with the same shapes and weaker intensities after the substitution. However, the FT-IR spectra show that some of the ungerade normal modes have shifted positions and different shapes, caused by different masses of Eu{sup 3+} ions (or Na{sup +} ions, or V{sub Ca}'' vacancies) from Ca2{sup +}.

  7. Novel protonated and hydrated n=1 Ruddlesden-Popper phases, HxNa1-xLaTiO4.yH2O, formed by ion-exchange/intercalation reaction

    International Nuclear Information System (INIS)

    Nishimoto, Shunsuke; Matsuda, Motohide; Miyake, Michihiro

    2005-01-01

    New derivatives of layered perovskite compounds with H 3 O + ions, H + ions and water molecules in the interlayer, H x Na 1-x LaTiO 4 .yH 2 O, were successfully synthesized by an ion-exchange/intercalation reaction with dilute HCl solution, using an n=1 member of Ruddlesden-Popper phase, NaLaTiO 4 . Powder X-ray diffraction revealed that the layered structure changed from space group P4/nmm with a=3.776(1) and c=13.028(5)A to I4/mmm with a=3.7533(3) and c=28.103(4)A after the ion-exchange/intercalation reaction at pH 5. The change of space group indicates that the perovskite layers are transformed from staggered to an eclipsed configuration through the ion-exchange/intercalation reaction. Thermogravimetric analysis and high-temperature powder X-ray diffraction suggested the existence of the secondary hydrated phase by dehydrating H x Na 1-x LaTiO 4 .yH 2 O at 100 o C

  8. Raman scattering, microstructural and dielectric studies on Ba{sub 1-x}Ca{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sunil; Kundu, Swarup [Materials Research Centre, Indian Institute of Science, Bangalore 560012 (India); Ochoa, D.A.; Garcia, J.E. [Department of Applied Physics, Universitat Politecnica de Catalunya, 08034 Barcelona (Spain); Varma, K.B.R., E-mail: kbrvarma@mrc.iisc.ernet.in [Materials Research Centre, Indian Institute of Science, Bangalore 560012 (India)

    2012-10-15

    Polycrystalline powders of Ba{sub 1-x}Ca{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} (where x = 0, 0.25, 0.50, 0.75 and 1) were prepared via the conventional solid-state reaction route. X-ray diffraction (XRD) and Raman scattering techniques have been employed to probe into the structural changes on changing x. XRD analyses confirmed the formation of monophasic bismuth layered structure of all the above compositions with an increase in orthorhombic distortion with increase in x. Raman spectra revealed a redshift in A{sub 1g} peak and an increase in the B{sub 2g}/B{sub 3g} splitting with increasing Ca content. The average grain size was found to increase with increasing x. The temperature of the maximum dielectric constant (T{sub m}) increased linearly with increasing Ca-content whereas the diffuseness of the phase transition was found to decrease with the end member CaBi{sub 4}Ti{sub 4}O{sub 15} showing a frequency independent sharp phase transition around 1048 K. Ca doping resulted in a decrease in the remnant polarization and an increase in the coercive field. Ba{sub 0.75}Ca{sub 0.25}Bi{sub 4}Ti{sub 4}O{sub 15} ceramics showed an enhanced piezoelectric coefficient d{sub 33} of 15 pC N{sup -1} at room temperature. Low values of dielectric losses and tunability of temperature coefficient of dielectric constant ({tau}{sub {epsilon}}) in the present solid-solution suggest that these compounds can be of potential use in microwave dielectrics at high temperatures. Highlights: Black-Right-Pointing-Pointer Ba{sub 1-x}Ca{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} (0 {<=} x {<=} 1) ceramics with four-layer Aurivillius structure were fabricated. Black-Right-Pointing-Pointer X-ray diffraction and Raman scattering techniques have been employed to probe into the structural changes on changing x. Black-Right-Pointing-Pointer Curie temperature (T{sub C}) was found to increase with increase in Ca-doping whereas the diffuseness of phase transition decreased. Black-Right-Pointing-Pointer Temperature

  9. SU(3)xSU(2) color symmetry and Usub(B)(1)xSUsub(f)(4) quark model of hadrons

    International Nuclear Information System (INIS)

    Khrushchov, V.V.

    1982-01-01

    A quark model with a generalized color group SUsub(c)(3)xSU'sub(c)(2) is treated in the framework of the SUsub(f)(4)xUsub(B)(1) symnetry of strong interactions. The model contains twelve standard u, d, s, c quarks and new quarks belonging to representation 6 of the SU(4) group. The properties of new quarks are considered with respect to the color group and some properties of the exotic states, predicted by the model are presented

  10. Synthesis and magnetic properties of ferrites spinels Mg{sub x}Cu{sub 1-x}Fe{sub 2}O{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Mounkachi, O.; Hamedoun, M. [Institute of Nanomaterials and Nanotechnology, MAScIR, Rabat (Morocco); Belaiche, M. [Institute of Nanomaterials and Nanotechnology, MAScIR, Rabat (Morocco); Hassan II Academy of Science and Technology, Rabat (Morocco); Laboratoire de Magnetisme, Materiaux Magnetiques, Microonde et Ceramique, Ecole Normale Superieure, Universite Mohammed V-Agdal, B.P. 9235, Ocean, Rabat (Morocco); Benyoussef, A. [Institute of Nanomaterials and Nanotechnology, MAScIR, Rabat (Morocco); Hassan II Academy of Science and Technology, Rabat (Morocco); LMPHE, (URAC 12), Faculte des Sciences, Universite Mohammed V-Agdal, Rabat (Morocco); Masrour, R. [Laboratory of Materials, Process, Environment and Quality, Cady Ayad University, National School of Applied Sciences, Safi (Morocco); El Moussaoui, H. [Institute of Nanomaterials and Nanotechnology, MAScIR, Rabat (Morocco); LMPHE, (URAC 12), Faculte des Sciences, Universite Mohammed V-Agdal, Rabat (Morocco); Sajieddine, M., E-mail: hamedoun@hotmail.com [Faculte des Sciences et Techniques, Universite Moulay Slimane, Beni Mellal (Morocco)

    2012-01-01

    Polycrystalline Mg{sub 0.6}Cu{sub 0.4}Fe{sub 2}O{sub 4} ferrites have been prepared using solid-state reaction technique. Their structural and magnetic properties have been studied, using X-ray diffraction and magnetic measurements. Using mean field theory and high-temperature series expansions (HTSE), extrapolated with the pade approximants method, the magnetic properties of Mg{sub 1-x}Cu{sub x}Fe{sub 2}O{sub 4} have been studied. The nearest neighbor super-exchange interactions for intra-site and inter-site of the Mg{sub 1-x}Cu{sub x}Fe{sub 2}O{sub 4} ferrites spinels, in the range 0{<=}x{<=}1, have been computed using the probability approach, based on Moessbauer data. The Curie temperature T{sub c} is calculated as a function of Mg concentration. The obtained theoretical results are in good agreement with experimental ones obtained by magnetic measurements.

  11. The crystal structure of a new ternary antimonide: TmCu4-xSb2 (x 1.065)

    International Nuclear Information System (INIS)

    Fedyna, L.O.; Bodak, O.I.; Fedorchuk, A.O.; Tokaychuk, Ya.O.

    2005-01-01

    The crystal structure of the new ternary compound TmCu 4-x Sb 2 (x 1.065) was determined by direct methods from X-ray powder data (diffractometer DRON-3M, Cu Kα-radiation). It crystallizes with the orthorhombic structure type ErFe 4 Ge 2 (low-temperature modification) and is the first representative of this structure type among known antimonides: space group Pnnm, Pearson code oP14-2.13, a = 7.00565(6) A, b = 7.83582(6) A, c = 4.25051(3) A, Z = 2. Investigated structure is an orthorhombically deformed derivative of the ZrFe 4 Si 2 structure type

  12. Synthesis and characterization of Sr{sub 1-x}Ba{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} ferroelectric materials

    Energy Technology Data Exchange (ETDEWEB)

    Xie Dan; Pan Wei; Shi Hui

    2003-05-25

    Sr{sub 1-x}Ba{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} (SBBT, x=0, 0.2, 0.5, 0.8, 1.0) was prepared by sol-gel method using the salts of strontium (Sr), barium (Ba), bismuth (Bi) and titanium butoxide as sources. The mechanism of hydrolysis and polymetric reaction of precursor solution and the influence of annealing condition on crystal structure and microstructure of SBBT ferroelectric materials were studied by infrared (IR) spectroscopy, X-ray diffraction (XRD), and scanning electron microscopy (SEM). The results of the analysis indicated the formation of stable sol-gel system for SBBT when pH value of the solution was about 3.5. The crystallization temperature of SBBT powder was about 700 deg. C and the particle size was about 100 nm.

  13. Synthesis and structural investigation of new Co1-xNixTeO4 (x = 0, 0.2, 0.5, 0.8 and 1) compounds

    Science.gov (United States)

    Patel, Akhilesh K.; Singh, Harishchandra; Suresh, K. G.

    2018-05-01

    The new polycrystalline compounds Co1-xNixTeO4 (x = 0, 0.2, 0.5, 0.8 and 1) were prepared by sol-gel method and their structural properties have been studied. Structural investigation through Rietveld method shows monoclinic structure with space group P21/c for all compounds. All compounds polyhedral structure found to be in octahedral form with cations (M) at the center and six oxygen atoms at corner of octahedral structure. The lattice parameters variation with Ni substitution are found to be decreasing with Ni substitution.

  14. Structure elucidation of 3-[1-(6-methoxy-2-naphtyl)ethyl]-6-(2,4-dichlorophenyl)-7H-1,2,4-triazolo[3,4-b]-1,3,4-thiadiazine, C23H18Cl2N4OS from synchrotron X-ray powder diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Gündoğdu, Gülsüm; Aytaç, Sevim Peri; Müller, Melanie; Tozkoparan, Birsen; Kaynak, Filiz Betül

    2017-12-01

    The 3-[1-(6-methoxy-2-naphtyl)ethyl]-6-(2,4-dichlorophenyl)-7H-1,2,4-triazolo[3,4-b]-1,3,4-thiadiazine, C23H18Cl2N4OS compound was synthesized, as a member of the family of novel potential anticancer agents. The structure of the title compound was characterized by IR,1H-NMR, mass spectroscopy, and elemental analysis, previously. In this study, the crystal structure of this compound has been determined from synchrotron X-ray powder diffraction data. The crystal structure was solved by simulated annealing and the final structure was achieved by Rietveld refinement method using soft restrains on all interatomic bond lengths and angles. This compound crystallizes in space groupP21,Z= 2, with the unit-cell parametersa= 15.55645(11) Å,b= 8.61693(6) Å,c= 8.56702(6) Å,β= 104.3270(4)°, andV= 1112.68(1) Å3. In the crystal structure, strong C-H∙∙∙πand weak intermolecular hydrogen-bonding interactions link the molecules into a three-dimensional network. The molecules are in a head-to-head arrangement in the unit cell.

  15. Efficient UV-emitting X-ray phosphors: octahedral Zr(PO4)6 luminescence centers in potassium hafnium-zirconium phosphates K2Hf1-xZrx(PO4)2 and KHf2(1-x)Zr2x(PO4)3

    International Nuclear Information System (INIS)

    Torardi, C.C.; Miao, C.R.; Li, J.

    2003-01-01

    Potassium hafnium-zirconium phosphates, K 2 Hf 1-x Zr x (PO 4 ) 2 and KHf 2(1-x) Zr 2x (PO 4 ) 3 , are broad-band UV-emitting phosphors. At room temperature, they have emission peak maxima at approximately 322 and 305 nm, respectively, under 30 kV peak molybdenum X-ray excitation. Both phosphors demonstrate luminescence efficiencies that make them up to ∼60% as bright as commercially available CaWO 4 Hi-Plus. The solid-state and flux synthesis conditions, and X-ray excited UV luminescence of these two phosphors are discussed. Even though the two compounds have different atomic structures, they contain zirconium in the same active luminescence environment as that found in highly efficient UV-emitting BaHf 1-x Zr x (PO 4 ) 2 . All the three materials have hafnium and zirconium in octahedral coordination via oxygen-atom corner sharing with six separate PO 4 tetrahedra. This octahedral Zr(PO 4 ) 6 moiety appears to be an important structural element for efficient X-ray excited luminescence, as are the edge-sharing octahedral TaO 6 chains for tantalate emission

  16. Thermal stability of Ni-Pt-Ta alloy silicides on epi-Si{sub 1-x}C{sub x}

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Jung-Ho; Chang, Hyun-Jin [Department of Ceramic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Min, Byoung-Gi [Department of Ceramic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Jusung Engineering Co., Ltd., 49, Neungpyeong-ri, Opo-eup, Gwangju-Si, Kyunggi-do 464-892 (Korea, Republic of); Ko, Dae-Hong [Department of Ceramic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of)], E-mail: dhko@yonsei.ac.kr; Cho, Mann-Ho [Institute of Physics and Applied Physics, Yonsei University, Seoul 120-749 (Korea, Republic of); Sohn, Hyunchul [Department of Ceramic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Lee, Tae-Wan [Jusung Engineering Co., Ltd., 49, Neungpyeong-ri, Opo-eup, Gwangju-Si, Kyunggi-do 464-892 (Korea, Republic of)

    2008-12-05

    We investigated the silicide formation in Ni/epi-Si{sub 1-x}C{sub x} systems. Ni-Pt and Ni-Pt-Ta films were deposited on epi-Si{sub 1-x}C{sub x}/Si substrates by DC magnetron sputtering and processed at various temperatures. The sheet resistance of the silicide from the Ni alloy/epi-Si{sub 1-x}C{sub x} systems was maintained at low values compared to that from Ni/Si systems. By TEM and EDS analyses, we confirmed the presence of a Pt alloy layer at the top of the Ni-silicide layer. The stability of the silicide layer in the Ni alloy/epi-Si{sub 1-x}C{sub x} system is explained by not only the Pt rich layer on the top of the Ni-silicide layer, but also by the presence of a small amount of Pt in the Ni-silicide layer or at the grain boundaries. And both the thermal stability and the morphology of silicide were greatly improved by the addition of Ta in Ni-Pt films.

  17. Structural, magnetic, and dielectric properties of multiferroic Co1xMgxCr2O4 nanoparticles

    International Nuclear Information System (INIS)

    Kamran, M.; Ullah, A.; Rahman, S.; Tahir, A.; Nadeem, K.; Anis ur Rehman, M.; Hussain, S.

    2017-01-01

    Highlights: • Properties of multiferroic Co 1x Mg x Cr 2 O 4 nanoparticles have been studied. • XRD showed that CoCr 2 O 4 and MgCr 2 O 4 are cubic normal spinel structure. • Rietveld refinement of XRD showed no impurity phases. • T c and T s showed decreasing trend with increasing Mg concentration. • Dielectric properties were improved for x = 0.6 Mg concentration. - Abstract: We examined the structural, magnetic, and dielectric properties of Co 1x Mg x Cr 2 O 4 nanoparticles with composition x = 0, 0.2, 0.4, 0.5, 0.6, 0.8 and 1 in detail. X-ray diffraction (XRD) revealed normal spinel structure for all the samples. Rietveld refinement fitting results of the XRD showed no impurity phases which signifies the formation of single phase Co 1x Mg x Cr 2 O 4 nanoparticles. The average crystallite size showed a peak behaviour with maxima at x = 0.6. Raman and Fourier transform infrared (FTIR) spectroscopy also confirmed the formation of single phase normal spinel for all the samples and exhibited dominant vibrational changes for x ≥ 0.6. For x = 0 (CoCr 2 O 4 ), zero field cooled/field cooled (ZFC/FC) magnetization curves showed paramagnetic (PM) to ferrimagnetic (FiM) transition at T c = 97 K and a conical spiral magnetic order at T s = 30 K. The end members CoCr 2 O 4 (x = 0) and MgCr 2 O 4 (x = 1) are FiM and antiferromagnetic (AFM), respectively. T c and T s showed decreasing trend with increasing x, followed by an additional AFM transition at T N = 15 K for x = 0.6. The system finally stabilized and changed to highly frustrated AFM structure at x = 1 due to formation of pure MgCr 2 O 4 . High field FC curves (5T) depicted nearly no effect on spiral magnetic state, which is attributed to strong exchange B-B magnetic interactions at low temperatures. Dielectric parameters showed a non-monotonous behaviour with Mg concentration and were explained with the help of Maxwell-Wagner model and Koop’s theory. Dielectric properties were improved for

  18. Structural Transition and Electrical Properties of (1 - x)(Na0.4K0.1Bi0.5)TiO3- xSrTiO3 Lead-Free Piezoceramics

    Science.gov (United States)

    Liu, Xing; Zhai, Jiwei; Shen, Bo; Li, Feng; Li, Peng

    2017-10-01

    (1 - x)(Na0.4K0.1Bi0.5)TiO3- xSrTiO3 (NKBT- xST) ceramics with x = 0 mol.%, 3 mol.%, and 5 mol.% (0ST, 3ST, and 5ST) have been prepared by a conventional solid-state reaction method and their ferroelectric, electrostrictive, and pyroelectric properties investigated. Addition of ST considerably disrupted the long-range ferroelectric order of NKBT- xST ceramics, and the 5ST ceramic exhibited ergodic relaxor phase structure. T FR shifted to near or below room temperature for 5ST ceramic, accompanied by a significant decline of ferroelectricity and enhanced strain. As the temperature approached T FR, the NKBT- xST ceramics exhibited predominantly electrostrictive effect, and the 5ST ceramic presented relatively high electrostrictive coefficient Q 33 of 0.0193 m4/C2. High pyroelectric response was observed for 0ST, 3ST, and 5ST ceramics in the vicinity of T FR due to the large polarization release during the ferroelectric-relaxor structural transition. The 5ST ceramic exhibited high and frequency-insensitive (100 Hz to 10 kHz) room-temperature pyroelectric properties with pyroelectric coefficient p of 656 μC m-2 K-1 and figures of merit F i, F v, and F d reaching 233 pm/V, 0.013 m2/C, and 7.61 μPa-1/2, respectively, indicating that 5ST ceramic is a promising candidate to replace PZT-based ceramics.

  19. Extracting performance of cesium by 25,27-bis (2-propyloxy) calix[4]-26,28-crown-6 (iPr-C[4]C-6) in n-octanol

    International Nuclear Information System (INIS)

    Jianchen Wang; Xiaowen Zhu; Chongli Song

    2005-01-01

    In this work, the extraction of cesium (Cs + ) in nitric acid and in a simulated high level liquid waste (HLLW) by iPr-C[4]C-6 was investigate in the dilluent n-octanol. The slope of the extractant dependency equals 1, indicating that the complex has 1:1[Cs + .iPr-C[4]C-6]Cs + to ligand. 0.025mol/L iPr-C[4]C-6 in n-octanol (abbreviated to iPr-C[4]C-6-n-octanol) has a stronger extracting ability to Cs when acidities are between 1.0mol/L and 4.0mol/L. The stripping properties of Cs loading in 0.025mol/L iPr-C[4]C-6-n-octanol was studied. Cs loading in iPr-C[4]C-6-n-octanol can be stripped easily into the aqueous phase because the distribution ratios of Cs are lower than 0.5 when pH is between 2 and 10 in the aqueous phase. On above basis, the better parameters were selected and the cold cascade test for removing Cs from the simulated HLLW was investigated on miniature centrifugal contactors. The results of the test are attractive. The removing ratio of Cs from the simulated HLLW is 99.5% and the stripping ratio of Cs loading in 0.025mol/L iPr-C[4]C-6-n-octanol is 99.2%. The results show that 0.025mol/L iPr-C[4]C-6-n-octanol is an effective process for removing Cs from HLLW. (author)

  20. V3-independent competitive resistance of a dual-X4 HIV-1 to the CXCR4 inhibitor AMD3100.

    Directory of Open Access Journals (Sweden)

    Yosuke Maeda

    Full Text Available A CXCR4 inhibitor-resistant HIV-1 was isolated from a dual-X4 HIV-1 in vitro. The resistant variant displayed competitive resistance to the CXCR4 inhibitor AMD3100, indicating that the resistant variant had a higher affinity for CXCR4 than that of the wild-type HIV-1. Amino acid sequence analyses revealed that the resistant variant harbored amino acid substitutions in the V2, C2, and C4 regions, but no remarkable changes in the V3 loop. Site-directed mutagenesis confirmed that the changes in the C2 and C4 regions were principally involved in the reduced sensitivity to AMD3100. Furthermore, the change in the C4 region was associated with increased sensitivity to soluble CD4, and profoundly enhanced the entry efficiency of the virus. Therefore, it is likely that the resistant variant acquired the higher affinity for CD4/CXCR4 by the changes in non-V3 regions. Taken together, a CXCR4 inhibitor-resistant HIV-1 can evolve using a non-V3 pathway.

  1. Thermodynamics, dielectric permittivity and phase diagrams of the Rb1-x(NH4xH2PO4 type proton glasses

    Directory of Open Access Journals (Sweden)

    S.I. Sorokov

    2010-01-01

    Full Text Available The cluster pseudospin model of proton glasses, which takes into account the energy levels of protons around the PO4 group, the long-range interactions between the hydrogen bonds, and an internal random deformational field is used to investigate thermodynamical characteristics, longitudinal and transverse dielectric permittivities of Rb1-x(ND4xD2PO4 and Rb1-x(NH4xH2AsO4 compounds. A review of experimental and theoretical works on the Rb1-x(NH4xH2PO4 type crystals is presented.

  2. Synthesis and characterization of perovskite-type La1-yCayMn1-xB″xO3±δ nanomaterials (B″ = Ni, Fe; x = 0.2, 0.5; y = 0.4, 0.25)

    Science.gov (United States)

    Franke, Daniela; Trots, Dmytro; Vasylechko, Leonid; Vashook, Vladimir; Guth, Ulrich

    2018-02-01

    Perovskite-type nanomaterials of the compositions La1-yCayMn1-xB″xO3±δ with B'' = Ni, Fe; x = 0.2, 0.5 and y = 0.4, 0.25 were prepared using two different preparation routes (synthesis by precipitation and the PVA/sucrose method) at 500 °C-700 °C. The calcined products of the syntheses were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), energy-dispersive X-ray spectroscopy (EDX) and physisorption measurements. The materials from the PVA/sucrose method contain particles with diameters from 33 nm to 48 nm, generate specific surface areas up to 33 m2/g and form pure compared to 45 nm-93 nm and up to 18 m2/g from precipitation method which contain a significant amount of sodium ions. The agglomeration process was analyzed for one nanomaterial (B'' = Fe, x = 0.2, y = 0.4) from the PVA/sucrose method using temperature dependent XRD showing only a slight growth (4.3%) of nanoparticles at 600 °C. The materials from the PVA/sucrose method turned out to be more suitable as electrode materials in electrochemical applications (SOFC, sensors) because of smaller particle sizes, higher specific surface areas and purity.

  3. Luminescence properties of LiPrxCe1-xP4O12

    International Nuclear Information System (INIS)

    Shalapska, T.; Stryganyuka, G.; Trotsc, D.; Demkiv, T.; Gektin, A.; Voloshinovskii, A.; Dorenbos, P.

    2010-01-01

    LiPr 1-x Ce x P 4 O 12 (x=0, 0.002, 0.02; 0.1) powder samples were prepared using the melt solution technique. Luminescent parameters of LiPr 1-x Ce x P 4 O 12 phosphors have been investigated under ultraviolet-vacuum ultraviolet (3-12 eV) synchrotron radiation and X-rays excitation at room and near liquid He temperatures. Excitation luminescence spectra of Ce 3+ emission, luminescent spectra and decay curves from the lower excited state levels of the 4f 1 5d 1 and 5d 1 electronic configuration of the Pr 3+ and Ce 3+ , respectively, clearly indicate energy transfer from Pr 3+ to Ce 3+ . Energy migration proceeds via the Pr-sublattice followed by nonradiation transfer from Pr 3+ to Ce 3+ ions.

  4. Synthesis of 1,2,4-Triazoles via Oxidative Heterocyclization: Selective C-N Bond Over C-S Bond Formation.

    Science.gov (United States)

    Gogoi, Anupal; Guin, Srimanta; Rajamanickam, Suresh; Rout, Saroj Kumar; Patel, Bhisma K

    2015-09-18

    The higher propensity of C-N over C-S bond forming ability was demonstrated, through formal C-H functionalization during the construction of 4,5-disubstituted 1,2,4-triazole-3-thiones from arylidenearylthiosemicarbazides catalyzed by Cu(II). However, steric factors imparted by the o-disubstituted substrates tend to change the reaction path giving thiodiazole as the major or an exclusive product. Upon prolonging the reaction time, the in situ generated thiones are transformed to 4,5-disubstituted 1,2,4-triazoles via a desulfurization process. Two classes of heterocycles viz. 4,5-disubstituted 1,2,4-triazole-3-thiones and 4,5-disubstituted 1,2,4-triazoles can be synthesized from arylidenearylthiosemicarbazides by simply adjusting the reaction time. Desulfurization of 1,2,4-triazole-3-thiones is assisted by thiophilic Cu to provide 1,2,4-triazoles with concomitant formation of CuS and polynuclear sulfur anions as confirmed from scanning electron microscope and energy dispersive X-ray spectroscopy measurements. A one-pot synthesis of an antimicrobial compound has been successfully achieved following this strategy.

  5. The influence of Bi content on dielectric properties of Bi4xTi3O12–1.5x ceramics

    Directory of Open Access Journals (Sweden)

    Hui Gong

    2017-06-01

    Full Text Available A kind of lead-free dielectric materials, such as the bismuth layered perovskite-type structure of Bi4xTi3O12–1.5x (x=0.04,0.02,0,–0.02,–0.04, was prepared by the conventional solid-state method at 800∘C and sintered at 1100∘C. The variation of structure and electrical properties with different Bi concentration was studied. All the Bi4xTi3O12–1.5x (x=0.04,0.02,0,–0.02,–0.04 samples exhibited a single structured phase. SEM could be a better approach to present the microstructure of Bi4xTi3O12–1.5x (x=0.04,0.02,0,–0.02,–0.04 ceramics. It could be found that the grain size of Bi4.02Ti3O12.03 sintered at 1100∘C was smaller than that of others among the five samples through grain size mechanics. Through impedance spectra analysis, we knew, when the Bi content was fixed, that the dielectric constant and the loss values increased with the decrease of frequency. The Curie temperature of the five samples was about 670∘C. In particular, while at the frequency of 100kHz, the lowest loss was 0.001 when Bi content was 3.98. The Bi4.02Ti3O12.03 ceramics with the minimum grain size had highest dielectric constant and the relatively low loss. Due to its high Curie temperature, high permittivity and low loss, the Bi4Ti3O12 (BIT ceramics have a broad application prospect in high density memory, generator, sensor, ferroelectric tunnel junctions and so on.

  6. Thermomagnetic properties of Co1-x Zn x Fe2O4 (x=0.1-0.5) nanoparticles

    International Nuclear Information System (INIS)

    Arulmurugan, R.; Vaidyanathan, G.; Sendhilnathan, S.; Jeyadevan, B.

    2006-01-01

    Ultra fine particles of Co 1- x Zn x Fe 2 O 4 with stoichiometric proportion (x) varying from 0.1 to 0.5 were prepared by the usual co-precipitation method. The preparation procedure favored the formation of complex Co-Zn-substituted ferrite nanoparticles. The particles were characterized by XRD. The particle size was calculated by using the Debye-Scherrer formula. The size of the particles precipitated was less than 12 nm. Thermal studies were carried out using simultaneous TG-DTA studies. TG-DTA studies confirmed the presence of associated water content in the precipitated nanoparticles and indicated that ferritization was complete. The temperature-dependent magnetization was recorded at two different fields (5 and 1 kOe). Curie temperature of the powder samples was calculated by extrapolating the linear part of the temperature-dependent magnetization data measured at 1 kOe. Thermomagnetic coefficient which is the first derivative of the temperature-dependent magnetization curve help us in understanding the redistribution of cations between the A and B sites, taking place during the process of heating in the case of nanoparticles. The temperature at which cation redistribution takes place depends on the zinc concentration. From the value of thermomagnetic coefficient and the temperature range, where k T is maximum, it is clear that Co 0.5 Zn 0.5 Fe 2 O 4 particles can be used for the preparation of temperature-sensitive ferrofluid

  7. Structural, magnetic, and dielectric properties of multiferroic Co{sub 1x}Mg{sub x}Cr{sub 2}O{sub 4} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Kamran, M.; Ullah, A. [Nanomagnetism and Nanotechnology Laboratory, International Islamic University, Islamabad 44000 (Pakistan); Rahman, S. [Department of Material Science and Engineering, University of Science and Technology of China Hefei, Anhui 230026 (China); Tahir, A. [Department of Physics, Quaid-e-Azam University, Islamabad 44000 (Pakistan); Nadeem, K., E-mail: kashif.nadeem@iiu.edu.pk [Nanomagnetism and Nanotechnology Laboratory, International Islamic University, Islamabad 44000 (Pakistan); Beijing National Laboratory for Condensed Matter Physics, National Laboratory for Superconductivity, Institute of Physics, Chinese Academy of Sciences, P.O. Box 603, Beijing 100190 (China); Anis ur Rehman, M. [Applied Thermal Physics Laboratory, Department of Physics, COMSATS Institute of Information Technology, Islamabad 44000 (Pakistan); Hussain, S. [Magnetism Laboratory, Department of Physics, COMSATS Institute of Information Technology, Islamabad 44000 (Pakistan)

    2017-07-01

    Highlights: • Properties of multiferroic Co{sub 1x}Mg{sub x}Cr{sub 2}O{sub 4} nanoparticles have been studied. • XRD showed that CoCr{sub 2}O{sub 4} and MgCr{sub 2}O{sub 4} are cubic normal spinel structure. • Rietveld refinement of XRD showed no impurity phases. • T{sub c} and T{sub s} showed decreasing trend with increasing Mg concentration. • Dielectric properties were improved for x = 0.6 Mg concentration. - Abstract: We examined the structural, magnetic, and dielectric properties of Co{sub 1x}Mg{sub x}Cr{sub 2}O{sub 4} nanoparticles with composition x = 0, 0.2, 0.4, 0.5, 0.6, 0.8 and 1 in detail. X-ray diffraction (XRD) revealed normal spinel structure for all the samples. Rietveld refinement fitting results of the XRD showed no impurity phases which signifies the formation of single phase Co{sub 1x}Mg{sub x}Cr{sub 2}O{sub 4} nanoparticles. The average crystallite size showed a peak behaviour with maxima at x = 0.6. Raman and Fourier transform infrared (FTIR) spectroscopy also confirmed the formation of single phase normal spinel for all the samples and exhibited dominant vibrational changes for x ≥ 0.6. For x = 0 (CoCr{sub 2}O{sub 4}), zero field cooled/field cooled (ZFC/FC) magnetization curves showed paramagnetic (PM) to ferrimagnetic (FiM) transition at T{sub c} = 97 K and a conical spiral magnetic order at T{sub s} = 30 K. The end members CoCr{sub 2}O{sub 4} (x = 0) and MgCr{sub 2}O{sub 4} (x = 1) are FiM and antiferromagnetic (AFM), respectively. T{sub c} and T{sub s} showed decreasing trend with increasing x, followed by an additional AFM transition at T{sub N} = 15 K for x = 0.6. The system finally stabilized and changed to highly frustrated AFM structure at x = 1 due to formation of pure MgCr{sub 2}O{sub 4}. High field FC curves (5T) depicted nearly no effect on spiral magnetic state, which is attributed to strong exchange B-B magnetic interactions at low temperatures. Dielectric parameters showed a non-monotonous behaviour with

  8. In vitro anti-Candida activity and single crystal X-ray structure of ({(1E-[3-(1H-imidazol-1-yl-1-phenylpropylidene]amino}oxy(4-nitrophenylmethanone

    Directory of Open Access Journals (Sweden)

    Mohamed I. Attia

    2014-03-01

    Full Text Available Synthesis, characterization, and anti-Candida activity of ({(E-[3-(1H-imidazol-1-yl-1-phenylpropylidene]amino}oxy(4-nitrophenylmethanone (4 are repor-ted. Compound 4 showed anti-Candida albicans activity (MIC = 0.6862 µmol/mL being nearly 5-fold more potent than the gold standard antifungal drug, fluconazole (MIC ˃ 3.265 µmol/mL, on the clinical isolates of Candida albicans. Single crystal X-ray structure of the title compound 4 confirmed its assigned (E-configuration. The compound crystallizes in the triclinic, P-1 (no. 2, a = 6.4633 (1 Å, b = 11.1063 (2 Å, c = 12.9872 (2 Å, α = 67.650 (1°, β = 86.415 (1°, γ = 86.776 (1°, V = 860.01 (3Å3, Z = 2, R(F = 0.046, wR(F2 = 0.139, T = 296 K. The crystal structure is stabilized by weak intermolecular C—H•••O hydrogen interactions.

  9. Luminescence properties of LiSr2Y1-xLnxO4 (Ln=Eu,Tb,Tm) (0≤x≤1)

    International Nuclear Information System (INIS)

    Kubota, S.; Suzuyama, Y.; Yamane, H.; Shimada, M.

    1998-01-01

    Investigations of the luminescence properties of LiSr 2 Y 1-x Eu x O 4 , LiSr 2 Y 1-x Tb x O 4 and LiSr 2 Y 1-x Tm x O 4 (0≤x≤1) at room temperature are reported. These samples were synthesized by a solid state reaction. The excitation spectra of Tb 3+ emission in LiSr 2 Y 1-x Tb x O 4 (0≤x≤1) consist of broad bands corresponding to a transition between the 4f 8 and 4f 7 5d 1 states of Tb 3+ . The maximum intensity is situated at about 318 nm. This is at a much longer wavelength than those of other Tb 3+ doped phosphors. This is explained by a large offset of the adiabatic potential curve of the 4f 7 5d 1 state. (orig.)

  10. New process of preparation, X-ray characterisation, structure and vibrational studies of a solid solution LiTiOAs 1-xP xO 4 (0⩽ x⩽1)

    Science.gov (United States)

    Chakir, M.; El Jazouli, A.; Chaminade, J. P.; Bouree, F.; de Waal, D.

    2006-01-01

    LiTiOAs 1-xP xO 4 (0⩽ x⩽1) compounds have been prepared using solutions of Li, Ti, As and P elements as starting products. Selected compositions have been investigated by powder X-ray or neutrons diffraction analysis, Raman and infrared spectroscopy. The structure of LiTiOAs 1-xP xO 4 ( x=0, 0.5 and 1) samples determined by Rietveld analysis is orthorhombic with Pnma space group. It is formed by a 3D network of TiO 6 octahedra and XO 4 ( X=As 1-xP x) tetrahedra where octahedral cavities are occupied by lithium atoms. TiO 6 octahedra are linked together by corners and form infinite chains along a-axis. Ti atoms are displaced from the centre of octahedral units in alternating short (1.700-1.709 Å) and long (2.301-2.275 Å) Ti-O bonds. Raman and infrared studies confirm the existence of Ti-O-Ti chains. Thermal stability of LiTiOAsO 4 has been reported.

  11. SISTEMA DE CROMOSSOMOS SEXUAIS MÚLTIPLOS X1X1X2X2/X1X2Y NA MOSCA-DAS-FRUTAS Anastrepha sororcula (DIPTERA: TEPHRITIDAE

    Directory of Open Access Journals (Sweden)

    Inês Regina de Araújo Moura Cunha

    2014-08-01

    Full Text Available Sistemas de cromossomos sexuais simples estão difundidos entre os Tephritidae do gênero Anastrepha. Espécies deste gênero apresentam enorme importância pelo impacto que causam em frutíferas cultivadas, sobretudo no nordeste do Brasil. Análises citogenéticas desenvolvidas em Anastrepha sororcula, através da análise da estrutura cariotípica e bandamento C revelaram a presença de um sistema de cromossomos sexuais múltiplos do tipo X1X1X2X2/X1X2Y nesta espécie. Enquanto as fêmeas apresentam um cariótipo homomórfico com 2n=12, os machos possuem 2n=11, onde se destaca um grande cromossomo Y despareado. O nível de divergência cariotípica da espécie A. sororcula do nordeste, com a presença de um sistema de cromossomos sexuais múltiplos, em relação às regiões central e sudeste do Brasil, podem indicar a ocorrência de impedimentos reprodutivos entre os exemplares das duas áreas e que possivelmente, como outros exemplos que existem neste gênero, A. sororcula constitua um complexo de espécies ainda não inteiramente definido. Palavras-chave: Alossomos, peste agrícola, citogenética de insetos, heterocromatina. DOI: http://dx.doi.org/10.18561/2179-5746/biotaamazonia.v4n2p1-4

  12. Aggregation behavior of gemini pyrrolidine-based ionic liquids 1,1'-(butane-1,4-diyl)bis(1-alkylpyrrolidinium) bromide ([C(n)py-4-C(n)py][Br2]) in aqueous solution.

    Science.gov (United States)

    Zhang, Shaohua; Yan, Han; Zhao, Mingwei; Zheng, Liqiang

    2012-04-15

    Three gemini pyrrolidine-based ionic liquids, 1,1'-(butane-1,4-diyl)bis(1-alkylpyrrolidinium) bromide ([C(n)py-4-C(n)py][Br(2)], n=10, 12, 14), were synthesized. Their aggregation behavior in aqueous solution was systematically investigated by surface tension, electrical conductivity, and steady-state fluorescence. Compared with their corresponding monomers, N-alkyl-N-methylpyrrolidinium bromide (C(n)MPB), [C(n)py-4-C(n)py][Br(2)], have higher surface activity. The special structure of [C(n)py-4-C(n)py][Br(2)] that has a spacer in their hydrophilic head groups results in a lower surface excess concentration (Γ(max)) and a larger molecular cross-sectional area (A(min)). Electrical conductivity studies show a lower degree of counter-ion binding to the aggregates. A smaller aggregation number (N(agg)) is observed by the pyrene fluorescence quenching method. A series of thermodynamic parameters (ΔG(agg)(0),ΔH(agg)(0),-TΔS(agg)(0)) of aggregation derived from electrical conductivity indicate that the aggregation of [C(n)py-4-C(n)py][Br(2)] is enthalpy-driven, while aggregation of C(n)MPB is entropy-driven at low temperatures but enthalpy-driven at high temperatures. Copyright © 2012 Elsevier Inc. All rights reserved.

  13. Accelerator mass spectrometry analysis of "1"4C-oxaliplatin concentrations in biological samples and "1"4C contents in biological samples and antineoplastic agents

    International Nuclear Information System (INIS)

    Toyoguchi, Teiko; Kobayashi, Takeshi; Konno, Noboru; Shiraishi, Tadashi; Kato, Kazuhiro; Tokanai, Fuyuki

    2015-01-01

    Accelerator mass spectrometry (AMS) is expected to play an important role in microdose trials. In this study, we measured the "1"4C concentration in "1"4C-oxaliplatin-spiked serum, urine and supernatant of fecal homogenate samples in our Yamagata University (YU) – AMS system. The calibration curves of "1"4C concentration in serum, urine and supernatant of fecal homogenate were linear (the correlation coefficients were ⩾0.9893), and the precision and accuracy was within the acceptance criteria. To examine a "1"4C content of water in three vacuum blood collection tubes and a syringe were measured. "1"4C was not detected from water in these devices. The mean "1"4C content in urine samples of 6 healthy Japanese volunteers was 0.144 dpm/mL, and the intra-day fluctuation of "1"4C content in urine from a volunteer was little. The antineoplastic agents are administered to the patients in combination. Then, "1"4C contents of the antineoplastic agents were quantitated. "1"4C contents were different among 10 antineoplastic agents; "1"4C contents of paclitaxel injection and docetaxel hydrate injection were higher than those of the other injections. These results indicate that our quantitation method using YU-AMS system is suited for microdosing studies and that measurement of baseline and co-administered drugs might be necessary for the studies in low concentrations.

  14. Solvothermal synthesis and characterisation of new one-dimensional indium and gallium sulphides: [C1N4H26]0.5[InS2] and [C1N4H26]0.5[GaS2

    International Nuclear Information System (INIS)

    Vaqueiro, Paz

    2006-01-01

    Two new main group metal sulphides, [C 1 N 4 H 26 ] 0.5 [InS 2 ] (1) and [C 1 N 4 H 26 ] 0.5 [GaS 2 ] (2) have been prepared solvothermally in the presence of 1,4-bis(3-aminopropyl)piperazine and their crystal structures determined by single-crystal X-ray diffraction. Both compounds are isostructural and crystallise in the monoclinic space group P2 1 /n (Z=4), with a=6.5628(5), b=11.2008(9), c=12.6611(9) A and β=94.410(4) o (wR=0.035) for compound (1) and a=6.1094(5), b=11.2469(9), c=12.7064(10) A and β=94.313(4) o (wR=0.021) for compound (2). The structure of [C 1 N 4 H 26 ] 0.5 [MS 2 ] (M=In,Ga) consists of one-dimensional [MS 2 ] - chains which run parallel to the crystallographic a axis and are separated by diprotonated amine molecules. These materials represent the first example of solvothermally prepared one-dimensional gallium and indium sulphides. -- Graphical abstract: [C 1 N 4 H 26 ] 0.5 [InS 2 ] and [C 1 N 4 H 26 ] 0.5 [GaS 2 ], prepared under solvothermal conditions, consist of one-dimensional [MS 2 ] - chains separated by diprotonated 1,4-bis(3-aminopropyl)piperazine molecules

  15. X-ray diffraction investigation of the sulphur induced 4x1 reconstruction of Ni(110)

    DEFF Research Database (Denmark)

    Foss, M.; Feidenhans'l, R.; Nielsen, M.

    1993-01-01

    The atomic structure of the Ni(110)4 x 1-S reconstruction has been determined on the basis of surface X-ray diffraction measurements. An analysis of the in-plane diffraction data shows that the model consists of Ni rows along the [001] direction, two for every 4 x 1 unit cell, corresponding to 0....

  16. Synthesis and characterization of Sr{sub 2}Ir{sub 1-x}M{sub x}O{sub 4} (M=Ti, Fe, Co) solid solutions

    Energy Technology Data Exchange (ETDEWEB)

    Gatimu, Alvin J.; Berthelot, Romain; Muir, Sean; Sleight, Arthur W. [Department of Chemistry, Oregon State University, Corvallis, OR 97331 (United States); Subramanian, M.A., E-mail: mas.subramanian@oregonstate.edu [Department of Chemistry, Oregon State University, Corvallis, OR 97331 (United States)

    2012-06-15

    The effects of Ti, Fe and Co substitutions for Ir on the structure and on the physical properties of Sr{sub 2}IrO{sub 4} are investigated. A complete solid solution Sr{sub 2}Ir{sub 1-x}Ti{sub x}O{sub 4} is obtained while both Fe and Co doping are relatively limited. In each case however, the c-axis cell parameter and the initial IrO{sub 6} octahedra tilting decreases with substitution. Doping with Ti, Fe and Co results in a decrease of the magnetic susceptibility and in an increase in the paramagnetic effective moment for Co and Fe doped samples and a suppression of the weak ferromagnetic ordering observed for Sr{sub 2}IrO{sub 4}. - Graphical abstract: Solid solutions of Sr{sub 2}Ir{sub 1-x}M{sub x}O{sub 4} (M=Ti, Fe, Co) have been synthesized and characterized by powder X-ray diffraction, magnetism and electrical measurements. Changes in the a parameter and decreases in both the c-axis cell parameters and the initial IrO{sub 6} octahedra tilting are found to be correlated. Highlights: Black-Right-Pointing-Pointer Solid Solutions of Sr{sub 2}Ir{sub 1-x}M{sub x}O{sub 4} (M=Ti, Fe, Co) are synthesized. Black-Right-Pointing-Pointer The Sr{sub 2}Ir{sub 1-x}Ti{sub x}O{sub 4} solid solution is complete while those of Fe and Co are relatively limited. Black-Right-Pointing-Pointer The change in a cell parameter with substitution is much less than that of the c parameter. Black-Right-Pointing-Pointer Decreased tilting and the smaller size of the M cation contrastingly affect the a parameter. Black-Right-Pointing-Pointer Doping results in a suppression of the weak ferromagnetic ordering in Sr{sub 2}IrO{sub 4}.

  17. The synthesis of 5'-[14C1] and 3a, 4-[13C2] labelled panadiplon (U-78875; 3-(5'-cyclopropyl-1,2,4-oxadiazol-3-yl)-5-(1-methylethyl)-imidazo-[1,5a]-quinoxalin-4(5H)-one)

    International Nuclear Information System (INIS)

    Ackland, M.J.; Howard, M.R.; Dring, L.G.

    1993-01-01

    5'-[ 14 C 1 ]Panadiplon was prepared in 3 steps starting from [ 14 C 1 ]cyclopropane carboxylic acid and 3-(5'-cyano-1,2,4-oxadiazol-3-yl)-5-(1-methylethyl)-imidazo-[1,5a] -quinoxalin-4(5H)-one. 3a, 4-[ 13 C 2 ]Panadiplon was prepared in two steps from 13 C 2 -oxalic acid and N-1-(1-methylethyl)-o-phenylenediamine. The position of labelling was confirmed by the appearance of two coupled resonances (J C-C =80.59 Hz) at 121.95 and 154.39 ppm in the assigned 13 C-NMR spectrum. (Author)

  18. 1- 4 Falodun

    African Journals Online (AJOL)

    DR. AMIN

    45.3. 2.31 (dd, J = 7.5, 12.8). CH2. 9. 70.7. 5.62 m. CH. 10. 122.9. 5.09 m. CH. 11. 131.2. -. C. 12. 25.5. 1.71 s. CH3. 13. 27.8. 1.30 s. CH3. 14. 16.8. 1.59 s. CH3. 15. 18.2. 1.70 s. CH3. CH3CO. 171.4. -. CH3. CH3CO. 20.2. 1.89 s. CH3. Organisms. Concentrations of seed extracts (mg/ml). 2.5. 5. 10. 20. 25. 50. 100. 200. E.coli.

  19. Composition and phase analysis of nanocrystalline Ba{sub x}Sr{sub 1-x}Fe{sub 12}O{sub 19} (x = 1.0; 0.6; and 0.4) by using general structure analysis system

    Energy Technology Data Exchange (ETDEWEB)

    Gunanto, Y. E., E-mail: yohanes.gunanto@uph.edu [Departement of Biology Education, Pelita Harapan University, Karawaci, Tangerang, 15811 (Indonesia); Jobiliong, E., E-mail: eric.jobiliong@uph.edu [Departement of Industrial Engineering, Pelita Harapan University, Karawaci, Tangerang, 15811 (Indonesia); Adi, Wisnu Ari, E-mail: dwisnuaa@batan.go.id [Centre for Sci. and Tech. of Adv. Materials, BATAN, Serpong, Tangerang Selatan, 15314 (Indonesia)

    2016-03-11

    Single phase of nanocrystalline Ba{sub x}Sr{sub 1-x}Fe{sub 12}O{sub 19} (x = 1.0; 0.6; and 0.4) was successfully synthesized by mechanical milling method and thermal process. Stoichiometric quantities of analytical-grade SrCO{sub 3}, BaCO{sub 3}, and Fe{sub 2}O{sub 3}, were mixed and milled using a high-energy milling. The mixture of all precursors was sintered at a temperature of 1000 °C for 10 hours. The refinement of x-ray diffraction trace for all samples confirmed a single phase material with a hexagonal structure. The increase of the amount of strontium content in the barium atoms in the Ba{sub x}Sr{sub 1-x}Fe{sub 12}O{sub 19} system can decrease the lattice parameter which have been successfully substituted into the barium atoms. The calculation result of cationic distribution showed that the Ba{sub x}Sr{sub 1-x}Fe{sub 12}O{sub 19} (x = 0.6) and (x = 0.4) samples have nominal composition of Ba{sub 0,61}Sr{sub 0,39}Fe{sub 12}O{sub 19} and Ba{sub 0,37}Sr{sub 0,63}Fe{sub 12}O{sub 19}, respectively. Results of the mean of crystallite size evaluation for respective powder materials showed that the Ba{sub x}Sr{sub 1-x}Fe{sub 12}O{sub 19} (x = 1.0; 0.6; and 0.4) samples have the crystallite size of 22 nm, 25 nm and 34 nm, respectively. We concluded that the cationic distribution of barium atoms was successfully substituted by strontium atoms approaching the nominal stoichiometric composition.

  20. 4H-SiC Schottky diode arrays for X-ray detection

    Energy Technology Data Exchange (ETDEWEB)

    Lioliou, G. [Semiconductor Materials and Devices Laboratory, School of Engineering and Informatics, University of Sussex, Falmer, Brighton BN1 9QT (United Kingdom); Chan, H.K. [School of Electrical and Electronic Engineering, Newcastle University, Newcastle upon Tyne NE1 7RU (United Kingdom); Gohil, T. [Semiconductor Materials and Devices Laboratory, School of Engineering and Informatics, University of Sussex, Falmer, Brighton BN1 9QT (United Kingdom); Vassilevski, K.V.; Wright, N.G.; Horsfall, A.B. [School of Electrical and Electronic Engineering, Newcastle University, Newcastle upon Tyne NE1 7RU (United Kingdom); Barnett, A.M. [Semiconductor Materials and Devices Laboratory, School of Engineering and Informatics, University of Sussex, Falmer, Brighton BN1 9QT (United Kingdom)

    2016-12-21

    Five SiC Schottky photodiodes for X-ray detection have been electrically characterized at room temperature. One representative diode was also electrically characterized over the temperature range 20°C to 140 °C. The performance at 30 °C of all five X-ray detectors, in both current mode and for photon counting X-ray spectroscopy was investigated. The diodes were fabricated in an array form such that they could be operated as either a 2×2 or 1×3 pixel array. Although the devices showed double barrier heights, high ideality factors and higher than expected leakage current at room temperature (12 nA/cm{sup 2} at an internal electric field of 105 kV/cm), they operated as spectroscopic photon counting soft X-ray detectors uncooled at 30 °C. The measured energy resolution (FWHM at 17.4 keV, Mo Kα) varied from 1.36 to 1.68 keV among different diodes.

  1. Phase stability predictions of Cr1x, Mx)2(Al1−y, Ay)(C1−z, Xz) (M = Ti, Hf, Zr; A = Si, X = B)

    International Nuclear Information System (INIS)

    Shang, Lin; Music, Denis; Baben, Moritz to; Schneider, Jochen M

    2014-01-01

    The phase stability of (Cr 1x , M x ) 2 (Al 1−y , A y )(C 1−z , X z ) (M = Ti, Hf, Zr; A = Si, X = B, space group P6 3 /mmc, prototype Cr 2 AlC) was studied using ab initio calculations. Based on the energy of mixing data as well as the density of states (DOS) analysis, (Cr 1x , Zr x ) 2 AlC and (Cr 1x , Hf x ) 2 AlC are predicted to be unstable, whereas (Cr 1x , Ti x ) 2 AlC, Cr 2 (Al 1−y , Si y )C and Cr 2 Al(C 1−z , B z ) are predicted to be stable or metastable. The density of states analysis reveals that small differences in the position of the Fermi level alters the phase stability: (Cr 1x , Zr x ) 2 AlC and (Cr 1x , Hf x ) 2 AlC are predicted to be unstable or metastable as the Fermi level lies at a peak position. While the Cr dominated DOS for (Cr 1x , Ti x ) 2 AlC plateaus at the Fermi level indicating stability. Implications of these results for the vapour phase condensation of self-healing Cr 2 AlC based materials are discussed. (paper)

  2. Chelate-size effects on the structures, chemical behavior, properties, and catalytic activity of the new palladium(II)-allyl complexes [Pd(eta(3)-1-R-1-C3H4){FcCH=N-CH2-(CH2)(n)-NMe2}][PF6] {Fc = (eta(5)-C5H5)Fe(eta(5)-C5H4), n=2 or 1, and R-1 = h or ph}

    NARCIS (Netherlands)

    Pérez, S.; López, C.; Bosque, R.; Solans, X.; Font-Bardía, M.; Roig, A.; Molins, E.; van Leeuwen, P.W.N.M.; van Strijdonck, G.P.F.; Freixa, Z.

    2008-01-01

    The synthesis, X-ray crystal structures, and the study of the solution behavior of the palladium(II) allyl complexes [Pd(eta(3)-1R(1)-C3H4){FcCH=N-CH2-(CH2)(n)-NMe2}][PF6] {with Fc = (eta(5)-C5H5)Fe(eta(5)-C5H4), R-1 = H, and n = 2 (4) or 1 (5) or R-1 = Ph and n = 2 (6) or 1 (7)} are described. The

  3. 11B study of spin dynamics in Y/sub 1-x/RE/sub x/Rh4B4

    International Nuclear Information System (INIS)

    Kumagai, K.; Fradin, F.Y.

    1982-06-01

    There has been intense interest in re-entrance and coexistence in ternary rare earth magnetic superconductors of the form RE Rh 4 B 4 . Of particular interest in this investigation is the effect of the superconducting state on the RKKY (Yosida, 1957) coupling between RE ions. Since one expects the conduction electron spin susceptibility chi/sup e/(q) to be cut off for q - 1 for the RE moments in the superconducting state. This paper reports on the spin dynamics of the RE ions using the 11 B nuclear magnetic relaxation rate T 1- 1 in dilute Y/sub 1-x/RE/sub x/Rh 4 B 4 (RE = Gd and Er)

  4. X-Ray diffraction and mu-Raman investigation of the monoclinic-orthorhombic phase transition in Th(1-x)U(x)(C(2)O(4))(2).2H(2)O solid solutions.

    Science.gov (United States)

    Clavier, Nicolas; Hingant, Nina; Rivenet, Murielle; Obbade, Saïd; Dacheux, Nicolas; Barré, Nicole; Abraham, Francis

    2010-02-15

    A complete Th(1-x)U(x)(C(2)O(4))(2).2H(2)O solid solution was prepared by mild hydrothermal synthesis from a mixture of hydrochloric solutions containing cations and oxalic acid. The crystal structure has been solved from twinned single crystals for x = 0, 0.5, and 1 with monoclinic symmetry, space group C2/c, leading to unit cell parameters of a approximately 10.5 A, b approximately 8.5 A, and c approximately 9.6 A. The crystal structure consists of a two-dimensional arrangement of actinide centers connected through bis-bidentate oxalate ions forming squares. The actinide metal is coordinated by eight oxygen atoms from four oxalate entities and two water oxygen atoms forming a bicapped square antiprism. The connection between the layers is assumed by hydrogen bonds between the water molecules and the oxygen of oxalate of an adjacent layer. Under these conditions, the unit cell contains two independent oxalate ions. From high-temperature mu-Raman and X-ray diffraction studies, the compounds were found to undergo a transition to an orthorhombic form (space group Ccca). The major differences in the structural arrangement concern the symmetry of uranium, which decreases from C2 to D2, leading to a unique oxalate group. Consequently, the nu(s)(C-O) double band observed in the Raman spectra recorded at room temperature turned into a singlet. This transformation was then used to make the phase transition temperature more precise as a function of the uranium content of the sample.

  5. Transportation Career Field, AFSC 60XXX

    Science.gov (United States)

    1988-04-01

    equipment, affixirg parachutes and extraction systems to airdrop loads, * rigging cargo on platforms for airdrops, assembling extraction systems and attaching...C Z= C4 (D Il L-. Ill CD Ill l "- 1i CD P-4J (i 0D CL .J wIX I- In V -i W I L 0e W Z-I -I 7-1 . C-) 1W ID .. C> LL w C) 10 C- = CDCt l 1) 0 < W...PERCENT MEMBERS PERFORMING PERCENT , MEMBERS ’ TASKS PERFORMING M1129 AFFIX PARACHUTES TO AIRDROP LOADS 99 M1149 RIG CARGO ON PLATFORMS FOR AIRDROPS 96

  6. Crystalline-electric field of Pr(Os1-xRux)4Sb12

    International Nuclear Information System (INIS)

    Akita, H.; Yoshino, G.; Ochiai, A.

    2006-01-01

    High-quality single crystals of Pr(Os 1-x Ru x ) 4 Sb 12 were grown by the Sb self-flux method. Magnetic susceptibility χ(T) was measured precisely. The characteristic temperature T max , where χ(T) exhibits a maximum, varies as a function of Ru-content x but its functional form changes at around x=0.6 where competition of two types of superconductivity is suggested. Since T max is thought to be relevant to the splitting energy between a ground state and a first excited state, we analyzed χ(T) considering the crystalline electric field (CEF) of the T h symmetry. χ(T) is well fitted assuming a Γ 1 singlet ground state for all x values. As expected from T max , the energy of the first excited state (Γ 4 (2) ) changes its functional form at around x=0.6. Furthermore, the energies of the second and third excited states (Γ 4 (1) and Γ 23 ) exhibit a minimum at almost the same value of x=0.6. These results suggest that the CEF is related to the superconductivity in Pr(Os 1-x Ru x ) 4 Sb 12

  7. Modulation-free bismuth-lead cuprate superconductors: BiPbSr1+xL1-xCuO6 and BiPbSr2Y1-xCaxCu2O8

    International Nuclear Information System (INIS)

    Manivannan, V.; Gopalakrishnan, J.; Rao, C.N.R.

    1991-01-01

    Modulation-free BiPbSrLCuO 6 (L=La, Pr, Nd) and BiPbSr 2 YCu 2 O 8 , which are isotypic with the n=1 and 2 members of the Bi 2 Sr 2 Ca n-1 Cu n O 2n+4 family, have been prepared and characterized. These parent compounds are nonsuperconducting, but when doped with holes by substitution chemistry give modulation-free superconducting cuprates of the general formulas BiPbSr 1+xL1-x CuO 6 and BiPbSr 2 Y 1-x Ca x Cu 2 O 8 , exhibiting maximum T c 's of 24 and 85 K, respectively. Significantly, the hole concentration at the maximum T c is 0.12 in the cuprate family with a single Cu-O layer and 0.22 in that with two Cu-O layers

  8. Experimental and DFT evaluation of the 1H and 13C NMR chemical shifts for calix[4]arenes

    Science.gov (United States)

    Guzzo, Rodrigo N.; Rezende, Michelle Jakeline Cunha; Kartnaller, Vinicius; Carneiro, José Walkimar de M.; Stoyanov, Stanislav R.; Costa, Leonardo Moreira da

    2018-04-01

    The density functional theory is employed to determine the efficiency of 11 exchange-correlation (XC) functionals to compute the 1H and 13C NMR chemical shifts of p-tert-butylcalix[4]arene (ptcx4, R1 = C(CH3)3) and congeners using the 6-31G(d,p) basis set. The statistical analysis shows that B3LYP, B3PW91 and PBE1PBE are the best XC functionals for the calculation of 1H chemical shifts. Moreover, the best results for the 13C chemical shifts are obtained using the LC-WPBE, M06-2X and wB97X-D functionals. The performance of these XC functionals is tested for three other calix[4]arenes: p-sulfonic acid calix[4]arene (sfxcx4 - R1 = SO3H), p-nitro-calix[4]arene (ncx4, R1 = NO2) and calix[4]arene (cx4 - R1 = H). For 1H chemical shifts B3LYP, B3PW91 and PBE1PBE yield similar results, although B3PW91 shows more consistency in the calculated error for the different structures. For 13C NMR chemical shifts, the XC functional that stood out as best is LC-WPBE. Indeed, the three functionals selected for each of 1H and 13C show good accuracy and can be used in future studies involving the prediction of 1H and 13C chemical shifts for this type of compounds.

  9. Reaction of hydrogen with the Laves phase (C14) TiCr{sub 1.78-x}Mn{sub x} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Agresti, F. [Universita di Padova, Dipartimento di Ingegneria Meccanica, Settore Materiali and CNISM, via Marzolo 9, 35131 Padova (Italy); Lo Russo, S. [Universita di Padova, Dipartimento di Fisica and CNISM, via Marzolo 8, 35131 Padova (Italy); Maddalena, A.; Principi, G. [Universita di Padova, Dipartimento di Ingegneria Meccanica, Settore Materiali and CNISM, via Marzolo 9, 35131 Padova (Italy); Mazzolai, G. [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Universita Telematica e-Campus, Via Isimbardi 10, Novedrate (Colombia) (Italy); Coluzzi, B.; Biscarini, A. [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Mazzolai, F.M., E-mail: fabio.mazzolai@fisica.unipg.it [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Tuissi, A. [Istituto per l' Energia e le Interfasi, CNR-IENI, C.so Promessi Sposi, 29, Lecco (Italy)

    2009-09-15

    The lattice constants a and c of the as cast hexagonal (C14) Laves phase TiCr{sub 1.78-x}Mn{sub x} (x = 0, 0.4, 0.6 and 0.8) have been measured by X-ray diffraction at room temperature as a function of the Mn content. It has been found that a decreases with increasing x while c remains almost unchanged. Being this alloy interesting as material for solid state hydrogen storage, pressure-composition isotherms have been traced on desorption mode for the H{sub 2} gas pressure and temperature varying from 10 to 0.01 MPa and from 209 to 307 K, respectively. From the temperature dependence of the plateau pressure the molar quantities {Delta}H-bar{sub H{sub 2}} and {Delta}S-bar{sub H{sub 2}} associated with the hydride decomposition have been determined as a function of the Mn content. With increasing x, both {Delta}H-bar{sub H{sub 2}} and {Delta}S-bar{sub H{sub 2}} progressively decrease, and the desorption pressure initially decreases (for x {<=} 0.4) then slightly increases. At the same time, the pseudo-plateaus become flatter.

  10. Quaternary selenostannates Na{sub 2-x}Ga{sub 2-x}Sn{sub 1+x}Se{sub 6} and AGaSnSe{sub 4} (A=K, Rb, and Cs) through rapid cooling of melts. Kinetics versus thermodynamics in the polymorphism of AGaSnSe{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, S -J; Iyer, R G; Kanatzidis, M G

    2004-10-01

    The quaternary alkali-metal gallium selenostannates, Na{sub 2-x}Ga{sub 2-x}Sn{sub 1+x}Se{sub 6} and AGaSnSe{sub 4} (A=K, Rb, and Cs), were synthesized by reacting alkali-metal selenide, Ga, Sn, and Se with a flame melting-rapid cooling method. Na{sub 2-x}Ga{sub 2-x}Sn{sub 1+x}Se{sub 6} crystallizes in the non-centrosymmetric space group C2 with cell constants a=13.308(3) A, b=7.594(2) A, c=13.842(3) A, {beta}=118.730(4) deg., V=1226.7(5) A{sup 3}. {alpha}-KGaSnSe{sub 4} crystallizes in the tetragonal space group I4/mcm with a=8.186(5) A and c=6.403(5) A, V=429.1(5) A{sup 3}. {beta}-KGaSnSe{sub 4} crystallizes in the space group P2{sub 1}/c with cell constants a=7.490(2) A, b=12.578(3) A, c=18.306(5) A, {beta}=98.653(5) deg., V=1705.0(8) A{sup 3}. The unit cell of isostructural RbGaSnSe{sub 4} is a=7.567(2) A, b=12.656(3) A, c=18.277(4) A, {beta}=95.924(4) deg., V=1741.1(7) A{sup 3}. CsGaSnSe{sub 4} crystallizes in the orthorhombic space group Pmcn with a=7.679(2) A, b=12.655(3) A, c=18.278(5) A, V=1776.1(8) A{sup 3}. The structure of Na{sub 2-x}Ga{sub 2-x}Sn{sub 1+x}Se{sub 6} consists of a polar three-dimensional network of trimeric (Sn,Ga){sub 3}Se{sub 9} units with Na atoms located in tunnels. The AGaSnSe{sub 4} possess layered structures. The compounds show nearly the same Raman spectral features, except for Na{sub 2-x}Ga{sub 2-x}Sn{sub 1+x}Se{sub 6}. Optical band gaps, determined from UV-Vis spectroscopy, range from 1.50 eV in Na{sub 2-x}Ga{sub 2-x}Sn{sub 1+x}Se{sub 6} to 1.97 eV in CsGaSnSe{sub 4}. Cooling of the melts of KGaSnSe{sub 4} and RbGaSnSe{sub 4} produces only kinetically stable products. The thermodynamically stable product is accessible under extended annealing, which leads to the so-called {gamma}-form (BaGa{sub 2}S{sub 4}-type) of these compounds.

  11. X-ray photoelectron spectroscopy study on Ba1-xEuxTiO3

    International Nuclear Information System (INIS)

    Lu, D.-Y.; Sugano, Mikio; Sun Xiuyun; Su Wenhui

    2005-01-01

    X-ray photoelectron spectroscopy is employed to study inner-shell core-level binding energies Eu 4d, Ti 2p and O 1s, Ba 3d for new single-phase Ba 1-x Eu x TiO 3 (0.1x ≤ 0.4) samples prepared by solid state reaction at 4.0 GPa and 1090 deg. C. The peak positions of binding energies determined by linear background subtraction and Gaussian fit are presented. XPS analysis indicates that the mixed-valent Eu 3+ /Eu 2+ ions at A-site and Ti 4+ /Ti 3+ ions at B-site coexisted in the Ba 1-x Eu x TiO 3 powder surface, and the amount of Eu 2+ ions is equal to Eu 3+ ions

  12. Synthesis, Structure, and Cyclocondensation of the 4,4,4-Trifluoro-3,3-dihydroxy-2-methyl-1-(thien-2-yl-1-butanone with Hydroxylamine and Hydrazine

    Directory of Open Access Journals (Sweden)

    Alex F. C. Flores

    2018-01-01

    Full Text Available The synthesis of 4,4,4-trifluoro-3,3-dihydroxy-2-methyl-1-(thien-2-ylbutan-1-one (3 through acylation of 1,1-dimethoxy-1-(thien-2-ylpropane (1 with trifluoroacetic anhydride and its reactions with hydroxylamine and hydrazine was investigated. X-ray structural analysis of new trifluoromethyl-substituted dielectrophile 3 revealed that this hydrate exists as a racemate with inter- and intramolecular O-H·O bonds. The crystal structure shows alignment along axis b of pair molecules with the same configuration of the O2-H·O1 bond. For 5(3-trifluoromethyl-4-methyl-3(5-(thien-2-yl-1H-pyrazole (4, obtained via cyclocondensation of precursor 2 and hydrazine hydrochloride, X-ray structural analysis indicated that its rings are almost planar (torsion angle N2-C5-C6-C7–5.4° and that S1 at the thienyl moiety is anti-periplanar to N2 (torsion angle N2-C5-C6-S1 176.01; no disorder effect was observed for the thienyl ring.

  13. Phase equilibria in the Mo-Fe-P system at 800 °C and structure of ternary phosphide (Mo(1-x)Fe(x))3P (0.10 ≤ x ≤ 0.15).

    Science.gov (United States)

    Oliynyk, Anton O; Lomnytska, Yaroslava F; Dzevenko, Mariya V; Stoyko, Stanislav S; Mar, Arthur

    2013-01-18

    Construction of the isothermal section in the metal-rich portion (ternary phases: (Mo(1-x)Fe(x))(2)P (x = 0.30-0.82) and (Mo(1-x)Fe(x))(3)P (x = 0.10-0.15). The occurrence of a Co(2)Si-type ternary phase (Mo(1-x)Fe(x))(2)P, which straddles the equiatomic composition MoFeP, is common to other ternary transition-metal phosphide systems. However, the ternary phase (Mo(1-x)Fe(x))(3)P is unusual because it is distinct from the binary phase Mo(3)P, notwithstanding their similar compositions and structures. The relationship has been clarified through single-crystal X-ray diffraction studies on Mo(3)P (α-V(3)S-type, space group I42m, a = 9.7925(11) Å, c = 4.8246(6) Å) and (Mo(0.85)Fe(0.15))(3)P (Ni(3)P-type, space group I4, a = 9.6982(8) Å, c = 4.7590(4) Å) at -100 °C. Representation in terms of nets containing fused triangles provides a pathway to transform these closely related structures through twisting. Band structure calculations support the adoption of these structure types and the site preference of Fe atoms. Electrical resistivity measurements on (Mo(0.85)Fe(0.15))(3)P reveal metallic behavior but no superconducting transition.

  14. 1,4-Dioxane Remediation by Extreme Soil Vapor Extraction (XSVE). Screening-Level Feasibility Assessment and Design Tool in Support of 1,4-Dioxane Remediation by Extreme Soil Vapor Extraction (XSVE) ESTCP Project ER 201326

    Science.gov (United States)

    2017-10-01

    USER GUIDE 1,4-Dioxane Remediation by Extreme Soil Vapor Extraction (XSVE) Screening-Level Feasibility Assessment and Design Tool in...Support of 1,4-Dioxane Remediation by Extreme Soil Vapor Extraction (XSVE) ESTCP Project ER-201326 OCTOBER 2017 Rob Hinchee Integrated Science...Technology, Inc. 1509 Coastal Highway Panacea, FL 32346 8/8/2013 - 8/8/2018 10-2017 1,4-Dioxane Remediation by Extreme Soil Vapor Extraction (XSVE) Screening

  15. Synthesis and characterization of Sr2Ir1xMxO4 (M=Ti, Fe, Co) solid solutions

    International Nuclear Information System (INIS)

    Gatimu, Alvin J.; Berthelot, Romain; Muir, Sean; Sleight, Arthur W.; Subramanian, M.A.

    2012-01-01

    The effects of Ti, Fe and Co substitutions for Ir on the structure and on the physical properties of Sr 2 IrO 4 are investigated. A complete solid solution Sr 2 Ir 1x Ti x O 4 is obtained while both Fe and Co doping are relatively limited. In each case however, the c-axis cell parameter and the initial IrO 6 octahedra tilting decreases with substitution. Doping with Ti, Fe and Co results in a decrease of the magnetic susceptibility and in an increase in the paramagnetic effective moment for Co and Fe doped samples and a suppression of the weak ferromagnetic ordering observed for Sr 2 IrO 4 . - Graphical abstract: Solid solutions of Sr 2 Ir 1x M x O 4 (M=Ti, Fe, Co) have been synthesized and characterized by powder X-ray diffraction, magnetism and electrical measurements. Changes in the a parameter and decreases in both the c-axis cell parameters and the initial IrO 6 octahedra tilting are found to be correlated. Highlights: ► Solid Solutions of Sr 2 Ir 1x M x O 4 (M=Ti, Fe, Co) are synthesized. ► The Sr 2 Ir 1x Ti x O 4 solid solution is complete while those of Fe and Co are relatively limited. ► The change in a cell parameter with substitution is much less than that of the c parameter. ► Decreased tilting and the smaller size of the M cation contrastingly affect the a parameter. ► Doping results in a suppression of the weak ferromagnetic ordering in Sr 2 IrO 4 .

  16. Valent states of ions in CuCrsub(2(1-x))Vsub(2x)Ssub(4) solid solutions

    International Nuclear Information System (INIS)

    Prokopenko, V.K.; Prokhorenko, Yu.I.; Shemyakov, A.A.; Menshchikova, T.K.; Gubskaya, G.F.; Kalinnikov, V.T.; AN SSSR, Moscow. Inst. Obshchej i Neorganicheskoj Khimii)

    1982-01-01

    Using the NMR method electron configurations of ions in copper-chromium chalcogenide spinels, in which part of chromium ions is substituted for by vanadium ions: CuCrsub(2(1-x))Vsub(2x)Ssub(4) (x=0; 0.025; 0.05), have been studied. In CuCrsub(2(1-x))Vsub(2x)Ssub(4) at x [ru

  17. Co-hydrothermal synthesis of LiMn_2_3_/_2_4Mg_1_/_2_4PO_4·LiAlO_2/C nano-hybrid cathode material with enhanced electrochemical performance for lithium-ion batteries

    International Nuclear Information System (INIS)

    Zhang, Jun; Luo, Shaohua; Chang, Longjiao; Hao, Aimin; Wang, Zhiyuan; Liu, Yanguo; Xu, Qian; Wang, Qing; Zhang, Yahui

    2017-01-01

    Highlights: • A co-hydrothermal approach to synthesize LiMn_2_3_/_2_4Mg_1_/_2_4PO_4·LiAlO_2/C composite material in water/PEG system is present. • The Mn_1_-_xMg_xPO_4 precursor is prepared by precipitation reaction. • Co-modified with Mg"2"+ doping and LiAlO_2 compositing strategies play an important role in improving the electronic conductivity and facilitating the diffusion of lithium ion. • LiMn_2_3_/_2_4Mg_1_/_2_4PO_4·LiAlO_2/C composite material exhibits a high specific discharge capacity of 151.8 mAh/g at 0.05C. - Abstract: LiMn_2_3_/_2_4Mg_1_/_2_4PO_4·LiAlO_2/C is synthesized by a co-hydrothermal method in water/PEG system using Li_2CO_3, AAO and Mn_1_-_xMg_xPO_4 as raw material. The electronic structure and micromorphology of multi-component compound LiMn_1_-_xMg_xPO_4/C (x = 0, 1/24, 1/12, 1/6) and nano-hybrid LiMn_2_3_/_2_4Mg_1_/_2_4PO_4·LiAlO_2/C cathode materials are studied by first-principles calculation and experimental research including XRD, SEM, TEM. The calculated band gap of LiMn_2_3_/_2_4Mg_1_/_2_4PO_4/C is 2.296 eV, which is lower than other percentages Mg"2"+ doping samples. Electrochemical tests exhibit LiMn_2_3_/_2_4Mg_1_/_2_4PO_4/C has better cycling performance and rate capability than other contents Mg"2"+ doping samples with the discharge capacity of 143.5 mAh/g, 141.5 mAh/g, 139.2 mAh/g and 136.3 mAh/g at 0.05C, 0.1C, 0.5C and 1C in order. After compositing and preparation of LiMn_2_3_/_2_4Mg_1_/_2_4PO_4·LiAlO_2/C composite material by co-hydrothermal route, the initial discharge capacity reaches up to 151.8 mAh/g, which suggests that co-modified with Mg"2"+ doping and LiAlO_2 compositing material can improve the electronic conductivity of LiMnPO_4/C by facilitating the lithium ion diffusion rate in the interior of the materials.

  18. Extraction of vitexin from binahong (Anredera cordifolia (Ten.) Steenis) leaves using betaine - 1,4 butanediol natural deep eutectic solvent (NADES)

    Science.gov (United States)

    Mulia, Kamarza; Muhammad, Fajri; Krisanti, Elsa

    2017-03-01

    The leaves of binahong (Anredera cordifolia (Ten) Steenis) contain flavonoids as bioactive substances that have efficacy to treat wounds and diseases caused by bacteria. One of the flavonoids contained in the leaves is 8-glucopyranosyl-4'5'7-trihydroxyflavone or vitexin. Conventional extraction of flavonoids from leaves of binahong has been developed and usually using non-friendly organic solvent. To overcome these problems, a Natural Deep Eutectic Solvent (NADES) is used to replace the conventional organic solvents, as it is an environmentally friendly, non-toxic and high boiling point solvent. In this study, a betaine-based NADES combined with 1,4-butanediol in 1:3 mole ratio was used as the extraction solvent. Vitexin in the extract was analyzed qualitatively and quantitatively using an HPLC. The extraction of vitexin from binahong leaves at room temperature (27 °C) for four hours give yield of 46 ppm, much lower than 200 ppm yield obtained after extraction at 55 °C for 90 minutes. This results showed that (a) NADES consisting of betaine and 1,4 butanediol is a promising green solvent for extraction of vitexin from binahong leaves, and, (b) the extraction can be performed above ambient temperature, as long as it does not exceed the degradation temperature of the bioactive compound extracted.

  19. Neutron diffraction studies of Ho1-xYxNi2B2C compounds

    DEFF Research Database (Denmark)

    Chang, L.J.; Tomy, C.V.; Paul, D.M.K.

    1996-01-01

    Neutron diffraction measurements have been carried out to investigate the nature of magnetic ordering in Ho(1-x)Y(x)Ni(2)B(2)C (x = 0, 0.1 and 0.2) compounds. HoNi(2)B(2)C shows a complex type of magnetic ordering below the superconducting transition, with a commensurate antiferromagnetic ordering...

  20. EXAFS analysis of cations distribution in structure of Co1-xNixFe2O4 nanoparticles obtained by hydrothermal method in aloe vera extract solution

    Science.gov (United States)

    Wongpratat, Unchista; Maensiri, Santi; Swatsitang, Ekaphan

    2016-09-01

    Effect of cations distribution upon EXAFS analysis on magnetic properties of Co1-xNixFe2O4 (x = 0, 0.25, 0.50, 0.75 and 1.0) nanoparticles prepared by the hydrothermal method in aloe vera extract solution were studied. XRD analysis confirmed a pure phase of cubic spinel ferrite of all samples. Changes in lattice parameter and particle size depended on the Ni content with partial substitution and site distributions of Co2+, Ni2+ ions of different ionic radii at both tetrahedral and octahedral sites in the crystal structure. Particle sizes of samples estimated by TEM images were found to be in the range of 10.87-62.50 nm. The VSM results at room temperature indicated the ferrimagnetic behavior of all samples. Superparamagnetic behavior was observed in NiFe2O4 sample. The coercivity (Hc) and remanance (Mr) values were related to the particle sizes of samples. The saturation magnetization (Ms) was increased by a factor of 1.4 to a value of 57.57 emu/g, whereas the coercivity (Hc) was decreased by a factor of 20 to a value of 63.15 Oe for a sample with x = 0.75. In addition to the cations distribution, the increase of aspect ratio (surface to volume ratio) due to the decrease of particle size could significantly affect the magnetic properties of the materials.

  1. Ferri-magnetic order in Mn induced spinel Co_3_−_xMn_xO_4 (0.1≤x≤1.0) ceramic compositions

    International Nuclear Information System (INIS)

    Meena, P.L.; Sreenivas, K.; Singh, M.R.; Kumar, Ashok; Singh, S.P.; Kumar, Ravi

    2016-01-01

    We report structural and magnetic properties of spinel Co_3_−_xMn_xO_4 (x=0.11.0) synthesized by solid state reaction technique. Rietveld refinement analysis of X-ray diffraction (XRD) data, revealed the formation of polycrystalline single phase Co_3_−_xMn_xO_4 without any significant structural change in cubic crystal symmetry with Mn substitution, except change in lattice parameter. Temperature dependent magnetization data show changes in magnetic ordering temperature, indicating formation of antiferromagnetic (AFM) and ferrimagnetic (FM) phase at low Mn concentration (x≤0.3) and well-defined FM phase at high Mn concentration (x≥0.5). The isothermal magnetization records established an AFM/FM mixed phase for composition ranging 0.1 0.5. - Highlights: • Synthesis of single phase polycrystalline Co_3_−_xMn_xO_4 ceramic. • Change in magnetic ordering with varying Mn concentration. • The complex spin distribution is contributing to FM ordering with higher Mn.

  2. Alloying effects on structural and thermal behavior of Ti{sub 1-x}Zr{sub x}C: A first principles study

    Energy Technology Data Exchange (ETDEWEB)

    Chauhan, Mamta, E-mail: mamta-physics@yahoo.co.in; Gupta, Dinesh C., E-mail: sosfizix@gmail.com [Condensed Matter Theory Group, School of Studies in Physics, Jiwaji University, Gwalior – 474 011(India)

    2016-05-06

    The formation energy, equilibrium lattice parameter, bulk modulus, Debye temperature and heat capacity at constant volume have been calculated for TiC, ZrC, and their intermediate alloys (Ti{sub 1-x}Zr{sub x}C, x = 0,0.25.0.5,0.75,1) using first principles approach. The calculated values of lattice parameter and bulk modulus agree well with the available experimental and earlier theoretical reports. The variation of lattice parameter and bulk modulus with the change in concentration of Zr atom in Ti{sub 1-x}Zr{sub x}C has also been reported. The heat capacities of TiC, ZrC, and their intermediate alloys have been calculated by considering both vibrational and electronic contributions.

  3. Adsorption configurations of hydrocarbon ring molecules on GaAs(001)-c(4 x 4)

    Energy Technology Data Exchange (ETDEWEB)

    Passmann, R.; Bruhn, T.; Esser, N.; Vogt, P. [Institut fuer Festkoerperphysik, Technische Universitaet Berlin (Germany); ISAS, Institute for Analytical Sciences, Department Berlin, Berlin (Germany); Nilsen, T.A.; Fimland, B.O. [Department of Electronics and Telecomunications, Norwegian University of Science and Technology, Trondheim (Norway); Kneissl, M. [Institut fuer Festkoerperphysik, Technische Universitaet Berlin (Germany)

    2009-07-15

    The understanding of self-assembly and bonding mechanisms of organic molecules on semiconductor surfaces represents a central research aspect in the investigation of novel organic/inorganic interfaces and their technological applicability. Here, we investigated the adsorption and bond formation of cyclopentene and 1,4-cyclohexadiene on a GaAs(001)-c(4 x 4) surface in order to clarify the influence of the number of intra-molecular C=C double bonds on the respective adsorption sites. For a determination of the adsorption configuration, the interfaces were characterized electronically and optically by synchrotron based X-ray photoelectron spectroscopy (SXPS), low energy electron diffraction (LEED) and reflectance anisotropy spectroscopy (RAS). The results reveal significantly different adsorption configurations for the two molecules. While cyclopentene bonds with a single covalent bond to the surface, 1,4-cyclohexadiene adsorbs onto the surface by the formation of multiple covalent bonds, e.g. bridge bonds. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  4. Two-step photoconductivity in LiY x Lu1 - x F4:Ce,Yb crystals

    Science.gov (United States)

    Nurtdinova, L. A.; Korableva, S. L.; Leontiev, A. V.

    2016-10-01

    Photoconductivity of LiY x Lu1- x F4:Ce,Yb ( x = 0-1) crystals is measured under one- and two-step excitation. It is established that the photoconductivity is due to intra-center transitions from excited states of Ce3+ ions. The position of the ground 4 f-state of Ce3+ ion relative to the bottom of the conduction band is determined. The choice of pumping conditions to obtain the lasing on the 5 d-4 f transitions of trivalent cerium in these active media is substantiated.

  5. Electrochemical characterization of Pt-CeO{sub 2}/C and Pt-Ce{sub x}Zr{sub 1-x}O{sub 2}/C catalysts for ethanol electro-oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Bai, Yuxia; Qiu, Xinping; Xi, Jingyu; Wang, Jianshe; Li, Jinfeng; Zhu, Wentao; Chen, Liquan [Key Laboratory of Organic Optoelectronics and Molecular Engineering, Department of Chemistry, Tsinghua University, Beijing 100084 (China); Wu, Jianjun [Key Laboratory of Organic Optoelectronics and Molecular Engineering, Department of Chemistry, Tsinghua University, Beijing 100084 (China); Department of Chemistry, Shijiazhuang College, Shijiazhuang 050801 (China)

    2007-04-24

    Pt-CeO{sub 2}/C and a series of Pt-Ce{sub x}Zr{sub 1-x}O{sub 2}/C catalyst powders with different Ce/Zr ratio were prepared and evaluated in terms of the electrochemical activity for ethanol electro-oxidation using cyclic voltammetry (CV), steady state polarization experiments and CO-stripping technique at room temperature. XRD results show that Ce{sub x}Zr{sub 1-x}O{sub 2} and Pt coexist in the Pt-Ce{sub x}Zr{sub 1-x}O{sub 2}/C catalyst and Ce{sub x}Zr{sub 1-x}O{sub 2} has no effect on the crystalline lattice of Pt. TEM results show that the Pt and Ce{sub x}Zr{sub 1-x}O{sub 2} particles dispersed uniformly over the surface of the carbon black. Cyclic voltammetry results show that the mass activity and specific activity of Pt-CeO{sub 2}/C for ethanol electro-oxidation is higher than that of Pt/C. The structure and Ce/Zr ratio of Pt-Ce{sub x}Zr{sub 1-x}O{sub 2}/C has effect on the catalytic activity of catalysts. CO-stripping voltammetry showed that the inclusion of CeO{sub 2} and Ce{sub x}Zr{sub 1-x}O{sub 2} favors the CO oxidation at lower potential. (author)

  6. Weak mixing angle and the SU(3)CxSU(3) model on M4xS1/(Z2xZ'2)

    International Nuclear Information System (INIS)

    Li Tianjun; Wei Liao

    2002-05-01

    We show that the desirable weak mixing angle sin 2 θ W =0.2312 at m Z scale can be generated naturally in the SU(3) C xSU(3) model on M 4 xS 1 /(Z 2 x Z 2 ') where the gauge symmetry SU(3) is broken down to SU(2) L xU(1) Y by orbifold projection. For a supersymmetric model with a TeV scale extra dimension, the SU(3) unification scale is about hundreds of TeVs at which the gauge couplings for SU(3) C and SU(3) can also be equal in the mean time. For the non-supersymmetric model, SU(2) L xU(1) Y are unified at order of 10 TeV. These models may serve as good candidates for physics beyond the SM or MSSM. (author)

  7. Study of magneto-optic effect on Mn{sub 1-x}Zn{sub x}Fe{sub 2}O{sub 4} nanoferrofluids

    Energy Technology Data Exchange (ETDEWEB)

    Karthick, R. [Department of Physics, PSNA College of Engineering and Technology, Dindigul – 624622 (India); Ramachandran, K. [School of Physics, Madurai Kamaraj University, Madurai - 625021 (India); Srinivasan, R., E-mail: r-srini2067@yahoo.co.in [Department of Physics, Thiagarajar College, Madurai – 625009 (India)

    2016-05-23

    Mn{sub 1-x}Zn{sub x}Fe{sub 2}O{sub 4} nanoparticles (with x varying as 0.1, 0.3, 0.5, 0.7 and 0.9) have been synthesized by co- precipitation method using polyvinyl alcohol as surfactant. Structural analysis and surface morphology of the samples were analysed using X-ray diffraction and scanning electron microscope respectively. The Scherer approximation was used to obtain crystallite sizes and found to decrease from 8.9 nm to 4.3 nm with increase in zinc substitution. The chemical composition of samples obtained through EDAX was comparable with the initial substitutions. Saturation magnetization (M{sub s}), Remanence (M{sub r}) and Coercivity (H{sub c}) were measured using VSM at room temperature and found to decrease with increase in zinc substitution. Verdet constant of the samples are obtained from Faraday rotation for various magnetic fields and it varies from 18 × 10{sup −4} to 3 × 10{sup −4}deg/Gcm with zinc substitution.

  8. Synthesis of the mevalonic acid labelled with "1"4C, "1"3C and "3H

    International Nuclear Information System (INIS)

    Rousseau, Bernard

    1982-01-01

    This thesis describes five new methods of synthesis of the (R,S) mevalonic acid adapted to the labelling with "1"4C and "1"3C in positions 4,5 or 5 or 3', or with tritium in position 3'. Three of them use the tri-oxa-2,4,10 adamantyl group as masked carboxyl function. The two others take benefit from the regioselectivity of the bis-hydro-boration of terminal acetylenics by the 9-borabicyclo [3-3-1]nonane. The acylation of the bis-trimethylsilyl lithiomalonate, and the chemistry of dithiannes are also involved. Acetylene and methyl iodide labelled with isotopes are used as cheap base products [fr

  9. Experimental and theoretical investigations for site preference and anisotropic size change of RE{sub 11}Ge{sub 4}In{sub 6−x}M{sub x} (RE = La, Ce; M = Li, Ge; x = 1, 1.96)

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, Beom-Yong; Jeon, Jieun [Department of Chemistry, Chungbuk National University, Cheongju, Chungbuk 361-763 (Korea, Republic of); Lee, Junseong [Department of Chemistry, Chonnam National University, Gwangju, Chonnam 500-757 (Korea, Republic of); Kim, Jongsik [Department of Chemistry, Dong-A University, Pusan 604-714 (Korea, Republic of); You, Tae-Soo [Department of Chemistry, Chungbuk National University, Cheongju, Chungbuk 361-763 (Korea, Republic of)

    2015-01-25

    Graphical abstract: Reported is experimental and theoretical studies to understand the site-preference between anionic elements and the anisotropic size-change of the 3-D anionic frameworks of two polar intermetallic compounds in the RE{sub 11}Ge{sub 4}In{sub 6−x}M{sub x} (RE = La, Ce; M = Li, Ge; x = 1, 1.96) phase. Indium atoms with a smaller electronegativity prefer to occupy the “dumbbell-site” having the smaller QVAL value, and the anisotropic size-change of the anionic framework in La{sub 11}Ge{sub 4}In{sub 5.00(1)}Li{sub 1.00} is rationalized by using various COHP curves analyses. - Highlights: • Site-preference between anions was elucidated by the QVAL value of each site. • Ten models with different atomic orderings were examined by coloring problems. • COHP curves explained the anisotropic size-change of La{sub 11}Ge{sub 4}In{sub 5.00(1)}Li{sub 1.00}. - Abstract: Two polar intermetallic compounds in the RE{sub 11}Ge{sub 4}In{sub 6−x}M{sub x} (RE = La, Ce; M = Li, Ge; x = 1, 1.96) series have been synthesized by conventional high-temperature reactions and characterized by both single-crystal and powder X-ray diffractions. Both compounds crystallized in the tetragonal crystal system (space group I4/mmm, Z = 4, Pearson symbol tI84) with nine crystallographically independent atomic positions in the asymmetric unit and adopted the Sm{sub 11}Ge{sub 4}In{sub 6}-type structure, which can be considered as an ordered version of the Ho{sub 11}Ge{sub 10}-type. The lattice parameters are a = 11.8370(4) Å and c = 17.2308(7) Å for La{sub 11}Ge{sub 4}In{sub 5.00(1)}Li{sub 1.00}; a = 11.8892(4) Å, c = 16.5736(7) Å for Ce{sub 11}Ge{sub 5.96(3)}In{sub 4.04}. The overall crystal structures of two isotypic compounds can be described as a combination of the cage-shaped 3-dimensional (3-D) anionic framework and three different types of cationic polyhedra filling the inside of the 3-D frameworks. Anionic elements consisting of the frameworks indicate the

  10. Oxidation of methanol on perovskite-type La{sub 2-x}Sr{sub x}NiO{sub 4} (0 {<=} x {<=} 1) film electrodes modified by dispersed nickel in 1 M KOH

    Energy Technology Data Exchange (ETDEWEB)

    Singh, R.N.; Singh, A.; Mishra, D.; Anindita [Department of Chemistry, Faculty of Science, Banaras Hindu University, Varanasi 221 005 (India); Chartier, P. [Laboratoire d' Electrochimie et Chimie Physique du Corps Solide, Institut de Chimie LC3-UMR7177 CNRS/ULP, Universite Louis Pasteur, 67000, Strasbourg (France)

    2008-12-01

    Finely-dispersed nickel particles are electrodeposited on high surface-area perovskite-type La{sub 2-x}Sr{sub x}NiO{sub 4} (0 {<=} x {<=} 1) electrodes for possible use in a direct methanol fuel cell (DMFC). The study is conducted by cyclic voltammetry, chronoamperometry, impedance spectroscopy and anodic Tafel polarization techniques. The results show that the apparent electrocatalytic activities of the modified oxide electrodes are much higher than those of unmodified electrodes under similar experimental conditions; the observed activity is the greatest with the modified La{sub 1.5}Sr{sub 0.5}NiO{sub 4} electrode. At 0.550 V (vs. Hg vertical stroke HgO) in 1 M KOH + 1 M CH{sub 3}OH at 25 C, the latter electrode delivers a current density of over 200 mA cm{sup -2}, whereas other electrodes of the series produce relatively low values (65-117 mA cm{sup -2}). To our knowledge, such high methanol oxidation current densities have not been reported on any other non-platinum electrode in alkaline solution. Further, the modified electrodes are not poisoned by methanol oxidation intermediates/products. (author)

  11. Ab initio pseudopotential calculations for the electronic and geometric structures of hydrogen covered Si(1 1 4)-(2x1)

    International Nuclear Information System (INIS)

    Smardon, R.D.; Srivastava, G.P.

    2004-01-01

    Using a first principles pseudopotential method we have studied the adsorption of H on the high index Si(1 1 4)-(2x1) surface within the local density approximation. This stable surface is found to be both chemically and electronically passivated by two different coverages of hydrogen: 1.0 ML and 1.5 ML. For the 1.0 ML coverage all the A- and B-type dimer bond lengths have equalised to 2.40 Angst and the rebonded lengths are slightly longer at 2.48 Angst. Hydrogen passivation, for both coverages, leads the surface bands of the clean Si(1 1 4)-(2x1) surface to move into the bulk valence and conduction bands. Differences in the density of states for the clean, 1.0 ML and 1.5 ML coverages were observed and are discussed

  12. 1/4-BPS M-theory bubbles with SO(3) x SO(4) symmetry

    International Nuclear Information System (INIS)

    Kim, Hyojoong; Kim, Kyung Kiu; Kim, Nakwoo

    2007-01-01

    In this paper we generalize the work of Lin, Lunin and Maldacena on the classification of 1/2-BPS M-theory solutions to a specific class of 1/4-BPS configurations. We are interested in the solutions of 11 dimensional supergravity with SO(3) x SO(4) symmetry, and it is shown that such solutions are constructed over a one-parameter familiy of 4 dimensional almost Calabi-Yau spaces. Through analytic continuations we can obtain M-theory solutions having AdS 2 x S 3 or AdS 3 x S 2 factors. It is shown that our result is equivalent to the AdS solutions which have been recently reported as the near-horizon geometry of M2 or M5-branes wrapped on 2 or 4-cycles in Calabi-Yau threefolds. We also discuss the hierarchy of M-theory bubbles with different number of supersymmetries

  13. New methods for the preparation and dielectric properties of La{sub 2−x}Sr{sub x}NiO{sub 4} (x = 1/8) ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Chupakhina, T.I., E-mail: chupakhina@ihim.uran.ru [Institute of Solid State Chemistry, UB RAS, 91, Pervomaiskaya str., Ekaterinburg 620990 (Russian Federation); Kadyrova, N.I. [Institute of Solid State Chemistry, UB RAS, 91, Pervomaiskaya str., Ekaterinburg 620990 (Russian Federation); Melnikova, N.V. [Ural Federal University, 19, Mira str., Ekaterinburg (Russian Federation); Gyrdasova, O.I. [Institute of Solid State Chemistry, UB RAS, 91, Pervomaiskaya str., Ekaterinburg 620990 (Russian Federation); Yakovleva, E.A. [Ural Federal University, 19, Mira str., Ekaterinburg (Russian Federation); Zainulin, Yu.G. [Institute of Solid State Chemistry, UB RAS, 91, Pervomaiskaya str., Ekaterinburg 620990 (Russian Federation)

    2016-05-15

    Highlights: • A new fuel in solution combustion synthesis of fine powder La{sub 15/8}Sr{sub 1/8}NiO{sub 4}. • Changes in the morphology of the ceramic La{sub 15/8}Sr{sub 1/8}NiO{sub 4} after thermobaric treatment. • Changes in structural parameters of the La{sub 15/8}Sr{sub 1/8}NiO{sub 4} after thermobaric treatment. • Increase of the dielectric constant of the thermobaric treated ceramic La{sub 15/8}Sr{sub 1/8}NiO{sub 4}. • Using of dielectric modulus and impedance formalisms, of equivalent circuits method. - Abstract: The perovskite-type oxide La{sub 2−x}Sr{sub x}NiO{sub 4} (x = 1/8) was prepared by a new precursor route. The reaction proceeds in the self-ignition mode. Single-phase powder and gas-tight ceramic samples can be produced by single annealing of decomposition products. It was shown that as a result of thermobaric treatment of La{sub 2−x}Sr{sub x}NiO{sub 4} (x = 1/8) the solid solution La{sub 2−x}Sr{sub x}NiO{sub 4} with a higher concentration of strontium and the second phase La{sub 3}Ni{sub 2}O{sub 7} are formed. Short-term (5 min) thermobaric treatment (P = 2.5 GPa) at t° = 900 °C changes the unit cell parameters, but is not accompanied by structural transitions. At the same time, morphological restructuring of the sample occurs—the agglomerates delaminate into thin plates crystals. It was established that the permittivity of the material exposed to thermobaric treatment is much higher compared to that of the sample annealed at atmospheric pressure and virtually does not depend on frequency in a wide temperature range.

  14. Crystallisation kinetics of amorphous Fe72.5-xCu1Nb4.5Si10+x+yB12-y alloy

    International Nuclear Information System (INIS)

    Miglierini, M.; Lipka, J.; Sitek, J.

    1994-01-01

    Fe 73.5 Cu 1 Nb 3 Si 13.5 B 9 and Fe 72.5-x Cu 1 Nb 4.5 Si 10+x+y B 12-y alloys are compared from the point of view of crystallisation behaviour and changes in the short-range order in the amorphous reminder. The increase in Nb to 4.5 at.% in the latter system slows down the formation of nanocrystals to approximately 40% even after 16 hours of anneal at 550 C for x = 0.5, y = 3. Segregation-induced changes in the short-range order are manifested via hyperfine field distributions corresponding to the amorphous reminder. (orig.)

  15. N +-implantation induced enhanced adhesion in WC1-x/Ti-6Al-4V

    Science.gov (United States)

    Laidani, Nadhira; Dorigoni, Carla; Miotello, Antonio

    1996-12-01

    In this work, the potentiality of the N +-implantation to promote adhesion in WC1-x/Ti-6Al-4V bilayers has been investigated. The WC 1- x films were deposited by rf sputtering in Ar discharge. N +-implantations were performed at 160 keV with ion dose ranging from 5 × 10 15 to 2 × 10 17N +/cm 2. The implantations have been carried out at two sample temperatures: 363 K and 423 K. Adhesion strength was measured by means of the scratch test in conjunction with scanning electron microscopy and energy dispersive spectrometry (EDS). Auger electron spectroscopy (AES), Rutherford backscattering spectrometry (RBS) and X-ray diffraction (XRD) analyses were used to study the chemical, compositional and structural changes of the WC1-x/Ti-6Al-4V interface. As a general result, N +-implantation modifies the adhesion failure mechanism which from adhesive, before implantation, becomes cohesive. The implantation temperature had a strong effect on the critical loads Lc. N +-implantation at 423 K resulted in a slight increase of Lc, from 2N (unimplanted systems) to 5N for all ion doses. This weak improvement of the adhesion strength was associated with the particular interface processes which allowed C, but not W, mixing into the substrate. In this case, TiC bondings formed which contributed to the substrate embrittlement. When the implantations were carried out at 363 K, both C and W underwent mixing with Ti-6Al-4V: this favoured not only an interface composition grading but also a graded chemistry across the interface, with a strong increase of Lc for low ion dose ( Lc = 14N for 1 × 10 16 N +/cm 2). Implantation with higher doses (5 × 10 16N -/cm 2 and 2 × 10 17N +/cm 2) exhibited lower efficiency ( Lc = 7N for 2 × 10 17 N +/cm 2). This ion dose dependence of the adhesion strength was attributed to the formation of different phases across the interface, probably structurally incompatible.

  16. Effect of grain boundary on electrical characteristics in B- and P-doped polycrystalline Si1-x-yGe xC y film deposited by ultraclean LPCVD

    International Nuclear Information System (INIS)

    Shim, Hyunyoung; Sakuraba, Masao; Murota, Junichi

    2006-01-01

    The effect of grain boundary on electrical characteristics in B- and P-doped polycrystalline (poly) Si 1-x -y Ge x C y films was investigated. Poly-Si 1-x -y Ge x C y films were deposited on thermally oxidized Si(100) at 500-650 deg. C in a SiH 4 -GeH 4 -SiH 3 CH 3 -H 2 gas mixture by an ultraclean hot-wall low-pressure chemical vapor deposition. B and P were doped into the films by ion implantation and diffusion by heat-treatment. The electrical properties are characterized by grain size, width of disordered region near grain boundaries, carrier trap density and the amount of impurity segregation at grain boundaries. In the B-doped poly-Si 1-x -y Ge x C y films heat-treated at 900 deg. C, the increase of carrier concentration n poly and the decrease of resistivity ρ poly with Ge addition are caused by the narrowing of the width of disordered regions, i.e., crystallization of disordered regions induced by Ge atoms. The decrease of n poly and the increase of ρ poly with C addition are explained by the suppression of crystallization of disordered region due to C atom segregation at grain boundaries. In the P-doped poly-Si 1-x -y Ge x C y films, it is found that n poly and ρ poly are influenced by P atom segregation at grain boundaries due to lowering solid solubility of P in grain by the existence of Ge

  17. 1-Cyclohexyl-6,7-dimethoxy-1,4-dihydronaphthalene

    Directory of Open Access Journals (Sweden)

    Shao-Yuan Chen

    2014-06-01

    Full Text Available The title compound, C18H24O2, was isolated from the leaves extract of Ficus carica L. The cyclohexane ring displays a chair conformation whereas the cyclohexa-1,4-diene ring adopts a flattened boat conformation with methyl C atoms at the prow and stern. In the crystal, molecules are linked by weak C—H...O hydrogen bonds into supramolecular chains propagated along the b-axis direction.

  18. The Cytoprotective Effects of E-α-(4-Methoxyphenyl-2',3,4,4'-Tetramethoxychalcone (E-α-p-OMe-C6H4-TMC--A Novel and Non-Cytotoxic HO-1 Inducer.

    Directory of Open Access Journals (Sweden)

    Kai B Kaufmann

    Full Text Available Cell protection against different noxious stimuli like oxidative stress or chemical toxins plays a central role in the treatment of many diseases. The inducible heme oxygenase isoform, heme oxygenase-1 (HO-1, is known to protect cells against a variety of harmful conditions including apoptosis. Because a number of medium strong electrophiles from a series of α-X-substituted 2',3,4,4'-tetramethoxychalcones (α-X-TMCs, X = H, F, Cl, Br, I, CN, Me, p-NO2-C6H4, Ph, p-OMe-C6H4, NO2, CF3, COOEt, COOH had proven to activate Nrf2 resulting in HO-1 induction and inhibit NF-κB downstream target genes, their protective effect against staurosporine induced apoptosis and reactive oxygen species (ROS production was investigated. RAW264.7 macrophages treated with 19 different chalcones (15 α-X-TMCs, chalcone, 2'-hydroxychalcone, calythropsin and 2'-hydroxy-3,4,4'-trimethoxychalcone prior to staurosporine treatment were analyzed for apoptosis and ROS production, as well as HO-1 protein expression and enzyme activity. Additionally, Nrf2 and NF-κB activity was assessed. We found that amongst all tested chalcones only E-α-(4-methoxyphenyl-2',3,4,4'-tetramethoxychalcone (E-α-p-OMe-C6H4-TMC demonstrated a distinct, statistically significant antiapoptotic effect in a dose dependent manner, showing no toxic effects, while its double bond isomer Z-α-p-OMe-C6H4-TMC displayed no significant activity. Also, E-α-p-OMe-C6H4-TMC induced HO-1 protein expression and increased HO-1 activity, whilst inhibition of HO-1 by SnPP-IX abolished its antiapoptotic effect. The only weakly electrophilic chalcone E-α-p-OMe-C6H4-TMC reduced the staurosporine triggered formation of ROS, while inducing the translocation of Nrf2 into the nucleus. Furthermore, staurosporine induced NF-κB activity was attenuated following E-α-p-OMe-C6H4-TMC treatment. Overall, E-α-p-OMe-C6H4-TMC demonstrated its effective cytoprotective potential via a non-toxic induction of HO-1 in RAW264

  19. Characterization of a n+3C/n−4H SiC heterojunction diode

    Energy Technology Data Exchange (ETDEWEB)

    Minamisawa, R. A.; Mihaila, A. [Department of Power Electronics, ABB Corporate Research Center, CH-5405 Baden-Dättwil (Switzerland); Farkas, I.; Hsu, C.-W.; Janzén, E. [Semiconductor Materials, IFM, Linköping University, SE-58183 Linköping (Sweden); Teodorescu, V. S. [National Institute of Material Physics, R-077125 Bucharest-Măgurele (Romania); Afanas' ev, V. V. [Semiconductor Physics Laboratory, KU Leuven, 3001 Leuven (Belgium); Rahimo, M. [ABB Semiconductors, Fabrikstrasse 3, CH-5600 Lenzburg (Switzerland)

    2016-04-04

    We report on the fabrication of n + 3C/n-4H SiC heterojunction diodes (HJDs) potentially promising the ultimate thermal stability of the junction. The diodes were systematically analyzed by TEM, X-ray diffraction, AFM, and secondary ion mass spectroscopy, indicating the formation of epitaxial 3C-SiC crystal on top of 4H-SiC substrate with continuous interface, low surface roughness, and up to ∼7 × 10{sup 17 }cm{sup −3} dopant impurity concentration. The conduction band off-set is about 1 V as extracted from CV measurements, while the valence bands of both SiC polytypes are aligned. The HJDs feature opening voltage of 1.65 V, consistent with the barrier height of about 1.5 eV extracted from CV measurement. We finally compare the electrical results of the n + 3C/n-4H SiC heterojunction diodes with those featuring Si and Ge doped anodes in order to evaluate current challenges involved in the fabrication of such devices.

  20. Polymorphism of Bi1-xLnxO1.5 phases (04Ln2O9 (x=0.33; Ln=La, Pr, Nd)

    International Nuclear Information System (INIS)

    Drache, Michel; Huve, Marielle; Roussel, Pascal; Conflant, Pierre

    2003-01-01

    The Bi 1-x Ln x O 1.5 solid solutions (Ln=La, Pr, Nd), of the β 2 /β 1 /ε (Bi-Sr-O) structural type, have been investigated in their Ln-rich domains. For Ln=La, Pr, and Nd, the upper limits are 0.35, 0.35 and 0.33, respectively. The Bi 4 Ln 2 O 9 ε phase (x=0.33) appears to be the single definite compound. For Bi 4 La 2 O 9 , Bi 4 Pr 2 O 9 and Bi 4 Nd 2 O 9 , the ε-type cells are respectively: a=9.484(4) A, b=3.982(2) A, c=7.030(3) A, β=104.75(3) deg.; a=9.470(5) A, b=3.945(2) A, c=6.968(4) A, β=104.73(3) deg. and a=9.439(3) A, b=3.944(2) A, c=6.923(2) A, β=105.03(3) deg. . Upon heating, each monoclinic (ε) compound transforms successively into rhombohedral phases (β 2 /β 1 ) and finally into a cubic fluorite-type phase. For La- and Pr-based compounds, all transitions are reversible; for Nd, depending on the thermal treatment, the reversibility of ε→β 2 can be incomplete. These transformations are characterized using X-ray thermodiffractometry, differential thermal analysis, dilatometry and impedance spectroscopy versus temperature. Examination of Bi 4 (Ln, Ln') 2 O 9 samples allows to correlate the evolution of the thermal behavior and of the unit cell parameters, to the lanthanide size. A partial plot of the (Bi 2 O 3 ) 1-x -(La 2 O 3 ) x phase diagram (0≤x≤0.40) is proposed

  1. HT-solution growth and characterisation of In{sub x}Na{sub x}Mn{sub 1-2x}WO{sub 4} (0

    Energy Technology Data Exchange (ETDEWEB)

    Gattermann, U. [Sektion Kristallographie, Department für Geo- und Umweltwissenschaften, Ludwig-Maximilians-Universität München, Theresienst rasse 41, D-80333 Munich (Germany); Park, S.-H., E-mail: sohyun.park@lmu.de [Sektion Kristallographie, Department für Geo- und Umweltwissenschaften, Ludwig-Maximilians-Universität München, Theresienst rasse 41, D-80333 Munich (Germany); Paulmann, C. [Geowissenschaften, Fakultät für Mathematik, Informatik und Naturwissenschaften, Universität Hamburg, Grindelallee 48, D-20146 Hamburg (Germany); Benka, G.; Pfleiderer, C. [Physik-Department, Technische Universität München, James-Franck-Strasse 1, D-85748 Garching (Germany)

    2016-12-15

    A new solid solution system, In{sub x}Na{sub x}Mn{sub 1–2x}WO{sub 4} (0<x=≤0.26) belonging to the MnWO{sub 4}-type multiferroics was investigated. Large single crystals were grown up to several mm in length from high-temperature oxide solutions using a solvent mixture of Na{sub 2}WO{sub 4} and Na{sub 2}W{sub 2}O{sub 7}. Quantitative doping degrees were analyzed by means of electron microprobe. Single crystal X-ray diffraction studies agreed with the polar space group P2 for In{sub x}Na{sub x}Mn{sub 1–2x}WO{sub 4}. The complexity of partial (Na{sup +}/Mn{sup 2+})- and (In{sup 3+}/Mn{sup 2+})-ordering makes their atomic sites unique, explaining the dissymmetrization from P2/c down to P2. This is also valid for the InNaW{sub 2}O{sub 8}-type Mn{sub 2y}In{sub 1-y}Na{sub 1-y}W{sub 2}O{sub 8} solid solution found as co-product in this study. Specific heat and magnetisation measurements showed a paramagnetic dilution effect from (In{sup 3+}/Na{sup +})-doping while lowering the transition temperature for the multiferroic phase AF2 of In{sub x}Na{sub x}Mn{sub 1–2x}WO{sub 4} with respect to the prototype MnWO{sub 4}. - Graphical abstract: A volume expansion around Mn2 site by (In, Na)-doping is drawn by the atomic shifts in a Mn2O{sub 6} octahedron in the atomistic structure of In{sub 0.20(2)}Na{sub 0.17(2)}Mn{sub 0.63(4)}WO{sub 4} from the respective atomic positions of In-free MnWO{sub 4}. The size and direction of arrows are scaled up for indicating the consequent local distortion. - Highlights: • HT solution crystal growth of (In, Na):MnWO{sub 4}-solid-solution compounds. • Polar space group symmetry P2 for their atomistic structures. • Magnetic properties of the multiferroic phase AF2 by (In{sup 3+}, Na{sup +})-doping. • Magnetic phase transitions.

  2. Microwave-induced combustion synthesis and electrical conductivity of Ce1-xGd xO2-1/2x ceramics

    International Nuclear Information System (INIS)

    Fu, Y.-P.; Chang, Y.-S.; Wen, S.-B.

    2006-01-01

    Ce 1-x Gd x O 2-1/2x nanopowder were successfully synthesized by microwave-induced combustion process. For the preparation, cerium nitrate, gadolinium nitrate hexahydrate, and urea were used for the microwave-induced combustion process. The process took only 30 min to obtain Ce 1-x Gd x O 2-1/2x powders. The exo-endo temperature, phase identification, and morphology of resultant powders were investigated by TG/DTA, XRD, and SEM. The as-received Ce 1-x Gd x O 2-1/2x powders showed that the average particle size ranged from 18 to 50 nm, crystallite dimension varied from 11 to 20 nm, and the specific surface area was distribution from 16 to 46 m 2 /g. As for Ce 1-x Gd x O 2-1/2x ceramics sintered at 1450 deg. C for 3 h, the bulk density of Ce 1-x Gd x O 2-1/2x ceramics were over 91% of the theoretical density, the maximum electrical conductivity, σ 700deg.C = 0.017 S/cm with minimum activation energy, E a = 0.869 eV was found at Ce 0.80 Gd 0.20 O 1.90 ceramic

  3. ??????????? ????????? ???????????? ???????????? NH4X (?=??,?1) ??? ??????????? CdxHgi-xTe ??????? ???????? ???????????? ???????

    OpenAIRE

    ??????, ?. ?.; ?????????, ?. ?.; ???????, ?. ?.; ?????????, ?. ?.; ?????????, ?. ?.

    2004-01-01

    ?? ?????? ??????????? ?????????? ???????????? ?????? ??????? ???? ??????? CdxHgi_xTe-Hg-NH4Br ??? ??????? ?????? Hg ? ????????? ?????????? 560-860? ? ??????????? ?????? ?? = 103-=-105 ?? ????????? ????????, ??? ??????? ???????? ????? ? ??????????????? ??????, ????? ? ?????? - CdBr2, Hg, ??2. ??? ????????? ??????? ??????? ???????????? CdxHgi_xTe ??????? ? = 0.2; 0.3; 0.4 ?? ????????? ??? ??? ? ??? ?????????? ??????? ???????? ??????? (??? ?????? ?????? ????? ? ???????) ????????? ??????????? ???...

  4. Reaction of hydrogen with the Laves phase (C14) TiCr1.78-xMnx compounds

    International Nuclear Information System (INIS)

    Agresti, F.; Lo Russo, S.; Maddalena, A.; Principi, G.; Mazzolai, G.; Coluzzi, B.; Biscarini, A.; Mazzolai, F.M.; Tuissi, A.

    2009-01-01

    The lattice constants a and c of the as cast hexagonal (C14) Laves phase TiCr 1.78-x Mn x (x = 0, 0.4, 0.6 and 0.8) have been measured by X-ray diffraction at room temperature as a function of the Mn content. It has been found that a decreases with increasing x while c remains almost unchanged. Being this alloy interesting as material for solid state hydrogen storage, pressure-composition isotherms have been traced on desorption mode for the H 2 gas pressure and temperature varying from 10 to 0.01 MPa and from 209 to 307 K, respectively. From the temperature dependence of the plateau pressure the molar quantities ΔH-bar H 2 and ΔS-bar H 2 associated with the hydride decomposition have been determined as a function of the Mn content. With increasing x, both ΔH-bar H 2 and ΔS-bar H 2 progressively decrease, and the desorption pressure initially decreases (for x ≤ 0.4) then slightly increases. At the same time, the pseudo-plateaus become flatter.

  5. Structural and magnetic studies of the Co{sub 1+x}Ti{sub x}Fe{sub 2(1x)}O{sub 4} ferrites

    Energy Technology Data Exchange (ETDEWEB)

    Amer, M.A., E-mail: moazamer@hotmail.com

    2017-03-15

    The cubic spinel Co{sub 1+x}Ti{sub x}Fe{sub 2(1x)}O{sub 4} ferrites, 0.0≤x≤0.5, were prepared by the standard ceramic technique. The samples were examined using the techniques; XRD, FT-IR, SEM and VSM. The average lattice parameter showed dependence on x, whereas the crystallite and grain size and strain did not. The infrared spectra showed six absorption bands in the range of 200–1000 cm{sup −1}. They were assigned to the corresponding metallic ion–oxygen bonds among the A- and B-sites. The absorption bands ν{sub 1} and ν{sub 2} and their intensities and force constants F{sub 1} and F{sub 2} were increased against x. Using the transmitted and absorbed energy, the IR velocity and refractive index and jump rate of vacancies were determined and discussed as functions of x. The trend of sauration magnetization Ms was decreased with x, whereas that of coercivity and anisotropy constant was increased. The determined Debye temperature and stiffness constant of the samples were discussed as functions of x. The absorption bands ν{sub 1} and ν{sub 2} proved dependence on the distance between magnetic ions (hopping length) L{sub A-A} and L{sub B-B} at the A- and B-sites, respectively, whereas F{sub 1} and F{sub 2} proved dependence on Ms. - Highlights: • Trend of Ms showed decrease with x, whereas that of Hc and K showed increase. • IR velocity and refractive index and jump rate of vacancies revealed dependence on x. • Debye temperature and stiffness constant showed increase with the additional factor x. • IR bands ν{sub 1} and ν{sub 2} were decreased with the distance between magnetic ions L{sub A} and L{sub B}. • Force constants F{sub 1} and F{sub 2} were affected by the saturation magnetization Ms.

  6. Influence of carbon on structure stability, mechanical and tribological properties of β-Si3(Cx,N1x)4 silicon carbonitride

    Science.gov (United States)

    Zhong, Jing; Hua, Guomin; Chen, Linbo; Li, Changsheng; Yang, Jianhong; Cheng, Xiaonong

    2018-05-01

    In this study, β-Si3(Cx,N1x)4 Silicon Carbonitride was prepared by Self-Propagation High-Temperature Synthesis (SHS). And the influence of carbon on structure stability, mechanical and tribological properties of β-Si3(Cx,N1x)4 were investigated. The results showed that the solubility of carbon in β-Si3(Cx,N1x)4 was about 10 wt%, beyond which cubic-SiC segregated out of β-Si3(Cx,N1x)4 to form β-Si3N4/cubic-SiC composite. Regarding influences of carbon concentration on mechanical properties, the hardness of β-Si3(Cx,N1x)4 decreased from 1400 Hv to 1200 Hv with the increase of carbon concentration. Whereas, the fracture toughness of β-Si3(Cx,N1x)4 increased from 6.5 MPa · m0.5 to 7.6 MPa · m0.5 with the increase of carbon concentration. The tribological property studies revealed the anti-wear performance of β-Si3(Cx,N1x)4 was enhanced by the increase of carbon concentration. The dominated wear mechanism could be attributed to the abrasive wear by fracture.

  7. Crystal structure of 2-(thiophen-2-yl)-1-(5-thioxo-4,5-dihydro-1,3,4-oxadiazol-2-yl) ethenyl]benzamide: N,N-dimethylformamide (1 : 1)

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, P. [University of Jammu, X-ray Crystallography Laboratory, Department of Physics (India); Subbulakshmi, K. N.; Narayana, B. [Mangalore University, Department of Chemistry (India); Sarojini, B. K. [Mangalore University, Industrial Chemistry Division, Department of Studies in Chemistry (India); Kant, R., E-mail: rkant.ju@gmail.com [University of Jammu, X-ray Crystallography Laboratory, Department of Physics (India)

    2016-03-15

    The title compound, 2-(thiophen-2-yl)-1-(5-thioxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)ethenyl] benzamide:N,N-dimethylformamide (1: 1), (C{sub 15}H{sub 11}N{sub 3}O{sub 2}S{sub 2} · C{sub 3}H{sub 7}NO), was synthesized, and its structure was established by spectral analysis and X-ray diffraction studies. The compound crystallizes in the monoclinic space group P2{sub 1}/n with a = 10.8714(7), b = 9.0497(5), c = 19.8347(13) Å, β = 91.093(5)°, Z = 4. The crystal structure is stabilized by N–H···S, C–H···O and N–H···O hydrogen bonds. The π···π interactions are also observed between the rings.

  8. Microwave assisted synthesis of core–shell LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4}/C nanocomposite cathode for high-performance lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Li, Huanhuan [Automotive Engineering Research Institute, Jiangsu University, 301 Xuefu Road, Zhenjiang 212013 (China); Li, Yunxing [School of Material Science and Engineering, Jiangsu University, Zhenjiang 212013 (China); Chen, Long; Jiang, Haobin [Automotive Engineering Research Institute, Jiangsu University, 301 Xuefu Road, Zhenjiang 212013 (China); Wei, Jinping [Institute of New Energy Material Chemistry, Key Laboratory of Advanced Energy Materials Chemistry (Ministry of Education), Nankai University, Tianjin 300071 (China); Wang, Hongbo [China Aviation Lithium Battery Co. Ltd., Luoyang 471003 (China); Wang, Yaping, E-mail: wangyaping@ujs.edu.cn [School of Material Science and Engineering, Jiangsu University, Zhenjiang 212013 (China)

    2014-12-25

    Highlights: • We firstly report a fast microwave heating way to prepare LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4}/C. • The reversible discharge capacity of LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4}/C is about 169 mA h g{sup −1}. • LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4}/C nanocomposite elucidates excellent cyclic stability. • LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4}/C nanocomposite exhibits attractive rate capability. - Abstract: A microwave assisted method is developed for synthesizing pure LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4} and LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4}/C nanocomposite. Olivine LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4} coated with uniform amorphous carbon film of ∼5 nm in thickness with an average size of ∼200 nm is successfully obtained. Compared with pure LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4}, LiFe{sub 1/3}Mn{sub 1/3}Co{sub 1/3}PO{sub 4}/C composite presents enhanced electrochemical Li-ion intercalation performances. It exhibits a high discharge capacity of 169 mA h g{sup −1} at 0.1 C (theoretical capacity is 170 mA h g{sup −1}). The capacity retention is 99% after 30 cycles. Furthermore, the capacities are still retained 101 at 5 C and 76 mA h g{sup −1} and 20 C, respectively. Carbon coating can significantly improve the Li-ion diffusion, the reversibility of lithium extraction/insertion and electrical conductivity of LiCo{sub 1/3}Mn{sub 1/3}Fe{sub 1/3}PO{sub 4}.

  9. Glassy behavior in the layered perovskites La2−xSrxCoO4(1.1≤x≤1.3)

    International Nuclear Information System (INIS)

    Mukherjee, S.; Mukherjee, Rajarshi; Banerjee, S.; Ranganathan, R.; Kumar, Uday

    2012-01-01

    The glassy behavior of the phase segregated state in the layered cobaltite La 2−x Sr x CoO 4 has been studied. The role of the inter-cluster interactions as well as the disordered spins at the paramagnetic–ferromagnetic interface, behind the observed glassy behavior have been investigated. The disordered spins at the interface appear to be strongly pinned, and they contribute little to the observed glassy behavior. On the other hand, the inter-cluster interactions play the key role. Both the Co 4+ and Co 3+ ions are in the intermediate spin state. - Highlights: ► Phase segregated state of cobaltite La 2−x Sr x CoO 4 for (1.1≤x≤1.3) to find the origin of the observed glassy behavior. ► Result of the frequency dependent ac susceptibility measurement excludes the possibility of any spin glass phase, hints strong inter-cluster interactions. ► Relaxation experiments confirm the system to be a collection of clusters with two preferred sizes. ► The glassy behavior originates from strong inter-cluster interactions.

  10. Synthesis of g-C3N4/Fe3O4 nanocomposites and application as a new sorbent for solid phase extraction of polycyclic aromatic hydrocarbons in water samples.

    Science.gov (United States)

    Wang, Man; Cui, Shihai; Yang, Xiaodi; Bi, Wentao

    2015-01-01

    An easy preparation of g-C3N4/Fe3O4 nanocomposites by chemical co-precipitation has been demonstrated. The as-prepared materials were characterized by X-ray diffraction, transmission electron microscopy, Fourier transform infrared spectroscopy and thermogravimetric analysis. The high affinity of g-C3N4 toward polycyclic aromatic hydrocarbons and the magnetic behavior of Fe3O4 were combined to provide an efficient and simple magnetic solid phase extraction (MSPE). The adsorption and desorption of polycyclic aromatic hydrocarbons on g-C3N4/Fe3O4 were examined. Different factors affecting the magnetic solid phase extraction of polycyclic aromatic hydrocarbons were assessed in terms of adsorption, desorption, and recovery. Under the optimized conditions, the proposed method showed good limits of detection (LOD, S/N=3) in the range of 0.05-0.1 ng mL(-1) and precision in the range of 1.8-5.3% (RSDs, n=3). This method was also successfully applied to the analysis of real water samples; good spiked recoveries over the range of 80.0-99.8% were obtained. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Effect of applied bias voltage on corrosion-resistance for TiC 1- xN x and Ti 1- xNb xC 1- yN y coatings

    Science.gov (United States)

    Caicedo, J. C.; Amaya, C.; Yate, L.; Aperador, W.; Zambrano, G.; Gómez, M. E.; Alvarado-Rivera, J.; Muñoz-Saldaña, J.; Prieto, P.

    2010-02-01

    Corrosion-resistance behavior of titanium carbon nitride (Ti-C-N) and titanium niobium carbon nitride (Ti-Nb-C-N) coatings deposited onto Si(1 0 0) and AISI 4140 steel substrates via r.f. magnetron sputtering process was analyzed. The coatings in contact with a solution of sodium chloride at 3.5% were studied by Tafel polarization curves and impedance spectroscopy methods (EIS). Variations of the bias voltage were carried out for each series of deposition to observe the influence of this parameter upon the electrochemical properties of the coatings. The introduction of Nb in the ternary Ti-C-N film was evaluated via X-ray diffraction (XRD) analysis. The structure was characterized by using Raman spectroscopy to identify ternary and quaternary compounds. Surface corrosion processes were characterized using optical microscopy and scanning electron microscopy (SEM). XRD results show conformation of the quaternary phase, change in the strain of the film, and lattice parameter as the effect of the Nb inclusion. The main Raman bands were assigned to interstitial phases and "impurities" of the coatings. Changes in Raman intensities were attributed to the incorporation of niobium in the Ti-C-N structure and possibly to resonance enhancement. Finally, the corrosion data obtained for Ti-C-N were compared with the results of corrosion tests of Ti-Nb-C-N coating. The results obtained showed that the incorporation of niobium to Ti-C-N coatings led to an increase in the corrosion-resistance. On another hand, an increase in the bias voltage led to a decrease in the corrosion-resistance for both Ti-C-N and Ti-Nb-C-N coatings.

  12. X-ray Photoelectron Spectroscopy Database (Version 4.1)

    Science.gov (United States)

    SRD 20 X-ray Photoelectron Spectroscopy Database (Version 4.1) (Web, free access)   The NIST XPS Database gives access to energies of many photoelectron and Auger-electron spectral lines. The database contains over 22,000 line positions, chemical shifts, doublet splittings, and energy separations of photoelectron and Auger-electron lines.

  13. Density of liquid Hg(1-x)Cd(x)Te

    Science.gov (United States)

    Chandra, D.; Holland, L. R.

    1983-01-01

    Negative thermal expansion has been established in liquid Hg(1-x)Cd(x)Te for x less than 0.2 employing a pycnometric method. Pure HgTe increases in density from its melting point at 670 C to a maximum value at 750 C, where normal thermal expansion progressively resumes. The dependence of density on temperature for liquid Hg(1-x)Cd(x)Te arises almost exclusively from the HgTe portion of the melt, while CdTe acts as a diluent. The temperature corresponding to the maximum density changes slightly with composition, increasing by about 5 C for x = 0.1.

  14. TaxHf1xB2–SiC multiphase oxidation protective coating for SiC-coated carbon/carbon composites

    International Nuclear Information System (INIS)

    Ren, Xuanru; Li, Hejun; Fu, Qiangang; Li, Kezhi

    2014-01-01

    Highlights: • Ta x Hf 1x B 2 –SiC coating was prepared on SiC coated C/C by in-situ reaction method. • TaB 2 and HfB 2 were introduced in the form of solid solution Ta x Hf 1x B 2 . • The coating could protect C/C for 1480 h with only 0.57% mass loss at 1773 K in air. • Oxidation layer consists of out Ta–Si–O compound layer and inner SiO 2 glass layer. • Ta–Si–O compound silicate layer presents a better stability than SiO 2 glass layer. - Abstract: A Ta x Hf 1x B 2 –SiC coating was prepared by in-situ reaction method on SiC coated C/C composites. Ta x Hf 1x B 2 phase is the form of solid solution between TaB 2 and HfB 2 . Isothermal oxidation behavior at 1773 K and ablation behavior of the coated C/C were tested. Ta x Hf 1x B 2 –SiC/SiC coating could protect the C/C from oxidation at 1773 K for 1480 h and ablation above 2200 K for 40 s. During oxidation, oxides of Ta and Hf atoms exist as “pinning phases” in the compound glass layer consisted of outer Ta–Si–O compound silicate layer and inner SiO 2 glass layer, which was responsible for the excellent oxidation resistance

  15. Thermal expansion of phosphates with the NaZr2(PO4)3 structure containing lanthanides and zirconium: R0.33Zr2(PO4)3 (R = Nd, Eu, Er) and Er0.33(1x) Zr0.25xZr2(PO4)3

    International Nuclear Information System (INIS)

    Volgutov, V. Yu.; Orlova, A. I.

    2015-01-01

    Phosphates R 0.33 Zr 2 (PO 4 ) 3 (R = Nd, Eu, or Er) and Er 0.33(1x) Zr 0.25 Zr 2 (PO 4 ) 3 (x = 0, 0.25, 0.5, 0.75, 1.0) of the NaZr 2 (PO 4 ) 3 family have been synthesized and investigated by high-temperature X-ray diffraction. The crystallochemical approach is used to obtain compounds with expected small and controllable thermal-expansion parameters. Phosphates with close-to-zero thermal-expansion parameters, including those with low thermal-expansion anisotropy, have been obtained: Nd 0.33 Zr 2 (PO 4 ) 3 with α a =–2.21 × 10 −6 °C1 , α c = 0.81 × 10 −6 °C1 , and Δα = 3.02 × 10 −6 °C1 and Er 0.08 Zr 0.19 Zr 2 (PO 4 ) 3 with α a =–1.86 × 10 −6 °C1 , α c = 1.73 × 10 −6 °C1 , and Δα = 3.58 × 10 −6 °C1

  16. Structure, morphology, and cathode performance of Li{sub 1-x}[Ni{sub 0.5}Mn{sub 1.5}]O{sub 4} prepared by coprecipitation with oxalic acid

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Dongqiang; Han, Jiantao; Goodenough, John B. [Texas Materials Institute, ETC 9.184, University of Texas at Austin, 1 University Station, C2200, Austin, TX 78712 (United States)

    2010-05-01

    The cathode materials Li{sub 1-x}[Ni{sub 0.5}Mn{sub 1.5}]O{sub 4} prepared by coprecipitation from acetate solution by oxalic acid and annealing at 900 C in air had the preferred disordered Ni and Mn on the 16d octahedral sites of a spinel Fd anti 3m structure. The coprecipitation method provides better crystallinity than the Fd anti 3m phase previously obtained by quenching from the melt. Polycrystalline octahedral-shaped particles with smooth surfaces contained trace amounts of a Li{sub y}Ni{sub 1-y}O impurity that introduced some Mn(III) into the spinel phase. Half-cells cycled at 0.2 C rate between 3.5 and 4.8 V versus Li exhibited a flat voltage V {approx} 4.7 V with a small step at x {approx} 0.5 and a capacity at room temperature of 130 mAh g{sup -1} that showed no fade after 50 cycles. A small capacity fade was initiated with a cut-off voltage {>=}4.9 V; a significant capacity loss between 2 and 5 C cycling rates was reversible to 134 mAh g{sup -1} on returning to 0.1 C after 50 cycles at 10 C between 3.5 and 5.0 V. (author)

  17. Association between Virulence Factors and TRAF1/4-1BB/Bcl-xL Expression in Gastric Mucosa Infected with Helicobacter pylori

    Directory of Open Access Journals (Sweden)

    Fen Wang

    2015-01-01

    Full Text Available Objective. CagA+/vacAs1+/vacAm1+ Helicobacter pylori upregulates the expression of tumor necrosis factor receptor–associated factor 1 (TRAF1, tumor necrosis factor receptor superfamily member 9 (4-1BB, and B-cell lymphoma-extra large (Bcl-xL in human gastric epithelial cells. We investigated the correlation between cagA/vacAs1/vacAm1 and TRAF1/4-1BB/Bcl-xL expression in gastric mucosal tissue of patients with gastric disorders. Methods. We collected gastric mucosa samples from 35 chronic, nonatrophic gastritis (CG patients, 41 atrophic gastritis patients, 44 intestinal metaplasia with atypical hyperplasia (IM patients, and 28 gastric carcinoma (Ca patients. The expression of  TRAF1, 4-1BB, and Bcl-xL was determined using western blotting. The expression of cagA, vacAs1, and vacAm1 in H. pylori was examined with polymerase chain reaction. Results. The expression of TRAF1, 4-1BB, and Bcl-xL was significantly upregulated in IM and Ca patients (P<0.05 compared with CG. There were more cases of cagA+/vacAs1+/vacAm1+ H. pylori infection in samples with elevated TRAF1, 4-1BB, or Bcl-xL expression (P<0.05. Additionally, there were a remarkably large number of samples with upregulated TRAF1/4-1BB/Bcl-xL expression in cases of cagA+/vacAs1+/vacAm1+ H. pylori infection (44 cases, 67.7%; P<0.05. Conclusions. The pathogenesis of IM and Ca may be promoted by cagA+/vacAs1+/vacAm1+ H. pylori, possibly via upregulated TRAF1, 4-1BB, and Bcl-xL in gastric mucosal tissue.

  18. Sex-specific expression of the X-linked histone demethylase gene Jarid1c in brain.

    Directory of Open Access Journals (Sweden)

    Jun Xu

    Full Text Available Jarid1c, an X-linked gene coding for a histone demethylase, plays an important role in brain development and function. Notably, JARID1C mutations cause mental retardation and increased aggression in humans. These phenotypes are consistent with the expression patterns we have identified in mouse brain where Jarid1c mRNA was detected in hippocampus, hypothalamus, and cerebellum. Jarid1c expression and associated active histone marks at its 5'end are high in P19 neurons, indicating that JARID1C demethylase plays an important role in differentiated neuronal cells. We found that XX mice expressed Jarid1c more highly than XY mice, independent of their gonadal types (testes versus ovaries. This increased expression in XX mice is consistent with Jarid1c escape from X inactivation and is not compensated by expression from the Y-linked paralogue Jarid1d, which is expressed at a very low level compared to the X paralogue in P19 cells. Our observations suggest that sex-specific expression of Jarid1c may contribute to sex differences in brain function.

  19. The Co-III-C bond in (1-thia-4,7-diazacyclodecyl-kappa N-3(4),N-7,C-10)(1,4,7-triazacyclononane-kappa N-3(1),N-4,N-7)-cobalt(III) dithionate hydrate

    DEFF Research Database (Denmark)

    Harris, Pernille; Kofod, P.; Song, Y.S.

    2003-01-01

    In the title compound, [Co(C6H15N3)(C7H15N2S)]S2O6.H2O, the Co-C bond distance is 1.9930 (13) Angstrom, which is shorter than for related compounds with the linear 1,6-diamino-3-thiahexan-4-ide anion in place of the macrocyclic 1-thia-4,7-diazacyclodecan-8-ide anion. The coordinated carbanion pro...... produces an elongation of 0.102 (7) Angstrom of the Co-N bond to the 1,4,7-triazacyclononane N atom in the trans position. This relatively small trans influence is presumably a result of the triamine ligand forming strong bonds to the Co-III atom....

  20. Magnetic properties of (Mn1-xRux)3Ga alloys

    International Nuclear Information System (INIS)

    Hori, T.; Akimitsu, M.; Miki, H.; Ohoyoama, K.; Yamaguchi, Y.

    2002-01-01

    We found that the pseudo binary alloys Mn 1-x Ru x 3 Ga, with 0.33≤x≤0.67, have an ordered b.c.c. structure. The lattice constant a is almost constant with respect to x: a=6.000 A for x=0.33 and a=5.992 A for x=0.67. For the alloy with x=0.33, i.e. Mn 2 RuGa, the magnetization is almost saturated in a field of 20 kOe. The saturation magnetization at 4.2 K is 23 emu/g, and the Curie temperature, T C , is 460 K. The T C of (Mn 1-x Ru x ) 3 Ga decreases almost linearly with increasing x, and it vanishes around x=0.67 (MnRu 2 Ga). We also determined atomic and magnetic structures from neutron diffraction experiments. The alloy Mn 2 RuGa (x=0.33) has an ordered structure of CuHg 2 Ti type; the magnetic Mn atoms mainly occupy the 4a (0,0,0) and 4d (3/4,3/4,3/4) sites. We also observed that the magnetic moments of Mn atoms on the 4a and 4d sites are antiparallel to each other; values of the magnetic moment are μ a =4.6 and μ d =3.3 μ B per Mn atom. (orig.)

  1. Magnetic properties of Co2-xCux(OH)PO4 (x=0, 1 and 2)

    International Nuclear Information System (INIS)

    Pedro, I. de; Jubera, V.; Rojo, J.M.; Lezama, L.; Sanchez Marcos, J.; Rodriguez Fernandez, J.; Mesa, J.L.; Rojo, T.; Arriortua, M.I.

    2004-01-01

    The isostructural Co 2-x Cu x (OH)PO 4 (x=0, 1 and 2) phases have been prepared from hydrothermal synthesis and characterized from powder X-ray diffraction. The structure consists of a three-dimensional framework in which M(1)O 5 -trigonal bipyramid dimers and M(2)O 6 -octahedral chains are simultaneously present. Magnetization measurements of Co 2 (OH)(PO 4 ) show the existence of two maxima attributed to a three-dimensional antiferromagnetic ordering at 70 K and a spin-glass-like state at 12 K. When Co 2+ is substituted by Cu 2+ ions, the spin-glass behavior disappears and the magnetic order is decreased

  2. Inhibitory effect of 12C6+ ion and X-ray on angiogenesis in HMEC-1

    International Nuclear Information System (INIS)

    Liu Yuanyuan; Zhang Hong; Liu Yang; Wu Zhenhua; Sun Chao; Li Hongyan

    2013-01-01

    The study aims to explore the effect of 12 C 6+ ion and X-ray on proliferation, migration, tube formation and MMPS of human microvascular endothelial cells (HMEC-1). Transwell migration experiment showed that the radiation could inhibit the migration of HMEC-1 in sub-lethal dose 24 h after irradiation. Furthermore, the inhibition ability of 12 C 6+ ion was stronger than that of X-ray. Matrigel experiment indicated that 12 C 6+ ion suppressed the tube formation of HMEC-1 spontaneously. However, the inhibitory effect of X-ray had no significance. Meanwhile, Gelatin Zymography showed the expression of MMP-2 was inhibited obviously by 12 C 6+ ion, while X-ray had little effect on the expression of MMP-2. In conclusion, 12 C 6+ ion is superior to X-ray in radiotherapy of tumor. (authors)

  3. Metal-insulator transition in Si(111)-(4 x 1)/(8 x 2)-In studied by optical spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Speiser, E.; Hinrichs, K.; Cobet, C.; Esser, N. [Leibniz-Institut fuer Analytische Wissenschaften - ISAS - e.V., Albert-Einstein-Str. 9, 12489 Berlin (Germany); Chandola, S. [Leibniz-Institut fuer Analytische Wissenschaften - ISAS - e.V., Albert-Einstein-Str. 9, 12489 Berlin (Germany); School of Physics, Trinity College Dublin 2 (Ireland); Gensch, M. [Helmholtz Zentrum Berlin (Germany); Wippermann, S.; Schmidt, W.G. [Theoretische Physik, Universitaet Paderborn (Germany); Bechstedt, F. [Institut fuer Festkoerpertheorie und -Optik, Friedrich-Schiller-Universitaet, Jena (Germany); Richter, W. [Dipartimento di Fisica, Universita di Roma Tor Vergata, Via della Ricerca Scientifica 1, 00133 Roma (Italy); Fleischer, K.; McGilp, J.F. [School of Physics, Trinity College Dublin 2 (Ireland)

    2010-08-15

    Measurements of the surface vibrational modes and optical response of Si(111)-(4 x 1)/(8 x 2)-In are compiled and a comparison to ab initio calculations performed within DFT-LDA formalism is given. Surface resonant Raman spectroscopy allows identifying a number of surface phonons with high spectral precision. The phase transition of the (4 x 1)-(8 x 2) surface structure is found to be accompanied by characteristic changes of the surface phonons, which are discussed with respect to various structural models suggested. The optical anisotropy of the (8 x 2) phase shows that the anisotropic Drude tail of the (4 x 1) phase is replaced by two peaks at 0.50 and 0.72 eV. The spectroscopic signatures of the (4 x 1) and (8 x 2) phases agree with a metal-insulator transition. The mid-IR-anisotropic optical response of the insulating (8 x 2) phase is interpreted in terms of electronic single particle excitations between surface electronic bands related to the In-nanowire surface. Comparison of the measured optical transitions with DFT ab initio calculations for the hexagon model and the trimer model of the (8 x 2) structure shows evidence for the existence of the hexagon structure. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  4. CHANDRA OBSERVATIONS OF COMETS C/2012 S1 (ISON) AND C/2011 L4 (PanSTARRS)

    Energy Technology Data Exchange (ETDEWEB)

    Snios, Bradford; Kharchenko, Vasili [Department of Physics, University of Connecticut, Storrs, CT 06269 (United States); Lisse, Carey M. [Planetary Exploration Group, Space Department, Johns Hopkins University Applied Physics Laboratory, Laurel, MD 20723 (United States); Wolk, Scott J. [Chandra X-Ray Observatory Center, Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Dennerl, Konrad [Max-Planck-Institut für extraterrestrische Physik, D-85748 Garching (Germany); Combi, Michael R. [Department of Climate and Space Sciences and Engineering, University of Michigan, Ann Arbor, MI 48109 (United States)

    2016-02-20

    We present our results on the Chandra X-ray Observatory Advanced CCD Imaging Spectrometer (ACIS) observations of the bright Oort Cloud comets C/2012 S1 (ISON) and C/2011 L4 (PanSTARRS). ISON was observed between 2013 October 31–November 06 during variable speed solar wind (SW), and PanSTARRS was observed between 2013 April 17–23 during fast SW. ISON produced an extended parabolic X-ray morphology consistent with a collisionally thick coma, while PanSTARRS demonstrated only a diffuse X-ray-emitting region. We consider these emissions to be from charge exchange (CX) and model each comet's emission spectrum from first principles accordingly. Our model agrees with the observational spectra and also generates composition ratios for heavy, highly charged SW ions interacting with the cometary atmosphere. We compare our derived SW ion compositions to observational data and find a strong agreement between them. These results further demonstrate the utility of CX emissions as a remote diagnostics tool of both astrophysical plasma interaction and SW composition. In addition, we observe potential soft X-ray emissions via ACIS around 0.2 keV from both comets that are correlated in intensity to the hard X-ray emissions between 0.41.0 keV. We fit our CX model to these emissions, but our lack of a unique solution at low energies makes it impossible to conclude if they are cometary CX in origin. Finally, we discuss probable emission mechanism sources for the soft X-rays and explore new opportunities these findings present in understanding cometary emission processes via Chandra.

  5. Synthesis, characterization and mechanoluminescence of europium doped ZnxBa(1x)Al2O4 (x=0, 0.4, 0.5, 0.6, 0.8, 1.0) phosphor

    International Nuclear Information System (INIS)

    Sajan, S.J.; Gopakumar, N.; Anjana, P.S.; Madhukumar, K.

    2016-01-01

    The samples of Zn x Ba (1x) Al 2 O 4 :0.1%Eu (x=0, 0.4, 0.5, 0.6, 0.8, 1.0) were prepared via high temperature solid state reaction method. The phase formation of the powder samples were confirmed by taking X-ray diffraction analysis. The mechanoluminescence (ML) property of the samples by impact method was studied by using ML measuring apparatus. The variations in the ML peak intensity due to the impact velocity of a load falling from different heights and due to the variation of composition were investigated. The photoluminescence studies of the samples were also conducted.

  6. Transforming growth factor beta 1 expression and inflammatory cells in tooth extraction socket after X-ray irradiation

    Directory of Open Access Journals (Sweden)

    Ramadhan Hardani Putra

    2016-06-01

    Full Text Available Background: Radiographic examination is often used in dentistry to evaluate tooth extraction complications. X-ray used in radiographic examination, however, has negative effects, including damage to DNA and inflammatory response during wound healing process. Purpose: This study aimed to analyze the effects of X-ray irradiation on transforming growth factor beta 1 (TGF-ß1 expression and number of inflammatory cells in tooth extraction sockets. Method: Thirty rats were divided into three groups, which consist of control group (with a radiation of 0 mSv, treatment group 1 (with a radiation of 0.08 mSv, and treatment group 2 (with a radiation of 0.16 mSv. These rats in each group were sacrificed on days 3 and 5 after treatment. Inflammatory cells which were observed in this research were PMN, macrophages, and lymphocytes. Histopathological and immunohistochemical examinations were used to calculate the number of inflammatory cells and TGF-ß1 expression. Obtained data were analyzed using SPSS 16.0 software with one way ANOVA and Tukey’s HSD tests. Result: There was no significant decrease in the number of PMN. On the other hand, there were significant decreases in the number of macrophages and lymphocytes in the sacrificed group on day-5 with the radiation of 0.16 mSv. Similarly, the most significant decreased expression of TGF-ß1 was found in the group sacrificed on day 5 with the radiation of 0.16 mSv. Conclusion: X-ray irradiation with 0.08 mSv and 0.16 mSv doses can decrease TGF-ß1 expression and number of inflammatory cells in tooth extraction sockets on day 3 and 5 post extraction.

  7. U(1) x U(1) x U(1) symmetry of the Kimura 3ST model and phylogenetic branching processes

    International Nuclear Information System (INIS)

    Bashford, J D; Jarvis, P D; Sumner, J G; Steel, M A

    2004-01-01

    An analysis of the Kimura 3ST model of DNA sequence evolution is given on the basis of its continuous Lie symmetries. The rate matrix commutes with a U(1) x U(1) x U(1) phase subgroup of the group GL(4) of 4 x 4 invertible complex matrices acting on a linear space spanned by the four nucleic acid base letters. The diagonal 'branching operator' representing speciation is defined, and shown to intertwine the U(1) x U(1) x U(1) action. Using the intertwining property, a general formula for the probability density on the leaves of a binary tree under the Kimura model is derived, which is shown to be equivalent to established phylogenetic spectral transform methods. (letter to the editor)

  8. Mild hydrothermal synthesis, crystal structure, thermal behavior, spectroscopic and magnetic properties of the (NH4)[Fe(AsO4)1-x(PO4)xF] (x=0.3, 0.6, 0.8) series. Thermal transformation of (NH4)[Fe(AsO4)0.7(PO4)0.3F] into the textural porous orthorhombic Fe(AsO4)0.7(PO4)0.3

    International Nuclear Information System (INIS)

    Berrocal, Teresa; Mesa, Jose L.; Pizarro, Jose L.; Bazan, Begona; Lezama, Luis; Arriortua, Maria I.; Rojo, Teofilo

    2009-01-01

    The (NH 4 )[Fe(AsO 4 ) 1-x (PO 4 ) x F] (x=0.3, 0.6, 0.8) series of compounds has been synthesized under mild hydrothermal conditions. The compounds crystallize in the orthorhombic Pna2 1 space group, with the unit-cell parameters a=13.1718(1), b=6.5966(6), c=10.797(1) A for x=0.3; a=13.081(1), b=6.5341(6), c=10.713(1) A for x=0.6 and a=13.0329(9), b=6.4994(4), c=10.6702(6) A for x=0.8, with the volumes 938.6(1), 915.7(1) and 903.8(1) A 3 , respectively, with Z=8. Single crystals of (NH 4 )[Fe(AsO 4 ) 0.7 (PO 4 ) 0.3 F] heated under air atmosphere at 465 deg. C remain as single crystals, changing the composition to Fe(AsO 4 ) 0.7 (PO 4 ) 0.3 . This later phase belongs to the orthorhombic Imam space group, with the unit cell parameters a=13.328(2), b=6.5114(5), c=10.703(1) A, V=928.9(2) A 3 and Z=12. The crystal structure of the ammonium phases consists of a KTP three-dimensional framework constructed by chains formed by alternating Fe(2)O 4 F 2 or Fe(1)O 4 F 2 octahedra and As/P(2)O 4 or As/P(1)O 4 tetrahedra, respectively. These octahedra and tetrahedra are linked by a common oxygen vertex. The chains run along the 'a' and 'b' crystallographic axes. The crystal structure of Fe(AsO 4 ) 0.7 (PO 4 ) 0.3 is a three-dimensional skeleton derived from that of the precursor, formed from (100) sheets stacked along the [001] direction, and interconnected by chains of alternating Fe(2)O 6 octahedra and As/P(2)O 4 tetrahedra sharing a vertex in the 'a' direction. Transmission electronic microscopy of this compound indicates the existence of unconnected external cavities with a BET surface area of 3.91(3) m 2 g -1 . The diffuse reflectance spectra in the visible region show the forbidden electronic transitions characteristic of the Fe(III) d 5 -high spin cation in slightly distorted octahedral geometry, for all the compounds. The ESR spectra for all the compounds, carried out from room temperature to 4.2 K, remain isotropic with variation in temperature; the g-value is 1.99(1

  9. Homoleptic Diphosphacyclobutadiene Complexes [M(η4-P2C2R2)2]x- (M=Fe, Co; x=0, 1)

    NARCIS (Netherlands)

    Wolf, Robert; Ehlers, A.W.; Khusniyarov, M.M.; Hartl, F.; de Bruin, B.; Long, G.J.; Grandjean, F.; Schappacher, F.M.; Pöttgen, R.; Slootweg, J.C.; Lutz, M.; Spek, A.L.; Lammertsma, K.

    2011-01-01

    The preparation and comprehensive characterization of a series of homoleptic sandwich complexes containing diphosphacyclobutadiene ligands are reported. Compounds [K([18]crown-6)ACHTUNGTRENUNG(thf)2][Fe(η4- P2C2tBu2)2] (K1), [K([18]crown-6)- ACHTUNGTRENUNG(thf)2][Co(h4-P2C2tBu2)2] (K2), and

  10. Homoleptic Diphosphacyclobutadiene Complexes [M(η(4)-P2C2R2)(2]x- (M = Fe, Co; x=0, 1)

    NARCIS (Netherlands)

    Wolf, R.; Ehlers, A.W.; Khusniyarov, M.M.; Hartl, F.; de Bruin, B.; Long, G.J.; Grandjean, F.; Schappacher, F.M.; Pöttgen, R.; Slootweg, J.C.; Lutz, M.; Spek, A.L.; Lammertsma, K.

    2010-01-01

    The preparation and comprehensive characterization of a series of homoleptic sandwich complexes containing diphosphacyclobutadiene ligands are reported. Compounds [K([18]crown-6)(thf)(2)[Fe(η(4)-P(2)C(2)tBu(2))(2)] (K1), [K([18]crown-6)(thf)(2)][Co(η(4)-P(2)C(2)tBu(2))(2)] (K2), and

  11. Synthesis and characterization of nano-sized BaxSr1xSO4 (0≤ x ...

    Indian Academy of Sciences (India)

    A facile aqueous solution route has been employed to synthesize BaSr1–SO4 (0 41) solid solution nanocrystals at room temperature without using any surfactants or templates. The as-synthesized products were characterized by means of X-ray diffraction (XRD), X-ray fluorescence spectrometer (XRF), scanning ...

  12. Thermodynamics and long-range order of nitrogen in gamma'-Fe4N1-x

    NARCIS (Netherlands)

    Kooi, BJ; Somers, MAJ; Mittemeijer, EJ

    Models are given for the description of the chemical potential of nitrogen in gamma'-Fe4N1-x. In previous work, gamma'-Fe4N1-x was treated as a (sub)regular solution, thereby assuming that the N atoms are distributed randomly on the sites of their own sublattice. However, in gamma'-Fe4N1-x,

  13. Ferroelasticity in palmierite-type(1  -  x)Pb3(PO4)2 - xPb3(AsO4)2

    Science.gov (United States)

    Bismayer, Ulli; Mihailova, Boriana; Angel, Ross

    2017-06-01

    Lead phosphate-arsenate Pb3(P1-x As x O4)2 undergoes an improper ferroelastic phase transition from a rhombohedral paraphase R\\bar{3}m to a monoclinic ferrophase C2/c leading to distinct twin boundary patterns. On cooling compounds with x larger than 0.8 undergo further transitions to monoclinic low-temperature phases, whereas the composition with x  =  0.8 shows order-parameter coupling phenomena. The transformation R\\bar{3}m -C2/c was described on the basis of a three-state Potts model and the existence of precursors of monoclinic clusters in the rhombohedral paraphase. The system is one of the best studied improper ferroelastics. Due to its two-mode phonon behaviour the solid solution exhibits multistep temperature- as well as pressure-driven structural transformations with different length and time scales. Relevant investigations and findings of this palmierite-type material have been made by Prof E K H Salje. Some of the most prominent results from x-ray diffraction, optical microscopy and Raman scattering are reviewed, and the potential implications for domain-wall structures and engineering are discussed.

  14. Effect of superconductivity on spin dynamics in (Y/sub 1-x/Re/sub x/)Rh4B4

    International Nuclear Information System (INIS)

    Kumagai, K.; Fradin, F.Y.

    1982-01-01

    An adiabatic field-cycle method has been used to study spin dynamics of RE ions in (Y/sub 1-x/RE/sub x/)Rh 4 B 4 . Longitudinal dipolar fluctuations of RE moments are found to be the main source of the nuclear spin-lattice relaxation time of 11 B. The variation of T 1 in the superconducting state is attributed to the reduction of the electronic spin-relaxation time, tau/sub m/, which is mainly determined by the RKKY type interaction mediated by the conduction electrons. 3 figures

  15. Bandgap engineering of the Lu{sub x}Y{sub 1x}PO{sub 4} mixed crystals

    Energy Technology Data Exchange (ETDEWEB)

    Levushkina, V.S., E-mail: viktoriia.levushkina@ut.ee [Institute of Physics, University of Tartu, Ravila 14c, 50411 Tartu (Estonia); Physics Faculty, Moscow State University, Leninskiye Gory 1-2, 11991 Moscow (Russian Federation); Spassky, D.A. [Institute of Physics, University of Tartu, Ravila 14c, 50411 Tartu (Estonia); Skobeltsyn Institute of Nuclear Physics, Moscow State University, Leninskiye Gory 1-2, 11991 Moscow (Russian Federation); Aleksanyan, E.M. [Institute of Physics, University of Tartu, Ravila 14c, 50411 Tartu (Estonia); A. Alikhanyan National Science Laboratory, Yerevan Physics Institute, Alikhanyan Yeghbayrneri St. 2, 0036 Yerevan (Armenia); Brik, M.G. [Institute of Physics, University of Tartu, Ravila 14c, 50411 Tartu (Estonia); College of Sciences, Chongqing University of Posts and Telecommunications, 400065 Chongqing (China); Institute of Physics, Jan Dlugosz University, Armii Krajowej 13/15, PL-42200 Czestochowa (Poland); Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warsaw (Poland); Tretyakova, M.S.; Zadneprovski, B.I. [Central Research and Development Institute of Chemistry and Mechanics, Nagatinskaya St. 16a, 115487 Moscow (Russian Federation); Belsky, A.N. [Institute of Light and Matter, CNRS, University Lyon1, 69622 Villeurbanne (France)

    2016-03-15

    Bandgap modification of the Lu{sub x}Y{sub 1x}PO{sub 4} mixed crystals has been studied by thermostimulated luminescence (TSL) and ab-initio calculation methods. Doping of Lu{sub x}Y{sub 1x}PO{sub 4} with Ce{sup 3+} allowed to follow up the changes of electron traps depth, caused by the modification of the bottom of conduction band. The observed gradual shift of the most intensive TSL peaks to higher temperatures with increase of x value was connected with the high-energy shift of the conduction band bottom. According to the band structure calculations the bottom of the conduction band is formed by the 5d and 4d states of Lu and Y, respectively. Therefore, substitution of one cation by another is responsible for the observed variation of the electronic and optical properties. Doping with Eu{sup 3+} was used to study the modification of the hole traps and the top of the valence band in Lu{sub x}Y{sub 1x}PO{sub 4}. The independence of the TSL peaks position on x value in Lu{sub x}Y{sub 1x}PO{sub 4}:Eu{sup 3+} allows to conclude that the top of the valence band is negligibly affected by the cation substitution. According to the band structure calculations the top of the valence band is formed by the O 2p electronic states, which are not affected by the cation substitution. The resulting increase of the bandgap with x value is confirmed by the data of ab-initio calculations. - Highlights: • Band structure modification with x in Lu{sub x}Y{sub 1x}PO{sub 4}:RE{sup 3+} (RE=Ce, Eu) is studied. • Depth of electron traps is affected by the bandgap modification. • Increase of bandgap with x is due to the shift of conduction band bottom.

  16. Synthesis and Characterization of Pyridino(1,4-Η-cyclohexa-1,3-dieneDerivatives of Iron Tricarbonyl Complexes

    Directory of Open Access Journals (Sweden)

    T. I. Odiaka

    2011-01-01

    Full Text Available In this synthesis, we have been able to show that, the addition of x- substituted pyridines, (X = H, 2- Me, 3- Me 4- Me, 4-NH2 and 4-N(CH32 to the dienyl ring of the organometallic cation, [(Fe(CO3 (1-5- η-2-Me0C3H6]BF4 and [(Fe(CO3(1-5-η-C6H7]BF4 gives ionic substituted diene products, (X C5H4-C6H6Y (Fe(CO3] BF4,Y=H or 2-MeO. The reaction takes place at ordinary room temperature. The resulting products were isolated and characterized.

  17. Regioselective synthesis of 7,8-dihydroimidazo[5,1-c][1,2,4]triazine-3,6(2H,4H-dione derivatives: A new drug-like heterocyclic scaffold

    Directory of Open Access Journals (Sweden)

    Nikolay T. Tzvetkov

    2012-09-01

    Full Text Available Dihydroimidazo[5,1-c][1,2,4]triazine-3,6(2H,4H-dione derivatives were prepared by successive N3- and N1-alkylation of hydantoins, followed by regioselective thionation and subsequent cyclization under mild conditions. In a final alkylation step a further substituent may be introduced. The synthetic strategy allows broad structural variation of this new drug-like heterobicyclic scaffold. In addition to extensive NMR and MS analyses, the structure of one derivative was confirmed by X-ray crystallography.

  18. Synthesis of [diene-"1"4C] curcumin at high specific activity

    International Nuclear Information System (INIS)

    Filer, Crist N.; Lacy, James M.; Wright, Christopher

    2016-01-01

    An efficient method is described to label curcumin with "1"4C at high specific activity. - Highlights: • This paper describes the synthesis of ["1"4C] Curcumin at the highest specific activity and total activity amount yet reported. • The "1"4C label was installed in the diene framework of Curcumin. • This paper also describes the characterization of ["1"4C] Curcumin by HPLC and mass spectrometry.

  19. Thermodynamics and Long-Range Order of Nitrogen in γ'-Fe4N1-x

    NARCIS (Netherlands)

    Kooi, Bart J.; Somers, Marcel A.J.; Mittemeijer, Eric J.

    1996-01-01

    Models are given for the description of the chemical potential of nitrogen in γ'-Fe4N1-x. In previous work, γ'-Fe4N1-x was treated as a (sub)regular solution, thereby assuming that the N atoms are distributed randomly on the sites of their own sublattice. However, in γ'-Fe4N1-x, long-range ordering

  20. (C2N2H10)[Fe xV1-x(HPO3)F3] (x = 0.44, 0.72): Two new organically templated phosphites

    International Nuclear Information System (INIS)

    Cisneros, Jose L.; Fernandez-Armas, Sergio; Mesa, Jose L.; Pizarro, Jose L.; Arriortua, Maria I.; Rojo, Teofilo

    2006-01-01

    (C 2 N 2 H 10 )[Fe x V 1-x (HPO 3 )F 3 ] (x = 0.44, 0.72) have been synthesized using mild solvothermal conditions under autogenous pressure and the ethylenediamine molecule as templating agent. The crystal structures have been determined from X-ray single-crystal diffraction data. The compounds crystallize in the orthorhombic P2 1 2 1 2 1 space group with Z = 4 and unit-cell parameters a = 12.8494(9), b = 9.5430(6), c = 6.4372(5) A, and a = 12.8578(1), b = 9.5342(1), c = 6.4370(7) A for (C 2 N 2 H 10 )[Fe 0.44 V 0.56 (HPO 3 )F 3 ] and (C 2 N 2 H 10 )[Fe 0.72 V 0.28 (HPO 3 )F 3 ] (1) and (2), respectively. These isostructural compounds exhibit a monodimensional crystal structure formed by pillared double anionic chains with the formula [M(HPO 3 )F 3 ] 2- , extended along the [0 0 1] direction. These doubled ionic chains are the result of the linking of two simple chains in which there are alternating octahedral [MO 3 F 3 ] and tetrahedral groups [HPO 3 ]. The ethylendiammonium cations are placed in the space delimited by three different chains. The metallic ions are interconnected by the pseudo-pyramidal (HPO 3 ) 2- phosphite oxoanions, adopting a slightly distorted octahedral geometry. The IR spectra show bands corresponding to the phosphite oxoanion and the ethylendiamonium cation at 2400 and 1600 cm -1 , respectively. The thermogravimetric analyses show that these phases are stable up to ca. 280 deg. C, at higher temperatures, the decomposition of the crystal structure begins by calcination of the organic cation and the elimination of the fluoride anions. The diffuse reflectance spectra show bands of the V 3+ ion (d 2 ) in octahedral symmetry. The values of the Dq (1540, 1540 cm -1 ), and Racah parameters, B (560, 535 cm -1 ) and C (3055, 3140 cm -1 ) for (1) and (2), respectively, correspond with those usually found for octahedrically coordinated V(III) compounds. Magnetic measurements, performed on a powered sample from 5.0 to 300 K at 1000 G, in the ZFC and

  1. Structural studies of TiC1xOx solid solution by Rietveld refinement and first-principles calculations

    International Nuclear Information System (INIS)

    Jiang, Bo; Hou, Na; Huang, Shanyan; Zhou, Gege; Hou, Jungang; Cao, Zhanmin; Zhu, Hongmin

    2013-01-01

    The lattice parameters, structural stability and electronic structure of titanium oxycarbides (TiC 1x O x , 0≤x≤1) solid solution were investigated by Rietveld refinement and first-principles calculations. Series of TiC 1x O x were precisely synthesized by sintering process under the vacuum. Rietveld refinement results of XRD patterns show the properties of continuous solid solution in TiC 1x O x over the whole composition range. The lattice parameters vary from 0.4324 nm to 0.4194 nm decreasing with increasing oxygen concentration. Results of first-principles calculations reveal that the disorder C/O structure is stable than the order C/O structure. Further investigations of the vacancy in Ti 1−Va (C 1x O x ) 1−Va solid solution present that the structure of vacancy segregated in TiO-part is more stable than the disorder C/O structure, which can be ascribed to the Ti–Ti bond across O-vacancy and the charge redistributed around Ti-vacancy via the analysis of the electron density difference plots and PDOS. - Graphical abstract: XRD of series of titanium oxycarbides (TiC 1x O x , 0≤x≤1) solid solution prepared by adjusting the proportion of TiO in the starting material. Highlights: • Titanium oxycarbides were obtained by sintering TiO and TiC under carefully controlled conditions. • Rietveld refinement results show continuous solid solution with FCC structure in TiC 1x O x . • The disorder C/O structure is stable than the order C/O structure. • Introduction of vacancy segregated in TiO-part is more stable than disorder C/O structure. • Ti–Ti bond across O-vacancy and the charge redistributed around Ti-vacancy enhance structural stability

  2. Labelling by 14C and 3H on 4,4-dimethyl-1-(3,4-methylenedioxyphenyl)-1-pentene-3-ol or stiripentol

    International Nuclear Information System (INIS)

    Madelmont, J.C.; Rapp, M.; Labarre, P.; Maurizis, J.C.; Dupuy, J.M.; Lepage, F.; Veyre, A.

    1992-01-01

    4,4-dimethyl-1-(3,4-methylenedioxyphenyl)-1-pentene-3-ol or stiripentol was labelled by 14 C and 3 H. 14 C labelling was performed on the carbon 1 of the pentene group via a four step procedure. The radiochemical yield calculated from the precursor (Ba 14 CO 3 ) is 28%. 3 H labelling was performed on the position 3 of the pentene chain by reduction of the corresponding ketone via NaBT 4 . The radiochemical yield calculated from the precursor (NaBT 4 ) is 40%. (author)

  3. Labelling by [sup 14]C and [sup 3]H on 4,4-dimethyl-1-(3,4-methylenedioxyphenyl)-1-pentene-3-ol or stiripentol. Marquage par [sup 14]C et [sup 3]H du 4,4-dimethyl-1-(methylendioxy-3,4 phenyl)-1-petene-3-ol ou stiripentol

    Energy Technology Data Exchange (ETDEWEB)

    Madelmont, J.C.; Rapp, M.; Labarre, P.; Maurizis, J.C. (Institut National de la Sante et de la Recherche Medicale (INSERM), 63 - Clermont-Ferrand (France)); Dupuy, J.M. (Centre Jean Perrin, Clermont-Ferrand (France)); Lepage, F. (Laboratoires BIOCODEX, Compiegne (France)); Veyre, A. (Clermont-Ferrand-1 Univ., 63 - Aubiere (France))

    1992-11-01

    4,4-dimethyl-1-(3,4-methylenedioxyphenyl)-1-pentene-3-ol or stiripentol was labelled by [sup 14]C and [sup 3]H. [sup 14]C labelling was performed on the carbon 1 of the pentene group via a four step procedure. The radiochemical yield calculated from the precursor (Ba[sup 14]CO[sub 3]) is 28%. [sup 3]H labelling was performed on the position 3 of the pentene chain by reduction of the corresponding ketone via NaBT[sub 4]. The radiochemical yield calculated from the precursor (NaBT[sub 4]) is 40%. (author).

  4. Neutrino masses in the flipped SU(5) x U(1) and the SU(4) x O(4) GUT models

    Energy Technology Data Exchange (ETDEWEB)

    Ranfone, S.; Papageorgiu, E.

    1992-03-01

    We classify the different neutrino-mass pattern arising in string-inspired Grand Universal Theory (GUT) and supersymmetric GUT models based on the flipped SU(5)xU(1) and the SU(4)xO(4) gauge groups. Phenomenologically interesting spectra are obtained through the interplay of the two seesaw mechanisms present, with typical neutrino masses {approx}10{sup -3} eV in the supersymmetric GUT models and of order 0.1 - 10 KeV in the ordinary GUTs. (author).

  5. Neutrino masses in the flipped SU(5)xU(1) and the SU(4)xO(4) GUT models

    Energy Technology Data Exchange (ETDEWEB)

    Papageorgiu, E.; Ranfone, S. (Rutherford Appleton Lab., Chilton (United Kingdom))

    1992-05-21

    We classify the different neutrino-mass patterns arising in string-inspired GUT and supersymmetric GUT models based on the flipped SU(5)xU(1) and the SU(4)xO(4) gauge groups. Phenomenologically interesting spectra are obtained through the interplay of the two seesaw mechanisms present, with typical neutrino masses {proportional to}10{sup -3} eV in the supersymmetric GUT models and of order 0.1-10 keV in the ordinary GUTs. (orig.).

  6. Spin canting and magnetic transition in NixZn1-xFe2O4 (x=0.0, 0.5 and 1.0) nanoparticles

    Science.gov (United States)

    Rani, Stuti; Raghav, Dharmendra Singh; Yadav, Prashant; Varma, G. D.

    2018-04-01

    Nanoparticles of NixZn1-xFe2O4(x=0.0, 0.5 and 1.0) have been synthesized via co-precipitation method and studied thestructural and magnetic properties. Rietveld refinement of X ray diffraction data of as synthesized samples revealthat the samples have mixed spinel structure with space group Fd-3m. The lattice parameter of the samples decreases as doping concentration of Ni ions increases. Magnetic measurements show paramagnetic to ferrimagnetic transition at room temperature on Ni doping in ZnFe2O4 nanoparticles. The magnetic measurements also show spin canting in samples possibly due to their nanocrystalline nature. The spin canting angles have been calculated with the help of Yafet-Kittel (Y-K) model. Furthermore, the Law of approach (LA) fitting of M-H curves indicates that the samples are highly anisotropicin nature. The Arrot plots of as synthesized samples also indicate the paramagnetic to ferrimagnetic transition. The correlation between the structural and observed magnetic properties of NixZn1-xFe2O4(x=0.0, 0.5 and 1.0) nanocrystals will be described and discussed in this paper.

  7. Atomic structure determination of InSb(100)c(4x4) and c(8x2)phases by X-ray photoelectron diffraction

    International Nuclear Information System (INIS)

    Carvalho, V.E. de; Soares, E.A.; Magalhaes, M.R.P.; Paniago, R.; Siervo, A. de; Landers, R.

    2004-01-01

    Full text: The (100) surfaces of III-V compound semiconductors exhibit a variety of surface reconstructions that have attracted a lot of attention because of their importance in both homo epitaxial and heteroepitaxial growth. In the special case of the narrow bandgap InSb compound semiconductor its potential application in high-speed electronic and optoelectronic devices has encourage many studies of its (100) surface atomic structure. Among the reconstructions presented by the InSb(100) surface two of them have received more attention, that is, the observed well-ordered In-rich c(8x2) and Sb terminated c(4x4) surfaces. The c(8x2) structure can be obtained by exposing the surface to low energy ion bombardment and annealing, whereas the c(4x4) structure involves the chemisorption of Sb onto an already Sb-terminated surface. These two structures have been studied mainly by scanning tunneling microscopy (STM) and surface X-ray diffraction (SXRD) techniques and all the proposed models are based on the occurrence of group III (and/or V) blocks of dimmers occupying sites on the top or at subsurface layer. However, there are still difficulties in determining either the exact number of atoms in each dimmer or the number of dimmers in each block. With the goal of getting a better structure determination of the InSb(100) surface phases a photoelectron diffraction experiment (XPD) was carried out at LNLS where synchrotron and Al-K α radiations have been used. In the present work, the experimental and preliminary results of structure determination for both In Sn(100)c(8x2) and InSb(100)c(4x4) phases will be presented and discussed. (author)

  8. Microstructure study of the rare-earth intermetallic compounds R5(SixGe1-x)4 and R5(SixGe1-x)3

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Qing [Iowa State Univ., Ames, IA (United States)

    2012-01-01

    The unique combination of magnetic properties and structural transitions exhibited by many members of the R5(SixGe1-x)4 family (R = rare earths, 0 ≤ x1) presents numerous opportunities for these materials in advanced energy transformation applications. Past research has proven that the crystal structure and magnetic ordering of the R5(SixGe1-x)4 compounds can be altered by temperature, magnetic field, pressure and the Si/Ge ratio. Results of this thesis study on the crystal structure of the Er5Si4 compound have for the first time shown that the application of mechanical forces (i.e. shear stress introduced during the mechanical grinding) can also result in a structural transition from Gd5Si4-type orthorhombic to Gd5Si2Ge2-type monoclinic. This structural transition is reversible, moving in the opposite direction when the material is subjected to low-temperature annealing at 500 °C.

  9. Magnetic properties and magnetocaloric effect in the HoNi1xCuxIn (x=0, 0.1, 0.3, 0.4) intermetallic compounds

    International Nuclear Information System (INIS)

    Mo, Zhao-Jun; Shen, Jun; Yan, Li-Qin; Tang, Cheng-Chun; He, Xiao-Nan; Zheng, Xinqi; Wu, Jian-Feng; Sun, Ji-Rong; Shen, Bao-Gen

    2014-01-01

    The magnetic properties and magnetocaloric effect (MCE) in HoNi 1x Cu x In (x=0, 0.1, 0.3, 0.4) compounds have been investigated. With the substitution of Cu for Ni, the Ho magnetic moment will cant from the c-axis, and form a complicated magnetic structure. These compounds exhibit two successive magnetic transitions with the increase in temperature. The large reversible magnetocaloric effects have been observed in HoNi 1x Cu x In compounds around T ord , with no thermal and magnetic hysteresis loss. The large reversible isothermal magnetic entropy change (−ΔS M ) is 20.2 J/kg K and the refrigeration capacity (RC) reaches 356.7 J/kg for field changes of 5 T for HoNi 0.7 Cu 0.3 In. Especially, the value of −ΔS M (12.5 J/kg K) and the large RC (132 J/kg) are observed for field changes of 2 T for HoNi 0.9 Cu 0.1 In. Additionally, the values of RC are improved to 149 J/K for the field changes of 2 T due to a wide temperature span for the mix of HoNi 0.9 Cu 0.1 In and HoNi 0.7 Cu 0.3 In compounds with the mass ratio of 1:1. These compounds with excellent MCE are expected to have effective applications in magnetic refrigeration around 20 K. - Highlights: • For magnetic-field changes of 2 T, the values of RC are improved to 149 J/K. • MCEs of these compounds show no thermal and magnetic hysteresis. • Compounds show two successive magnetic transitions with the increase in temperature. • With the substitution of Cu for Ni, compounds form a complicated magnetic structure

  10. X-Ray Diffraction and μ-Raman Investigation of the Monoclinic-Orthorhombic Phase Transition in Th1-xUx(C2O4)2. 2H2O Solid Solutions

    International Nuclear Information System (INIS)

    Clavier, N.; Dacheux, N.; Clavier, N.; Hingant, N.; Dacheux, N.; Barre, N.; Rivenet, M.; Obbade, S.; Abraham, F.

    2010-01-01

    A complete Th 1-x U x (C 2 O 4 ) 2 . 2H 2 O solid solution was prepared by mild hydrothermal synthesis from a mixture of hydrochloric solutions containing cations and oxalic acid. The crystal structure has been solved from twinned single crystals for x=0, 0. 5, and 1 with monoclinic symmetry, space group C2/c, leading to unit cell parameters of a ≅ to 10. 5 Angstroms, b ≅ 8. 5 Angstrom, and c ≅ 9. 6 Angstrom. The crystal structure consists of a two-dimensional arrangement of actinide centers connected through bis-bidentate oxalate ions forming squares. The actinide metal is coordinated by eight oxygen atoms from four oxalate entities and two water oxygen atoms forming a bi-capped square anti-prism. The connection between the layers is assumed by hydrogen bonds between the water molecules and the oxygen of oxalate of an adjacent layer. Under these conditions, the unit cell contains two independent oxalate ions. From high-temperature μ-Raman and X-ray diffraction studies, the compounds were found to undergo a transition to an orthorhombic form (space group Ccca). The major differences in the structural arrangement concern the symmetry of uranium, which decreases from C2 to D2, leading to a unique oxalate group. Consequently, the ν s (C-O) double band observed in the Raman spectra recorded at room temperature turned into a singlet. This transformation was then used to make the phase transition temperature more precise as a function of the uranium content of the sample. (authors)

  11. SU(4) x U(1) gauge theory. II. CP nonconservation

    International Nuclear Information System (INIS)

    Deshpande, N.G.; Hwa, R.C.; Mannheim, P.D.

    1979-01-01

    We exploit the higher symmetry inherent in an SU(4) x U(1) gauge theory to construct a spontaneously broken theory of CP nonconservation. Higgs multiplets in the adjoint representation of SU(4) contain both even and odd CP fields; thus, requiring the simultaneous nonvanishing of the vacuum expectation values of these fields leads to CP noninvariance of the vacuum. We find that all the CP-nonconserving effects are mediated in our theory by the superheavy gauge bosons of the broken SU(4) x U(1) symmetry. In fact, the very existence of CP violation sets an upper limit on the masses of these bosons. In our model the dominant CP effect lies in the neutral kaon system and is found to arise through a direct (ΔS = 2) K 1 -K 2 transition. The model has all the features of a superweak theory, with a neutron electric dipole moment substantially smaller than 10 -24 e cm

  12. Three-Dimensional Hierarchical NixCo1-xO/NiyCo2-yP@C Hybrids on Nickel Foam for Excellent Supercapacitors.

    Science.gov (United States)

    Shao, Yubo; Zhao, Yongqing; Li, Hua; Xu, Cailing

    2016-12-28

    Active materials and special structures of the electrode have decisive influence on the electrochemical properties of supercapacitors. Herein, three-dimensional (3D) hierarchical Ni x Co 1-x O/Ni y Co 2-y P@C (denoted as NiCoOP@C) hybrids have been successfully prepared by a phosphorization treatment of hierarchical Ni x Co 1-x O@C grown on nickel foam. The resulting NiCoOP@C hybrids exhibit an outstanding specific capacitance and cycle performance because they couple the merits of the superior cycling stability of Ni x Co 1-x O, the high specific capacitance of Ni y Co 2-y P, the mechanical stability of carbon layer, and the 3D hierarchical structure. The specific capacitance of 2638 F g -1 can be obtained at the current density of 1 A g -1 , and even at the current density of 20 A g -1 , the NiCoOP@C electrode still possesses a specific capacitance of 1144 F g -1 . After 3000 cycles at 10 A g -1 , 84% of the initial specific capacitance is still remained. In addition, an asymmetric ultracapacitor (ASC) is assembled through using NiCoOP@C hybrids as anode and activated carbon as cathode. The as-prepared ASC obtains a maximum energy density of 39.4 Wh kg -1 at a power density of 394 W kg -1 and still holds 21 Wh kg -1 at 7500 W kg -1 .

  13. On the studies of thermodynamics properties of fast neutron irradiated (Li{sub x}K{sub 1-x}){sub 2}SO{sub 4} crystals

    Energy Technology Data Exchange (ETDEWEB)

    El-Khatib, A.M.; Kassem, M.E.; Gomaa, N.G.; Mahmoud, S.A. [Alexandria Univ. (Egypt). Dept. of Physics

    1996-12-31

    The effect of fast neutron irradiation on the thermodynamic properties of (Li{sub x}K{sub 1-x}){sub 2}SO{sub 4}, (x = 0.1, 0.2,......0.5) has been studied. The measurements were carried out in the vicinity of phase transition. The study reveals that as the lithium content decreases the first high temperature phase T{sub c} 705K disappears, while the second one is shifted to lower temperature. It is observed also that the specific heat, C{sub p}, decreases sharply with neutron integrated fluence {phi} and increases once more. Both entropy and enthalpy changes increase with the increase of neutron integrated fluence. (Author).

  14. Magnetocaloric effect in the La0.8Ce0.2Fe11.4-xCoxSi1.6 compounds

    International Nuclear Information System (INIS)

    Wang, G.F.; Song, L.; Li, F.A.; Ou, Z.Q.; Tegus, O.; Brueck, E.; Buschow, K.H.J.

    2009-01-01

    The effects of substitution of Co for Fe on the magnetic and magnetocaloric properties of La 0.8 Ce 0.2 Fe 11.4-x Co x Si 1.6 (0, 0.2, 0.4, 0.6, 0.8 and 1.0) compounds have been investigated. X-ray diffraction shows that all compounds crystallize in the NaZn 13 -type structure. Magnetic measurements show that the Curie temperature (T C ) can be tuned between 184 and 294 K by changing the Co content from 0 to 1. A field-induced methamagnetic transition occurs in samples with x=0, 0.2 and 0.4. The magnetic entropy changes of the compounds have been determined from the isothermal magnetization measurements by using the Maxwell relation.

  15. Optical properties of lattice matched InxGa1-xP1-yNy heteroepitaxial layers on GaP

    International Nuclear Information System (INIS)

    Imanishi, T.; Wakahara, A.; Kim, S.M.; Yonezu, H.; Furukawa, Y.

    2005-01-01

    Optical constants and band structure of In x Ga 1-x P 1-y N y lattice matched to GaP (100) substrate are investigated. Nitrogen concentration in the film estimated by X-ray diffraction and X-ray photoelectron spectroscopy, was 1.4%, 1.8% and 3.5%. Refractive index and transition critical points E 0 (Γ v to Γ c ), E 1 (L v to L c ) and E 2 (X v to X c ) are evaluated by spectroscopic ellipsometry. When N composition increases from 1.4% to 3.5%, both photoluminescence (PL) peak energy, E PL , and E 0 shift to lower energy, and the energy difference ΔE=E 0 -E PL decrease from 380 meV to 110 meV. The large red-sift of E PL from the E 0 suggest that the luminescence is of defect-related luminescence, and crossover point of indirect band structure estimated by the extrapolation of N-composition dependence of ΔE is estimated to be around in In 0.1 Ga 0.9 P 0.96 N 0.04 . (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  16. Synthesis of New Pyrazolo[5,1-c]triazine, Triazolo[5,1-c]triazine, Triazino[4,3-b]indazole and Benzimidazo[2,1-c]triazine Derivatives Incorporating Chromen-2-one Moiety

    Energy Technology Data Exchange (ETDEWEB)

    Khalil, Mohamed A.; Sayed, Samia M.; Raslan, Mohamed A. [Aswan Univ., Aswan (Egypt)

    2013-10-15

    The versatile, hitherto unreported 3-(4-(2-phenyldiazenyl)-2-oxo-2H-chromen-3-yl)-3-oxopropanenitrile 3 was prepared by two convenient routes: either by the reaction of ethyl 4-(2-phenyldiazenyl)-2-oxo-2H-chromen-3-carboxylate 2 with acetonitrile in the presence of sodium hydride or by treatment of 4-(2-phenyldiazenyl)-3-(2-bromoacetyl)-2H-chromen-2-one 5 with potassium cyanide. Reaction of 3 with heterocyclic diazonium salts 6, 7, 14 and 17 furnished the corresponding hydrazones 8, 9, 15 and 18. The latter hydrazones underwent intramolecular cyclization into the corresponding pyrazolo[5,1-c]-1,2,4-triazine 10, 1,2,4-triazolo[5,1-c]-1,2,4-triazine 11, 1,2,4-triazino[4,3-b]indazole 16 and imidazo[2,1-c]-1,2,4-triazine 19 derivatives, respectively upon refluxing in pyridine.

  17. A convenient method for 14C-labeling of 2-methylthio-1-[4-N-α-ethoxycarbonylbenzyl)-amino-benzyl] -5-hydroxymethyl-2-[14C]-1H-imidazole and 1-[4-N-α-ethoxy-carbonylbenzyl)-aminobenzyl]-5-hydroxymethyl-2-[14C] -1H-imidazole as potential antihypertensives

    International Nuclear Information System (INIS)

    Nader Saemian; Gholamhossein Shirvani; Mohsen Javaheri; Sayed Sajad Oliyaee

    2012-01-01

    The key synthetic intermediate, (2-mercapto-1-(4-nitrobenzyl)-1H-imidazol-5-yl)methanol-[2- 14 C], has been synthesized by using one pot procedure from potassium[ 14 C]-thiocyanate. It was converted to two nonpeptide angiotensin II receptor antagonists, 2-methylthio-1-[4-N-α-ethoxycarbonyl benzyl)-aminobenzyl]-5-hydroxymethyl-1H-imidazole-[2- 14 C] and 1-[4-N-α-ethoxy-carbonylbenzyl)-aminobenzyl] -5-hydroxymethyl-1H-imidazole-[2- 14 C] via a 3-step sequence synthetic pathway. (author)

  18. Effect of artichoke extract (Cynara scolymus L.) on palmitic-1-14C acid oxidation in rats.

    Science.gov (United States)

    Juzyszyn, Zygmunt; Czerny, Boguslaw; Pawlik, Andrzej; Drozdzik, Marek

    2008-05-01

    Studies on the effect of the artichoke extract (AE) on oxidation of palmitic-1-14C acid administered intravenously to rats at a dose 25 and 50 mg/kg bw demonstrated marked enhancement of both 14CO2 expiration rate and 14CO2 recovery in the expired air. The extract suppressed accumulation of palmitic-1-14C acid in serum lipids and epididymal fat pad tissue as well. The effects of the extract on 14CO2 expiration rate, 14CO2 recovery, as well as accumulation of palmitic-1-14C acid were dose dependent. Total14CO2 recovery in expired air during 60 min was elevated by 17.3% (p < 0.05) and 52.1% (p < 0.001) in rats administered the extract at a dose of 25 and 50 mg/kg, respectively. The rats supplemented with the AE at a dose of 25 and 50 mg/kg bw were characterized by 10.0% (not significant) and 19% (p < 0.05) decrease in( 14)C radioactivity of serum lipids as well as reduction of epididymal fat tissue 14C radioactivity by 8.7 and 17.5% (p < 0.05), respectively, in comparison with the control rats. Thus, the results demonstrate that the AE possess stimulatory properties with respect to oxidation of palmitic acid administered to rats, and provide new information on the mechanism of antilipemic activity of the extract associated with activation of lipid oxidation in the organism.

  19. New homo- and heteroleptic derivatives of trivalent ytterbium containing anion-radical 1,4-diazadiene ligands. Synthesis, properties and crystal structure of (C9H7)2Yb[2-MeC6H4NC(Me)C(Me)NC6H4Me-2] and [PhNC(Ph)C(Ph)NPh]3Yb complexes

    International Nuclear Information System (INIS)

    Gudilenkov, I.D.; Fukin, G.K.; Cherkasov, A.V.; Shavyrin, A.S.; Trifonov, A.A.; Larionova, Yu.E.

    2008-01-01

    Reaction of ytterbium bisindenyl complex (C 9 H 7 ) 2 Yb II (THF) 2 (1) with 1,4-diazabutadiene 2-MeC 6 H 4 N=C(Me)-C(Me)=NC 6 H 4 Me-2 ( Me DAD) is accompanied by the oxidation of metal atom until trivalent state and results in the formation of paramagnetic compound of metallocenes type (C 9 H 7 ) 2 Yb III ( Me DAD -. ) (3) containing 1,4-diazabutadiene anion-radical. Structure of complex 3 is ascertained by the X-ray structure analysis. Reactions of bisindenyl (1) and bisfluorenyl (C 13 H 9 ) 2 Yb II (THF) 2 (2) derivatives of bivalent ytterbium with 1,4-diazabutadiene PhN=C(Ph)-C(Ph)=NPh ( Ph DAD) (at 1:2 molar ratio of reagents) proceed with the complete break of Yb-C bonds, oxidation of ytterbium atom until trivalent state, and result in the formation of homoligand complex ( Ph DAD -. ) 3 Yb (6) containing three anion-radical 1,4-diazadiene ligands. Complex 6 was also prepared by the exchange reaction of YbCl 3 with Ph DAD -. K + (1:3) in THF. Complex 6 is characterized by the X-ray structure analysis [ru

  20. Optical and magneto-optical effects in Hg{sub 1-x}Cd{sub x}Cr{sub 2}Se{sub 4} (0 ⩽ x1) single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sukhorukov, Yu. P., E-mail: suhorukov@imp.uran.ru; Telegin, A. V.; Bebenin, N. G.; Zainullina, R. I.; Mostovshchikova, E. V.; Viglin, N. A. [Ural Branch, Russian Academy of Sciences, Mikheev Institute of Metal Physics (Russian Federation); Gan’shina, E. A.; Zykov, G. S. [Moscow State University (Russian Federation); Fedorov, V. A. [Russian Academy of Sciences, Kurnakov Institute of Inorganic Chemistry (Russian Federation); Menshchikova, T. K.; Buchkevich, A. A. [Ural Branch, Russian Academy of Sciences, Mikheev Institute of Metal Physics (Russian Federation)

    2015-09-15

    The concentration, temperature, and magnetic-field dependences of the magnetoreflection and magnetotransmission of natural light in the infrared spectral range and the Kerr effect in single crystals of ferromagnetic Hg{sub 1-x}Cd{sub x}Cr{sub 2}Se{sub 4} (0 ⩽ x1) spinels have been studied. A relationship of the magneto-optical properties to the electronic band structure of spinels has been established. The most significant changes in the spectra of magnetoreflection, magnetotransmission, and the Kerr effect are shown to be observed for 0.1 < x < 0.25 and are attributable to a rearrangement of the band structure as the composition changes.

  1. Synthesis and performance of Li{sub 3}(V{sub 1-x}Mg{sub x}){sub 2}(PO{sub 4}){sub 3} cathode materials

    Energy Technology Data Exchange (ETDEWEB)

    Dai, Changsong; Chen, Zhenyu; Jin, Haizu; Hu, Xinguo [School of Chemical Engineering and Technology, Harbin Institute of Technology, Harbin 150001 (China)

    2010-09-01

    In order to search for cathode materials with better performance, Li{sub 3}(V{sub 1-x}Mg{sub x}){sub 2}(PO{sub 4}){sub 3} (0, 0.04, 0.07, 0.10 and 0.13) is prepared via a carbothermal reduction (CTR) process with LiOH.H{sub 2}O, V{sub 2}O{sub 5}, Mg(CH{sub 3}COO){sub 2}.4H{sub 2}O, NH{sub 4}H{sub 2}PO{sub 4}, and sucrose as raw materials and investigated by X-ray diffraction (XRD), scanning electron microscopic (SEM) and electrochemical impedance spectrum (EIS). XRD shows that Li{sub 3}(V{sub 1-x}Mg{sub x}){sub 2}(PO{sub 4}){sub 3} (x = 0.04, 0.07, 0.10 and 0.13) has the same monoclinic structure as undoped Li{sub 3}V{sub 2}(PO{sub 4}){sub 3} while the particle size of Li{sub 3}(V{sub 1-x}Mg{sub x}){sub 2}(PO{sub 4}){sub 3} is smaller than that of Li{sub 3}V{sub 2}(PO{sub 4}){sub 3} according to SEM images. EIS reveals that the charge transfer resistance of as-prepared materials is reduced and its reversibility is enhanced proved by the cyclic votammograms. The Mg{sup 2+}-doped Li{sub 3}V{sub 2}(PO{sub 4}){sub 3} has a better high rate discharge performance. At a discharge rate of 20 C, the discharge capacity of Li{sub 3}(V{sub 0.9}Mg{sub 0.1}){sub 2}(PO{sub 4}){sub 3} is 107 mAh g{sup -1} and the capacity retention is 98% after 80 cycles. Li{sub 3}(V{sub 0.9}Mg{sub 0.1}){sub 2}(PO{sub 4}){sub 3}//graphite full cells (085580-type) have good discharge performance and the modified cathode material has very good compatibility with graphite. (author)

  2. Mn induced ferromagnetism spin fluctuation enhancement in Sr{sub 2}Ru{sub 1x}Mn{sub x}O{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Long; Cai, Jinzhu; Xie, Qiyun; Lv, Bin [Laboratory of Solid State Microstructures and Department of Physics, Nanjing University, Nanjing 210093 (China); Mao, Z.Q. [Department of Physics and Engineering Physics, Tulane University, New Orleans, LA 70118 (United States); Wu, X.S., E-mail: xswu@nju.edu.cn [Laboratory of Solid State Microstructures and Department of Physics, Nanjing University, Nanjing 210093 (China)

    2013-09-15

    We establish that Sr{sub 2}RuO{sub 4} is extremely close to incommensurate spin density wave instability. With increasing Mn content, the RuO{sub 6} octahedron in the unit cell varies. The octahedron of RuO{sub 6} contracts along c-axis for x<0.20, Mn element mainly showing the +3 chemical valence (Mn{sup 3+}), and it expands along c-axis with further increasing Mn content (x>0.20), and Mn element shows the +4 chemical valence (Mn{sup 4+}). Spin-glass-related ferromagnetism enhancement is observed for x>0.20, which indicates the critical ferromagnetic spin fluctuation due to Mn doping in Sr{sub 2}Ru{sub 1x}Mn{sub x}O{sub 4}. - Highlights: • The chemical valence of Mn ions changed from Mn{sup 3+} to Mn{sup 4+} with the increase of Mn content. • Spin-glass-related ferromagnetism enhancement behavior is observed. • The electrical resistivity can be fitted using Mott's variable-range hopping model. • The evolution of octahedron with increase of Mn content is given. • The spin fluctuation effect plays an important role in the magnetic property.

  3. Optical properties of lattice matched In{sub x}Ga{sub 1-x}P{sub 1-y}N{sub y} heteroepitaxial layers on GaP

    Energy Technology Data Exchange (ETDEWEB)

    Imanishi, T.; Wakahara, A.; Kim, S.M.; Yonezu, H.; Furukawa, Y. [Department of Electrical and Electron Engineering, Toyohashi University of Technology, 1-1 Hibarigaoka, Tempaku-cho, Toyohashi, Aichi 411-8580 (Japan)

    2005-04-01

    Optical constants and band structure of In{sub x}Ga{sub 1-x}P{sub 1-y}N{sub y} lattice matched to GaP (100) substrate are investigated. Nitrogen concentration in the film estimated by X-ray diffraction and X-ray photoelectron spectroscopy, was 1.4%, 1.8% and 3.5%. Refractive index and transition critical points E{sub 0} ({gamma}{sub v} to {gamma}{sub c}), E{sub 1} (L{sub v} to L{sub c}) and E{sub 2} (X{sub v} to X{sub c}) are evaluated by spectroscopic ellipsometry. When N composition increases from 1.4% to 3.5%, both photoluminescence (PL) peak energy, E{sub PL}, and E{sub 0} shift to lower energy, and the energy difference {delta}E=E{sub 0}-E{sub PL} decrease from 380 meV to 110 meV. The large red-sift of E{sub PL} from the E{sub 0} suggest that the luminescence is of defect-related luminescence, and crossover point of indirect band structure estimated by the extrapolation of N-composition dependence of {delta}E is estimated to be around in In{sub 0.1}Ga{sub 0.9}P{sub 0.96}N{sub 0.04}. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  4. Alloying effects on structural and thermal behavior of Ti1-xZrxC: A first principles study

    International Nuclear Information System (INIS)

    Chauhan, Mamta; Gupta, Dinesh C.

    2016-01-01

    The formation energy, equilibrium lattice parameter, bulk modulus, Debye temperature and heat capacity at constant volume have been calculated for TiC, ZrC, and their intermediate alloys (Ti 1-x Zr x C, x = 0,0.25.0.5,0.75,1) using first principles approach. The calculated values of lattice parameter and bulk modulus agree well with the available experimental and earlier theoretical reports. The variation of lattice parameter and bulk modulus with the change in concentration of Zr atom in Ti 1-x Zr x C has also been reported. The heat capacities of TiC, ZrC, and their intermediate alloys have been calculated by considering both vibrational and electronic contributions.

  5. A study of TaxC1-x coatings deposited on biomedical 316L stainless steel by radio-frequency magnetron sputtering

    International Nuclear Information System (INIS)

    Ding, M.H.; Wang, B.L.; Li, L.; Zheng, Y.F.

    2010-01-01

    In this paper, Ta x C 1-x coatings were deposited on 316L stainless steel (316L SS) by radio-frequency (RF) magnetron sputtering at various substrate temperatures (T s ) in order to improve its corrosion resistance and hemocompatibility. XRD results indicated that T s could significantly change the microstructure of Ta x C 1-x coatings. When T s was x C 1-x coatings were in amorphous condition, whereas when T s was ≥150 deg. C, TaC phase was formed, exhibiting in the form of particulates with the crystallite sizes of about 15-25 nm (T s = 300 deg. C). Atomic force microscope (AFM) results showed that with the increase of T s , the root-mean-square (RMS) values of the Ta x C 1-x coatings decreased. The nano-indentation experiments indicated that the Ta x C 1-x coating deposited at 300 deg. C had a higher hardness and modulus. The scratch test results demonstrated that Ta x C 1-x coatings deposited above 150 deg. C exhibited good adhesion performance. Tribology tests results demonstrated that Ta x C 1-x coatings exhibited excellent wear resistance. The results of potentiodynamic polarization showed that the corrosion resistance of the 316L SS was improved significantly because of the deposited Ta x C 1-x coatings. The platelet adhesion test results indicated that the Ta x C 1-x coatings deposited at T s of 150 deg. C and 300 deg. C possessed better hemocompatibility than the coating deposited at T s of 25 deg. C. Additionally, the hemocompatibility of the Ta x C 1-x coating on the 316L SS was found to be influenced by its surface roughness, hydrophilicity and the surface energy.

  6. Luminescent properties of stabled hexagonal phase Sr1-xBaxAl2O4:Eu2+ (x=0.37-0.70)

    International Nuclear Information System (INIS)

    Wu Qiaoli; Liu Zhen; Jiao Huan

    2009-01-01

    Stabled hexagonal phase Sr 1-x Ba x Al 2 O 4 :Eu 2+ (x=0.37-0.70) was prepared by solid-state method. Result revealed that the structure behavior of the SrAl 2 O 4 :Eu 2+ calcined at 1350 deg. C in a reducing atmosphere for 5 h strongly depended on the Ba 2+ concentration. With increasing Ba 2+ concentration, a characteristic hexagonal phase can be observed. When 37-70% of the strontium is replaced by barium, the structure of the prepared sample is pure hexagonal. Photoluminescence and excitation spectra of the samples with different x and doped with 2% Eu 2+ were investigated. Changes in the emission spectra were observed in the two different phases. The green emission at 505 nm from Eu 2+ was found to be quite strong in the hexagonal phase. The intensity and peak position of the green luminescence from Eu 2+ changed with increasing content of Ba 2+ . The strongest green emission was obtained from Sr 0.61 Ba 0.37 Al 2 O 4 :Eu 2+ . The decay characteristics of Sr 1-x Ba x Al 2 O 4 :Eu 2+ (x=0.37-0.70) showed that the life times also varied with the value of x. Furthermore, the emission colors and decay times varying with x could be ascribed to the variation of crystal lattice.

  7. Basic hydrolysis of 1, 3, 4, 6-tetra-O-acetyl-2-[18F] fluoro-D-glucose on solid phase extraction

    International Nuclear Information System (INIS)

    Zhang Jinming; Tian Jiahe; He Yijie; Huan Dingcai; Liu Boli

    2003-01-01

    A new base hydrolysis method are used for 1, 3, 4, 6-tetra-O-acetyl-2-[ 18 F] fluoro-D-glucose on solid phase extraction. The labeled intermediate is trapped on an active C-18 solid phase extraction cartridge, and hydrolyzed in cartridge with 1 mL 2 mol/L NaOH at room temperature. The results show that there are over 99% of the labeled intermediate being turned into 18 F-FDG within 2 min. It is easy to get 18 F-FDG after neutralized with phosphate buffer, purified by C-18 and Alumina cartridge. The basic hydrolysis on solid extraction is a simple method for preparation of 18 F-FDG

  8. Extraction X-ray fluorescence determination of gold in natural samples

    International Nuclear Information System (INIS)

    Dmitriev, S.N.; Shishkina, T.V.; Zhuravleva, E.L.; Chimehg, Zh.

    1990-01-01

    The behaviour of gold and other elements impeding its X-ray fluorescence (XRF) determination, namely, of zinc, lead, and arsenic, has been studied during their extraction by TBP from hydrochloric, nitric, and aqua regia solutions using solid extractant (SE(TBP)). Gold extraction from pulps after aqua regia leaching, with the gold distribution coefficient (D) being equal to about 10 4 , was observed as the most favourable one for the quantitative and selective recovery of gold. For extraction from hydrochloric solutions the D Au value does not depend on the gold content of initial solutions (10 -8 - 10 -4 M), but it decreases substantially with increasing extraction temperature (from 5x10 5 at 20 deg C to 9x10 3 at 70 deg C). An anomalously high distribution coefficient of lead (D Pb =10 3 ) was observed during extraction from hydrochloric solutions in the presence of chlorine. This fact could be explained by the formation of the chlorocomplexes of lead (IV). The XRF method of gold determination in natural samples has been developed, which includes the aqua regia decomposition of the samples, recovery of gold from the pulp after its leaching by SE(TBP) and back - extraction using a 0.025 M hot thiourea solution providing a thin sample film for secondary XRF spectrometry. For 25 g of the sample material the limit of determination is set at 0.01 g per ton (10 -6 %). The accuracy of the technique has been checked on different reference materials. The results agree within 10%. 16 refs.; 5 figs.; 1 tab

  9. Formation and magnetic properties of compounds Er(Fe1-xCox)11.35Nb0.65 (0≤x≤0.4)

    International Nuclear Information System (INIS)

    Wang, K.-Y.; Chen, D.-X.; Arcas, J.; Multigner, M.; Crespo, P.; Vazquez, M.; Hernando, A.

    1997-01-01

    A new series of compounds Er(Fe 1-x Co x ) 11.35 Nb 0.65 were synthesized. For x≤0.4, the element Nb can stabilize the ThMn 12 -type compounds. X-ray diffraction results show that the lattice parameters a and c decrease with the substitution of Co for Fe atoms. With increasing Co content, the Curie temperature increases from T c =507 K for x=0 to T c =904 K for x=0.4. Values of the saturation magnetization at 5 K and 300 K are reported. (orig.)

  10. Purification and characterization of antimicrobial peptides from fish isolate Carnobacterium maltaromaticum C2: Carnobacteriocin X and carnolysins A1 and A2.

    Science.gov (United States)

    Tulini, Fabricio L; Lohans, Christopher T; Bordon, Karla C F; Zheng, Jing; Arantes, Eliane C; Vederas, John C; De Martinis, Elaine C P

    2014-03-03

    Carnobacterium maltaromaticum C2, isolated from Brazilian smoked fish (Surubim, Pseudoplatystoma sp.), was found to exert antimicrobial activity against Listeria monocytogenes, an important foodborne pathogen. In this study, the bacteriocins produced by C. maltaromaticum C2 were purified via an extraction with XAD-16 resin, a C18 solid phase extraction, followed by reversed-phase fast protein liquid chromatography. The purified active fractions were characterized using tandem mass spectrometry, permitting the identification of multiple bacteriocins. Carnobacteriocins BM1, B1, and a variant of carnobacteriocin B2 were all found, providing much of the antilisterial activity. Additionally, we herein report the first isolation of the previously predicted antimicrobial peptide carnobacteriocin X. Moreover, C. maltaromaticum C2 produces a novel two-component lantibiotic, termed carnolysin, homologous to enterococcal cytolysin. This lantibiotic is antimicrobially inactive when tested against the non-bacteriocinogenic strain C. maltaromaticum A9b-, likely requiring an additional proteolytic cleavage to reach maturity. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. Synthesis, antityrosinase activity of curcumin analogues, and crystal structure of (1E,4E)-1,5-bis(4-ethoxyphenyl)penta-1,4-dien-3-one

    Energy Technology Data Exchange (ETDEWEB)

    Chantrapromma, S., E-mail: suchada.c@psu.ac.th; Ruanwas, P. [Prince of Songkla University, Department of Chemistry, Faculty of Science (Thailand); Boonnak, N. [Thaksin University, Department of Basic Science and Mathematics, Faculty of Science (Thailand); Chantrapromma, K. [Hatyai University, Faculty of Science and Technology (Thailand); Fun, H.-K. [Universiti Sains Malaysia, X-ray Crystallography Unit, School of Physics (Malaysia)

    2016-12-15

    Five derivatives of curcumin analogue (R = OCH{sub 2}CH{sub 3} (1), R = N(CH{sub 3}){sub 2} (2), R = 2,4,5-OCH{sub 3} (3), R = 2,4,6-OCH{sub 3} (4), and R = 3,4,5-OCH{sub 3} (5)) were synthesized and characterized by {sup 1}H NMR, FT-IR and UV–Vis spectroscopy. The synthesized derivatives were screened for antityrosinase activity, and found that 4 and 5 possess such activity. The crystal structure of 1 was determined by single crystal X-ray diffraction: monoclinic, sp. gr. P2{sub 1}/c, a = 17.5728(15) Å, b = 5.9121(5) Å, c = 19.8269(13) Å, β = 121.155(5)°, Z = 4. The molecule 1 is twisted with the dihedral angle between two phenyl rings being 15.68(10)°. In the crystal packing, the molecules 1 are linked into chains by C−H···π interactions and further stacked by π···π interactions with the centroid–centroid distance of 3.9311(13) Å.

  12. The interplay of magnetic order and superconductivity in GdxY1-xNi2B2C

    International Nuclear Information System (INIS)

    Drzazga, Z.; Fuchs, G.; Handstein, A.; Nenkov, K.; Mueller, K.-H.

    2003-01-01

    Resistivity, ac susceptibility and magnetization measurements are reported for polycrystalline samples of the Gd x Y 1-x Ni 2 B 2 C series as a function of temperature and magnetic field. The magnetic Gd impurities cause an almost linear decrease of the superconducting transition temperature T c with increasing Gd content in the range of x c have been observed. The effect of the 4f local moments manifests in a complete suppression of superconductivity for x≥0.3 and in antiferromagnetic ordering for x>0.3. In zero applied magnetic field, a distinct concentration region around x∼0.3 has been revealed separating superconductivity and antiferromagneting ordering. A metamagnetic transition has been observed in the compound with x=0.5 at a magnetic field of 0.8 T

  13. Magnetic and magnetocaloric properties of La{sub 1.4-x}Yb{sub x}Ca{sub 1.6}Mn{sub 2}O{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Himcinschi, C. [Babes-Bolyai Univ., Cluj-Napoca (Romania). Faculty of Physics; GSI, Strasbourg (France). Inst. de Physique et Chemie des Materiaux; Burzo, E. [Babes-Bolyai Univ., Cluj-Napoca (Romania). Faculty of Physics; Deville, J.P. [GSI, Strasbourg (France). Inst. de Physique et Chemie des Materiaux

    2001-07-01

    Magnetic and magnetocaloric properties of La{sub 1.4-x}Yb{sub x}Ca{sub 1.6}Mn{sub 2}O{sub 7} system were studied. Polycrystalline samples with x = 0 and 0.2 were prepared by solid state reaction. Magnetic measurements show that Curie temperatures decrease from 246 K for x = 0 down to 211 K for x = 0.2. The temperature dependences of the magnetic entropy change {delta}S{sub M}, show peaks close to the magnetic transition temperatures. Peak values of {delta}S{sub M} = 2.7 J/kg K and 2.1 J/kg K were obtained for compositions x = 0 and 0.2. The decrease in {delta}S{sub M} when changing composition was correlated with the diminution of exchange interactions. (orig.)

  14. Synthesize and Analysis of Li1.33Mn1.67O4 as Adsorbent for Lithium Extraction of Lumpur Sidoarjo

    Science.gov (United States)

    Noerochim, L.; Kistiyanto, W. P.; Susanti, D.; Purwaningsih, H.; Widodo, A.

    2017-07-01

    Li1.33Mn1.67O4 (LMO) was successfully synthesized by solid state reaction method at temperature variation of 500, 600, and 700 °C. As-prepared samples are immersed in 1 lt 0.5M HCL for 24 hours to create vacant site for lithium ion. Lithium extraction process is employed by soaking the adsorbent LMO in 1 lt of Lumpur Sidoarjo for 24 hrs. SEM images of adsorbent with variation of calcination temperature show irregular shape with particles size in the range of 15-52 μm. The calcination temperature effects on the size of the grain and crystallinity of adsorbent. LMO 700 sample has the highest capacity of lithium adsorption with capacity of 29.8 mg/g. It is attributed to the high crystalline of LMO 700 sample compared with other samples.

  15. Shengui Sansheng San extraction is an angiogenic switch via regulations of AKT/mTOR, ERK1/2 and Notch1 signal pathways after ischemic stroke.

    Science.gov (United States)

    Liu, Bowen; Luo, Cheng; Zheng, Zhaoguang; Xia, Zhenyan; Zhang, Qian; Ke, Chienchih; Liu, Renshyan; Zhao, Yonghua

    2018-05-15

    As a traditional Chinese herbal formula, Shengui Sansheng San (SSS) has been employed for stroke treatment more than 300 years. We hypothesize that SSS extraction is an angiogenic switch in penumbra post-stroke, and corresponding mechanisms are investigated. In present study, rats were subjected to permanent middle cerebral artery occlusion model (MCAo) and were treated with low, middle and high doses of SSS extraction. We assessed neurological function and survival rate, and measured infarct volume by 2,3,5-triphenyltetrazolium chloride staining on day 7 after ischemia. von Willebrand factor (vWF), stromal cell-derived factor-1 alpha (SDF-1α) /chemokine (C-X-C motif) receptor 4 (CXCR4) axis, vascular endothelial growth factor (VEGF)/VEGF receptor 2 (VEGFR2) as well as protein kinase B (AKT)/mammalian target of rapamycin (mTOR) /hypoxia-inducible factor-1 alpha (HIF-1α), extracellular signal-regulated kinase 1/2 (ERK1/2) and Notch1 signaling pathways were respectively investigated by immunofluorescence assay or western blotting in vivo and oxygen-glucose-deprived (OGD) brain microvascular endothelial cells (BMECs); simultaneously, wound healing of BMECs and tube formation assay were administrated. Compared to MCAo group, SSS extraction could significantly improve neurological functional scores, survival rate and cerebral infarct volume, enhance vWF + vascular density and perimeter, SDF-1α/CXCR4 axis, VEGF expression, as well as activate AKT/mTOR/HIF-1α and ERK1/2 and inhibit Notch1 pathways in penumbra. In vitro, containing SSS extraction serum increased BMEC migration, capillary formation and VEGF expression via up-regulations of AKT/mTOR and ERK1/2 pathways in OGD BMECs, but ERK inhibitor (U0126) reversed the result of VEGF expression in high dose of SSS group. Additionally, VEGFR2 and Notch1 expressions were suppressed by containing SSS extraction serum. All results were in dose dependent manner. Our study firstly demonstrates that SSS extraction is an

  16. Cross section and asymmetry parameter calculations for the C 1s photoionization of CH4, CF4, and CCl4

    International Nuclear Information System (INIS)

    Natalense, Alexandra P. P.; Brescansin, Luiz M.; Lucchese, Robert R.

    2003-01-01

    We have computed cross sections and asymmetry parameters for the C 1s photoionization of CX 4 (X=H, F, Cl) using the Schwinger variational method with Pade corrections. We present a comparative study that shows the influence of the identity of the X atom on the computed cross sections. Predicted cross sections are in good agreement with available photoionization and photoabsorption experimental data. We conclude that the presence of heavy outer atoms produces resonance structures in the photoionization cross sections and in the asymmetry parameters. We find a single nonvalence resonant state in the photoionization of CF 4 and multiple resonances in CCl 4 that have significant d-orbital character in the vicinity of the Cl atoms

  17. A computational study on the energetics and mechanisms for the dissociative adsorption of SiHx(x = 1-4) on W(1 1 1) surface

    Science.gov (United States)

    Lin, Y. H.; Raghunath, P.; Lin, M. C.

    2016-01-01

    The adsorption and dissociation mechanisms of SiHx(x = 1-4) species on W(1 1 1) surface have been investigated by using the periodic density functional theory with the projector-augmented wave approach. The adsorption of all the species on four surface sites: top (T), bridge (B), shallow (S), and deep (D) sites have been analyzed. For SiH4 on a top site, T-SiH4(a), it is more stable with an adsorption energy of 2.6 kcal/mol. For SiH3, the 3-fold shallow site is most favorable with adsorption energy of 46.0 kcal/mol. For SiH2, its adsorption on a bridge site is most stable with 73.0 kcal/mol binding energy, whereas for SiH and Si the most stable adsorption configurations are on 3-fold deep sites with very high adsorption energies, 111.8 and 134.7 kcal/mol, respectively. The potential energy surfaces for the dissociative adsorption of all SiHx species on the W(1 1 1) surface have been constructed using the CINEB method. The barriers for H-atom migration from SiHx(a) to its neighboring W atoms, preferentially on B-sites, were predicted to be 0.4, 1.0, 4.5 and, 8.0 kcal/mol, respectively, for x = 4, 3, 2, and 1, respectively. The adsorption energy of the H atom on a bridge site on the clean W(1 1 1) surface was predicted to be 65.9 kcal/mol, which was found to be slightly affected by the co-adsorption of SiHx-1 within ± 1 kcal/mol.

  18. Microwave absorption enhancement, magnetic coupling and ab initio electronic structure of monodispersed (Mn1-xCox)3O4 nanoparticles

    Science.gov (United States)

    Zhao, Pengfei; Liang, Chongyun; Gong, Xiwen; Gao, Ran; Liu, Jiwei; Wang, Min; Che, Renchao

    2013-08-01

    Monodispersed manganese oxide (Mn1-xCox)3O4 (0 nanoparticles, less than 10 nm size, are respectively synthesized via a facile thermolysis method at a rather low temperature, ranging from 90 to 100 °C, without any inertia gas for protection. The influences of the Co dopant content on the critical reaction temperature required for the nanoparticle formation, electronic band structures, magnetic properties, and the microwave absorption capability of (Mn1-xCox)3O4 are comprehensively investigated by means of both experimental and theoretical approaches including powder X-ray diffraction (XRD), electron energy loss spectroscopy (EELS), super conductivity quantum interference device (SQUID) examination, and first-principle simulations. Co is successfully doped into the Mn atomic sites of the (Mn1-xCox)3O4 lattice, which is further confirmed by EELS data acquired from one individual nanoparticle. Therefore, continuous solid solutions of well-crystallized (Mn1-xCox)3O4 products are achieved without any impurity phase or phase separation. With increases in the Co dopant concentration x from 0 to 0.5, the lattice parameters change systemically, where the overall saturation magnetization at 30 K increases due to the more intense coupling of the 3d electrons between Mn and Co, as revealed by simulations. The microwave absorption properties of the (Mn1-xCox)3O4 nanoparticles are examined between 2 and 18 GHz. The maximum absorption peak -11.0 dB of the x = 0 sample is enhanced to -11.5 dB for x = 0.2, -12.7 dB for x = 0.25, -15.6 dB for x = 0.33, and -24.0 dB for x = 0.5 respectively, suggesting the Co doping effects. Our results might provide novel insights into the understanding of the influences of metallic ion doping on the electromagnetic properties of metallic oxide nanomaterials.Monodispersed manganese oxide (Mn1-xCox)3O4 (0 nanoparticles, less than 10 nm size, are respectively synthesized via a facile thermolysis method at a rather low temperature, ranging from 90 to

  19. A 4Σ1/2-X1/2 transition in the electronic spectrum of the CuS molecule

    International Nuclear Information System (INIS)

    Lefebvre, Y.; Delaval, J.M.; Schamps, J.

    1991-01-01

    The (0-0) band of a new 4 Σ 1/2 -X 2 Π 1/2 transition has been observed in the hollow cathode emission spectra of the CuS molecule. Rotational analysis provides the following molecular constants (in cm -1 ) for the D 4 Σ 1/2 state: T 0 = 23112.88; B 0 = 0.17453; p 0 = 0.858; p 0j = 3.3x10 -6 ; D 0 = 0.11x10 -6 . Pulsed dye laser fluorescence experiments confirm the general diagram of the observed CuS electronic states. (orig.)

  20. The influence of fluorine on the structures and properties of Pr sub 2 sub - sub x Sr sub x CuO sub 4 sub - sub y (x = 0.0, 0.4, 1.0)

    CERN Document Server

    Yang Jin Ling; Tang Wei Hua; Rao Guang Hui; Liang Jing Kui; Jin Duo

    1997-01-01

    Introducing F into the lattices of the copper oxides Pr sub 2 CuO sub 4 , Pr sub 1 sub . sub 6 Sr sub 0 sub . sub 4 CuO sub 4 and PrSrCuO sub 4 sub - sub y is accomplished via a low-temperature fluorination reaction using CuF sub 2 as the fluorinating reagent. The oxyfluorides retain the structures of their precursors, but striking lattice expansions are observed. No trace of SrF sub 2 was detected in the fluorinated products. F doping was successfully used to induce superconductivity in the oxyfluoride PrSrCu(O, F) sub 4 sub - subdelta (T sub c = 15 K) with a reduced CuO sub 2 plane and in the presence of apical anions, but failed to optimize the carrier density and induce superconductivity in Pr sub 2 CuO sub 4 sub - sub x F sub x and Pr sub 1 sub . sub 6 Sr sub 0 sub . sub 4 CuO sub 4 sub - sub x F sub x. (author)

  1. Selective Magnetic Evolution of MnxFe1-xO Nanoplates

    KAUST Repository

    Song, Hyon-Min

    2015-04-27

    Iron-manganese oxide (MnxFe1-xO) nanoplates were prepared by thermal decomposition method. Irregular development of crystalline phases was observed with the increase of annealing temperature. Magnetic properties are in accordance with their respective crystalline phases, and the selective magnetic evolution from their rich magnetism of MnxFe1-xO and MnFe2O4 is achieved by controlling the annealing conditions. Rock-salt structure of MnxFe1-xO (space group Fm-3m) is observed in as-synthesized nanoplates, while MnFe2O4 and MnxFe1-xO with significant magnetic interactions between them are observed at 380 °C. In nanoplates annealed at 450 °C, soft ferrites of Mn0.48Fe2.52O4 with MnxFe1-xO are observed. It is assumed that the differential and early development of crystalline phase of MnxFe1-xO, and the inhomogeneous cation mixing between Mn and Fe cause this rather extraordinary magnetic development. In particular, the prone nature of divalent metal oxides to cation vacancy and the prolonged annealing time of 15 hours which enables ordering are also thought to contribute to these irregularities.

  2. Selective Magnetic Evolution of MnxFe1-xO Nanoplates

    KAUST Repository

    Song, Hyon-Min; Zink, Jeffrey I.; Khashab, Niveen M.

    2015-01-01

    Iron-manganese oxide (MnxFe1-xO) nanoplates were prepared by thermal decomposition method. Irregular development of crystalline phases was observed with the increase of annealing temperature. Magnetic properties are in accordance with their respective crystalline phases, and the selective magnetic evolution from their rich magnetism of MnxFe1-xO and MnFe2O4 is achieved by controlling the annealing conditions. Rock-salt structure of MnxFe1-xO (space group Fm-3m) is observed in as-synthesized nanoplates, while MnFe2O4 and MnxFe1-xO with significant magnetic interactions between them are observed at 380 °C. In nanoplates annealed at 450 °C, soft ferrites of Mn0.48Fe2.52O4 with MnxFe1-xO are observed. It is assumed that the differential and early development of crystalline phase of MnxFe1-xO, and the inhomogeneous cation mixing between Mn and Fe cause this rather extraordinary magnetic development. In particular, the prone nature of divalent metal oxides to cation vacancy and the prolonged annealing time of 15 hours which enables ordering are also thought to contribute to these irregularities.

  3. Heteroaromatization with 4-Hydroxycoumarin Part II: Synthesis of Some New Pyrano[2,3-d]pyrimidines, [1,2,4]triazolo[1,5-c]pyrimidines and Pyrimido[1,6-b]-[1,2,4]triazine Derivatives

    Directory of Open Access Journals (Sweden)

    A. H. Bedair

    2001-05-01

    Full Text Available A variety of novel [1,2,4]triazolo[1,5-c]pyrimidine-13-ones (4a-f and (5b-d could be obtained via reaction of 9-amino-7-(4’-chlorophenyl-8,9-dihydro-8-imino-6H,7H-[1]benzopyrano[3`,4`:5,6]pyrano[2,3-d]pyrimidine-6-one (3 with a variety of reagents. Pyrano[2,3-d]pyrimidine-6-ones 5a, 8a-c and pyrimido[1,6-b][1,2,4]-triazine-3,14-dione (6 were also prepared. The antimicrobial activity of some of the synthesized compounds was tested.

  4. Cytotoxic effect of x-irradiation of mouse tumor cells in the presence of Korean ginseng extract

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Hyoung Cheol; Kim, Jin Ki; Kim, Jung Soo [College of Medicine, Chonbuk National Univ., Junju (Korea, Republic of); Choi, Dong Seong [College of Medicine, Woosuck Univ., Wanju (Korea, Republic of)

    2000-09-01

    We already reported the results that aqueous extract of Korean ginseng roots showed a marked cytotoxicity. In this study, we investigated whether combined ginseng product with X-irradiation increase the cytotoxicity of tumor cells than X-irradiation or not. Fifty gram of Korean ginseng powder mixed with 1 L of distilled water was extracted with reflux flask under condition of 100 .deg. C for 5 hrs. This aqueous ginseng extract was filtered, centrifuged and then was freezed under condition of -90 .deg. C for 16-18 hrs. The freezing extract was dried with freeze drier, and then diluted. X-irradiation was given to tumor cells by 6 MeV linear accelerator. The cytotoxicity of ginseng in vitro was evaluated from its ability to reduce the clonogenecity of fibrosarcoma (FSa ll) cells. In X-irradiation alone group, each 2, 4, 6 and 8 Gy was given to tumor cells. In X-irradiation with ginseng group, 0.2 mg/mL or ginseng extract was exposed to tumor cells for 1 hour before X-irradiation. The yield for 50 g of ginseng extract which was treated with freezing drier was 3.13 g(6.3%). Cytotoxicity in vitro was measured as survival fraction which was judged from the curve, at ginseng concentration of 0.001, 0.01, 0.1 and 1 mg/ml were 0.89{+-}0.04, 0.86{+-}0.06, 0.73{+-}0.01 and 0.09{+-}0.02, respectively. Survival fraction at X-irradiation alone of 2, 4, 6 and 8 Gy were 0.81{+-}0.07, 0.42{+-}0.08, 0.15{+-}0.02, 0.03{+-}0.01, respectively. But, survival fraction in combined group of X-irradiation and ginseng (0.2mg/mL) at each same radiation dose were 0.28{+-}0.01, 0.18{+-}0.03, 0.08{+-}0.02, 0.006{+-}0.002, respectively (p<0.05). The yield for ginseng extract which was treated with freezing drier was 6.3%. Cytotoxicity of Fsa II in combined ginseng with X-irradiation group was increased than that at X-irradiation alone group, and its enhancing effect seemed to be added.

  5. Cytotoxic effect of x-irradiation of mouse tumor cells in the presence of Korean ginseng extract

    International Nuclear Information System (INIS)

    Kwon, Hyoung Cheol; Kim, Jin Ki; Kim, Jung Soo; Choi, Dong Seong

    2000-01-01

    We already reported the results that aqueous extract of Korean ginseng roots showed a marked cytotoxicity. In this study, we investigated whether combined ginseng product with X-irradiation increase the cytotoxicity of tumor cells than X-irradiation or not. Fifty gram of Korean ginseng powder mixed with 1 L of distilled water was extracted with reflux flask under condition of 100 .deg. C for 5 hrs. This aqueous ginseng extract was filtered, centrifuged and then was freezed under condition of -90 .deg. C for 16-18 hrs. The freezing extract was dried with freeze drier, and then diluted. X-irradiation was given to tumor cells by 6 MeV linear accelerator. The cytotoxicity of ginseng in vitro was evaluated from its ability to reduce the clonogenecity of fibrosarcoma (FSa ll) cells. In X-irradiation alone group, each 2, 4, 6 and 8 Gy was given to tumor cells. In X-irradiation with ginseng group, 0.2 mg/mL or ginseng extract was exposed to tumor cells for 1 hour before X-irradiation. The yield for 50 g of ginseng extract which was treated with freezing drier was 3.13 g(6.3%). Cytotoxicity in vitro was measured as survival fraction which was judged from the curve, at ginseng concentration of 0.001, 0.01, 0.1 and 1 mg/ml were 0.89±0.04, 0.86±0.06, 0.73±0.01 and 0.09±0.02, respectively. Survival fraction at X-irradiation alone of 2, 4, 6 and 8 Gy were 0.81±0.07, 0.42±0.08, 0.15±0.02, 0.03±0.01, respectively. But, survival fraction in combined group of X-irradiation and ginseng (0.2mg/mL) at each same radiation dose were 0.28±0.01, 0.18±0.03, 0.08±0.02, 0.006±0.002, respectively (p<0.05). The yield for ginseng extract which was treated with freezing drier was 6.3%. Cytotoxicity of Fsa II in combined ginseng with X-irradiation group was increased than that at X-irradiation alone group, and its enhancing effect seemed to be added

  6. Transition from weak ferromagnetism to metamagnetism in the itinerant-electron system Y{sub 1-x}La{sub x}Co{sub 9}Si{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Nishiyama, M; Kohara, T [Graduate School of Material Science, University of Hyogo, Kamigori, Ako-gun, Hyogo 678-1297 (Japan); Nakamura, H [Department of Materials Science and Engineering, Kyoto University, Kyoto 606-8501 (Japan)

    2010-01-15

    The magnetism of solid solution Yi{sub 1-x}La{sub x}Co{sub 9}Si{sub 4} between strongly enhanced Pauli paramagnetic LaCo{sub 9}Si{sub 4} and weakly ferromagnetic YCo{sub 9}Si{sub 4} has been investigated. The Curie temperature T{sub C} in the ferromagnetic region and the metamagnetic transition field H{sub M} in the paramagnetic region change continuously against x and approach zero at the same composition x {approx_equal} 0.15, suggesting the presence of a critical point from spontaneous to field-induced ferromagnetism.

  7. Laccase-catalyzed C-S and C-C coupling for a one-pot synthesis of 1,4-naphthoquinone sulfides and 1,4-naphthoquinone sulfide dimers

    CSIR Research Space (South Africa)

    Wellington, Kevin W

    2013-06-01

    Full Text Available Oxidative C-S and C-C bond formation with aryl and alkyl thiols was catalyzed under mild conditions in a reaction vessel open to air at pH 4.5 in the presence of a commercial laccase (Novozym 51003 or Suberase) and a cosolvent (DMF) to afford 1...

  8. Effects of preparation conditions on the ionic conductivity of hydrothermally synthesized Li1+xAlxTi2-x(PO4)3 solid electrolytes

    International Nuclear Information System (INIS)

    Kim, Kwang Man; Shin, Dong Ok; Lee, Young-Gi

    2015-01-01

    Li 1+x Al x Ti 2-x (PO 4 ) 3 (LATP) solid electrolytes are prepared by hydrothermal reaction as an effective method to yield moderate ionic conductivity adoptable in actual lithium-ion batteries. Particularly examined in this study are the effects of the synthesis conditions, such as Al dopant concentration (x), hydrothermal reaction time, and calcination and sintering temperatures, on the ionic conductivity of the synthesized LATP. Through repeated synthesis and characterizations of the LATPs by variation of the values of condition variables, the optimum condition for the best LATP with adequate ionic conductivity applicable to actual lithium batteries are determined to be x = 0.3 or 0.4, a hydrothermal reaction time of 12 h, and calcination and sintering temperatures of 600 °C and 900 °C, respectively

  9. Ferri-magnetic order in Mn induced spinel Co{sub 3−x}Mn{sub x}O{sub 4} (0.1≤x≤1.0) ceramic compositions

    Energy Technology Data Exchange (ETDEWEB)

    Meena, P.L., E-mail: plmeena@gmail.com [Department of Physics, Deen Dayal Upadhyaya College (University of Delhi), Shivaji Marg, Karampura, New Delhi 110015 (India); Sreenivas, K. [Department of Physics and Astrophysics, University of Delhi, North Campus, Delhi 110007 (India); Singh, M.R. [Technical Physics and Prototype Engineering Division, Bhabha Atomic Research Centre, Mumbai, Maharashtra 400085 (India); Kumar, Ashok; Singh, S.P. [National Physical Laboratory, Dr. K.S. Krishnan Marg, New Delhi 110012 (India); Kumar, Ravi [Beant College of Engineering and Technology, Gurdaspur, Punjab 143521 (India)

    2016-04-01

    We report structural and magnetic properties of spinel Co{sub 3−x}Mn{sub x}O{sub 4} (x=0.11.0) synthesized by solid state reaction technique. Rietveld refinement analysis of X-ray diffraction (XRD) data, revealed the formation of polycrystalline single phase Co{sub 3−x}Mn{sub x}O{sub 4} without any significant structural change in cubic crystal symmetry with Mn substitution, except change in lattice parameter. Temperature dependent magnetization data show changes in magnetic ordering temperature, indicating formation of antiferromagnetic (AFM) and ferrimagnetic (FM) phase at low Mn concentration (x≤0.3) and well-defined FM phase at high Mn concentration (x≥0.5). The isothermal magnetization records established an AFM/FM mixed phase for composition ranging 0.1<x<0.5 and with strong FM phase above x>0.5. - Highlights: • Synthesis of single phase polycrystalline Co{sub 3−x}Mn{sub x}O{sub 4} ceramic. • Change in magnetic ordering with varying Mn concentration. • The complex spin distribution is contributing to FM ordering with higher Mn.

  10. Cr/B{sub 4}C multilayer mirrors: Study of interfaces and X-ray reflectance

    Energy Technology Data Exchange (ETDEWEB)

    Burcklen, C.; Meltchakov, E.; Jérome, A.; Rossi, S. de; Delmotte, F. [Laboratoire Charles Fabry, Institut d' Optique Graduate School, CNRS, Université Paris-Saclay, 91127 Palaiseau Cedex (France); Soufli, R. [Laboratoire Charles Fabry, Institut d' Optique Graduate School, CNRS, Université Paris-Saclay, 91127 Palaiseau Cedex (France); Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, California 94550 (United States); Dennetiere, D.; Polack, F.; Capitanio, B.; Thomasset, M. [Synchrotron SOLEIL, L' Orme des Merisiers, Saint Aubin, BP 48F-91192 Gif sur Yvette Cedex (France); Gullikson, E. [Center for X-ray Optics, Lawrence Berkeley National Laboratory, 1 Cyclotron Rd., Berkeley, California 94720 (United States)

    2016-03-28

    We present an experimental study of the effect of layer interfaces on the x-ray reflectance in Cr/B{sub 4}C multilayer interference coatings with layer thicknesses ranging from 0.7 nm to 5.4 nm. The multilayers were deposited by magnetron sputtering and by ion beam sputtering. Grazing incidence x-ray reflectometry, soft x-ray reflectometry, and transmission electron microscopy reveal asymmetric multilayer structures with a larger B{sub 4}C-on-Cr interface, which we modeled with a 11.5 nm thick interfacial layer. Reflectance measurements in the vicinity of the Cr L{sub 2,3} absorption edge demonstrate fine structure that is not predicted by simulations using the currently tabulated refractive index (optical constants) values for Cr.

  11. Dicty_cDB: Contig-U13006-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A-FP_182294 Lysiphlebus testaceipes adult whol... 34 3.0 2 ( BU896130 ) X036A07 Populus wood cDNA library Populus tremul...1.r GM_WBc Glycine max genomic clone ... 34 2.9 2 ( DN492755 ) X036A07.3pR Populus wood cDNA library Populus tre...... 34 2.9 2 ( DN502768 ) X036A07.5pR Populus wood cDNA library Populus tre... 34 2.9 2 ( EH014215 ) USD..... 34 2.4 2 ( EU795178 ) Uncultured bacterium HF0010_09O16 genomic sequence. 34 2.4 2 ( AC182691 ) Populus tric...itermes flavipes symbiont library ... 36 3.2 2 ( DQ927304 ) Tetrahymena paravorax strain RP m

  12. Theoretical study on guided wave propagation in (1 - x)Pb(Mg1/3Nb2/3)O3-xPbTiO3 (x = 0.29 and 0.33) single crystal plates

    International Nuclear Information System (INIS)

    Chen Chuanwen; Zhang Rui; Cao Wenwu

    2009-01-01

    The propagation of guided waves in free standing (1 - x)Pb(Mg 1/3 Nb 2/3 )O 3 -xPbTiO 3 [PMN-xPT] (x = 0.29 or 0.33) single crystal plates has been studied theoretically. The polar directions are in the (111) family directions of the cubic reference coordinates but the crystals are being polarized along [0 0 1] c , [0 1 1] c and [1 1 1] c of the cubic reference directions so that the effective microscopic symmetries are 4mm, mm2 and 3m, respectively. Multiple mode couplings appear in the dispersion curves for both the symmetric and the antisymmetric Lamb and shear horizontal modes. The velocities of most guided waves decrease rapidly with frequency. Then, after passing a minimum, they begin to increase with frequency and eventually saturate to the shear wave velocity v sz (or v 1 = 3507 m s -1 for [1 1 1] c polarized sample). For a [1 1 1] c polarized single domain PMN-0.33PT sample, the S 1 mode instead of the S 0 mode approaches the Rayleigh velocity v R at high frequencies.

  13. Relieving geometrical frustration through doping in the Dy1x Cax BaCo4O7 swedenborgites

    International Nuclear Information System (INIS)

    Nath Panja, Soumendra; Kumar, Jitender; Dengre, Shanu; Nair, Sunil

    2016-01-01

    The geometrically frustrated antiferromagnet DyBaCo 4 O 7 is investigated through a combination of x-ray diffraction, magnetization and dielectric measurements. Systematic doping in the series Dy 1x Ca x BaCo 4 O 7 causes a lifting of the geometrical frustration resulting in a structural transition from a trigonal P31c to an orthorhombic Pbn2 1 symmetry at x   =  0.4. This structural transition can also be accessed as a function of temperature, and all our orthorhombic specimens exhibit this transition at elevated temperatures. The temperature at which this structural transition occurs is observed to scale linearly with the mean ionic radius of the R site ion. However, CaBaCo 4 O 7 which has an equal number of Co 2+  and Co 3+ ions clearly violates this quasilinear relationship, indicating that charge ordering could also play a critical role in stabilizing the orthorhombic distortion in this system. Using thermoremanent magnetization measurements to circumvent the problem of the large paramagnetic background arising from Dy 3+ ions, we chart out the phase diagram of the Dy 1x Ca x BaCo 4 O 7 series. (paper)

  14. Moessbauer study of (Fe1-x Cu x )4N (0.05≤x≤0.15) films

    International Nuclear Information System (INIS)

    El Khiraoui, S.; Sajieddine, M.; Vergnat, M.; Bauer, Ph.; Mabrouki, M.

    2007-01-01

    In this work, we have prepared nitrogenated Fe 1- x Cu x alloys by reactive evaporation under a flow of nitrogen ions. After annealing, X-ray diffraction shows that we have synthesized the γ'-(Fe 1- x Cu x ) 4 N (0.05≤x≤0.15) compounds. The films were investigated by Moessbauer spectroscopy. The crystallographic structure and the respective positions of the Fe and Cu atoms in the compounds have been determined

  15. Ab-initio electronic structure calculations and properties of [Si{sub x}Sn{sub 1x}]{sub 3}N{sub 4} ternary nitrides

    Energy Technology Data Exchange (ETDEWEB)

    Pavloudis, Th. [Department of Physics, Aristotle University of Thessaloniki, GR-54124 Thessaloniki (Greece); Zervos, M. [Nanostructured Materials and Devices Laboratory, Department of Mechanical and Manufacturing Engineering, PO Box 20537, Nicosia 1678 (Cyprus); Komninou, Ph. [Department of Physics, Aristotle University of Thessaloniki, GR-54124 Thessaloniki (Greece); Kioseoglou, J., E-mail: sifisl@auth.gr [Department of Physics, Aristotle University of Thessaloniki, GR-54124 Thessaloniki (Greece)

    2016-08-31

    We carry out ab initio electronic structure calculations of (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4} using density functional theory with projector augmented-wave potentials under the generalized gradient approximation. We find that the energetically favorable structure of Sn{sub 3}N{sub 4} is the face-centered cubic spinel structure, followed by the hexagonal structure which has energy band gaps of 1.85 eV and 1.44 eV respectively. The (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4} ternary compound can exhibit both cubic and hexagonal crystal structures over the full range of x. However, the cubic structure is found to be energetically favorable for x < 0.3 above which the hexagonal structure of (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4} dominates. The energy band gap can be tuned continuously from 1.44 eV up to 5.8 eV in the case of the hexagonal crystal structure of (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4} and from 1.85 eV to 4.82 eV in the case of cubic (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4}. Nevertheless the energy gap of (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4} is direct only for x < 0.3 when it is cubic and for x < 0.5 when hexagonal. - Highlights: • (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4} exhibits both cubic and hexagonal crystal structures. • The cubic structure is favorable for x < 0.3 and the hexagonal structure for x > 0.3. • The bandgap of hexagonal (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4} may be tuned from 1.44 eV up to 5.8 eV. • The bandgap may be tuned from 1.85 eV to 4.82 eV for the cubic (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4}. • Bandgaps are direct for x < 0.3 (cubic) and for x < 0.5 3 (hexagonal (Si{sub x}Sn{sub 1x}){sub 3}N{sub 4}).

  16. Structure and magnetic properties of (Nd1-xErx)3Fe25Cr4.0 (0 ≤ x ≤ 0.8) compounds

    International Nuclear Information System (INIS)

    Luo Hongzhi; Jia Lin; Li Yangxian; Meng Fanbin; Shen Jiang; Chen Nanxian; Wu Guangheng; Yang Fuming

    2004-01-01

    The structure and magnetic properties of (Nd 1-x Er x ) 3 Fe 25 Cr 4.0 compounds with x = 0-0.8 have been investigated using x-ray powder diffraction (XRD) and magnetic measurements. It has been found that all the compounds crystallize in a Nd 3 (Fe,Ti) 29 -type structure. Substitution of Er for Nd leads to a contraction of the unit-cell volume. The Curie temperature, T c , and the saturation magnetization, M s , of (Nd 1-x Er x ) 3 Fe 25 Cr 4.0 decrease monotonically with increasing Er content. The easy magnetization direction (EMD) of Nd 3 Fe 25 Cr 4.0 at room temperature is close to the [040] direction but may be a little out of the basal plane. With increasing Er content, the EMD changes closer to the [40-2] direction and the tilt angle increases. Both the XRD patterns and ac susceptibility indicate the appearance of a spin reorientation for x = 0-0.4 as the temperature decreases from room temperature to 77 K. The spin reorientation temperature, T sr , increases monotonically with increasing Er content from 158 K for x = 0 to 198 K for x = 0.4. A first order magnetization process (FOMP) occurs for all the compounds, and the critical field of the FOMP decreases with increasing Er content from 6.6 T for x = 0 to 2.0 T for x = 0.7

  17. Green synthesis, characterization and catalytic activity of natural bentonite-supported copper nanoparticles for the solvent-free synthesis of 1-substituted 1H-1,2,3,4-tetrazoles and reduction of 4-nitrophenol

    Directory of Open Access Journals (Sweden)

    Akbar Rostami-Vartooni

    2015-12-01

    Full Text Available In this study, Cu nanoparticles were immobilized on the surface of natural bentonite using Thymus vulgaris extract as a reducing and stabilizing agent. The natural bentonite-supported copper nanoparticles (Cu NPs/bentonite were characterized by FTIR spectroscopy, X-ray diffraction (XRD, X-ray fluorescence (XRF, field emission scanning electron microscopy (FE-SEM, energy dispersive X-ray spectroscopy (EDS, transmission electron microscopy (TEM, selected area electron diffraction (SAED and Brunauer–Emmett–Teller (BET analysis. Afterward, the catalytic performance of the prepared catalyst was investigated for the solvent-free synthesis of 1-substituted 1H-1,2,3,4-tetrazoles and reduction of 4-nitrophenol (4-NP in water. It was found that the Cu NPs/bentonite is a highly active and recyclable catalyst for related reactions.

  18. Radiochemical synthesis of 3-(4-[18F] Fluorophenyl)-8-hydroxy-1, 2, 3, 4-tetrahydrochromeno [3, 4-c] pyridin-5-one: A putative dopamine D$4 receptor PET imaging agent

    International Nuclear Information System (INIS)

    Li, G.C.; Yin, D.Z.; Wang, M.W.; Cheng, D.F.; Wang, Y.X.

    2005-01-01

    Introduction: The dopamine D 4 receptor has lately received increasing interest since it has been hypothesized to be involved in the pathology and pharmacotherapy of schizophrenia. While this receptor is expressed in lower density in various extrastriatal brain regions and its distribution is still unclear due to the lack of suitable imaging agent and its level change in schizophrenia is controversial. Herein, based on the structure-activity analysis of chromeno[3, 4-c]pyridine- 5-ones as potential dopamine D 4 receptor ligands, a putative D 4 subtype positron emission tomography (PET) radioligand, 3-(4-[ 18 F]fluorophenyl)-8-hydroxy-1, 2, 3, 4-tetrahydrochromeno [3, 4-c]pyridin-5-one ([ 18 F]FHTP), was designed and synthesized. Methods: The radiochemical synthesis route was shown in Figure 1. [ 18 F]Fluoride was produced with a Cyclone-30 (IBA, Belgium) by 18 O(p, n) 18 F reaction using enriched 18 O-H 2 O and eluted from a Dowex 1-X8 anion-exchange column with aqueous potassium carbonate (20 mg/mL). 4-[ 18 F]Fluorobenzaldehyde was prepared according to the method reported by Alan A. Wilson and et al.. Then, 8-hydroxy-1, 2, 3, 4-tetrahydrochromeno [3, 4-c]pyridin-5-one, sodium cyanoborohydride, methanol and acetic acid were added to the dry residue, The mixture was then sealed and heated at 120 degree C for 12 min. At the end of the reaction, the mixture was cooled, diluted with ethyl acetate and washed with water. The extracted organic layer was passed through a small anhydrous magnesium sulfate column. After removal of the solvents in the mixture at 50 degree C under a stream of nitrogen, the obtained residue was redissolved in methanol and purified with a semi-preparative HPLC system, then the desired product was collected. Results: The radiochemical synthesis of [ 18 F]FHTP took around 110 min at EOS with an overall radiochemical yield 19% (decay-corrected) and its radiochemical purity was higher than 95%. Conclusion: A presumed dopamine D 4 receptor PET

  19. Biosynthesis and isolation of C1 and Cx cellulases

    Energy Technology Data Exchange (ETDEWEB)

    Panaiotov, Kh; Cholakov, G

    1981-01-01

    Aspergillus usamii, Aspergillus niger, and Trichoderma viridae were grown on media containing lactose, lignin, (NH4)2SO4, urea, KH2PO4, CaCl2, MgSO4, and yeast extract. Maximum activities of cellulase C1 and Cx in Aspergillus usamii were observed after 76 and 90 h to be approximately 6 and approximately 24 units/mug protein, respectively. Maximum production by Aspergillus niger was 5 units C1/mug at 90h and 44 units Cx/mug at 34 h and Trichoderma produced 32.5 units C1 at 34 h and 16.5 units Cx at 58 h. Thus, Trichoderma viride produces cellulases C1 and Cx in a more balanced ratio than the Aspergillus strains.

  20. Accessing alkali-free NASICON-type compounds through mixed oxoanion sol–gel chemistry: Hydrogen titanium phosphate sulfate, H{sub 1x}Ti{sub 2}(PO{sub 4}){sub 3−x}(SO{sub 4}){sub x} (x=0.5–1)

    Energy Technology Data Exchange (ETDEWEB)

    Mieritz, Daniel; Davidowski, Stephen K.; Seo, Dong-Kyun, E-mail: dseo@asu.edu

    2016-10-15

    We report a direct sol–gel synthesis and characterization of new proton-containing, rhombohedral NASICION-type titanium compounds with mixed phosphate and sulfate oxoanions. The synthetic conditions were established by utilizing peroxide ion as a decomposable and stabilizing ligand for titanyl ions in the presence of phosphates in a strong acidic medium. Thermogravimetric analysis (TGA), powder X-ray diffraction (PXRD), induction-coupled plasma optical emission spectroscopic (ICP-OES) elemental analysis, and Raman and {sup 1}H magic angle spinning nuclear magnetic resonance (MAS-NMR) spectroscopic studies have determined the presence of sulfate and proton ions in the structure, for which the compositional range has been found to be H{sub 1x}Ti{sub 2}(PO{sub 4}){sub 3−x}(SO{sub 4}){sub x} (x=0.5–1). The particulate products exhibit a nanocrystalline nature observed through characterization with scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The N{sub 2} sorption isotherm measurements and subsequent Brunauer–Emmett–Teller (BET) and Barrett–Joyner–Halenda (BJH) analyses confirmed the presence of the textural meso- and macropores in the materials. Future studies would determine the potential of the new compounds in various applications as battery materials, proton conductors and solid acid catalysts. - Graphical abstract: A series of proton-containing NASICON-type compounds, H{sub 1x}Ti{sub 2}(PO{sub 4}){sub 3−x}(SO{sub 4}){sub x} (x=0.5–1), were discovered through a new sol–gel synthetic method that utilizes peroxide ion as a decomposable and stabilizing ligand for titanyl ions in the presence of phosphates in a strong acidic medium.

  1. Physical properties and microstructures of La_{1-{x}}Pr_{{x}}PO_4 monazite-ceramics

    Science.gov (United States)

    Thust, Anja; Hirsch, Antje; Haussühl, Eiken; Schrodt, Nadine; Loison, Lise; Schott, Petra; Peters, Lars; Roth, Georg; Winkler, Björn

    2018-04-01

    Synthetic La_{1-{x}}Pr_{{x}}PO_4 monazite-type powders and ceramics with 0 ≤ x1 were analysed by scanning electron microscopy, high-temperature powder X-ray diffraction, dilatometry, and plane wave ultrasound spectroscopy. Ceramics were synthesised in a two-step sintering process at 1273 and 1573 K. Final densities were up to 99.3% of the theoretical densities. Each sample shows a homogeneous distribution of grain sizes, which increase with increasing sintering temperature. Grain sizes also depend on composition, with intermediate compositions yielding the largest grains. In-situ high-temperature powder X-ray diffraction shows that the volumetric thermal expansion coefficients of the monazite powders decrease with increasing Pr content. This behavior is not observed in dilatometry measurements of the bulk samples (ceramics) because their thermal expansion mainly depends on their density. Elastic properties show the same dependence on the density.

  2. Automatic Tracking Radar Career Ladder, AFSC-303X3. Electronics Principles Inventory (EPI).

    Science.gov (United States)

    1981-02-01

    Oscilloscopes (p. 12) to low in areas such as Infrared (pp. 42-43), Lasers (pp. 43-44), and Display Tubes (p. 44-45). The 3-skill level column is...41 55 INPUT/OUTPUT (PERIPHERAL) DEVICES S1171 41 56 PHOTO SENSITIVE DEVICES S1185 42 57 SYNCHRONOUS VIBRATIONS (CHOPPER CIRCUITS) S1186 42 58 INFRARED ... WW2 00 w. 2 -O . 0 a1a 0 21 a a1 a’ 3iiihh hi V i-- 2 a a. aV oft1 cca a x ar cc a a & & it-1- " IkU4. aacW r c f a a ar - C3 j a cca o low cc t a: a cc

  3. NLO NRQCD disfavors the interpretation of X(3872) as {chi}{sub c1}(2P)

    Energy Technology Data Exchange (ETDEWEB)

    Butenschoen, Mathias [Wien Univ. (Austria). Fakultaet fuer Physik; He, Zhi-Guo; Kniehl, Bernd A. [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik

    2013-03-15

    We study {chi}{sub c1}(2P) inclusive hadroproduction at next-to-leading order (NLO) within the factorization formalism of nonrelativistic quantum chromodynamics (NRQCD), including both the color-singlet {sup 3}P{sub 1}{sup [1]} and color-octet {sup 3}S{sub 1}{sup [8]} c anti c Fock states. Assuming the recently discovered X(3872) hadron to be the 2P (1{sup ++}) charmonium state, we perform a fit to the cross sections measured by the CDF, CMS, and LHCb Collaborations. We either obtain an unacceptably high value of {chi}{sup 2} or a value of vertical stroke R{sub 2P}{sup '}(0) vertical stroke incompatible with well-established potential models. We thus conclude that NLO NRQCD is incompatible with the hypothesis X(3872){identical_to}{chi}{sub c1}(2P).

  4. Growth and laser characterization of mixed Nd:Lu xGd 1-xVO 4 laser crystals

    Science.gov (United States)

    Yu, Haohai; Yu, Yonggui; Zhang, Huaijin; Wang, Zhengping; Wang, Jiyang; Cheng, Xiufeng; Shao, Zongshu; Jiang, Minhua

    2006-08-01

    A new series Nd:Lu xGd 1-xVO 4 ( x=0.14, 0.32, 0.50, 0.61, 0.70 and 0.80) mixed laser crystals have been successfully grown by the Czochralski method. The X-ray powder diffraction (XRPD) analysis shows that the as-grown mixed crystals possess the ZrSiO 4 structure. The cell parameters are found to decrease with an increase of x. The optical absorption spectra of the mixed crystals have been measured at room temperature, and five strong-absorption bands centered at the wavelengths of 531, 594, 752, 807 and 880 nm have been revealed in all crystals. They are assigned to the different spin- and electric-dipole-allowed transition from the ground state to the 2K 13/2+ 4G 7/2+ 4G 9/2, 4G 5/2+ 2G 7/2, 4F 7/2+ 4S 3/2, 4F 5/2+ 2H 9/2 and 4F 3/2 energy levels, respectively. A continuous-wave (CW) laser output has been achieved with the mixed crystals at 1.06 μm under laser diode pumping. The maximum CW output power of 377.4 mW has been obtained with the pump power of 2 W, and the corresponding optical conversion efficiency is 18.8%.

  5. Preferential susceptibility of Th9 and Th2 CD4+ T cells to X4-tropic HIV-1 infection.

    Science.gov (United States)

    Orlova-Fink, Nina; Chowdhury, Fatema Z; Sun, Xiaoming; Harrington, Sean; Rosenberg, Eric S; Yu, Xu G; Lichterfeld, Mathias

    2017-10-23

    The functional polarization of CD4 T cells determines their antimicrobial effector profile, but may also impact the susceptibility to infection with HIV-1. Here, we analyzed the susceptibility of CD4 T cells with different functional polarization to infection with X4 and R5-tropic HIV-1. CD4 T cells with a Th1, Th2, Th17, and Th9 polarization were subjected to in-vitro infection assays with X4, R5, or vesicular stomatitis virus-G protein-pseudotyped HIV-1. In addition, we sorted differentially polarized CD4 T-cell subsets from individuals treated with antiretroviral therapy and analyzed the tropism of viral env sequences. Th9-polarized CD4 T cells and, to a lesser extent, Th2-polarized CD4 T cells expressed higher surface levels of CXCR4, and are more permissive to X4-tropic infection in vitro. In contrast, Th1 and Th17 CD4 T cells exhibited stronger surface expression of CCR5, and were more susceptible to infection with R5-tropic viruses. Correspondingly, the distribution of X4-tropic viral sequences in antiretroviral therapy-treated HIV-1-infected patients was biased toward Th9/Th2 cells, whereas R5-tropic sequences were more frequently observed in Th17 cells. CD4 T-cell polarization is associated with a distinct susceptibility to X4 and R5-tropic HIV-1 infection.

  6. A comparative study of low-field magnetoresistance for La sub 2 sub / sub 3 Ca sub 1 sub / sub 3 Mn sub 1 sub - sub x Cu sub x O sub 3 (x = 0% and 4%) synthesized at different temperatures

    CERN Document Server

    Yuan, S L; Xia, Z C; Zhao, L F; Liu, L; Chen, W; Zhang, G H; Zhang, L J; Feng, W; Zhong, Q H; Liu, S

    2003-01-01

    Polycrystalline samples of nominal La sub 2 sub / sub 3 Ca sub 1 sub / sub 3 Mn sub 1 sub - sub x Cu sub x O sub 3 (x 0% and 4%) were fabricated by a sol-gel method following sintering treatments at temperature T sub s ranging between 1000 deg. C and 1300 deg. C. Experiments indicate that doping Cu does not cause a change in crystalline structure, but strongly affects transport and magnetoresistance (MR) properties. For lower T sub s , when a low magnetic field of H = 0.3 T, is applied, the x = 0 samples show typical intergrain MR behaviour with a monotonic increase in MR sub 0 (ident to DELTA rho/rho(H = 0)) on cooling; while for the x = 4% samples, in addition to intergrain MR, a characteristic feature similar to colossal MR (CMR) is observed near the insulator-metal transition. The maximum MR with a value approx 80% of that for H = 0.3 T is obtained in the sample prepared at 1100 deg. C, which is comparable to the intrinsic CMR response usually observed in large fields of the order of several teslas.

  7. Quaternary (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloys and photosensitive structures on their basis

    Energy Technology Data Exchange (ETDEWEB)

    Bodnar, I. V. [Belarusian State University of Informatics and Radioelectronics (Belarus); Rud, V. Yu., E-mail: rudvas.spb@gmail.com [St. Petersburg State Polytechnical University (Russian Federation); Rud, Yu. V. [Russian Academy of Sciences, Ioffe Physical Technical Institute (Russian Federation); Lozhkin, D. V. [Belarusian State University of Informatics and Radioelectronics (Belarus)

    2011-07-15

    Using directional crystallization of the melt of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloy, homogeneous crystals of a similar atomic composition are grown over the entire range of compositions 1 {>=} x {>=} 0. It is established that the crystals of the continuous series of quaternary alloys in the range x = 0-1 crystallize in the spinel structure and lattice parameter a linearly depends on x. It is established that it is possible to obtain In(Al)/(FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} photosensitive structures. Room-temperature spectra of relative quantum efficiency of photoconversion of the In(Al)/(FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} structures fabricated for the first time are obtained. From the analysis of these spectra, activation energies of direct and indirect band-to-band transitions for the crystals of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloys are determined and the dependence of these parameters on the composition of the position-disordered phases of mentioned alloys is discussed. It is concluded that the crystals of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloys can be used in broadband photoconverters of optical radiation.

  8. Composition Screening in Blue-Emitting Li4Sr1+xCa0.97-x(SiO4)2:Ce3+ Phosphors for High Quantum Efficiency and Thermally Stable Photoluminescence.

    Science.gov (United States)

    Zhang, Jingchen; Zhang, Jilin; Zhou, Wenli; Ji, Xiaoyu; Ma, Wentao; Qiu, Zhongxian; Yu, Liping; Li, Chengzhi; Xia, Zhiguo; Wang, Zhengliang; Lian, Shixun

    2017-09-13

    Photoluminescence quantum efficiency (QE) and thermal stability are important for phosphors used in phosphor-converted light-emitting diodes (pc-LEDs). Li 4 Sr 1+x Ca 0.97-x (SiO 4 ) 2 :0.03Ce 3+ (-0.7 ≤ x1.0) phosphors were designed from the initial model of Li 4 SrCa(SiO 4 ) 2 :Ce 3+ , and their single-phased crystal structures were found to be located in the composition range of -0.4x ≤ 0.7. Depending on the substitution of Sr 2+ for Ca 2+ ions, the absolute QE value of blue-emitting composition-optimized Li 4 Sr 1.4 Ca 0.57 (SiO 4 ) 2 :0.03Ce 3+ reaches ∼94%, and the emission intensity at 200 °C remains 95% of that at room temperature. Rietveld refinements and Raman spectral analyses suggest the increase of crystal rigidity, increase of force constant in CeO 6 , and decrease of vibrational frequency by increasing Sr 2+ content, which are responsible for the enhanced quantum efficiency and thermal stability. The present study points to a new strategy for future development of the pc-LEDs phosphors based on local structures correlation via composition screening.

  9. Characterization of Y1-xCaxBa2Cu4O8 (x=0.0˜ 0.1) with Double Cu-O Chains by Raman Spectra

    Science.gov (United States)

    Kodama, Yasuharu; Tanemura, Sakae; Ikeda, Teruki

    1991-08-01

    Raman spectra of Y1-xCaxBa2Cu4O8 (x=0.0, 0.02, 0.05 and 0.1) ceramic samples synthesized under high oxygen pressure were investigated. Seven clear peaks assigned to Ag modes were observed for the sample with x=0. With increasing x, the peaks at 238 cm-1, 332 cm-1, 430 cm-1 and 590 cm-1 were broadened. The origin of the broadening of the peaks at 238 cm-1 and 590 cm-1 is considered to be the destruction of the double Cu-O chains due to the substitution of Ca for Y.

  10. New organic superconductors beta-(BDA-TTP)2X [BDA-TTP + 2,5-bis(1,3-dithian-2ylidene)-1,3,4,6-tetrathiapentalene; X(-) = SbF6(-), AsF6(-), and PF6(-)].

    Science.gov (United States)

    Yamada, J; Watanabe, M; Akutsu, H; Nakatsuji, S; Nishikawa, H; Ikemoto, I; Kikuchi, K

    2001-05-09

    The synthesis, electrochemical properties, and molecular structure of a new pi-electron donor, 2,5-bis(1,3-dithian-2-ylidene)-1,3,4,6-tetrathiapentalene (BDA-TTP), is described. In contrast to the hitherto-known tetrachalcogenafulvalene pi-donors providing organic superconductors, this donor contains only the bis-fused 1,3-dithiole-2-ylidene unit as a pi-electron system, yet produces a series of ambient-pressure superconductors beta-(BDA-TTP)2X [X = SbF6 (magnetic T(c) = 6.9 K, resistive T(c) = 7.5 K), AsF6 (magnetic T(c) = 5.9 K, resistive T(c) = 5.8 K), and PF6 (magnetic T(c) = 5.9 K)], which are isostructural. The values of the intermolecular overlap integrals calculated on the donor layers of these superconductors suggest a two-dimensional (2D) electronic structure with loose donor packing. Tight-binding band calculations also indicate that these superconductors have the 2D band dispersion relations and closed Fermi surfaces.

  11. Measurement and interpretation of momentum spectra of the inclusive reaction np→pX between 1.4 and 1.9GeV/c. Determination of cross sections for the np→pΔ330 channel

    International Nuclear Information System (INIS)

    Laville, J.-L.

    1976-01-01

    The creation of a high intensity beam of monokinetic neutrons obtained from stripping deuterons extracted from the synchrotron Saturne (C.E.N., Saclay) has allowed to measure with good statistical accuracy 43 momentum spectra of the final proton of the inclusive reaction np→pX at 1.39, 1.56, 1.73 and 1.90GeV/c (approximately 10 spectra per incident momentum). The final proton was analyzed with a magnetic spectrometer in the angular region between 0 and 20 deg in the laboratory. The set of results has been the object of two analyses: at first, the experimental spectra were compared with a pion exchange model modified by the off-shell parametrization of BENECKE-DURR-PILKUHN overall, this model correctly reproduces the measured spectra, both in form and absolute normalization. In the second analysis, the total and differential cross sections of the np→pΔ 33 0 channel were determined from the spectra measured using a subtraction procedure. The differential cross sections obtained in this way show an angular dependence that differs from the predictions of the pion exchange model. It is concluded that, at low energy, near its threshold, the reaction NN→NΔ 33 involves a set of more complex mechanisms than pion exchange alone, even if the latter remains dominant [fr

  12. Structural and magnetic properties of Zn{sub X}Co{sub 1X}Fe{sub 2}O{sub 4} nanoparticles: Nonsaturation of magnetization

    Energy Technology Data Exchange (ETDEWEB)

    Chithra, M.; Anumol, C.N. [Department of Physics, Central University of Kerala, Riverside Transit Campus, Nileshwar, P.O. Padnekkad, Kasaragod, Kerala 671314 (India); Sahu, Baidyanath [Department of Physics, I.I.T. Bombay, Powai, Mumbai 400076 (India); Sahoo, Subasa C., E-mail: subasa.cs@gmail.com [Department of Physics, Central University of Kerala, Riverside Transit Campus, Nileshwar, P.O. Padnekkad, Kasaragod, Kerala 671314 (India)

    2017-02-15

    Zn{sub X}Co{sub 1-X}Fe{sub 2}O{sub 4} nanoparticles were synthesized by sol-gel method and were annealed at two different temperatures; 500 °C and 900 °C in air for 2 h. Structural studies were carried out by X-ray diffraction and Fourier transformed infrared spectroscopy. The crystallite size didn’t show any variation with the increase in Zn{sup 2+} concentration and was increased after annealing. The magnetization value at 300 K for the as-prepared samples increased from 53 emu/g to 60 emu/g when Zn{sup 2+} concentration increased from x=0 to 0.2 and then it decreased to 11 emu/g for x=1. Similar magnetic behavior was also observed for the annealed samples with a peak at x=0.2. A very high magnetization value of 116 emu/g at 60 K was observed for the 900 °C annealed sample with x=0.4. The coercivity decreased monotonically with the increase in the Zn{sup 2+} concentration for both the as- prepared and the annealed samples. The magnetization and coercivity values were observed to be enhanced with the decrease in measurement temperature. The nonsaturation behavior of the magnetic hysteresis loops of these nanoparticle samples observed for all compositions and temperatures was studied by the method of approach to saturation by fitting M(H)=M(∞) [1−(H*/H){sup 1/2}] to the high field data of the initial curve from 20 kOe to 30 kOe. It was observed that H* value which is the measure of the nonsaturation increased with the increase in the Zn{sup 2+} concentration. The observed magnetic properties in these nanoparticle samples can be ascribed to the changed cation distribution in the spinel structure and to the decrease of Co{sup 2+} concentration. - Highlights: • Zn{sub X}Co{sub 1X}Fe{sub 2}O{sub 4} nanoparticles were prepared by sol-gel technique and were annealed. • Crystallite size didn’t show any variation with the increase in Zn{sup 2+} concentration and was increased after annealing. • Magnetic hysteresis loops showed non-saturation behavior

  13. Extraction-spectrophotometric method for silicon determination in high-purity substances. 1. Silicon determination in tellurium

    Energy Technology Data Exchange (ETDEWEB)

    Shaburova, V P; Yudelevich, I G [AN SSSR, Novosibirsk (USSR). Inst. Neorganicheskoj Khimii

    1989-01-01

    The extraction-spectrophotometric method for silicon determination in tellurium based on extraction isolation of the base by tributyl phosphate from hydrochloride solutions and with addition of HNO/sub 3/ and spectrophotometric silicon determination using malachite green is developed. The method permits to determine 2x10/sup -1/-3x10/sup -4/ % Si.

  14. 26 CFR 1.1092(c)-4 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES Wash Sales of Stock Or Securities § 1.1092(c)-4 Definitions. The following definitions apply... by the Philadelphia Stock Exchange, Inc., Relating to the Listing of Flexible Exchange Traded Equity... of the underlying security. (e) Adjusted applicable stock price means the applicable stock price, as...

  15. Magnetic instabilities in Er1-xYxCo3 studied by NMR

    International Nuclear Information System (INIS)

    Niki, H.; Fukumura, T.; Kinjou, H.; Kinjou, T.; Pieper, M.W.; Gratz, E.; Paul-Boncour, V.; Markosyan, A.S.

    2006-01-01

    The field dependence of 59 Co NMR in ferrimagnetic Er 1-x Y x Co 3 was measured up to 8T at 4.2K. For pure ErCo 3 in fields perpendicular to the c axis the resonance frequencies change discontinuously between 2 and 3T due to a field induced metamagnetic transition. The transition is characterized by rotations of Er and Co magnetic moments away from the easy c-axis. The angles between the Co moments and the c axis at x=0.1 are obtained. The easy axis is found to be along the c axis for x=0 and 0.1, and inclined from the c axis for x=0.3 and 0.5

  16. Two anhydrous zeolite X crystal structures, Pd sub 1 sub 8 Tl sub 5 sub 6 Si sub 1 sub 0 sub 0 Al sub 9 sub 2 O sub 3 sub 8 sub 4 and Pd sub 2 sub 1 Tl sub 5 sub 0 Si sub 1 sub 0 sub 0 Al sub 9 sub 2 O sub 3 sub 8 sub 4

    CERN Document Server

    Yoon, B Y; Lee, S H; Kim, Y

    2001-01-01

    The crystal structures of fully dehydrated Pd sup 2 sup + - and Tl sup + -exchanged zeolite X, Pd sub 1 sub 8 Tl sub 5 sub 6 Si sub 1 sub 0 sub 0 Al sub 9 sub 2 O sub 3 sub 8 sub 4 (Pd sub 1 sub 8 Tl sub 5 sub 6 X, a = 24.935(4) A) and Pd sub 2 sub 1 Tl sub 5 sub 0 Si sub 1 sub 0 sub 0 Al sub 9 sub 2 O sub 3 sub 8 sub 4 (Pd sub 2 sub 1 Tl sub 5 sub 0 -X, a = 24.914(4) A), have been determined by single-crystal X-ray diffraction methods in the cubic space group Fd3 at 21(1) .deg. C. The crystals were prepared using an exchange solution that had a Pd(NH sub 3) sub 4 Cl sub 2 : TINO sub 3 mole ratio of 50 : 1 and 200 : 1, respectively, with a total concentration of 0.05 M for 4 days. After dehydration at 360 .deg. C and 2 x 10 sup - sup 6 Torr in flowing oxygen for 2 days, the crystals were evacuated at 21(1) .deg. C for 2 hours. They were refined to the final error indices R sub 1 = 0.045 and R sub 2 = 0.038 with 344 reflections for Pd sub 1 sub 8 Tl sub 5 sub 6 -X, and R sub 1 = 0.043 and R sub 2 = 0.045 with ...

  17. Synthesis, characterization, thermal properties and theoretical investigation on Bis(guanidinium) 4,4‧- Azo-1H-1,2,4-triazol-5-one

    Science.gov (United States)

    Cao, Wen-li; Guo, Jia-jia; Chen, Xiang; Ding, Zi-mei; Xu, Kang-zhen; Song, Ji-rong; Fan, An; Huang, Jie

    2017-11-01

    Bis(guanidinium) 4,4‧-Azo-1H-1,2,4-triazol-5-one [G2(ZTO)] was synthesized and characterized by X-ray single crystal diffraction, elemental analyzer and Fourier Transform Infrared (FT-IR) spectrometer. The result from X-ray single crystal diffraction indicates that G2(ZTO) crystallizes in the monoclinic space group P2(1)/c with parameters of a = 4.779(2) Å, b = 9.081(4) Å, c = 14.676(6) Å, α = 90.00°, β = 92.43(7)°, γ = 90.00°, V = 636.4(5) Å3, Z = 2, μ(Mo Kα) = 0.131, F(000) = 328, S = 1.071, Dc = 1.640 g·cm-3, R1 = 0.0510 and wR2 = 0.1389. Interestingly enough, its structure does not contain crystallization water, which is a unique characteristic in this material. Besides, the molecular geometry of the compound was optimized by using Density Functional Theory (DFT) method at B3LYP/6-31G (d, p) level in the ground state, revealing that the obtained geometric parameters are in accordance with the X-ray result of the structure. The experimental vibrational spectrum was compared with the calculated spectrum. Besides, molecular electrostatic potential (MEP) of G2(ZTO) was computed with the same method in gas phase, theoretically. The thermal properties of this compound were investigated by DSC, TG/DTG and micro-DSC methods. The results manifest that its thermal behavior can be divided into two main decomposition stages, the first intense decomposition peak temperature is 248.11 °C at the heating rate of 10 °C·min-1, which is higher than that of RDX (219 °C) but slightly lower than that of G(ZTO)·H2O (252.08 °C). The constant-volume combustion heat (ΔcU) of G2(ZTO), G(ZTO)·H2O and ZTO were determined and then the enthalpy of formation were calculated. The results show that G2(ZTO) possesses the highest standard molar enthalpy of formation, which may be explained by the fact that G2(ZTO) contains no water and possesses the highest nitrogen content in all guanidine salts. Moreover, the apparent activation energy (E), thermal stability and safety

  18. Extraction of plutonium(IV) by diglycolamide extractants in room temperature ionic liquids

    Energy Technology Data Exchange (ETDEWEB)

    Prabhu, Dattaprasad R.; Raut, Dhaval R.; Murali, Mallekav S.; Mohapatra, Prasanta K. [Bhabha Atomic Research Centre, Mumbai (India). Radiochemistry Div.

    2017-06-01

    Extraction of Pu(IV) was investigated using solutions of two diglycolamide extractants viz., N,N,N{sup '},N{sup '}-tetra-n-octyldiglycolamide (TODGA) and its branched homolog, N,N,N{sup '},N{sup '}-tetra(2-ethylhexyl) diglycolamide (T2EHDGA), dissolved in two imidazolium based room temperature ionic liquids viz., 1-butyl-3-methylimidazolium bis(trifluoromethanesulphonyl) imide ([C{sub 4}mim][NTf{sub 2}]) and 1-octyl-3-methylimidazolium bis(trifluoromethanesulphonyl) imide ([C{sub 8}mim][NTf{sub 2}]) from aqueous nitric acid medium. The extraction kinetics was found to be extremely slow which is reported for the first time for analogous extraction systems and took as long as 30 h to attain equilibrium D{sub Pu} values. In general, TODGA based solvents showed better extraction of Pu(IV) than the T2EHDGA based solvents, one order of magnitude higher, and though both the ionic liquids ultimately yielded comparable D{sub Pu} values, attainment of equilibrium was slower with [C{sub 4}mim][NTf{sub 2}]. The extracted species conformed to 1:1 for TODGA in both the ionic liquids while a mixture of 1:1 and 1:2 species was observed for T2EHDGA at 1 M HNO{sub 3} which changed to 1:1 species at 4 M HNO{sub 3}. The extracted species is proposed to be (Pu(L){sub x}{sup 4+}){sub IL} (where, L is the extractant and x=1 or 2) at lower acidities suggesting a cation exchange mechanism which changes over to (Pu(NO{sub 3}){sub 4} .L){sub IL} at 4 M HNO{sub 3} conforming to a solvation mechanism for all the systems except for T2EHDGA-[C{sub 8}mim][NTf{sub 2}]. UV-VIS spectroscopic studies were carried out to throw light on the nature of the extracted species.

  19. Cathepsin X Cleaves Profilin 1 C-Terminal Tyr139 and Influences Clathrin-Mediated Endocytosis.

    Directory of Open Access Journals (Sweden)

    Urša Pečar Fonović

    Full Text Available Cathepsin X, a cysteine carboxypeptidase, is upregulated in several types of cancer. Its molecular target in tumor cells is profilin 1, a known tumor suppressor and regulator of actin cytoskeleton dynamics. Cathepsin X cleaves off the C-terminal Tyr139 of profilin 1, affecting binding of poly-L-proline ligands and, consequently, tumor cell migration and invasion. Profilin 1 with mutations at the C-terminus, transiently expressed in prostate cancer cells PC-3, showed that Tyr139 is important for proper function of profilin 1 as a tumor suppressor. Cleaving off Tyr139 prevents the binding of clathrin, a poly-L-proline ligand involved in endocytosis. More profilin 1-clathrin complexes were present in PC-3 cells when cathepsin X was inhibited by its specific inhibitor AMS36 or silenced by siRNA. As a consequence, the endocytosis of FITC-labeled dextran and transferrin conjugate was significantly increased. These results constitute the first report of the regulation of clathrin-mediated endocytosis in tumor cells through proteolytic processing of profilin 1.

  20. Cathepsin X Cleaves Profilin 1 C-Terminal Tyr139 and Influences Clathrin-Mediated Endocytosis

    Science.gov (United States)

    Pečar Fonović, Urša; Kos, Janko

    2015-01-01

    Cathepsin X, a cysteine carboxypeptidase, is upregulated in several types of cancer. Its molecular target in tumor cells is profilin 1, a known tumor suppressor and regulator of actin cytoskeleton dynamics. Cathepsin X cleaves off the C-terminal Tyr139 of profilin 1, affecting binding of poly-L-proline ligands and, consequently, tumor cell migration and invasion. Profilin 1 with mutations at the C-terminus, transiently expressed in prostate cancer cells PC-3, showed that Tyr139 is important for proper function of profilin 1 as a tumor suppressor. Cleaving off Tyr139 prevents the binding of clathrin, a poly-L-proline ligand involved in endocytosis. More profilin 1—clathrin complexes were present in PC-3 cells when cathepsin X was inhibited by its specific inhibitor AMS36 or silenced by siRNA. As a consequence, the endocytosis of FITC-labeled dextran and transferrin conjugate was significantly increased. These results constitute the first report of the regulation of clathrin-mediated endocytosis in tumor cells through proteolytic processing of profilin 1. PMID:26325675

  1. Preparation of Zn(BH4)2 and diborane and hydrogen release properties of Zn(BH4)2+xMgH2 (x=1, 5, 10, and 15)

    Science.gov (United States)

    Kwak, Young Jun; Kwon, Sung Nam; Song, Myoung Youp

    2015-09-01

    Zn(BH4)2 was prepared by milling ZnCl2 and NaBH4 in a planetary ball mill under Ar atmosphere, and Zn(BH4)2+xMgH2 (x=1, 5, 10, and 15) samples were prepared. Diborane (B2H6) and hydrogen release characteristics of the Zn(BH4)2 and Zn(BH4)2+xMgH2 samples were studied. The samples synthesized by milling ZnCl2 and NaBH4 contained Zn(BH4)2 and NaCl, together with small amounts of ZnCl2 and NaBH4. We designated these samples as Zn(BH4)2(+NaCl). The weight loss up to 400 °C of the Zn(BH4)2(+NaCl) sample synthesized by milling 4 h was 11.2 wt%. FT-IR analysis showed that Zn(BH4)2 was formed in the Zn(BH4)2(+NaCl) samples. MgH2 was also milled in a planetary ball mill, and mixed with the Zn(BH4)2(+NaCl) synthesized by milling for 4 h in a mortar and pestle. The weight loss up to 400 °C of Zn(BH4)2(+NaCl)+MgH2 was 8.2 wt%, corresponding to the weight % of diborane and hydrogen released from the Zn(BH4)2(+NaCl)+MgH2 sample, with respect to the sample weight. DTA results of Zn(BH4)2(+NaCl)+xMgH2 showed that the decomposition peak of Zn(BH4)2 was at about 61 °C, and that of MgH2 was at about 370-389 °C.

  2. Improved cycling and high rate performance of core-shell LiFe1/3Mn1/3Co1/3PO4/carbon nanocomposites for lithium-ion batteries: Effect of the carbon source

    International Nuclear Information System (INIS)

    Li, Huanhuan; Chen, Yi; Chen, Long; Jiang, Haobin; Wang, Yaping; Wang, Hongbo; Li, Guochun; Li, Yunxing; Yuan, Yuan

    2014-01-01

    Highlights: • We report a fast microwave heating way to prepare LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /C. • The effects of different carbon sources were discussed in detail. • LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /BP2000 shows a discharge capacity of 160 mA h g −1 at 0.1 C. • LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /BP2000 elucidates excellent cyclic stability. • LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /BP2000 exhibits attractive rate capability. - Abstract: Core-shell type olivine solid solutions, LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /C, are synthesized via a very simple and rapid microwave heating route with different carbon sources. The obatined LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /C materials are characterized thoroughly by various analytical techniques such as X-ray diffraction, scanning electron microscopy, transmission electron microscopy and energy-dispersive spectroscopy instrument. The particle sizes and distribution of the carbon layer of BP2000 carbon black coated LiFe 1/3 Mn 1/3 Co 1/3 PO 4 (LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /BP) are more uniform than that obtained from acetylene black (LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /AB) and Super P (LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /SP). Moreover, the LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /BP nanocomposite shows superior electrochemical properties such as high discharge capacity of 160 mA h g −1 at 0.1 C, excellent cyclic stability (143 mA h g −1 at 0.1 C after 30 cycles) and rate capability (76 mAh g −1 at 20 C), which are better than other two samples. Cyclic voltammetric and electrical tests disclose that the Li-ion diffusion, the reversibility of lithium extraction/insertion and electrical conductivity are significantly improved in LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /BP composite. Electrochemical impedance spectroscopy illustrates that LiFe 1/3 Mn 1/3 Co 1/3 PO 4 /BP composite electrode possesses low contact and charge-transfer impedances, which can lead to rapid electron transport during the electrochemical lithium insertion/extraction reaction. It is believed that olivine solid

  3. Electronic structure of Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} surface and CdS/Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} interface

    Energy Technology Data Exchange (ETDEWEB)

    Udaka, Yusuke; Takaki, Shin' ichi; Isowaki, Keisuke; Terada, Norio [Graduate School of Science and Engineering, Kagoshima University, 1-21-40 Korimoto, Kagoshima 890-0065 (Japan); Nagai, Takehiko; Kim, Kang Min; Kim, Shinho; Tampo, Hitoshi; Shibata, Hajime; Matsubara, Koji; Niki, Shigeru [Research Center for Photovoltaics, National Institute of Advanced Industrial Science and Technology, 1-1-1 Umezono, Tsukuba 305-8568 (Japan); Sakai, Noriyuki; Kato, Takuya; Sugimoto, Hiroki [Solar Frontier K.K., 123-1 Shimo-Kawairi, Atsugi 243-0206 (Japan)

    2017-06-15

    Changes of the electronic structure of the Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} [CZTSSe] films and the band alignment at the interfaces between CdS buffer and the CZTSSe in conjunction with the anion-mixing ratio x = 0-1 have been investigated using in situ X-ray, ultraviolet photoemission spectroscopy (XPS, UPS), and inverse photoemission spectroscopy (IPES). Changes of the UPS and IPES spectra in conjunction with x have revealed that the electronic structure of the CZTSSe surface is characterized with the preferential rise of conduction band minimum (CBM) in conjunction with the increase of x. As x increases, interface induced band bending decreases from 0.5 to 0.6 at the CdS/CZTSe (x = 0) interface to 0.1-0.2 at the CdS/CZTS (x = 1) one. And the downward shift of CBM due to the deposition of the CdS layer is enhanced as x increases. These changes result in the monotonous decrease of conduction band offset (CBO) in conjunction with the increase of x: CBO at the x = 0 and 1 interfaces are +0.5 and -0.14 to -0.15 eV, respectively. The values of CBO are consistent with the device properties; occasional emergence of double junction like current-voltage characteristics in the CdS/CZTSe-based cells, serious voltage-loss in the CdS/CZTS ones, and the highest performance achieved in the CdS/CZTSSe ones. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Neutron diffraction studies on Ca1-xBaxZr4P6O24 solid solutions

    International Nuclear Information System (INIS)

    Achary, S.N.; Jayakumar, O.D.; Patwe, S.J.; Kulshreshtha, S.K.; Tyagi, A.K.; Shinde, A.B.; Krishna, P.S.R.

    2008-01-01

    Herein we report the results of detailed crystallographic studies of Ca 1-x Ba x Zr 4 P 6 O 24 compositions from combined Rietveld refinements of powder X-ray and neutron diffraction data. All the studied compositions crystallize in rhombohedral lattice (space group R-3 No. 148). A continuous solid solution is concluded from the systematic variation of unit cell parameters. The variation of unit cell parameters with the composition indicates decreasing trend in α parameter with increasing Ba 2+ concentration contrast to an increasing trend in c parameter. (author)

  5. Effect of applied bias voltage on corrosion-resistance for TiC1-xNx and Ti1-xNbxC1-yNy coatings

    International Nuclear Information System (INIS)

    Caicedo, J.C.; Amaya, C.; Yate, L.; Aperador, W.; Zambrano, G.; Gomez, M.E.; Alvarado-Rivera, J.; Munoz-Saldana, J.; Prieto, P.

    2010-01-01

    Corrosion-resistance behavior of titanium carbon nitride (Ti-C-N) and titanium niobium carbon nitride (Ti-Nb-C-N) coatings deposited onto Si(1 0 0) and AISI 4140 steel substrates via r.f. magnetron sputtering process was analyzed. The coatings in contact with a solution of sodium chloride at 3.5% were studied by Tafel polarization curves and impedance spectroscopy methods (EIS). Variations of the bias voltage were carried out for each series of deposition to observe the influence of this parameter upon the electrochemical properties of the coatings. The introduction of Nb in the ternary Ti-C-N film was evaluated via X-ray diffraction (XRD) analysis. The structure was characterized by using Raman spectroscopy to identify ternary and quaternary compounds. Surface corrosion processes were characterized using optical microscopy and scanning electron microscopy (SEM). XRD results show conformation of the quaternary phase, change in the strain of the film, and lattice parameter as the effect of the Nb inclusion. The main Raman bands were assigned to interstitial phases and 'impurities' of the coatings. Changes in Raman intensities were attributed to the incorporation of niobium in the Ti-C-N structure and possibly to resonance enhancement. Finally, the corrosion data obtained for Ti-C-N were compared with the results of corrosion tests of Ti-Nb-C-N coating. The results obtained showed that the incorporation of niobium to Ti-C-N coatings led to an increase in the corrosion-resistance. On another hand, an increase in the bias voltage led to a decrease in the corrosion-resistance for both Ti-C-N and Ti-Nb-C-N coatings.

  6. Progress in AMS measurement of "1"2"9I and "1"4C at CIAE

    International Nuclear Information System (INIS)

    Yang Xuran; Dong, K.J.; Shan, J.; He Ming; Xie, L.B.

    2013-01-01

    Twenty-four years have passed since the AMS was built at China Institute of Atomic Energy (CIAE) in 1989. We have measured "2"3"6U, "1"8"2Hf, "5"9Ni and other elements. Recently, the routine method of measuring the "1"2"9I concentration in air particle samples using AMS have been set up due to it has great advantages to measure long-lived radioisotopes. For the applications, "1"2"9I could be used for monitoring nuclear environment. "1"2"9I was collected in air particle samples after the accident of Fukushima nuclear power plant and measured at the China Institute of Atomic Energy (CIAE) by using AMS, the result show that "1"2"9I derived from FNPP accident had been arrived in Beijing early on March 26th and "1"2"9I concentration had been greatly increased relative to March 20th. On the other hand, a new system to measure "1"4C of AMS will be designed for the application in bio-medical science: urea breath test (UBT). UBT has been carried out widely by using carbon isotope of "1"3C and "1"4C, respectively, in the world. They are two tracers with different measurement methods but applied by the same principle. Optimizing UBT methods with using "1"4C is the priori for the diagnosis of helicobacter pylori in the future. (author)

  7. Nanopowders Y{sub 1−y}Nd{sub y}V{sub 1x}Cr{sub x}O{sub 4} with y=0 and 1; x=0, 0.1, 0.2 and 0.5 synthesized by a sol–gel process. Relationship between morphological characteristics and optical properties

    Energy Technology Data Exchange (ETDEWEB)

    Alcaraz, L. [Departamento de Química Inorgánica I, Facultad de Ciencias Químicas, Universidad Complutense de Madrid, Ciudad Universitaria s/n, 28040 Madrid (Spain); Isasi, J., E-mail: isasi@quim.ucm.es [Departamento de Química Inorgánica I, Facultad de Ciencias Químicas, Universidad Complutense de Madrid, Ciudad Universitaria s/n, 28040 Madrid (Spain); Caballero, A.C. [Departamento de Electrocerámica, Instituto de Cerámica y Vidrio (CSIC), Kelsen, 5, 28049 Madrid (Spain); Izquierdo, J.G.; Bañares, L. [Departamento de Química Física I and Centro de Láseres Ultrarrápidos, Facultad de Ciencias Químicas, Universidad Complutense de Madrid, Ciudad Universitaria s/n, 28040 Madrid (Spain)

    2015-05-15

    Y{sub 1−y}Nd{sub y}V{sub 1x}Cr{sub x}O{sub 4} nanopowders with y=0 and 0.1; x=0, 0.1, 0.2 and 0.5, have been synthetized by a sol–gel process followed by heating in an oxygen flow. This second treatment was done only in the case of samples containing chromium. The samples have been characterized by X-ray diffraction (XRD), Fourier Transform Infrared (FTIR) spectroscopy, scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The structural analysis revealed that when chromium was inserted at vanadium-sites in Y{sub 0.9}Nd{sub 0.1}VO{sub 4}, the host retained the tetragonal symmetry corresponding to a zircon-type structure, attributed to the space group I4{sub 1}/amd. In addition, a loss of crystallinity was observed when chromium substitutes vanadium into the Y{sub 0.9}Nd{sub 0.1}VO{sub 4} host. The morphological studies revealed agglomerates of spherical particles whose size is increased with the Cr content and confirmed the composition of all synthetized samples. FTIR spectra of these samples exhibit a broadening and a slight shift of the bands around 830 cm{sup −1} towards higher values of frequency when the chromium content increases. The effect of vanadium substitution by chromium on the optical properties was also evaluated by UV–vis absorption and photoluminescence (PL) spectroscopies. The broad UV band absorption is due to the presence of Cr{sup 5+}. A decrease of PL emission is found when chromium substitutes vanadium in the YVO{sub 4} host. - Highlights: • Nanophosphors Y{sub 1−y}Nd{sub y}V{sub 1x}Cr{sub x}O{sub 4} with y=0, 0.1 and x=0, 0.1, 0.2 and 0.5 have been synthesized. • Structural analysis reveals structural distortions associated to chromium insertion. • Morphological studies confirm the nanocristalline size and the stoichiometry of synthesized samples. • Chromium insertion causes a decrease of the PL emission intensity.

  8. Determination of barium and strontium in Basub(x)Srsub(1-x)Nbsub(2)Osub(6) monocrystals and raw materials after their solvent ' extraction separation with 1-phenyl-3-methyl-4-benzoylpyrazolone-5

    International Nuclear Information System (INIS)

    Sizonenko, N.T.; Egorova, L.A.

    1981-01-01

    The extraction of milligram amounts of barium and strontium by 1-phenyl-3-methyl-4-benzoylpyrazolone-5 solutions in various diluents has been examined. The possibility has been shown of using the reagent for extraction separation of the elements for determining the stoichiometric composition of barium- and strontium-based compounds. Conditions have been studied for separation of barium and strontium at their different ratios by the chromate method in the presence of EDTA. A procedure has been worked out of determining barium and strontium in the estimation of stoichiometric composition of charge and single crystals of barium-strontium niobates of different composition

  9. Ionic conductivity of Bi{sub 2}Ni{sub x}V{sub 1x}O{sub 5.5−3x/2} (0.1x ≤ 0.2) oxides prepared by a low temperature sol-gel route

    Energy Technology Data Exchange (ETDEWEB)

    Rusli, Rolan; Patah, Aep, E-mail: ismu@chem.itb.ac.id; Prijamboedi, Bambang, E-mail: ismu@chem.itb.ac.id; Ismunandar, E-mail: ismu@chem.itb.ac.id [Inorganic and Physical Chemistry Division, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132 (Indonesia); Abrahams, Isaac [Materials Research Institute, School of Biological and Chemical Sciences, Queen Mary University of London, Mile End Road, London E1 4NS (United Kingdom)

    2014-03-24

    Solid oxides fuel cells (SOFCs) is one technology that could contribute toward future sustainable energy. One of the most important components of an SOFC is the electrolyte, which must have high ionic conductivity. Cation substitution of vanadium in Bi{sub 4}V{sub 2}O{sub 11} yields a family of fast oxide ion conducting solids known collectively as the BIMEVOXes (bismuth metal vanadium oxide), which have the potential to be applied as electrolytes in SOFCs. The purpose of this work is to study the effect of Ni concentration, when used as a dopant, on the ionic conductivity of Bi{sub 2}Ni{sub x}V{sub 1x}O{sub 5.5−3x/2} (BINIVOX) oxides (0.1x ≤ 0.2) when prepared by a sol gel method. The gels were calcined at 600 °C for 24 h to produce pure BINIVOX. These oxides were found to exhibit the γ-phase structure with tetragonal symmetry in space group I4/mmm. Ionic conductivity of BINIVOX at 300 °C were 6.9 × 10{sup −3} S cm{sup −1}, 1.2 × 10{sup −3} S cm{sup −1}, and 8.2 × 10{sup −4} S cm{sup −1}, for x = 0.1; 0.15; and 0.2; respectively; and at 600 °C were 1.1 × 10{sup −1} S cm{sup −1}, 5.3 × 10{sup −2} S cm{sup −1}, and 2.8 ×10{sup −2} S cm{sup −1}, for x = 0.1; 0.15; and 0.2; respectively.

  10. Synthesis and Antibacterial Activities of Novel 2,5-Diphenylindolo[2,3-e] Pyrazolo[1',5':3",4"]pyrimido[2",1"-c] [1,2,4]triazines

    Directory of Open Access Journals (Sweden)

    Mohamed G. Marei

    2011-12-01

    Full Text Available The formation of (E-3-{2-(2,5-diphenylpyrazolo[1,5-c]pyrimidin-7-ylhydrazono}indolin-2-ones 3 has been achieved by condensation of equimolar amounts of 7-hydrazino-2,5-diphenylpyrazolo[1,5-c]pyrimidine (1 and isatin (or isatin derivatives 2 at room temperature. The (E-products could be isomerized into corresponding the (Z-3 isomers. Reactions of the latter fused heterocyclic hydrazones towards different electro-philic reagents yielded the corresponding 3-substituted derivatives 4–7. Dehydrative cyclisation of the hydrazones 3 using phosphorus oxychloride afforded the 2,5-diphenyl- indolo[2,3-e]pyrazolo[1',5':3",4"]pyrimido[2",1"-c][1,2,4] triazines 13. The polyfused heterocyclic ring system 13 underwent electrophilic substitution reactions at position 4 rather than at position 3. The 3-bromo isomer of 17 was prepared by a sequence of reactions starting from 2,5-diphenylpyrazolo[1,5-c]pyrimidine-7(6H-thione (11. The orientation of the electrophilic attack was supported by spectroscopic and chemical evidence. Some of the synthesized compounds were found to possess slight to moderate activity against the microorganisms Bacillus subtilis, Micrococcus luteus, Staphylococcus aureus, Escherichia coli and Pseudomonas aeruginosa.

  11. WAS COMET C/1945 X1 (DU TOIT) A DWARF, SOHO-LIKE KREUTZ SUNGRAZER?

    Energy Technology Data Exchange (ETDEWEB)

    Sekanina, Zdenek [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Kracht, Rainer, E-mail: Zdenek.Sekanina@jpl.nasa.gov, E-mail: R.Kracht@t-online.de [Ostlandring 53, D-25335 Elmshorn, Schleswig-Holstein (Germany)

    2015-12-10

    The goal of this investigation is to reinterpret and upgrade the astrometric and other data on comet C/1945 X1, the least prominent among the Kreutz system sungrazers discovered from the ground in the twentieth century. The central issue is to appraise the pros and cons of a possibility that this object is—despite its brightness reported at discovery—a dwarf Kreutz sungrazer. We confirm Marsden’s conclusion that C/1945 X1 has a common parent with C/1882 R1 and C/1965 S1, in line with the Sekanina and Chodas scenario of their origin in the framework of the Kreutz system’s evolution. We integrate the orbit of C/1882 R1 back to the early twelfth century and then forward to around 1945 to determine the nominal direction of the line of apsides and perform a Fourier analysis to get insight into effects of the indirect planetary perturbations. To better understand the nature of C/1945 X1, its orbital motion, fate, and role in the hierarchy of the Kreutz system, as well as to attempt detecting the comet’s possible terminal outburst shortly after perihelion and answer the question in the title of this investigation, we closely examined the relevant Boyden Observatory logbooks and identified both the photographs with the comet’s known images and nearly 20 additional patrol plates, taken both before and after perihelion, on which the comet or traces of its debris will be searched for, once the process of their digitization, currently conducted as part of the Harvard College Observatory’s DASCH Project, has been completed and the scanned copies made available to the scientific community.

  12. Spatial structure determination of (√3 x √3)R30 degrees and (1.5 x 1.5)R18 degrees CO on Cu(111) using angle-resolved photoemission extended fine structure

    International Nuclear Information System (INIS)

    Moler, E.J.; Kellar, S.A.; Huff, W.R.A.

    1997-01-01

    The authors report a study of the spatial structure of (√3 x √3)R30 degrees (low coverage) and (1.5 x 1.5)R18 degrees (intermediate coverage) CO adsorbed on Cu(111), using the Angle-Resolved Photoemission Extended Fine Structure (ARPEFS) technique at beamline 9.3.2 at the Advanced Light Source. The CO molecule adsorbs on an atop site for both adsorption phases. Full multiple-scattering spherical-wave (MSSW) calculations were used to extract the C-Cu. bond length and the first Cu-Cu layer spacing for each adsorption phase. The authors find that the C-Cu bond length remains unchanged with increasing coverage, but the 1st Cu-Cu layer spacing contracts at the intermediate coverage. They calculate the bending mode force constant in the (1.5 x 1.5)R18 degrees phase to be K δ = 2.2 (1) x 10 -12 dyne-cm/rad from their experimentally determined bond lengths combined with previously published infra-red absorption frequencies

  13. r-1,t-2,3,c-4-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene in humanurine: A potential biomarker for assessing polycyclic aromatic hydrocarbon metabolic activation

    Energy Technology Data Exchange (ETDEWEB)

    Hecht, S.S.; Chen, M.L.; Yagi, H.; Jerina, D.M.; Carmella, S.G. [University of Minnesota, Minneapolis, MN (United States)

    2003-12-01

    Carcinogen metabolite phenotyping is proposed as a more reliable way to determinethe role of host metabolism in PAH-related cancer. Phenanthrene,is the simplest PAH with a bay region and is metabolized to diol epoxides by the same enzymes and with the same stereochemistry as the prototypic carcinogenic PAH, benzo(a)pyrene. The major end product of this metabolic activation pathway is r-1,t-2,3,c-4-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene (trans, anti-PheT). We have developed a method for the analysis of trans, anti-PheT in human urine. r-1,t-2,4,c-3,-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene (trans,syn-PheT) was used as internal standard. After hydrolysis by beta-glucuronidase and sulfatase, solid phase extraction, and high-performance liquid chromatography collection, the sample was silylated and analyzed by gas chromatography-negative ion chemical ionization-mass spectrometry-selected ion monitoring. Thechromatograms were clean and trans, anti-PheT was detected in all human urine samples. Levels of trans, anti-PheT were 791 {+-} 363 pmol/mg creatinine (n = 20) in psoriasis patients treated with a PAH-containing ointment, 25.7 {+-} 16.8 pmol/mg creatinine (n = 32) in coke oven workers exposed to PAH, 4.58 {+-} 2.95 pmol/mg creatinine (n = 31) in smokers, and 1.51 {+-} 1.15 pmol/mg creatinine (n = 30) in nonsmokers. Levels of trans, anti-PheT correlated with levels of 1-hydroxypyrene in the urine of coke oven workers, smokers, and nonsmokers. Trans, anti-PheT appears to be an excellent biomarker of PAH uptake. Levels of trans, anti-PheT were 8,000-19,000 times higher than those can be detected in human urine.

  14. Nanopowders Y1−yNdyV1xCrxO4 with y=0 and 1; x=0, 0.1, 0.2 and 0.5 synthesized by a sol–gel process. Relationship between morphological characteristics and optical properties

    International Nuclear Information System (INIS)

    Alcaraz, L.; Isasi, J.; Caballero, A.C.; Izquierdo, J.G.; Bañares, L.

    2015-01-01

    Y 1−y Nd y V 1x Cr x O 4 nanopowders with y=0 and 0.1; x=0, 0.1, 0.2 and 0.5, have been synthetized by a sol–gel process followed by heating in an oxygen flow. This second treatment was done only in the case of samples containing chromium. The samples have been characterized by X-ray diffraction (XRD), Fourier Transform Infrared (FTIR) spectroscopy, scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The structural analysis revealed that when chromium was inserted at vanadium-sites in Y 0.9 Nd 0.1 VO 4 , the host retained the tetragonal symmetry corresponding to a zircon-type structure, attributed to the space group I4 1 /amd. In addition, a loss of crystallinity was observed when chromium substitutes vanadium into the Y 0.9 Nd 0.1 VO 4 host. The morphological studies revealed agglomerates of spherical particles whose size is increased with the Cr content and confirmed the composition of all synthetized samples. FTIR spectra of these samples exhibit a broadening and a slight shift of the bands around 830 cm −1 towards higher values of frequency when the chromium content increases. The effect of vanadium substitution by chromium on the optical properties was also evaluated by UV–vis absorption and photoluminescence (PL) spectroscopies. The broad UV band absorption is due to the presence of Cr 5+ . A decrease of PL emission is found when chromium substitutes vanadium in the YVO 4 host. - Highlights: • Nanophosphors Y 1−y Nd y V 1x Cr x O 4 with y=0, 0.1 and x=0, 0.1, 0.2 and 0.5 have been synthesized. • Structural analysis reveals structural distortions associated to chromium insertion. • Morphological studies confirm the nanocristalline size and the stoichiometry of synthesized samples. • Chromium insertion causes a decrease of the PL emission intensity

  15. Thermogravimetric and magneticproperties of Ni1-X Zn xFe2O4 nanoparticles synthesized by coprecipitation

    Directory of Open Access Journals (Sweden)

    Kandasamy Velmurugan

    2009-01-01

    Full Text Available Ni1-xZn xFe2O4 (x = 0 to 1 nanoparticles of size less than 9 nm were prepared by a chemical coprecipitation method which could be used for ferrofluid preparation. XRD, VSM and DTA-TG (STA were used to study the effect of variation in Zn substitution and its influence on particle size, magnetic properties such as M S, H C and Curie temperature, as well as on the water content. ICP was used to estimate Ni, Zn and Fe concentrations. The average crystallite size (DaveXR of the particles was found to decrease from 8.95 to 6.92 nm with increasing zinc substitution. The lattice constant (a o increased with increasing zinc substitution. The specific saturation magnetization (M S of the particles was measured at room temperature. Magnetic parameters such as M S, Hc, and Mr were found to decrease with increasing zinc substitution. Estimation of the water content, which varies the Zn concentration, plays a vital role for the correct determination of cation contents. The Curie temperature was found to decrease with increasing zinc substitution.

  16. Analysis of SAW properties in ZnO/AlxGa1-xN/c-Al2O3 structures.

    Science.gov (United States)

    Chen, Ying; Emanetoglu, Nuri William; Saraf, Gaurav; Wu, Pan; Lu, Yicheng; Parekh, Aniruddh; Merai, Vinod; Udovich, Eric; Lu, Dong; Lee, Dong S; Armour, Eric A; Pophristic, Milan

    2005-07-01

    Piezoelectric thin films on high acoustic velocity nonpiezoelectric substrates, such as ZnO, AlN, or GaN deposited on diamond or sapphire substrates, are attractive for high frequency and low-loss surface acoustic wave devices. In this work, ZnO films are deposited on AlxGa1-xN/c-Al2O3 (0 structure provides several advantages, including higher order wave modes with higher velocity and larger electromechanical coupling coefficient (K2). The surface acoustic wave (SAW) velocities and coupling coefficients of the ZnO/AlxGa1-xN/c-Al2O3 structure are tailored as a function of the Al mole percentage in AlxGa1-xN films, and as a function of the ZnO (h1) to AlxGa1-xN (h2) thickness ratio. It is found that a wide thickness-frequency product (hf) region in which coupling is close to its maximum value, K(2)max, can be obtained. The K(2)max of the second order wave mode (h1 = h2) is estimated to be 4.3% for ZnO/GaN/c-Al2O3, and 3.8% for ZnO/AlN/c-Al2O3. The bandwidth of second and third order wave modes, in which the coupling coefficient is within +/- 0.3% of K(2)max, is calculated to be 820 hf for ZnO/GaN/c-Al2O3, and 3620 hf for ZnO/AlN/c-Al2O3. Thus, the hf region in which the coupling coefficient is close to the maximum value broadens with increasing Al content, while K(2)max decreases slightly. When the thickness ratio of AlN to ZnO increases, the K(2)max and hf bandwidth of the second and third higher wave modes increases. The SAW test devices are fabricated and tested. The theoretical and experimental results of velocity dispersion in the ZnO/AlxGa1-xN/c-Al2O3 structures are found to be well matched.

  17. Study of the adsorption, electronic structure and bonding of C2H4 on the FeNi(1 1 1) surface

    International Nuclear Information System (INIS)

    Simonetti, S.; Brizuela, G.; Juan, A.

    2010-01-01

    The adsorption of C 2 H 4 on the FeNi(1 1 1) alloy surface has been studied by ASED-MO tight binding calculations. The C 2 H 4 molecule presents its most stable geometry with the C=C bond axis parallel to the surface along the [1, -1, 0] direction, bonded on top Fe atom and bonded along a Fe-Fe bridge site. As a consequence, the strength of the local Fe-Fe bond decreases between 37 and 62% of its original bulk value. This bond weakening is mainly due to the new C-Fe interactions however no Fe 3 C carbide formation is evidenced on surface. The Fe-Ni and Ni-Ni superficial bonds are only slightly modified.

  18. a-Si{sub x}C{sub 1x}:H thin films with subnanometer surface roughness for biological applications

    Energy Technology Data Exchange (ETDEWEB)

    Herrera-Celis, José, E-mail: jlhc@inaoep.mx; Reyes-Betanzo, Claudia, E-mail: creyes@inaoep.mx; Itzmoyotl-Toxqui, Adrián, E-mail: aitzmo@inaoep.mx [Instituto Nacional de Astrofísica, Óptica y Electrónica, Luis Enrique Erro #1, Santa María Tonantzintla, San Andrés Cholula 72840, Puebla (Mexico); Orduña-Díaz, Abdu, E-mail: abdueve@hotmail.com; Pérez-Coyotl, Ana, E-mail: anapcoyotl@hotmail.com [Centro de Investigación en Biotecnología Aplicada del IPN, Ex-Hacienda San Juan Molino Carretera Estatal Tecuexcomac-Tepetitla Km 1.5, Tepetitla 90700, Tlaxcala (Mexico)

    2015-09-15

    The characterization of a-Si{sub x}C{sub 1x}:H thin films by plasma-enhanced chemical vapor deposition with high hydrogen dilution for biological applications is addressed. A root mean square roughness less than 1 nm was measured via atomic force microscopy for an area of 25 μm{sup 2}. Structural analysis was done using Fourier transform infrared spectroscopy in the middle infrared region. It was found that under the deposition conditions, the formation of Si–C bonds is promoted. Electrical dark conductivity measurements were performed to evaluate the effect of high hydrogen dilution and to find the relation between carrier transport properties and the structural arrangement. Conductivities of the order of 10{sup −7} to 10{sup −9} S/cm at room temperature for methane–silane gas flow ratio from 0.35 to 0.85 were achieved, respectively. UV-visible spectra were used to obtain the optical band gap and the Tauc parameter. Optical band gap as wide as 3.55 eV was achieved in the regime of high carbon incorporation. Accordingly, deposition under low power density and high hydrogen dilution reduces the roughness, improves the structure of the network, and stabilizes the film properties as a greater percentage of carbon is incorporated. The biofunctionalization of a-Si{sub x}C{sub 1x}:H surfaces with NH{sub 2}-terminated self-assembled monolayers was obtained through silanization with 3-aminopropyltrimethoxysilane. This knowledge opens a window for the inclusion of these a-Si{sub x}C{sub 1x}:H thin films in devices such as biosensors.

  19. Computational alloy design of (Co1-xNix)88Zr7B4Cu1 nanocomposite soft magnets

    Science.gov (United States)

    Dong, B.; Healy, J.; Lan, S.; Daniil, M.; Willard, M. A.

    2018-05-01

    The dependence of coercivity on composition is an important factor for establishing optimized soft magnetic properties. In this study, we have used the random anisotropy and coherent rotation models to estimate the variation of coercivity with composition in (Co1-xNix)88Zr7B4Cu1 nanocomposite alloys. Our calculations that the magnetoelastic anisotropy contribution to coercivity dominates for Ni rich compositions (x > 0.5). A small range of compositions (0.65 < x < 0.75) is predicted to result in low values of coercivity (<10 A/m). To validate this prediction, (Co1-xNix)88Zr7B4Cu1 nanocomposites in this range were prepared by melt spinning followed by 3600 s isothermal annealing at the primary crystallization peak temperature (˜673 K). Hysteresis loops were measured using vibrating sample magnetometry at room temperature and saturation magnetostriction was measured using a strain gage based magnetostrictometer. Moderately small coercivities (30-40 A/m) and magnetostrictions (3-4 ppm) were measured at for samples with 0.685 < x < 0.725. Our measured coercivity had a minimum value of 32 A/m at x = 0.725, a shift in composition of about 5 at% in the direction of higher Ni content and without the anticipated low value of coercivity. Several reasons for the inaccuracy of this approach are described, including: ignored contributions from amorphous phase (especially in magnetoealstic anisotropy), composition segregation during crystallization leading to unpredictable compositional shifts in prediction, and the general observation that the predictability of minimum coercivity from minimal combined anisotropies has unexplained deviation even in far less complicated materials.

  20. Structural, Dielectric, and Electrical Properties of Bi1- x Pb x Fe1- x (Zr0.5Ti0.5) x O3

    Science.gov (United States)

    Panda, Niranjan; Pattanayak, Samita; Choudhary, R. N. P.

    2015-12-01

    Polycrystalline samples of Bi1- x Pb x Fe1- x (Zr0.5Ti0.5) x O3 (BPFZTO) with x = 0.0, 0.2, 0.3, and 0.4 were prepared by high-temperature solid-state reaction. Preliminary structural analysis of calcined powders of the materials by use of x-ray powder diffraction confirmed formation of single-phase systems with the tetragonal structure. Room-temperature scanning electron micrographs of the samples revealed uniform distribution of grains of low porosity and different dimensions on the surface of the samples. The frequency-temperature dependence of dielectric and electric properties was studied by use of dielectric and complex impedance spectroscopy over a wide range of frequency (1 kHz to 1 MHz) at different temperatures (25-500°C). The dielectric constant of BiFeO3 (BFO) was enhanced by substitution with Pb(Zr0.5Ti0.5)O3 (PZT) whereas the dielectric loss of the BPFZTO compounds decreased with increasing PZT content. A significant contribution of both grains and grain boundaries to the electrical response of the materials was observed. The frequency-dependence of the ac conductivity of BPFZTO followed Jonscher's power law. Negative temperature coefficient of resistance behavior was observed for all the BPFZTO samples. Conductivity by thermally excited charge carriers and oxygen vacancies in the materials was believed to be of the Arrhenius-type.

  1. Quantum Griffiths phase in CePd1-xRhx with x ∼ 0.8

    International Nuclear Information System (INIS)

    Brando, M; Westerkamp, T; Deppe, M; Geibel, C; Steglich, F; Gegenwart, P

    2010-01-01

    The magnetic field dependence of the magnetisation (M) and the temperature dependence of the ac susceptibility (χ' = dM/dH) of CePd 1-x Rh x single crystals with 0.80 ≤ x ≤ 0.86 are analysed within the frame of the quantum Griffiths phase scenario, which predicts M ∝ H λ and χ' ∝ T λ-1 with 0 ≤ λ ≤ 1. All M vs H and χ' vs T data follow the predicted power-law behaviour. The parameter λ, extracted from χ'(T), is very sensitive to the Rh content x and varies systematically with x from -0.1 to 0.4. The value of λ, derived from M(H) measurements on a CePdo 0.2 Rho 0.8 single crystal, seems to be rather constant, λ ∼ 0.2, in a broad range of temperatures between 0.05 and 2 K and fields up to about 10 T. All observed signatures and the λ values are thus compatible with the quantum Griffiths scenario.

  2. Synthesis of 1-benzyl-4-[(5,6-dimethoxy[2-14C]-1-indanon)-2-YL]-methylpiperidine hydrochloride (E2020-14C)

    International Nuclear Information System (INIS)

    Iimura, Youichi; Mishima, Mannen; Sugimoto, Hachiro

    1989-01-01

    1-Benzyl-4-[(5,6-dimethoxy[2- 14 C]-1-indanon)-2-yl]-methylpiperidine hydrochloride (E2020- 14 C), and acetylcholinesterase inhibitor for studying the pharmacokinetic profiles of E2020, was synthesized from 5,6-dimethoxy[2- 14 C]-1-indanone as the labelled starting material. (author)

  3. Selective isolation of gonyautoxins 1,4 from the dinoflagellate Alexandrium minutum based on molecularly imprinted solid-phase extraction.

    Science.gov (United States)

    Lian, Ziru; Wang, Jiangtao

    2017-09-15

    Gonyautoxins 1,4 (GTX1,4) from Alexandrium minutum samples were isolated selectively and recognized specifically by an innovative and effective extraction procedure based on molecular imprinting technology. Novel molecularly imprinted polymer microspheres (MIPMs) were prepared by double-templated imprinting strategy using caffeine and pentoxifylline as dummy templates. The synthesized polymers displayed good affinity to GTX1,4 and were applied as sorbents. Further, an off-line molecularly imprinted solid-phase extraction (MISPE) protocol was optimized and an effective approach based on the MISPE coupled with HPLC-FLD was developed for selective isolation of GTX1,4 from the cultured A. minutum samples. The separation method showed good extraction efficiency (73.2-81.5%) for GTX1,4 and efficient removal of interferences matrices was also achieved after the MISPE process for the microalgal samples. The outcome demonstrated the superiority and great potential of the MISPE procedure for direct separation of GTX1,4 from marine microalgal extracts. Copyright © 2017. Published by Elsevier Ltd.

  4. Valence band photoemission from in-situ grown GaAs(100)-c(4 x 4)

    Czech Academy of Sciences Publication Activity Database

    Jiříček, Petr; Cukr, Miroslav; Bartoš, Igor; Adell, M.; Strasser, T.; Schattke, W.

    2006-01-01

    Roč. 56, č. 1 (2006), s. 21-26 ISSN 0011-4626. [Symposium on Surface Physics /10./. Praha, 11.07.2005-15.07.2005] R&D Projects: GA ČR(CZ) GA202/04/0994 Institutional research plan: CEZ:AV0Z10100521 Keywords : GaAs(100)-c(4X4) * surface states * band structure * structure plot Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.568, year: 2006

  5. Variation of sigma-hole magnitude with M valence electron population in MX(n)Y(4-n) molecules (n = 1-4; M = C, Si, Ge; X, Y = F, Cl, Br).

    Science.gov (United States)

    McDowell, Sean A C; Joseph, Jerelle A

    2014-01-14

    Sigma holes are described as electron-deficient regions on atoms, particularly along the extension of covalent bonds, due to non-uniform electron density distribution on the surface of these atoms. A computational study of MX(n)Y(4-n) molecules (n = 1-4; M = C, Si, Ge; X, Y = F, Cl, Br) was undertaken and it is shown that the relative sigma hole potentials on M due to X-M and Y-M can be adequately explained in terms of the variation in the valence electron population of the central M atom. A model is proposed for the depletion of the M valence electron population which explains the trends in sigma hole strengths, especially those that cannot be accounted for solely on the basis of relative electronegativities.

  6. Synthesis and characterization of nano-Li1.95FeSiO4/C composite as cathode material for lithium-ion batteries

    International Nuclear Information System (INIS)

    Huang Xiaobing; Chen Honghui; Zhou Shibiao; Chen Yuandao; Yang Jifeng; Ren Yurong; Wang Haiyan; Qu Meizhen; Pan Zhonglai; Yu Zuolong

    2012-01-01

    Li 1.95 FeSiO 4 /C and Li 2 FeSiO 4 /C composites were synthesized by a traditional solid-state reaction method and then discussed comparatively through the results of X-ray diffraction (XRD), scanning electron microscopy (SEM), the Brunauer–Emmet–Teller (BET) method, the charge–discharge test and electrochemical impedance spectra measurement, respectively. The results demonstrated that the Li 1.95 FeSiO 4 /C composite could exhibit much better battery performance in terms of the discharge capacity, cycling stability and rate capability in comparison with the Li 2 FeSiO 4 /C composite. At 0.2C and 5C, it delivered a discharge capacity of 142 mAh g −1 and 93 mAh g −1 , respectively, and after 100 cycles at 1C, 95.1% of its initial capacity was retained.

  7. LaNi1-xCoxO3-δ (x=0.4 to 0.7) cathodes for solid oxide fuel cells by infiltration

    Science.gov (United States)

    Chrzan, Aleksander; Ovtar, Simona; Chen, Ming

    2016-01-01

    Performance of LaNi1-xCoxO3-δ (LNC) (x=0.4 to 0.7) as a cathode in solid oxide fuel cell (SOFC) is evaluated. Symmetrical cathode/electrolyte/cathode cells for electrochemical testing are prepared by infiltration of yttria stabilized zirconia (YSZ) backbone with LNC solutions. It is showed that the cathode infiltrated with LaNi0.5Co0.5O3-δ (LNC155) has the lowest polarization resistance and activation energy, 197 mΩ cm2 at 600 °C and 0.91 eV, respectively. Therefore it is the most promising material of the LNC group for electrochemical applications. X-ray diffraction analysis revealed that none of the materials is single-phased after heat treatment at 800 °C as they contain residues of La2O3 and La2NiO4

  8. Phase relations, crystal structure, and phase transformation of In_1_−_xNb_1_−_xTi_2_xO_4 (0 ≤ x < 0.45) in In_2O_3–Nb_2O_5–TiO_2 system

    International Nuclear Information System (INIS)

    Su, Liumei; Fan, Xing; Cai, Gemei; Liu, Huashan; Jin, Zhanpeng

    2015-01-01

    Phase relations, crystal structures, and phase transformation of In_1_−_xNb_1_−_xTi_2_xO_4 (0 ≤ x < 0.45) in In_2O_3–Nb_2O_5–TiO_2 ternary system were investigated for the first time. A number of samples with different compositions were prepared by a solid-state reaction method, and phase assembles were analyzed by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), and electron probe micro-analysis (EPMA). Five three-phase regions, ten two-phase regions, and six single-phase solid solutions were determined in this system. The solid solution of In_1_−_xNb_1_−_xTi_2_xO_4 (0 ≤ x < 0.45) is composed of both ordered monoclinic wolframite-type structure (0 ≤ x < 0.35) and disordered orthorhombic α-PbO_2 type structure (0.35 < x < 0.45). Driving force for composition-driven phase transformation in In_1_−_xNb_1_−_xTi_2_xO_4 (0 ≤ x < 0.45) stems from the ordering of cations. The ever reported compound InNbTiO_6 with an orthorhombic α-PbO_2 type structure was amended to be a monoclinic wolframite-type structure. Present investigations will be useful for the whole ceramic community working with In_2O_3–Nb_2O_5–TiO_2 ternary system as well as for the development of functional materials. - Highlights: • Phase relations of In_2O_3–Nb_2O_5–TiO_2 ternary system were constructed. • Crystal structures of a novel solid solution In_1_−_xNb_1_−_xTi_2_xO_4 were determined. • Crystal structure of InNbTiO_6 was amended to be a wolframite-type structure. • Composition-driven phase transformation of In_1_−_xNb_1_−_xTi_2_xO_4 was investigated.

  9. Magnetic properties of ZrNi{sub 5-x}In{sub x} (0{<=}x{<=}1) ternary system

    Energy Technology Data Exchange (ETDEWEB)

    Drulis, H. E-mail: drulis@int.pan.wroc.pl; Iwasieczko, W.; Zaremba, V

    2003-01-01

    Magnetisation was measured for the series of ZrNi{sub 5-x}In{sub x} (x=0, 0.25. 0.50, 0.75 and 1.0) alloys over the temperature range 1.75-700 K in applied field up to 50 kOe. All materials studied crystallise in the AuGe{sub 5}-type crystal structure. Alloys with x=0, 0.25 and 0.5 were found to be ferromagnets with relatively high transition temperatures, T{sub c}, dependent on the indium concentration (from T{sub c}=368 K for x=0.5 up to 647 K for x=0). The measured saturation magnetic moments are fully connected with nickel atom; the Zr and In moments are negligible. An environment-dependent model for the formation of Ni moments is suggested. The critical concentration of Ni for the onset of long-range ferromagnetic order in ZrNi{sub 5-x}In{sub x} is estimated as 4.5 atoms/f.u. (75 at%), approximately. The long-range magnetic order is determined by the number of the nearest neighbours of Ni atoms occupying 16(e) positions. Alloys with x=0.75 and 1.0 exhibit Pauli paramagnetism.

  10. Synthesis of the hexaamine ligand 1,4,7-tris(3-aminopropyl)-1,4,7-triazacyclononane: Reactivity and x-ray crystal structures of the nickel(II) and cobalt(III) complexes

    International Nuclear Information System (INIS)

    Bushnell, G.W.; Fortier, D.G.; McAuley, A.

    1988-01-01

    The synthesis of the ligand 1,4,7-tris(3-aminopropyl)-1,4,7-triazacyclononane(tapacn) can be achieved by the reaction of 1,4,7-triazacyclononane with an excess of acetonitrile, followed by reduction of the nitrile with sodium metal in toluene. Halide salts of the cobalt(III)(complex A) and nickel(II)(complex B) ions have been prepared and examined by using x-ray crystallography. The crystal structures are reported. The 13 C NMR spectrum of the dismagnetic d 6 Co(III) complex ion is reported. A discussion of the two ligand structures deals with the ligand opening and with trigonal twist angle as related to metal ion size and mechanism for redox processes of the complex. 45 refs., 6 figs., 9 tabs

  11. Transistor properties of exfoliated single crystals of 2 H -Mo (Se1-xT ex ) 2(0 ≤x1 )

    Science.gov (United States)

    Uesugi, Eri; Miao, Xiao; Ota, Hiromi; Goto, Hidenori; Kubozono, Yoshihiro

    2017-06-01

    Field-effect transistors (FETs) were fabricated using exfoliated single crystals of Mo (Se1-xT ex) 2 with an x range of 0 to 1, and the transistor properties fully investigated at 295 K in four-terminal measurement mode. The chemical composition and crystal structure of exfoliated single crystals were identified by energy-dispersive x-ray spectroscopy (EDX), single-crystal x-ray diffraction, and Raman scattering, suggesting the 2 H - structure in all Mo (Se1-xT ex) 2 . The lattice constants of a and c increase monotonically with increasing x , indicating the substitution of Se by Te. When x 0.4 . In contrast, the polarity of a thick single-crystal Mo (Se1-xT ex) 2 FET did not change despite an increase in x . The change of polarity in a thin single-crystal FET was well explained by the variation of electronic structure. The absence of such change in the thick single-crystal FET can be reasonably interpreted based on the large bulk conduction due to naturally accumulated electrons. The μ value in the thin single-crystal FET showed a parabolic variation, with a minimum μ at around x =0.4 , which probably originates from the disorder of the single crystal caused by the partial replacement of Se by Te, i.e., a disorder that may be due to ionic size difference of Se and Te.

  12. X-ray absorption edges and E.X.A.F.S.: application to the study of electronic and atomic structures of titanium and vanadium carbides TiC(1-x) and VC(1-x)

    International Nuclear Information System (INIS)

    Moisy-Maurice, Virginie.

    1980-09-01

    This text presents a systematic study of the X-ray absorption fine structures evolution, at the K edge of titanium, with vacancy concentration in TiC(1-x). The absorption edges are situated in the 50 eV following the coefficient discontinuity: from the evaluation of their general aspect, it is deduced that the positive charge of titanium atoms decreases when vacancy concentration increases in TiC(1-x). This allowed us to determine the best band structure calculation model. The interpretation of EXAFS spectra (modulation of the absorption coefficient until 1500 eV above the edge) gives indications about the local atomic structure. Here, the contraction of the average titanium-carbon interatomic distances compared to the distances between crystallographic sites is of the order of the experimental resolution 0.02 A for Ti C(0.8). The study of the damping of the spectra in terms of Debye-Waller factors gave an evaluation of the relative static atomic mean square displacements between first neighbours. Last, it has been established that the disordering of vacancies in the order-disorder transition of V 8 C 7 is an atomic scale phenomenon [fr

  13. Synthesis and Electronic Structure of Dissymmetrical, Naphthalene-Bridged Sandwich Complexes [Cp ' Fe(mu-C10H8)MCp*](x) (x=0,+1; M = Fe, Ru; Cp ' = eta(5)-C5H2-1,2,4-tBu(3); Cp* = eta(5)-C5Me5)

    NARCIS (Netherlands)

    Malberg, J.; Lupton, E.; Schnöckelborg, E.M.; de Bruin, B.; de Sutter, J.; Meyer, K.; Hartl, F.; Wolf, R.

    2013-01-01

    The dissymmetrical naphthalene-bridged complexes [Cp'Fe(mu-C10H8)FeCp*] (3; Cp* = eta(5)-C5Me5, Cp' = eta(5)-C5H2-1,2,4-tBu(3)) and [Cp'Fe(mu-C10H8)RuCp*] (4) were synthesized via a one-pot procedure from FeCl2(thf)(1.5), Cp'K, KC10H8, and [Cp*FeCl(tmeda)] (tmeda =

  14. AFSC/FMA/ATLAS Remote Client

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data is collected by observers on deck sheets and either entered onto local databases and transmitted electronically or faxed to the AFSC for data entry. The FMA...

  15. Tunable thermodynamic activity of La x Sr1-x Mn y Al1-y O3-δ (0 ≤ x1, 0 ≤ y ≤ 1) perovskites for solar thermochemical fuel synthesis.

    Science.gov (United States)

    Ezbiri, M; Takacs, M; Theiler, D; Michalsky, R; Steinfeld, A

    2017-02-28

    Nonstoichiometric metal oxides with variable valence are attractive redox materials for thermochemical and electrochemical fuel processing. To guide the design of advanced redox materials for solar-driven splitting of CO 2 and/or H 2 O to produce CO and/or H 2 (syngas), we investigate the equilibrium thermodynamics of the La x Sr 1- x Mn y Al 1- y O 3- δ perovskite family (0 ≤ x1, 0 ≤ y ≤ 1) and La 0.6 Ca 0.4 Mn 0.8 Al 0.2 O 3- δ , and compare them to those of CeO 2 as the baseline. Oxygen nonstoichiometry measurements from 1573 to 1773 K and from 0.206 to 180 mbar O 2 show a tunable reduction extent, increasing with increasing Sr content. Maximal nonstoichiometry of 0.32 is established with La 0.2 Sr 0.8 Mn 0.8 Al 0.2 O 3- δ at 1773 K and 2.37 mbar O 2 . As a trend, we find that oxygen capacities are most sensitive to the A-cation composition. Partial molar enthalpy, entropy and Gibbs free energy changes for oxide reduction are extracted from the experimental data using defect models for Mn 4+ /Mn 3+ and Mn 3+ /Mn 2+ redox couples. We find that perovskites exhibit typically decreasing enthalpy changes with increasing nonstoichiometries. This desirable characteristic is most pronounced by La 0.6 Sr 0.4 Mn 0.4 Al 0.6 O 3- δ , rendering it attractive for CO 2 and H 2 O splitting. Generally, perovskites show lower enthalpy and entropy changes than ceria, resulting in more favorable reduction but less favorable oxidation equilibria. The energy penalties due to larger temperature swings and excess oxidants are discussed in particular. Using electronic structure theory, we conclude with a practical methodology estimating thermodynamic activity to rationally design perovskites with variable stoichiometry and valence.

  16. Synthesis and electrochemical properties of KPb_4_−_xCa_x(PO_4)_3 (0 ≤ x1.5) for oxidation of cadmium at graphite electrode

    International Nuclear Information System (INIS)

    Lahrich, Sara; Manoun, Bouchaib; El Mhammedi, Moulay Abderrahim

    2017-01-01

    Chemically modified carbon paste electrode (CPE) for cadmium (II) analysis has been constructed by mixing KPb_4_−_xCa_x(PO_4)_3 (0 ≤ x1.5) (CaLA) and graphite powder. The lacunar apatite was synthesized using solid reaction and characterized by X-ray diffraction (XRD), infrared spectroscopy (IR) and Raman spectroscopy. The refinement study was carried out using Rietveld method where the obtained results show a good agreement between the observed and calculated patterns. The detection of cadmium (II) was investigated in acetate buffer (pH 4.5) using differential pulse anodic stripping voltammetry (DPASV). The limit of detection obtained under the optimized experimental conditions was 5.35 × 10"−"7 mol L"−"1 with a relative standard deviation of 2.37%. Possible interferences were tested and evaluated in 5.0 × 10"−"5 mol L"−"1 cadmium (II) in the presence of other inorganic ions. Finally, the proposed method was successfully applied to determine cadmium (II) in seawater and mussel samples. Hence, the satisfactory results confirm the applicability of this sensor in practical analysis. - Highlights: • Synthesis and characterization of new lacunar apatites KPb_4_−_xCa_x(PO_4)_3 (0 ≤ x1.5). • Structural refinement of these compounds using Rietveld method. • A study of Ca doping effect in lacunar apatites for detecting Cd (II). • The electrochemical oxidation of Cd (II) was performed at CaLA-CPE using DPASV. • The proposed method was evaluated to detect cadmium in seawater and mussel samples.

  17. Magneto-optical imaging of polycrystalline FeTe1-xSex prepared at various conditions

    International Nuclear Information System (INIS)

    Ding, Q.; Taen, T.; Mohan, S.; Nakajima, Y.; Tamegai, T.

    2011-01-01

    High-quality FeTe 1-x Se x polycrystals with T c ∼ 14 K were prepared by sintering at different temperatures. Intragranular critical current density of FeTe 1-x Se x polycrystals estimated from M-H curve is 5 x 10 4 A/cm 2 at 5 K under zero field. The observed intragranular J c value was confirmed by the magneto-optical images in the remanent state. The weak-link feature of FeTe 1-x Se x polycrystals is also revealed through magneto-optical imaging. We have prepared high-quality polycrystalline FeTe 1-x Se x by sintering at different temperatures and characterized their structural and magnetic properties with X-ray diffraction, magnetization measurements, and magneto-optical imaging. The intragranular J c was estimated to be 5 x 10 4 A/cm 2 , which is smaller than the single crystal, but still in the range for practical applications.

  18. Thermoelectric properties of chalcogenide based Cu2+xZnSn1xSe4

    Directory of Open Access Journals (Sweden)

    Ch. Raju

    2013-03-01

    Full Text Available Quaternary chalcogenide compounds Cu2+xZnSn1xSe4 (0 ≤ x ≤ 0.15 were prepared by solid state synthesis. Rietveld powder X-ray diffraction (XRD refinements combined with Electron Probe Micro Analyses (EPMA, WDS-Wavelength Dispersive Spectroscopy and Raman spectra of all samples confirmed the stannite structure (Cu2FeSnS4-type as the main phase. In addition to the main phase, small amounts of secondary phases like ZnSe, CuSe and SnSe were observed. Transport properties of all samples were measured as a function of temperature in the range from 300 K to 720 K. The electrical resistivity of all samples decreases with an increase in Cu content except for Cu2.1ZnSn0.9Se4, most likely due to a higher content of the ZnSe. All samples showed positive Seebeck coefficients indicating that holes are the majority charge carriers. The thermal conductivity of doped samples was high compared to Cu2ZnSnSe4 and this may be due to the larger electronic contribution and the presence of the ZnSe phase in the doped samples. The maximum zT = 0.3 at 720 K occurs for Cu2.05ZnSn0.95Se4 for which a high-pressure torsion treatment resulted in an enhancement of zT by 30% at 625 K.

  19. Photomagnetic studies on spin-crossover solid solutions containing two different metal complexes, [Fe(1-bpp)(2)](x)[M(terpy)2](1-x)[BF4]2 (M = Ru or Co).

    Science.gov (United States)

    Chastanet, Guillaume; Tovee, Clare A; Hyett, Geoffrey; Halcrow, Malcolm A; Létard, Jean-François

    2012-04-28

    The photomagnetic properties of two series of spin-crossover solid solutions, [Fe(1-bpp)(2)](x)[Ru(terpy)(2)](1-x)(BF(4))(2) and [Fe(1-bpp)(2)](x)[Co(terpy)(2)](1-x)(BF(4))(2) (1-bpp = 2,6-bis[pyrazol-1-yl]pyridine), have been investigated. For all the materials, the evolution of the T(LIESST) value, the high-spin → low-spin relaxation parameters and the LITH loops were thoroughly studied. Interestingly in the Fe:Co series, along the photo-excitation, cobalt ions are concomitantly converted from low-spin to high-spin states with the iron centres, and also fully relax after light excitation. This journal is © The Royal Society of Chemistry 2012

  20. Structural, catalytic and magnetic properties of Cu{sub 1-X}Co{sub X}Fe{sub 2}O{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Briceno, Sarah, E-mail: sbriceno@ivic.gob.ve [Laboratorio de Fisica de la Materia Condensada, Centro de Fisica, Instituto Venezolano de Investigaciones Cientificas (IVIC), Apartado 20632, Caracas 1020-A (Venezuela, Bolivarian Republic of); Del Castillo, Hector [Laboratorio de Cinetica y Catalisis, Departamento de Quimica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101-A (Venezuela, Bolivarian Republic of); Sagredo, V. [Laboratorio de Magnetismo, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101-A (Venezuela, Bolivarian Republic of); Bramer-Escamilla, Werner; Silva, Pedro [Laboratorio de Fisica de la Materia Condensada, Centro de Fisica, Instituto Venezolano de Investigaciones Cientificas (IVIC), Apartado 20632, Caracas 1020-A (Venezuela, Bolivarian Republic of)

    2012-12-15

    Highlights: Black-Right-Pointing-Pointer Cu{sub 1-X}Co{sub X}Fe{sub 2}O{sub 4} ferrite synthesized by sol-gel auto-combustion method. Black-Right-Pointing-Pointer Structural identification, magnetic and catalytic properties were investigated. Black-Right-Pointing-Pointer Characterization by TGA, DTA, XRD, SEM, TEM and VSM techniques. Black-Right-Pointing-Pointer Magnetic properties decrease with the increase of Cu{sup 2+} doping. Black-Right-Pointing-Pointer The selective conversion to N{sub 2} is higher for Cu-Co mixed ferrites. - Abstract: Copper substituted cobalt ferrite Cu{sub 1-X}Co{sub X}Fe{sub 2}O{sub 4} (0 {<=}x {<=} 1) have been synthesized using sol-gel auto combustion method with citric acid as fuel. Structural identification, magnetic and catalytic properties were investigated using thermogravimetric and differential thermal analysis, X-ray diffraction, scanning electron microscopy, transmission electron microscopy, vibrating sample magnetometry and their application in the selective catalytic reduction of NOx were studied. Analysis of structural properties reveals that all samples have cubic spinel structure. Room temperature magnetic hysteresis measurements as a function of magnetic field infer that the magnetic properties decrease with Cu{sup 2+} doping which may be due to the difference of the magnetic moment of Cu{sup 2+} and Co{sup 2+} ions. The higher activity of the samples in NO selective reduction to N{sub 2} occurs at 350 Degree-Sign C, reaching a maximum of 38% NO conversion and 95% of selective conversion to N{sub 2}. The compositions containing both Cu{sup 2+} and Co{sup 2+} ions are more active to the products selectivity to N{sub 2}, suggesting a synergistic effect on the active surface of ferrite and the effect of Co{sup 2+} is more pronounced than Cu{sup 2+} towards NO conversion.

  1. MAX phase formation by intercalation upon annealing of TiCx/Al (0.4x1) bilayer thin films

    International Nuclear Information System (INIS)

    Abdulkadhim, Ahmed; Takahashi, Tetsuya; Music, Denis; Munnik, Frans; Schneider, Jochen M.

    2011-01-01

    TiC x /Al bilayer thin films were synthesized using combinatorial magnetron sputtering to study the influence of C content on the reaction products at different annealing temperatures. Based on energy-dispersive X-ray analysis calibrated by elastic recoil detection analysis data, x in TiC x was varied from 0.4 to 1.0. Film constitution was studied by X-ray diffraction before and after annealing at temperatures from 500 to 1000 deg. C. The formation of TiC x and Al in the as-deposited samples over the whole C/Ti range was identified. Upon annealing, TiC x reacts with Al to form Ti-Al-based intermetallics. At temperatures as low as 700 deg. C, the formation of MAX phases (space group P6 3 /mmc) is observed at x ≤ 0.7. Based on the comparison between the C content induced changes in the lattice spacing of TiC x and Ti 2 AlC as well as Ti 3 AlC 2 , we infer the direct formation of MAX phases by Al intercalation into TiC x for x ≤ 0.7.

  2. Transport mean free path in K5Bi1-xNdx(MoO4)4 laser crystal powders

    International Nuclear Information System (INIS)

    Illarramendi, M A; Aramburu, I; Fernandez, J; Balda, R; Al-Saleh, M

    2007-01-01

    In this work, we calculate in two different ways the transport mean free paths in K 5 Bi 1-x Nd x (MoO 4 ) 4 (x = 0.05, 0.2, 1) laser crystal powders by using the diffuse spectral reflectance and transmittance of the powders and the absorption coefficient of the crystal materials. The theoretical calculations have been made by assuming a diffusive propagation of light in these materials. Similar results have been obtained from both methods

  3. Tandem pseudopericyclic reactions: [1,5]-X sigmatropic shift/6pi-electrocyclic ring closure converting N-(2-X-carbonyl)phenyl ketenimines into 2-X-quinolin-4(3H)-ones.

    Science.gov (United States)

    Alajarín, Mateo; Ortín, María-Mar; Sanchez-Andrada, Pilar; Vidal, Angel

    2006-10-13

    N-(2-X-Carbonyl)phenyl ketenimines undergo, under mild thermal conditions, [1,5]-migration of the X group from the carbonyl carbon to the electron-deficient central carbon atom of the ketenimine fragment, followed by a 6pi-electrocyclic ring closure of the resulting ketene to provide 2-X-substituted quinolin-4(3H)-ones in a sequential one-pot manner. The X groups tested are electron-donor groups, such as alkylthio, arylthio, arylseleno, aryloxy, and amino. When involving alkylthio, arylthio, and arylseleno groups, the complete transformation takes place in refluxing toluene, whereas for aryloxy and amino groups the starting ketenimines must be heated at 230 degrees C in a sealed tube in the absence of solvent. The mechanism for the conversion of these ketenimines into quinolin-4(3H)-ones has been studied by ab initio and DFT calculations, using as model compounds N-(2-X-carbonyl)vinyl ketenimines bearing different X groups (X = F, Cl, OH, SH, NH(2), and PH(2)) converting into 4(3H)-pyridones. This computational study afforded two general reaction pathways for the first step of the sequence, the [1,5]-X shift, depending on the nature of X. When X is F, Cl, OH, or SH, the migration occurs in a concerted mode, whereas when X is NH(2) or PH(2), it involves a two-step sequence. The order of migratory aptitudes of the X substituents at the acyl group is predicted to be PH(2) > Cl > SH > NH(2) > F> OH. The second step of the full transformation, the 6pi-electrocyclic ring closure, is calculated to be concerted and with low energy barriers in all the cases. We have included in the calculations an alternative mode of cyclization of the N-(2-X-carbonyl)vinyl ketenimines, the 6pi-electrocyclic ring closure leading to 1,3-oxazines that involves its 1-oxo-5-aza-1,3,5-hexatrienic system. Additionally, the pseudopericyclic topology of the transition states for some of the [1,5]-X migrations (X = F, Cl, OH, SH), for the 6pi-electrocyclization of the ketene intermediates to the 4

  4. Tensor analysing power T{sub 2}0 in inelastic (d, d`) X scattering at 0{sup 0} on {sup 1}H and {sup 12}C from 4.5 to 9.0 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Azhgirej, L S; Chernykh, E V [Laboratory of High Energies, Joint Institute for Nuclear Research, Dubna (Russian Federation); Kobushkin, A P [Institute of Theoretical Physics, Ukrainian Academy of Sciences, Kiev (Ukraine); and others

    1998-12-01

    Tensor analysing power T{sub 20} for inelastic (d, d`) X reaction at deuteron momentum from 4.2 to 9 GeV/c is presented. It is observed that T{sub 20} taken as a function of the four-momentum transfer squared t demonstrates an approximate scaling; its absolute value is small at |t| <{approx_equal} (0.05 - 0.1) GeV{sup 2}/c{sup 2} and has a maximum at -t {approx_equal}0.3 GeV{sup 2}/c{sup 2}. No significant dependence on the type of the target was observed 10 refs., 4 figs., 4 tabs.

  5. Gd5(SixGe1x)4 system – updated phase diagram

    International Nuclear Information System (INIS)

    Melikhov, Yevgen; Hadimani, R.L.; Raghunathan, Arun

    2015-01-01

    Gd 5 (Si x Ge 1x ) 4 for 0.41<x<0.5 is orthorhombic and ferromagnetic at lower temperature, monoclinic and paramagnetic at higher temperature, and shows a first order magnetic-structural phase transition between the two. In this range, the magnetic moment vs. magnetic field (MH) isotherms measured just above the first order transition temperature carry information about all magnetic and structural transitions. Here, the Curie–Weiss law was applied to the paramagnetic portions of the MH isotherms which allowed identification of the second order magnetic phase transition temperature of the monoclinic phase, a region where the second order transition does not occur due to the existence of the first order transition. The calculated second order phase transition temperatures of the monoclinic phase were added to the existing phase diagram. The completed magnetic-structural phase diagram carries now all the information including the magnetic transition temperatures of both monoclinic and orthorhombic phases. It was also found that the magnetic transition temperature of the monoclinic phase and the first order transition temperature are interrelated. - Highlights: • Magnetocaloric Gd 5 (Si x Ge 1x ) 4 for 0.41<x<0.5 was studied. • First order phase transition suppresses second order transition of monoclinic phase. • Curie–Weiss law and Arrott Plot technique were used to analyse M vs. H isotherms. • Second order phase transition temperatures of the monoclinic phase were estimated. • Magnetic-structural phase diagram Gd 5 (Si x Ge 1x ) 4 for 0.41<x<0.5 was completed

  6. Switching between solid solution and two-phase regimes in the Li1-xFe1-yMnyPO4 cathode materials during lithium (de)insertion: combined PITT, in situ XRPD and electron diffraction tomography study

    International Nuclear Information System (INIS)

    Drozhzhin, Oleg A.; Sumanov, Vasiliy D.; Karakulina, Olesia M.; Abakumov, Artem M.; Hadermann, Joke; Baranov, Andrey N.; Stevenson, Keith J.; Antipov, Evgeny V.

    2016-01-01

    The electrochemical properties and phase transformations during (de)insertion of Li + in LiFePO 4 , LiFe 0.9 Mn 0.1 PO 4 and LiFe 0.5 Mn 0.5 PO 4 are studied by means of galvanostatic cycling, potential intermittent titration technique (PITT) and in situ X-ray powder diffraction. Different modes of switching between the solid solution and two-phase regimes are revealed which are influenced by the Mn content in Li 1-x Fe 1-y Mn y PO 4 . Additionally, an increase in electrochemical capacity with the Mn content is observed at high rates of galvanostatic cycling (10C, 20C), which is in good agreement with the numerically estimated contribution of the solid solution mechanism determined from PITT data. The observed asymmetric behavior of the phase transformations in Li 1-x Fe 0.5 Mn 0.5 PO 4 during charge and discharge is discussed. For the first time, the crystal structures of electrochemically deintercalated Li 1-x Fe 0.5 Mn 0.5 PO 4 with different Li content – LiFe 0.5 Mn 0.5 PO 4 , Li 0.5 Fe 0.5 Mn 0.5 PO 4 and Li 0.1 Fe 0.5 Mn 0.5 PO 4 – are refined, including the occupancy factors of the Li position. This refinement is done using electron diffraction tomography data. The crystallographic analyses of Li 1-x Fe 0.5 Mn 0.5 PO 4 reveal that at x = 0.5 and 0.9 the structure retains the Pnma symmetry and the main motif of the pristine x = 0 structure without noticeable short range order effects.

  7. Creep-rupture behavior of 2-1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in a simulated HTGR helium environment

    International Nuclear Information System (INIS)

    Lai, G.Y.; Wolwowicz, R.J.

    1979-12-01

    Creep-rupture testing was conducted on 1 1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in flowing helium containing nominal concentration of following gases: 1500 μatm H 2 , 450 μatm CO, 50 μatm CH 4 , 50 μatm H 2 O and 5 μatm CO 2 . This environment is believed to represent maximum permissible levels of impurities in the primary coolant for the steam-cycle system of a high-temperature gas-cooled reactor (HTGR) when it is operating continuously with a water and/or steam leak at technical specification limits. Two or three heats of material for each alloy were investigated. Tests were conducted at 482 0 C and 760 0 C (1200 0 F and 1400 0 F) for Alloy 800H, and at 760 0 C and 871 0 C (1400 0 F and 1600 0 F) for Hastelloy Alloy X for times up to 10,000 h. Selected tests were performed on same heat of material in both air and helium environments to make a direct comparison of creep-rupture behaviors between two environments. Metallurgical evaluation was performed on selected post test specimens with respect to gas-metal interactions which included oxidation, carburization and/or decarburization. Correlation between gaseous corrosion and creep-rupture behavior was attempted. Limited tests were also performed to investigate the specimen size effects on creep-rupture behavior in the helium environment

  8. Single-source-precursor synthesis of dense SiC/HfCxN1-x-based ultrahigh-temperature ceramic nanocomposites

    Science.gov (United States)

    Wen, Qingbo; Xu, Yeping; Xu, Binbin; Fasel, Claudia; Guillon, Olivier; Buntkowsky, Gerd; Yu, Zhaoju; Riedel, Ralf; Ionescu, Emanuel

    2014-10-01

    polycarbosilane (SMP10) and tetrakis(dimethylamido)hafnium(iv) (TDMAH) for the purpose of preparing dense monolithic SiC/HfCxN1-x-based ultrahigh temperature ceramic nanocomposites. The materials obtained at different stages of the synthesis process were characterized via Fourier transform infrared (FT-IR) as well as nuclear magnetic resonance (NMR) spectroscopy. The polymer-to-ceramic transformation was investigated by means of MAS NMR and FT-IR spectroscopy as well as thermogravimetric analysis (TGA) coupled with in situ mass spectrometry. Moreover, the microstructural evolution of the synthesized SiHfCN-based ceramics annealed at different temperatures ranging from 1300 °C to 1800 °C was characterized by elemental analysis, X-ray diffraction, Raman spectroscopy and transmission electron microscopy (TEM). Based on its high temperature behavior, the amorphous SiHfCN-based ceramic powder was used to prepare monolithic SiC/HfCxN1-x-based nanocomposites using the spark plasma sintering (SPS) technique. The results showed that dense monolithic SiC/HfCxN1-x-based nanocomposites with low open porosity (0.74 vol%) can be prepared successfully from single-source precursors. The average grain size of both HfC0.83N0.17 and SiC phases was found to be less than 100 nm after SPS processing owing to a unique microstructure: HfC0.83N0.17 grains were embedded homogeneously in a β-SiC matrix and encapsulated by in situ formed carbon layers which acted as a diffusion barrier to suppress grain growth. The segregated Hf-carbonitride grains significantly influenced the electrical conductivity of the SPS processed monolithic samples. While Hf-free polymer-derived SiC showed an electrical conductivity of ca. 1.8 S cm-1, the electrical conductivity of the Hf-containing material was analyzed to be ca. 136.2 S cm-1. Electronic supplementary information (ESI) available: Raman spectroscopy characterization of the SiHfCN-based ceramics. See DOI: 10.1039/c4nr03376k

  9. Program Management Assistance Group: AFSC’s Internal Consultants

    Science.gov (United States)

    1977-11-01

    acquisition activity reviews. Subsequently, since PMAG’s effectiveness is difficult, if not impossible, to measure due to, the confidentiality of its...implications. While the PMAG field review results would be very interesting and illuminating in terms of PMAG’s effectiveness and value, these examples are...December 1975, the new Commander of AFSC, General William J. Evans, wrote his commanders and directors of AFSC’s divisions, centers, SAMSO, AFETR and

  10. Preparation and property of magnetic photocatalyst BiOCl/Mn{sub x}Zn{sub 1x}Fe{sub 2}O{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Feng, Shan; Xu, Longjun, E-mail: xulj@cqu.edu.cn; Liu, Chenglun [State Key Laboratory of Coal Mine Disaster Dynamics and Control (China); Du, Haigang [Liupanshui Normal University, Department of Mining Engineering (China); Xie, Taiping [State Key Laboratory of Coal Mine Disaster Dynamics and Control (China); Zhu, Qianqian [Chongqing University, College of Chemistry and Chemical Engineering (China)

    2017-02-15

    The magnetic photocatalyst BiOCl/Mn{sub x}Zn{sub 1x}Fe{sub 2}O{sub 4} was prepared by impregnation-calcination method. The structure and properties of the prepared photocatalyst were characterized by FTIR, XRD, SEM, TEM, UV–vis DRS, and VSM. Mn{sub x}Zn{sub 1x}Fe{sub 2}O{sub 4} inhibited the growth along (001) crystal face and promoted (110) crystal surface exposure of BiOCl. The as-prepared magnetic composite appeared flower-like microspheres assembled with nanosheets. The average crystallite size and the nanosheet thickness range of BiOCl/Mn{sub x}Zn{sub 1x}Fe{sub 2}O{sub 4} were 57.6 and 75.7–112.2 nm, respectively. The band gap energy (E{sub g}) of BiOCl/Mn{sub x}Zn{sub 1x}Fe{sub 2}O{sub 4} was 2.48 eV, which was lower than that of BiOCl. The saturation magnetization (Ms), coercive force (Hc), and remanent magnetization (Mr) of BiOCl/Mn{sub x}Zn{sub 1x}Fe{sub 2}O{sub 4} were respectively 4.64 emu g{sup −1}, 50.12 G and 0.09 emu g{sup −1}, indicating a good resistance to demagnetization and paramagnetism. The optimum synthesis condition of BiOCl/Mn{sub x}Zn{sub 1x}Fe{sub 2}O{sub 4} was obtained by orthogonal experiments, and the degradation ratio of RhB with the photocatalyst was 99.6% at 30 min. After four cycles, the degradation ratio of RhB with the recovered photocatalyst was still above 83%.

  11. The effect of Alcoholic garlic (Allium sativum extract on ABCA1 expression in human THP-1 macrophages

    Directory of Open Access Journals (Sweden)

    Malekpour-Dehkordi Z

    2011-06-01

    Full Text Available "n Normal 0 false false false EN-US X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:Arial; mso-bidi-theme-font:minor-bidi;} Background: ATP-binding cassette transporter A1 (ABCA1 is a key mediator of cholesterol efflux to apoA-I in lipid-laden macrophages, the first step of reverse cholesterol transport (RCT in vivo and a critical step in preventing atherosclerosis. Enhanced ABCA1 expression may inhibit foam cell formation and consequently reduce atherogenic risk. On the other hand, garlic, Allium sativum, and garlic extracts have been demonstrated to have potential cardiovascular benefits. Moreover, garlic has direct antiatherogenic and antiathersclerotic effects on artery walls. The aim of this study was to evaluate the effects of alcoholic garlic extract on the expression of ABCA1 in macrophages."n"nMethods: Cell viability assay was used in order to detect the cytotoxic dose of alcoholic garlic extract on macrophages. Real-time PCR and Western blotting were performed to study the effects of alcoholic garlic extract on the expression of ABCA1. Macrophage cells were treated by different concentrations of alcoholic garlic extract for 48 h. The total RNA of the treated macrophages were extracted and analyzed by real-time PCR. ABCA1 protein expression was also analyzed using the Western blotting technique."n"nResults: Alcoholic garlic extract

  12. Structure and dielectric properties of (Ba{sub 0.7}Sr{sub 0.3}){sub 1-x}Na{sub x}(Ti{sub 0.9}Sn{sub 0.1}){sub 1-x}Nb{sub x}O{sub 3} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Ghoudi, Hanen; Khirouni, Kamel [Universite de Gabes, Laboratoire de Physique des Materiaux et des Nanomateriaux Appliquee a l' Environnement (La Phy MNE), Faculte des Sciences de Gabes, Gabes (Tunisia); Chkoundali, Souad [Universite de Sfax, Laboratoire des Materiaux Multifonctionnels et Applications (LaMMA), Faculte des Sciences de Sfax (FSS), Sfax (Tunisia); Aydi, Abdelhedi [Universite de Gabes, Laboratoire de Physique des Materiaux et des Nanomateriaux Appliquee a l' Environnement (La Phy MNE), Faculte des Sciences de Gabes, Gabes (Tunisia); Universite de Sfax, Laboratoire des Materiaux Multifonctionnels et Applications (LaMMA), Faculte des Sciences de Sfax (FSS), Sfax (Tunisia)

    2017-11-15

    (Ba{sub 0.7}Sr{sub 0.3}){sub 1-x}Na{sub x}(Ti{sub 0.9}Sn{sub 0.1}){sub 1-x}Nb{sub x}O{sub 3} ceramics with compositions x = 0.6, 0.7, 0.8 and 0.9 were synthesized using the solid-state reaction method. These ceramics were examined by X-ray diffraction and dielectric measurements over a broad temperature and frequency ranges. X-ray diffraction patterns revealed a single-perovskite phase crystallized in a cubic structure, for x < 0.8, and in tetragonal, for x ≥ 0.8, with Pm3m and P4mm spaces groups, respectively. Two types of behaviors, classical ferroelectric or relaxor, were observed depending on the x composition. It is noted that temperatures T{sub C} (the Curie temperature) or T{sub m} (the temperature of maximum permittivity) rise when x increases and the relaxor character grows more significantly when x composition decreases. To analyze the dielectric relaxation degree of relaxor, various models were considered. It was proven that an exponential function could well describe the temperature dependence of the static dielectric constant and relaxation time. (orig.)

  13. ZZ MCNPDATA, Standard Neutron, Photon and Electron Data Libraries for MCNP-4C and MCB1C

    International Nuclear Information System (INIS)

    2002-01-01

    1 - Description: These cross-section libraries are released by the Diagnostics Applications Group, X-5, at Los Alamos National Laboratory for use with the MCNP Monte Carlo code package. This release includes all of the X-5 distributed neutron data libraries, the photon libraries MCPLIB1 and MCPLIB02, the electron libraries EL1 and EL03, an updated XSDIR file, and information files Readme.txt and Readme e ndf60.txt. This release is intended to completely replace previous RSICC releases DLC-105, DLC-181, and DLC-189 as well as the cross sections previously included with CCC-200/MCNP4A, and will be updated as new libraries become available. The README file provides information regarding each data library of this release. Additional documentation for some of the individual libraries and example SPECS files for use with MAKXSF are also provided. The XSDIR file is specific to this release and may not work with previous packages. Currently the neutron data library ENDF60 (based on ENDF/B-VI, up through and including release 2) is the default library for continuous-energy neutron transport. Additionally, the libraries MCPLIB02 and EL03 are the default libraries for photon and electron transport respectively. More information on the data libraries contained in this release is available in Appendix G of the MCNP4C manual. 2 - Description of program or function: ZZ-MCB-DLC200 contains the same cross section tables as the DLC-0200/03 package for the MCNP-4C code, except that the installation procedures are adapted to the MCB1C code system (NEA 1643/01). 3 - Application of the data: DLC-200/MCNPDATA is for use with Version 4C and later of the MCNP transport code. This data library provides a comprehensive set of cross sections for a wide range of radiation transport applications using the Monte Carlo code package CCC-700/MCNP4C. See Appendix G of the MCNP report LA-13709-M for information on the libraries and how to select specific nuclides for use in MCNP. 4 - Source and scope

  14. Carboranyl tetrahydroisoquinolines. Synthesis and the X-ray structural study of 1-(o-Carboran-1-ylmethyl)-1,2,3,4-Tetrahydroisoquinolines

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jong Dae; Kang, Sang Ook [Korea University, Dept. of Chemistry, Chung-nam (Korea); Lee, Chai-Ho [Wonkwang Univ., Dept. of Chemistry, Jeonbuk (Korea); Lee, Seung-Hoon [National Cancer Center, Kyungi-do (Korea); Lim, Sang-Moo [Korea Cancer Center Hospital, Seoul (Korea); Cho, Sungil [Seoul City Univ., Dept. of Chemical Engineering, Seoul (Korea)

    2001-11-01

    Synthesis of the first fully characterized boronated tetrahydroisoquinolines is reported. Thus, tetrahydroisoquinolines containing 1-(0-carboran-1-ylmethyl)-1,2,3,4-tetrahydroisoquinolines have been synthesized from the corresponding arylethylamines to provide carboranes attached to functional group capable of being covalently incorporated into structures of potential use in boron neutron capture therapy (BNCT). The carboranyl functionalities were attached at the 1-position of the tetrahydroisoquinoline molecule. Experimental details and analytical data leading to the identification of the reported compounds are provided. Additionally, the X-ray diffraction structure of 9b is reported. (author)

  15. Spatial structure determination of ({radical}3 x {radical}3)R30{degrees} and (1.5 x 1.5)R18{degrees}CO on Cu(111) using angle-resolved photoemission extended fine structure

    Energy Technology Data Exchange (ETDEWEB)

    Moler, E.J.; Kellar, S.A.; Huff, W.R.A. [Lawrence Berkeley National Lab., CA (United States)] [and others

    1997-04-01

    The authors report a study of the spatial structure of ({radical}3 x {radical}3)R30{degrees} (low coverage) and (1.5 x 1.5)R18{degrees} (intermediate coverage) CO adsorbed on Cu(111), using the Angle-Resolved Photoemission Extended Fine Structure (ARPEFS) technique at beamline 9.3.2 at the Advanced Light Source. The CO molecule adsorbs on an atop site for both adsorption phases. Full multiple-scattering spherical-wave (MSSW) calculations were used to extract the C-Cu. bond length and the first Cu-Cu layer spacing for each adsorption phase. The authors find that the C-Cu bond length remains unchanged with increasing coverage, but the 1st Cu-Cu layer spacing contracts at the intermediate coverage. They calculate the bending mode force constant in the (1.5 x 1.5)R18{degrees} phase to be K{sub {delta}} = 2.2 (1) x 10{sup {minus}12} dyne-cm/rad from their experimentally determined bond lengths combined with previously published infra-red absorption frequencies.

  16. Synthesis and characterization of a powellite Ca1-x-yNaxREEyMoO4

    International Nuclear Information System (INIS)

    Moudir, Dalida; Kamel, Nour-el-hayet; Yahiaoui, Saliha; Mouheb, Yasmina; Kamariz, Soumia; Aouchiche, Fairouz

    2015-01-01

    Powellite is a Ca-molybdate ceramic, which forms in nuclear glasses. It may contain an actinide or a lanthanide in its structure, insuring a double containment of radioactivity. This study deals with the synthesis and characterization of powellites, with the general formula: Ca 1-x-y Na x REE y MoO 4 , 0.01≤y≤0.08, x+y≤ 0.20, with REE = Er, Yb and Y. The minerals are synthesized in two heating stages: a calcination at 800 C followed by a sintering at 1150 C. The materials final densities were all similar to the standard value of natural powellite (≅4250 kg/m 3 ), and do not vary significantly with the nature and amount of the lanthanide dopant. The materials microstructure was observed by scanning electron microscopy analysis, and the phase identification was performed by X-ray diffraction analysis. All powellites have a I41/a CaMoO 4 tetragonal structure. The variation of the lattice parameters and molar volumes as a function of the materials composition, calculated using CELREF software, show that they decrease from Yb to Er to Y, and quietly vary with the amount of dopant in the powellites; the materials crystallographic structure remaining preserved. (authors)

  17. X-ray structure, semi-empirical MO calculations and π-electron delocalization of 1-cyanoacetyl-5-trifluoromethyl-5-hydroxy-4,5-dihydro-1 H-pyrazoles

    Science.gov (United States)

    Martins, Marcos A. P.; Moreira, Dayse N.; Frizzo, Clarissa P.; Campos, Patrick T.; Longhi, Kelvis; Marzari, Mara R. B.; Zanatta, Nilo; Bonacorso, Helio G.

    2010-04-01

    The structure of three 1-cyanoacetyl-3-alkyl[aryl]-5-trifluoromethyl-5-hydroxy-4,5-dihydro-1 H-pyrazoles ( 1- 3) has been determined by X-ray diffractometry. The 4,5-dihydro-1 H-pyrazole rings were obtained as almost planar structures showing RMS deviation at a range of 0.0196-0.0736 Å. The data demonstrate that the molecular packing is dependent on the substituent present in each molecule. In addition, a computational investigation using semi-empirical AM1 and RM1 methods was performed in order to investigate the correlation between experimental and calculated geometrical parameters. The data obtained suggest that the structural data furnished by the AM1 method is in better agreement with those experimentally determined for the above compounds. An analysis of the π-electron delocalization by HOMA calculations indicate that there is a hyperconjugation effect in the imine group toward to phenyl group at ring 3-position of compound 2, and that this resonance effect decrease in compounds 1 and 3. In addition, it was showed that bond N(1) and C(6) do not have an amide character. Thus, the O(6)-C(6)-N(1)-N(2)-C(3) fragment is not completely delocalized mainly due to the low π-electron delocalization in N(1)-N(2) bond for all compounds.

  18. Cinnamon Extract Enhances Glucose Uptake in 3T3-L1 Adipocytes and C2C12 Myocytes by Inducing LKB1-AMP-Activated Protein Kinase Signaling

    Science.gov (United States)

    Shen, Yan; Honma, Natsumi; Kobayashi, Katsuya; Jia, Liu Nan; Hosono, Takashi; Shindo, Kazutoshi; Ariga, Toyohiko; Seki, Taiichiro

    2014-01-01

    We previously demonstrated that cinnamon extract (CE) ameliorates type 1 diabetes induced by streptozotocin in rats through the up-regulation of glucose transporter 4 (GLUT4) translocation in both muscle and adipose tissues. This present study was aimed at clarifying the detailed mechanism(s) with which CE increases the glucose uptake in vivo and in cell culture systems using 3T3-L1 adipocytes and C2C12 myotubes in vitro. Specific inhibitors of key enzymes in insulin signaling and AMP-activated protein kinase (AMPK) signaling pathways, as well as small interference RNA, were used to examine the role of these kinases in the CE-induced glucose uptake. The results showed that CE stimulated the phosphorylation of AMPK and acetyl-CoA carboxylase. An AMPK inhibitor and LKB1 siRNA blocked the CE-induced glucose uptake. We also found for the first time that insulin suppressed AMPK activation in the adipocyte. To investigate the effect of CE on type 2 diabetes in vivo, we further performed oral glucose tolerance tests and insulin tolerance tests in type 2 diabetes model rats administered with CE. The CE improved glucose tolerance in oral glucose tolerance tests, but not insulin sensitivity in insulin tolerance test. In summary, these results indicate that CE ameliorates type 2 diabetes by inducing GLUT4 translocation via the AMPK signaling pathway. We also found insulin antagonistically regulates the activation of AMPK. PMID:24551069

  19. X-ray photo-emission studies of Cu1-xTlxBa2Ca3Cu4O12-y superconductor thin films

    International Nuclear Information System (INIS)

    Khan, Nawazish A.; Mumtaz, M.; Ahadian, M.M.; Iraji-zad, Azam

    2006-01-01

    X-ray photo-emission spectroscopy (XPS) studies of Cu 1-x Tl x Ba 2 Ca 3 Cu 4 O 12-y superconductor thin films have been carried out for understanding the mechanism of superconductivity and to find out the reasons for the increase of zero resistivity critical temperature T c (R = 0) with post-annealing in a nitrogen atmosphere. It is observed from these studies that reduction of charge state of thallium is a source of doping of carriers to the CuO 2 planes. The reduced charge state of thallium (i.e. Tl 1+ ) promotes lower oxygen concentration in the charge reservoir layer, which possibly results in movement of electrons to the conducting CuO 2 planes. The higher density of electrons in the CuO 2 planes optimizes the hole concentration 'n p ' in these planes. The reduced charge state of thallium in the Cu 1-x Tl x Ba 2 O 4-δ charge reservoir layer is also supported by a shift of the Ba 3d 5/2 and Ba 3d 3/2 XPS lines to lower binding energies with post-annealing in nitrogen atmosphere. Moreover, the movement of the valance band spectrum to lower binding energies suggested that the electronic density of states changes in the valance band with the post-annealing in nitrogen, which possibly becomes a source of doping of carriers to the CuO 2 planes. The increased doping of electrons to the CuO 2 planes optimizes the Fermi-vector K F and Fermi-velocity V F of the carriers and increases the T c (R = 0) of final compound

  20. C-Methylated Flavonoids from Cleistocalyx operculatus and Their Inhibitory Effects on Novel Influenza A (H1N1) Neuraminidase

    DEFF Research Database (Denmark)

    Dao, Trong-Tuan; Tung, Bui-Thanh; Nguyen, Phi-Hung

    2010-01-01

    As part of an ongoing study focused on the discovery of anti-influenza agents from plants, four new (1-4) and 10 known (5-14) C-methylated flavonoids were isolated from a methanol extract of Cleistocalyx operculatus buds using an influenza H1N1 neuraminidase inhibition assay. Compounds 4, 7, 8...... mutant) expressed in 293T cells with IC50 values of 8.15 ± 1.05 and 3.31 ± 1.34 μM, respectively. Compounds 4, 7, 8, and 14 behaved as noncompetitive inhibitors in the kinetic studies. These results indicate that C-methylated flavonoids from C. operculatus have the potential to be developed...

  1. Bioactive constituents from Chinese natural medicines. XXXII. aminopeptidase N and aldose reductase inhibitors from Sinocrassula indica: structures of sinocrassosides B(4), B(5), C(1), and D(1)-D(3).

    Science.gov (United States)

    Morikawa, Toshio; Xie, Haihui; Wang, Tao; Matsuda, Hisashi; Yoshikawa, Masayuki

    2008-10-01

    From the methanolic extract of the whole plant of Sinocrassula indica (Crassulaceae), six new flavonol glycosides, sinocrassosides B(4) (1), B(5) (2), C(1) (3), D(1) (4), D(2) (5), and D(3) (6), were isolated together with 30 compounds. The structures of 1-6 were elucidated on the basis of chemical and physicochemical evidence. In addition, several constituents were found to show inhibitory effects on aminopeptidase N and aldose reductase.

  2. Spin glass and ferromagnetic properties of Ce(Cu_1_-_xNi_x)_4Mn alloys: Multicritical points in the magnetic phase diagram

    International Nuclear Information System (INIS)

    Synoradzki, K.; Toliński, T.

    2016-01-01

    We report on the CeNi_4Mn (ferromagnet FM) - CeCu_4Mn (spin-glass SG) transformation leading to a complex magnetic phase diagram (MPD). It is verified that all the Ce(Cu_1_-_xNi_x)_4Mn alloys are isostructural and the transformation is governed only by the Cu-Ni substitution. MPD is built based on the magnetic dc/ac susceptibility measurements and reveals SG formation as well as the region of the coexistence of the FM and SG state in the middle range of the Ni concentration. The complex MPD is explained by clusters formation and a competition of interactions between various crystallographic sites of the hexagonal CaCu_5-type structure, mainly the 3g-3g and 3g-2c interactions. The predominance of the SG state is confirmed by the analysis of the frequency dependence of the ac magnetic susceptibility components and the relaxation of the remanent magnetization. Additionally, the presence of two multicritical points is observed. - Highlights: • We fully characterized the magnetic properties of Ce(Cu_1_-_xNi_x)_4Mn alloys. • We show the presence of complex magnetic behaviour due to atomic-site disorder. • Magnetic phase diagram revels mixed-phase ground state. • Two multicritical points on magnetic phase diagram occurs.

  3. Evaluation of the transfer and the accumulation of microcystins in tomato (Solanum lycopersicum cultivar MicroTom) tissues using a cyanobacterial extract containing microcystins and the radiolabeled microcystin-LR ("1"4C-MC-LR)

    International Nuclear Information System (INIS)

    Corbel, Sylvain; Mougin, Christian; Nélieu, Sylvie; Delarue, Ghislaine; Bouaïcha, Noureddine

    2016-01-01

    Microcystins are the most common cyanotoxins and may be expected wherever blooms of cyanobacteria occur in surface waters. Their persistence both in the irrigation water and in the soil can lead to their transfer and bioaccumulation into agricultural plants. The aim of this work was to investigate microcystin accumulation in Solanum lycopersicum cultivar MicroTom. The plant was exposed to either Microcystis aeruginosa crude extracts containing up to 100 μg eq. MC-LR L"−"1 in a soil–plant system for 90 days or pure radiolabeled "1"4C-MC-LR in a hydroponic condition for 48 h. Toxin bioaccumulation in the soil and different plant tissues was assessed both by the PP2A inhibition assay and by liquid chromatography-mass spectrometry (LC/MS/MS). After 90 days of exposure, microcystins persisted in the soil and their free extractable concentrations accumulated were very low varying between 1.6 and 3.9 μg eq. MC-LR kg"−"1 DW. Free MC-LR was detected only in roots and leaves with concentrations varying between 4.5 and 8.1 μg kg"−"1 DW and between 0.29 and 0.55 μg kg"−"1 DW, respectively. By using radioactivity ("1"4C-MC-LR), the results have reported a growing accumulation of toxins within the organs roots > leaves > stems and allowed them to confirm the absence of MC-LR in fruits after 48 h of exposure. The bioconcentration factor (BCF) was 13.6 in roots, 4.5 in leaves, and 1.4 in stems. On the other hand, the results highlight the presence of two radioactive fractions in different plant tissues. The non-extractable fraction of radioactivity, corresponding to the covalently bound MC-LR, was higher than that of the extractable fraction only in roots and leaves reaching 56% and 71% of the total accumulated toxin, respectively. Therefore, results raise that monitoring programs must monitor the presence of MCs in the irrigation water to avoid the transfer and accumulation of these toxins in crops. - Graphical abstract: Bioconcentration factors in organs of the

  4. X1X1X2X2/X1X2Y sex chromosome systems in the Neotropical Gymnotiformes electric fish of the genus Brachyhypopomus

    Directory of Open Access Journals (Sweden)

    Adauto Lima Cardoso

    2015-06-01

    Full Text Available Several types of sex chromosome systems have been recorded among Gymnotiformes, including male and female heterogamety, simple and multiple sex chromosomes, and different mechanisms of origin and evolution. The X1X1X2X2/X1X2Y systems identified in three species of this order are considered homoplasic for the group. In the genus Brachyhypopomus, only B. gauderio presented this type of system. Herein we describe the karyotypes of Brachyhypopomus pinnicaudatus and B. n. sp. FLAV, which have an X1X1X2X2/X1X2Y sex chromosome system that evolved via fusion between an autosome and the Y chromosome. The morphology of the chromosomes and the meiotic pairing suggest that the sex chromosomes of B. gauderio and B. pinnicaudatus have a common origin, whereas in B . n. sp. FLAV the sex chromosome system evolved independently. However, we cannot discard the possibility of common origin followed by distinct processes of differentiation. The identification of two new karyotypes with an X1X1X2X2/X1X2Y sex chromosome system in Gymnotiformes makes it the most common among the karyotyped species of the group. Comparisons of these karyotypes and the evolutionary history of the taxa indicate independent origins for their sex chromosomes systems. The recurrent emergence of the X1X1X2X2/X1X2Y system may represent sex chromosomes turnover events in Gymnotiformes.

  5. Spin re-orientation in heavy fermion system α - YbAl1 - x FexB4

    Science.gov (United States)

    Wu, Shan; Broholm, C.; Kuga, K.; Suzuki, Shintaro; Nakatsuji, S.; Mourigal, M.; Stone, M.; Tian, Wei; Qiu, Y.; Rodriguez-Rivera, Jose

    Non centro-symmetric α - YbAlB4 has a heavy Fermi liquid ground state and shares many characteristics with centro-symmetric β - YbAlB4 . Both isomorphs display intermediate valence, associated with a fluctuation scale of T0 = 200 K and a Kondo lattice scale of T* = 8 K. Unlike β - YbAlB4 , α - YbAlB4 is at the boundary of a transition from a Fermi liquid metallic state to an antiferromagnetic (AFM) insulating state, driven by Fe substitution of Al. Magnetization and specific heat measurements reveal two different antiferromagnetic phases with TN = 9 K and TN = 2 K for Fe concentration above and below x =0.07. We report single crystal neutron scattering experiments on Fe doped YbAlB4 with x =0.035 and x =0.125. While the ordering wave vector is identical, k -> = (1 , 0 , 0) , the spin orientation switches from c to a with increasing Fe concentration. This suggests different anisotropic hybridization between 4f and conduction electrons that we confirmed by determining the crystal field levels. Supported by DOE, BES through DE-FG02-08ER46544.

  6. Bi1xNbxO1.5+x (x=0.0625, 0.12) fast ion conductors: Structures, stability and oxide ion migration pathways

    International Nuclear Information System (INIS)

    Tate, Matthew L.; Hack, Jennifer; Kuang, Xiaojun; McIntyre, Garry J.; Withers, Ray L.; Johnson, Mark R.; Radosavljevic Evans, Ivana

    2015-01-01

    A combined experimental and computational study of Bi 1x Nb x O 1.5+x (x=0.0625 and 0.12) has been carried out using laboratory X-ray, neutron and electron diffraction, impedance measurements and ab-initio molecular dynamics. We demonstrate that Bi 0.9375 Nb 0.0625 O 1.5625 , previously reported to adopt a cubic fluorite-type superstructure, can form two different polymorphs depending on the synthetic method: a metastable cubic phase is produced by quenching; while slower cooling yields a stable material with a tetragonal √2×√2×1 superstructure, which undergoes a reversible phase transition into the cubic form at ~680 °C on subsequent reheating. Neutron diffraction reveals that the tetragonal superstructure arises mainly from ordering in the oxygen sublattice, with Bi and Nb remaining disordered, although structured diffuse scattering observed in the electron diffraction patterns suggests a degree of short-range ordering. Both materials are oxide ion conductors. On thermal cycling, Bi 0.88 Nb 0.12 O 1.62 exhibits a decrease in conductivity of approximately an order of magnitude due to partial transformation into the tetragonal phase, but still exhibits conductivity comparable to yttria-stabilised zirconia (YSZ). Ab-initio molecular dynamics simulations performed on Bi 0.9375 Nb 0.0625 O 1.5625 show that oxide ion diffusion occurs by O 2− jumps between edge- and corner-sharing OM 4 groups (M=Bi, Nb) via tetrahedral □M 4 and octahedral □M 6 vacancies. - Graphical abstract: Oxide ion migration in tetragonal Bi 0.9375 Nb 0.0625 O 1.5625 occurs by O 2− jumps between edge- and corner-sharing OM 4 groups (M=Bi, Nb) via tetrahedral M 4 and octahedral M 6 vacancies. - Highlights: • Bi 0.9375 Nb 0.0625 O 1.5625 adopts a tetragonal √2×√2×1 fluorite superstructure. • Superstructure is due to ordering in the O-sublattice, with Bi/Nb disordered. • Bi 0.9375 Nb 0.0625 O 1.5625 is a good oxide ion conductor. • O 2− jump between OM 4 groups (M

  7. Hepatitis B Virus X Protein Up-Regulates AKR1C1 Expression Through Nuclear Factor-Y in Human Hepatocarcinoma Cells.

    Science.gov (United States)

    Li, Kai; Ding, Shijia; Chen, Ke; Qin, Dongdong; Qu, Jialin; Wang, Sen; Sheng, Yanrui; Zou, Chengcheng; Chen, Limin; Tang, Hua

    2013-01-01

    The hepatitis B virus X (HBx) protein has long been recognized as an important transcriptional transactivator of several genes. Human aldo-keto reductase family 1, member C1 (AKR1C1), a member of the family of AKR1CS, is significantly increased in HBx-expressed cells. This study aimed to investigate the possible mechanism of HBx in regulating AKR1C1 expression in HepG2.2.15 cells and the role of AKR1C1 for HBV-induced HCC. RT-PCR was performed to detect AKR1C1 expression on mRNA level in HepG2 and HepG2.2.15 cell. The promoter activity of AKR1C1 was assayed by transient transfection and Dual-luciferase reporter assay system. The AKR1C1 promoter sequence was screened using the TFSEARCH database and the ALIBABA 2.0 software. The potential transcription factors binding sites were identified using 5' functional deletion analysis and site-directed mutagenesis. In this study, we found that HBx promoted AKR1C1 expression in HepG2.2.15 cells. Knockdown of HBx inhibited AKR1C1 activation. The role of HBx expression in regulating the promoter activity of human AKR1C1 gene was analyzed. The 5'functional deletion analysis identified that the region between -128 and -88 was the minimal promoter region of HBx to activate AKR1C1 gene expression. Site-directed mutagenesis studies suggested that nuclear factor-Y (NF-Y) plays an important role in this HBx-induced AKR1C1 activation. In HepG2.2.1.5 cell, HBx can promote AKR1C1 promoter activity and thus activates the basal transcription of AKR1C1 gene. This process is mediated by the transcription factor NF-Y. This study explored the mechanism for the regulation of HBV on AKR1C1 expression and has provided a new understanding of HBV-induced HCC.

  8. X-ray study of CuGa sub x In sub 1-x Se sub 2 solid solutions

    Energy Technology Data Exchange (ETDEWEB)

    Suri, D.K.; Nagpal, K.C. (National Physical Lab., New Delhi (India). Materials Characterization Div.); Chadha, G.K. (Delhi Univ. (India). Dept. of Physics and Astrophysics)

    1989-12-01

    The semiconducting compound CuGa{sub x}In{sub 1-x}Se{sub 2} crystallizes in the chalcopyrite structure (space group Ianti 42d, Z=4). The X-ray powder data for x=1, 0.75, 0.6, 0.5, 0.4, 0.25 and 0.0 have been collected and it is found that the lattice parameters a and c and their ratio c/a vary linearly with x. Thus the composition of any chalcopyrite in the pseudo-binary system CuGaSe{sub 2} and CuInSe{sub 2} can be obtained from the accurate lattice parameters. The crystallite size determined from the (112) plane is minimum for x=0.50 ({proportional to}1000 A) and away from x=0.50 it increases. A value of u=0.240 (5) has been established for fixing, the Se-atom positions in the CuGa{sub 0.5}In{sub 0.5}Se{sub 2} solid solution. The JCPDS Diffraction File No. for CuInSe{sub 2} is 40-1487 and for CuGa{sub 0.5}In{sub 0.5}Se{sub 2} is 40-1488. (orig.).

  9. Robust s± pairing in CaK (Fe1-xNix) 4As4 (x =0 and 0.05) from the response to electron irradiation

    Science.gov (United States)

    Teknowijoyo, S.; Cho, K.; Kończykowski, M.; Timmons, E. I.; Tanatar, M. A.; Meier, W. R.; Xu, M.; Bud'ko, S. L.; Canfield, P. C.; Prozorov, R.

    2018-04-01

    Controlled pointlike disorder introduced by 2.5-MeV electron irradiation was used to probe the superconducting state of single crystals of CaK (Fe1-xNix) 4As4 superconductor at x =0 and 0.05 doping levels. Both compositions show an increase of the residual resistivity and a decrease of the superconducting transition temperature, Tc, at the rate of d Tc/d ρ (Tc) ≈0.19 K/(μ Ω cm ) for x =0 and 0.38 K/(μ Ω cm ) for x =0.05 , respectively. In the Ni-doped compound (x =0.05 ), the coexisting spin-vortex crystal (SVC) magnetic phase is suppressed at the rate of d TN/d ρ (TN) ≈ 0.16 K/(μ Ω cm ). The low-temperature variation of London penetration depth is well approximated by the power-law function, Δ λ (T ) =A Tn , with n ≈2.5 for x =0 and n ≈1.9 for x =0.05 in the pristine state. Detailed analysis of λ (T ) and Tc evolution with disorder is consistent with two effective nodeless energy gaps in the density of states due to robust s± pairing. Overall the behavior of CaK (Fe1-xNix) 4As4 at x =0 is similar to a slightly overdoped Ba1 -yKyFe2As2 at y ≈ 0.5, and at x =0.05 to an underdoped composition at y ≈ 0.2.

  10. Mg{sub x}Mn{sub (1-x)}(BH{sub 4}){sub 2} (x = 0-0.8), a cation solid solution in a bimetallic borohydride

    Energy Technology Data Exchange (ETDEWEB)

    Cerny, Radovan, E-mail: radovan.cerny@unige.ch [Laboratory of Crystallography, University of Geneva, 1211 Geneva (Switzerland); Penin, Nicolas [Laboratory of Crystallography, University of Geneva, 1211 Geneva (Switzerland); CNRS, Universite de Bordeaux 1, ICMCB, 87 Avenue du Docteur Albert Schweitzer, F-33608 Pessac Cedex (France); D' Anna, Vincenza; Hagemann, Hans [Department of Physical Chemistry, University of Geneva, 1211 Geneva (Switzerland); Durand, Etienne [CNRS, Universite de Bordeaux 1, ICMCB, 87 Avenue du Docteur Albert Schweitzer, F-33608 Pessac Cedex (France); Ruzicka, Jakub [Charles University, Faculty of Science, Department of Inorganic Chemistry, Hlavova 2030, 128 40, Prague 2 (Czech Republic)

    2011-08-15

    Highlights: {yields} The magnesium and manganese borohydrides form a solid solution Mg{sub x}Mn{sub (1-x)}(BH{sub 4}){sub 2} (x = 0-0.8) which conserves the trigonal structure of Mn{sub (}(BH{sub 4}){sub 2}. {yields} Coexistence of both trigonal and hexagonal borohydrides occurs within nominal composition ranging from x{sub Mg} = 0.8-0.9. {yields} The decomposition temperature of trigonal Mg{sub x}Mn{sub (1-x)}(BH{sub 4}){sub 2} (x = 0-0.8) does not vary significantly with magnesium content (433-453 K). {yields} The desorbed gas contains mostly hydrogen and 3-7.5 mol.% of diborane B{sub 2}H{sub 6}. - Abstract: A solid solution of magnesium and manganese borohydrides was studied by in situ synchrotron radiation X-ray powder diffraction and infrared spectroscopy. A combination of thermogravimetry, mass and infrared spectroscopy, and atomic emission spectroscopy were applied to clarify the thermal gas desorption of pure Mn(BH{sub 4}){sub 2} and a solid solution of composition Mg{sub 0.5}Mn{sub 0.5}(BH{sub 4}){sub 2}. Mg{sub x}Mn{sub (1-x)}(BH{sub 4}){sub 2} (x = 0-0.8) conserves the trigonal structure of Mn(BH{sub 4}){sub 2} at room temperature. Manganese is dissolved in the hexagonal structure of {alpha}-Mg(BH{sub 4}){sub 2}, with the upper solubility limit not exceeding 10 mol.% at room temperature. There exists a two-phase region of trigonal and hexagonal borohydrides within the compositional range x = 0.8-0.9 at room temperature. Infrared spectra show splitting of various vibrational modes, indicating the presence of two cations in the trigonal Mg{sub x}Mn{sub (1-x)}(BH{sub 4}){sub 2} solid solutions, as well as the appearance of a second phase, hexagonal {alpha}-Mg(BH{sub 4}){sub 2}, at higher magnesium contents. All vibrational frequencies are shifted to higher values with increasing magnesium content. The decomposition temperature of the trigonal Mg{sub x}Mn{sub (1-x)}(BH{sub 4}){sub 2} (x = 0-0.8) does not vary significantly as a function of the magnesium

  11. 1,3-Di-4-pyridylpropane–4,4′-oxydibenzoic acid (1/1

    Directory of Open Access Journals (Sweden)

    Hirofumi Hinode

    2008-12-01

    Full Text Available The hydrothermal reaction of Cd(NO32·4H2O, 1,3-di-4-pyridylpropane (BPP and 4,4′-oxydibenzoic acid (OBA led to the formation of the title compound, C13H14N2·C14H10O5. The asymmetric unit consists of one molecule of OBA and one of BPP. In the OBA molecule, one COOH group is nearly planar with its attached benzene ring [dihedral angle = 0.9 (1°], while the other COOH group is slightly twisted with a dihedral angle of 10.8 (3°. The carboxyl groups form strong intermolecular O—H...N hydrogen bonds with N atoms of the pyridine rings in BPP, linking the molecules into zigzag chains.

  12. Evaluation of ferritic alloy Fe-2-1/4Cr-1Mo after neutron irradiation - microstructure development

    International Nuclear Information System (INIS)

    Gelles, D.S.

    1984-05-01

    Microstructural examinations are reported for nine specimen conditions of 2-1/4Cr-1Mo steel which had been irradiated by fast neutrons over the temperature range 390 to 510 0 C. Two heats of material were involved, each with a different preirradiation heat treatment, one irradiated to a peak fluence of 5.1 x 10 22 n/cm 2 (E > 0.1 MeV) or 24 dpa and the other to 2.4 x 10 23 n/cm 2 (E > 0.1 MeV) or 116 dpa. Void swelling is found following irradiation at 400 0 C in both conditions and to 480 0 C in the higher fluence conditions. Concurrently dislocation structure and precipitation formed. Peak void swelling, void density, dislocation density and precipitate number density developed at the lowest temperature, approx. 400 0 C, whereas mean void size, and mean precipitate size increased with increasing irradiation temperature. The examination results are used to provide interpretation of in-reactor creep, density change and post irradiation tensile behavior

  13. Study of the conduction phenomenon in the system Zn(1-x)FeCrO4Nix

    International Nuclear Information System (INIS)

    Zhou Yuan; Xia Yuanfu; Zhang Shiyuan; Chen Kunji

    1993-01-01

    In order to explore an 'anomalous' conduction phenomenon in the system Zn (1-x) FeCrO 4 Ni x which was investigated with Moessbauer spectra, X-rays diffraction, infrared spectra and other methods. The results show that the conductivity anomaly is not an intrinsic behavior but arises from the moisture-adsorption. Their native conduction is similar to that of semiconductors, obeying the relationship σ = σ ∝ exp (E a /KT). All samples crystallize in cubic symmetry and their lattice parameters increase with x. The cation distribution is (Zn (1-x) Fe x ) [Fe ( -1 -x) Ni x Cr]O 4 . No phase change occurs in the temperature range from 283 to 423 K

  14. The features of nucleophilic substitution of the nitro group in 4-alkyl-6-nitro-1,2,4-triazolo[5,1-c][1,2,4]triazines

    Directory of Open Access Journals (Sweden)

    E. N. Ulomsky

    2017-05-01

    Full Text Available The nucleophilic substitution of the nitro group of 4-alkyl-6-nitro-4,7-dihydro-1,2,4-triazolo[5,1-c][1,2,4]triazine-7-ones on the example of interactionwith morpholine was studied. It is established that under the action of excess cycloalkylimine at room temperature the unusual easy disclosure of triazine cycle with the formation of sterically hindered hydrazones occurs which are the key intermediates for further transformations. The carrying of reaction at elevated temperatures leads to the formation of products of substitution of the nitro group with the amine and also with morpholyl hydrazones which are the products of hydrolysis of amides of hydrazones and subsequent decarboxylation. Thus, the nucleophilic substitution of the nitro group in the described triazolotriazines flows through the ANRORC mechanism.

  15. Effect of applied bias voltage on corrosion-resistance for TiC{sub 1-x}N{sub x} and Ti{sub 1-x}Nb{sub x}C{sub 1-y}N{sub y} coatings

    Energy Technology Data Exchange (ETDEWEB)

    Caicedo, J.C., E-mail: Jcesarca@calima.univalle.edu.co [Department of Physics, Universidad del Valle, Ciudad Universitaria Melendez, A.A. 25360 Cali (Colombia); Department de Fisica Aplicada i Optica, Universitat de Barcelona, Catalunya (Spain); Amaya, C. [Department of Physics, Universidad del Valle, Ciudad Universitaria Melendez, A.A. 25360 Cali (Colombia); Laboratorio de Recubrimientos Duros DT-ASTIN SENA, Cali (Colombia); Yate, L. [Department de Fisica Aplicada i Optica, Universitat de Barcelona, Catalunya (Spain); Aperador, W.; Zambrano, G.; Gomez, M.E. [Department of Physics, Universidad del Valle, Ciudad Universitaria Melendez, A.A. 25360 Cali (Colombia); Alvarado-Rivera, J.; Munoz-Saldana, J. [Centro de Investigacion y de Estudios Avanzados del IPN, Unidad Queretaro (Mexico); Prieto, P. [Department of Physics, Universidad del Valle, Ciudad Universitaria Melendez, A.A. 25360 Cali (Colombia); Centro de Excelencia en Nuevos Materiales, Calle 13 100-00 Edificio 320, espacio 1026, Cali (Colombia)

    2010-02-15

    Corrosion-resistance behavior of titanium carbon nitride (Ti-C-N) and titanium niobium carbon nitride (Ti-Nb-C-N) coatings deposited onto Si(1 0 0) and AISI 4140 steel substrates via r.f. magnetron sputtering process was analyzed. The coatings in contact with a solution of sodium chloride at 3.5% were studied by Tafel polarization curves and impedance spectroscopy methods (EIS). Variations of the bias voltage were carried out for each series of deposition to observe the influence of this parameter upon the electrochemical properties of the coatings. The introduction of Nb in the ternary Ti-C-N film was evaluated via X-ray diffraction (XRD) analysis. The structure was characterized by using Raman spectroscopy to identify ternary and quaternary compounds. Surface corrosion processes were characterized using optical microscopy and scanning electron microscopy (SEM). XRD results show conformation of the quaternary phase, change in the strain of the film, and lattice parameter as the effect of the Nb inclusion. The main Raman bands were assigned to interstitial phases and 'impurities' of the coatings. Changes in Raman intensities were attributed to the incorporation of niobium in the Ti-C-N structure and possibly to resonance enhancement. Finally, the corrosion data obtained for Ti-C-N were compared with the results of corrosion tests of Ti-Nb-C-N coating. The results obtained showed that the incorporation of niobium to Ti-C-N coatings led to an increase in the corrosion-resistance. On another hand, an increase in the bias voltage led to a decrease in the corrosion-resistance for both Ti-C-N and Ti-Nb-C-N coatings.

  16. Structural, magnetic, and dielectric properties of multiferroic Co1-xMgxCr2O4 nanoparticles

    Science.gov (United States)

    Kamran, M.; Ullah, A.; Rahman, S.; Tahir, A.; Nadeem, K.; Anis ur Rehman, M.; Hussain, S.

    2017-07-01

    We examined the structural, magnetic, and dielectric properties of Co1-xMgxCr2O4 nanoparticles with composition x = 0, 0.2, 0.4, 0.5, 0.6, 0.8 and 1 in detail. X-ray diffraction (XRD) revealed normal spinel structure for all the samples. Rietveld refinement fitting results of the XRD showed no impurity phases which signifies the formation of single phase Co1-xMgxCr2O4 nanoparticles. The average crystallite size showed a peak behaviour with maxima at x = 0.6. Raman and Fourier transform infrared (FTIR) spectroscopy also confirmed the formation of single phase normal spinel for all the samples and exhibited dominant vibrational changes for x ≥ 0.6. For x = 0 (CoCr2O4), zero field cooled/field cooled (ZFC/FC) magnetization curves showed paramagnetic (PM) to ferrimagnetic (FiM) transition at Tc = 97 K and a conical spiral magnetic order at Ts = 30 K. The end members CoCr2O4 (x = 0) and MgCr2O4 (x = 1) are FiM and antiferromagnetic (AFM), respectively. Tc and Ts showed decreasing trend with increasing x, followed by an additional AFM transition at TN = 15 K for x = 0.6. The system finally stabilized and changed to highly frustrated AFM structure at x = 1 due to formation of pure MgCr2O4. High field FC curves (5T) depicted nearly no effect on spiral magnetic state, which is attributed to strong exchange B-B magnetic interactions at low temperatures. Dielectric parameters showed a non-monotonous behaviour with Mg concentration and were explained with the help of Maxwell-Wagner model and Koop's theory. Dielectric properties were improved for nanoparticles with x = 0.6 and is attributed to their larger average crystallite size. In summary, Mg doping has significantly affects the structural, magnetic, and dielectric properties of CoCr2O4 nanoparticles, which can be attributed to variations in local magnetic exchange interactions and variation in average crystallite size of these chromite nanoparticles.

  17. Crystallization behavior of (1 - x)Li2O.xNa2O.Al2O3.4SiO2 glasses

    International Nuclear Information System (INIS)

    Wang, Moo-Chin; Cheng, Chih-Wei; Chang, Kuo-Ming; Hsi, Chi-Shiung

    2010-01-01

    The crystallization behavior of the (1 - x)Li 2 O.xNa 2 O.Al 2 O 3 .4SiO 2 glasses has been investigated using X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), electron diffraction (ED) and energy dispersive spectroscopy (EDS). The crystalline phase was composed of β-spodumene. The isothermal crystallization kinetics of β-spodumene from the (1 - x)Li 2 O.xNa 2 O.Al 2 O 3 .4SiO 2 glasses has also been studied by a quantitative X-ray diffraction method. The activation energy of β-spodumene formation decreases from 359.2 to 317.8 kJ/mol when the Na 2 O content increases from 0 to 0.4 mol and it increases from 317.8 to 376.9 kJ/mol when the Na 2 O content increases from 0.4 to 0.6 mol. The surface nucleation and plate-like growth were dominant in the crystallization of the (1 - x)Li 2 O.xNa 2 O.Al 2 O 3 .4SiO 2 glasses.

  18. The dynamics of ammonium ions in K1-x(NH4)xCl mixed crystals by the neutron scattering study

    International Nuclear Information System (INIS)

    Smirnov, L.S.; Natkanets, I.; Shuvalov, L.A.; Dolbinina, V.V.

    2004-01-01

    The study of vibrational spectrum of the K 1-x (NH 4 ) x Cl mixed crystals in a dynamically disordered cubic α-phase at 10 K is carried out by means of inelastic incoherent neutron scattering on the NERA-PR time-of-flight spectrometer set at the IBR-2 reactor (JINR, Dubna). It is shown that low-energy modes of ammonium ions with the energies 19-23 and 62-63 cm -1 at 10 K are observed only within the disordered cubic α-phase and are absent in the ordered cubic δ-phase of NH 4 Cl. The energies of local translation and libration modes of ammonium ions are determined in the α- and δ-phases of the K 1-x (NH 4 ) x Cl mixed crystals

  19. Growth and characterization of polycrystalline Ge1-xCx by reactive pulsed laser deposition

    International Nuclear Information System (INIS)

    Hernandez, M.P.; Farias, M.H.; Castillon, F.F.; Diaz, Jesus A.; Avalos, M.; Ulloa, L.; Gallegos, J.A.; Yee-Madeiros, H.

    2011-01-01

    Polycrystalline thin films of Ge-C were grown on Si (1 1 1) substrates by means of reactive pulsed laser deposition with methane pressure of 100 mTorr. Effect substrate temperature, T s , on C incorporation to substitutional sites (x) in Ge 1-x C x was investigated systematically by X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS) analyzes. The substrate temperatures were ranging from 250 to 400 deg. C. The substitutional C composition x in the films by XRD were estimated using the Vegard's linear law. The maximum value of x calculated by XRD was 0.032 for T s of 350 deg. C. The position of the C 1s peak at 283.4 eV in the XPS spectrum confirmed the germanium-carbon alloys. XRD measurements indicated that x increased with T s from 250 deg. C to 350 deg. C. At T s = 400 deg. C, the estimation of x was lowered. However, the C content calculated by XPS analyzes increased with T s being more these values than substitutional C composition x. XPS and XRD analyzes demonstrate that the remaining C atoms are incorporated to interstitial sites. The use of the T s plays important roles in the incorporation of substitutional C and in restraining C-cluster formation in the reactive pulsed laser deposition growth of Ge-C/Si.

  20. 5-[(3-Fluorophenyl(2-hydroxy-6-oxocyclohex-1-en-1-ylmethyl]-6-hydroxy-1,3-dimethylpyrimidine-2,4(1H,3H-dione

    Directory of Open Access Journals (Sweden)

    Assem Barakat

    2016-09-01

    Full Text Available 5-[(3-Fluorophenyl(2-hydroxy-6-oxocyclohex-1-en-1-yl-methyl]-6-hydroxy-1,3-di-methylpyrimidine-2,4(1H,3H-dione 3 was synthesized via a multicomponent reaction. The Aldol–Michael addition reactions of N,N-dimethylbarbituric acid, cyclohexane-1,3-dione, and 3-fluorobenzaldehyde in aqueous solution gave the product in high yield. The molecular structure of the compound was confirmed by spectroscopic methods and X-ray crystallography. The title compound (C19H19FN2O5·H2O crystallizes in the Monoclinic form, P21/c, a = 7.8630 (5 Å, b = 20.0308 (13 Å, c = 11.3987 (8 Å, β = 104.274 (3°, V = 1739.9 (2° Å3, Z = 4, Rint = 0.117, wR(F2 = 0.124, T = 100 K.

  1. Epitaxial growth of bcc-Fe{sub x}Co{sub 100-x} thin films on MgO(1 1 0) single-crystal substrates

    Energy Technology Data Exchange (ETDEWEB)

    Ohtake, Mitsuru, E-mail: ohtake@futamoto.elect.chuo-u.ac.j [Faculty of Science and Engineering, Chuo University, 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551 (Japan); Nishiyama, Tsutomu; Shikada, Kouhei [Faculty of Science and Engineering, Chuo University, 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551 (Japan); Kirino, Fumiyoshi [Graduate School of Fine Arts, Tokyo National University of Fine Arts and Music, 12-8 Ueno-koen, Taito-ku, Tokyo 110-8714 (Japan); Futamoto, Masaaki [Faculty of Science and Engineering, Chuo University, 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551 (Japan)

    2010-07-15

    Fe{sub x}Co{sub 100-x} (x=100, 65, 50 at%) epitaxial thin films were prepared on MgO(1 1 0) single-crystal substrates heated at 300 deg. C by ultra-high vacuum molecular beam epitaxy. The film structure and the growth mechanism are discussed. FeCo(2 1 1) films with bcc structure grow epitaxially on MgO(1 1 0) substrates with two types of variants whose orientations are rotated around the film normal by 180 deg. each other for all compositions. Fe{sub x}Co{sub 100-x} film growth follows the Volmer Weber mode. X-ray diffraction analysis indicates the out-of-plane and the in-plane lattice spacings are in agreement with the values of respective bulk Fe{sub x}Co{sub 100-x} crystals with very small errors less than +-0.4%, suggesting the strains in the films are very small. High-resolution cross-sectional transmission electron microscopy shows that periodical misfit dislocations are preferentially introduced in the film at the Fe{sub 50}Co{sub 50}/MgO interface along the MgO[1 1-bar 0] direction. The presence of such periodical dislocations decreases the large lattice mismatch of about -17% existing at the FeCo/MgO interface along the MgO[1 1-bar 0] direction.

  2. Optical, Electrical and Photocatalytic Properties of the Ternary Semiconductors ZnxCd1-xS, CuxCd1-xS and CuxZn1-xS

    Directory of Open Access Journals (Sweden)

    Sandra Andrea Mayén-Hernández

    2014-01-01

    Full Text Available The effects of vacuum annealing at different temperatures on the optical, electrical and photocatalytic properties of polycrystalline and amorphous thin films of the ternary semiconductor alloys ZnxCd1-xS, CuxCd1-xS and CuxZn1-xS were investigated in stacks of binary semiconductors obtained by chemical bath deposition. The electrical properties were measured at room temperature using a four-contact probe in the Van der Pauw configuration. The energy band gap of the films varied from 2.30 to 2.85 eV. The photocatalytic activity of the semiconductor thin films was evaluated by the degradation of an aqueous methylene blue solution. The thin film of ZnxCd1-xS annealed under vacuum at 300°C exhibited the highest photocatalytic activity.

  3. The effect of Ni-doping on the magnetic order in the cubic GdIn(Cu{sub 1-x}Ni{sub x})4 (0.00 < x < 1.00) compounds

    Energy Technology Data Exchange (ETDEWEB)

    Mendonca, Edielma Costa; Silva, Leonardo Souza; Mercena, Samuel Gomes; Peixoto, Erilaine Barreto; Meneses, Cristiano Teles de, E-mail: edielmacm@gmail.com [Universidade Federal de Sergipe (UFS), Aracaju, SE (Brazil); Duque, Jose Gerivaldo; Jesus, Camilo Bruno Ramos; Pagliuso, Pascoal G. [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Fisica Gleb Wataghin

    2016-07-01

    Full text: In this work, we report on X-ray, magnetization, heat capacity and electron spin resonance measurements in GdIn(Ni{sub x}Cu{sub 1-x}){sub 4} (0.00 < x < 1.00) samples synthesized via flux method. The analysis of X-ray powder diffraction data carried out at room temperature reveal that all samples belong to cubic space group (Cl5b-type structure) with lattice parameters ranging 7.087 < a < 7.233 Å. Interestingly, the T-dependence of magnetic susceptibility and the MvsH loops indicate an gradual transition from antiferromagnetic to ferromagnetic as function the Ni-doping. Specific heat for samples with concentrations x = 0 (Cu-rich) and x = 0.70 and 0.90 (Ni-rich) confirm the order temperatures observed in MvsT data. Finally, electron spin resonance taken in 10 < T < 60 K for two intermediate concentrations x = 0.5 and 0.65 shows a single resonance of Dysonian with a nearly temperature g-independent and a linear thermal broadening of the linewidth following a Korringa-like behavior. In both cases, we observe an increasing of the residual linewidth as compared with GdInCu{sub 4}. We suggest that this can be linked with the chemical disorder produced by the Ni-doping. (author)

  4. K,L X-rays production cross sections for 1H and 4He

    International Nuclear Information System (INIS)

    Heitz, C.; Costa, G.J.; Cailleret, J.; Lagarde, G.

    1982-01-01

    Experimental X-ray production cross sections are tabulated for 1 H and 4 He projectiles. In the case of K X-rays, a comparison with theoretical values is also performed in view of applications, such a PIXE analysis [fr

  5. Dicty_cDB: Contig-U15861-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lmmnkakldyticdnegtpaihiaaasnniplitmllkgsdarvsirdqhgntplh lfvqknvslncediinklie... X70831 ) C.elegans IFA3 gene for intermediate filament protein. 46 7.1 1 ( AC181799 ) Strongylocentrotus pu... ) 1095439023029 Global-Ocean-Sampling_GS-26-01-01-1... 40 0.071 2 ( CR936240 ) Z... 0.85 9 ( EJ288041 ) 1095370001506 Global-Ocean-Sampling_GS-27-01-01-1... 42 0.95 2 ( AY242996 ) Antheraea p...2996300114 Global-Ocean-Sampling_GS-31-01-01-1... 36 4.7 3 ( AL407498 ) T3 end of clone AV0AA001F06 of li

  6. a-SixC1x:H thin films with subnanometer surface roughness for biological applications

    International Nuclear Information System (INIS)

    Herrera-Celis, José; Reyes-Betanzo, Claudia; Itzmoyotl-Toxqui, Adrián; Orduña-Díaz, Abdu; Pérez-Coyotl, Ana

    2015-01-01

    The characterization of a-Si x C 1x :H thin films by plasma-enhanced chemical vapor deposition with high hydrogen dilution for biological applications is addressed. A root mean square roughness less than 1 nm was measured via atomic force microscopy for an area of 25 μm 2 . Structural analysis was done using Fourier transform infrared spectroscopy in the middle infrared region. It was found that under the deposition conditions, the formation of Si–C bonds is promoted. Electrical dark conductivity measurements were performed to evaluate the effect of high hydrogen dilution and to find the relation between carrier transport properties and the structural arrangement. Conductivities of the order of 10 −7 to 10 −9 S/cm at room temperature for methane–silane gas flow ratio from 0.35 to 0.85 were achieved, respectively. UV-visible spectra were used to obtain the optical band gap and the Tauc parameter. Optical band gap as wide as 3.55 eV was achieved in the regime of high carbon incorporation. Accordingly, deposition under low power density and high hydrogen dilution reduces the roughness, improves the structure of the network, and stabilizes the film properties as a greater percentage of carbon is incorporated. The biofunctionalization of a-Si x C 1x :H surfaces with NH 2 -terminated self-assembled monolayers was obtained through silanization with 3-aminopropyltrimethoxysilane. This knowledge opens a window for the inclusion of these a-Si x C 1x :H thin films in devices such as biosensors

  7. Crystallisation kinetics of amorphous Fe{sub 72.5-x}Cu{sub 1}Nb{sub 4.5}Si{sub 10+x+y}B{sub 12-y} alloy

    Energy Technology Data Exchange (ETDEWEB)

    Miglierini, M. [Komenskeho Univ., Bratislava (Czechoslovakia). Dept. of Nuclear Physics and Technics; Lipka, J. [Komenskeho Univ., Bratislava (Czechoslovakia). Dept. of Nuclear Physics and Technics; Sitek, J. [Komenskeho Univ., Bratislava (Czechoslovakia). Dept. of Nuclear Physics and Technics

    1994-11-01

    Fe{sub 73.5}Cu{sub 1}Nb{sub 3}Si{sub 13.5}B{sub 9} and Fe{sub 72.5-x}Cu{sub 1}Nb{sub 4.5}Si{sub 10+x+y}B{sub 12-y} alloys are compared from the point of view of crystallisation behaviour and changes in the short-range order in the amorphous reminder. The increase in Nb to 4.5 at.% in the latter system slows down the formation of nanocrystals to approximately 40% even after 16 hours of anneal at 550 C for x = 0.5, y = 3. Segregation-induced changes in the short-range order are manifested via hyperfine field distributions corresponding to the amorphous reminder. (orig.)

  8. 4,4′-([4,4′-Bipyridine]-1,1′-diium-1,1′-diyldibenzoate dihydrate

    Directory of Open Access Journals (Sweden)

    Mark A. Rodriguez

    2016-06-01

    Full Text Available We report here the synthesis of a neutral viologen derivative, C24H16N2O4·2H2O. The non-solvent portion of the structure (Z-Lig is a zwitterion, consisting of two positively charged pyridinium cations and two negatively charged carboxylate anions. The carboxylate group is almost coplanar [dihedral angle = 2.04 (11°] with the benzene ring, whereas the dihedral angle between pyridine and benzene rings is 46.28 (5°. The Z-Lig molecule is positioned on a center of inversion (Fig. 1. The presence of the twofold axis perpendicular to the c-glide plane in space group C2/c generates a screw-axis parallel to the b axis that is shifted from the origin by 1/4 in the a and c directions. This screw-axis replicates the molecule (and solvent water molecules through space. The Z-Lig molecule links to adjacent molecules via O—H...O hydrogen bonds involving solvent water molecules as well as intermolecular C—H...O interactions. There are also π–π interactions between benzene rings on adjacent molecules.

  9. A comparative structural and electrochemical study of monoclinic Li3V2(PO4)3/C and rhombohedral Li2.5Na0.5V(2−2x/3)Nix(PO4)3/C

    International Nuclear Information System (INIS)

    Wang, Wenhui; Chen, Zhenyu; Zhang, Jiaolong; Dai, Changsong; Li, Jiajie; Ji, Dalong

    2013-01-01

    In order to synthesize pure derivative of rhombohedral Li 3 V 2 (PO 4 ) 3 (LVP), lithium-ion batteries materials Li 2.5 Na 0.5 V (2−2x/3) Ni x (PO 4 ) 3 /C (x = 0.03, 0.06, 0.09) and its control, monoclinic Li 3 V 2 (PO 4 ) 3 /C (LVP/C), were prepared by sol–gel method. The samples were investigated by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) spectroscopy, scanning electron microscopy (SEM), Raman spectroscopy, and electrochemical methods. The XRD patterns of Li 2.5 Na 0.5 V (2−2x/3) Ni x (PO 4 ) 3 /C are in good agreement with that of rhombohedral LVP, which indicates that the Na + –Ni 2+ composite doping can change the structure of monoclinic LVP. All the composite doping samples displayed a single flat plateau at 3.7 V in the charge/discharge voltage profile, which is caused by transformation of multi-phase mechanism to single-phase mechanism. For Li 2.5 Na 0.5 V 1.98 Ni 0.03 (PO 4 ) 3 /C, a specific discharge capacity of 108 mAh g −1 was achieved at a 0.5 C charge rate and a 1 C discharge rate, and a 99.0% retention rate of the initial capacity was obtained after 50 cycles

  10. Study on "1"4C content in post-irradiation graphite spheres of HTR-10

    International Nuclear Information System (INIS)

    Wang Shouang; Pi Yue; Xie Feng; Li Hong; Cao Jianzhu

    2014-01-01

    Since the production mechanism of the "1"4C in spherical fuel elements was similar to that of fuel-free graphite spheres, in order to obtain the amount of "1"4C in fuel elements and graphite spheres of HTR-10, the production mechanism of the "1"4C in graphite spheres was studied. The production sources of the "1"4C in graphite spheres and fuel elements were summarized, the amount of "1"4C in the post-irradiation graphite spheres was calculated, the decomposition techniques of graphite spheres were compared, and experimental methods for decomposing the graphite spheres and preparing the "1"4C sample were proposed. The results can lay the foundation for further experimental research and provide theoretical calculations for comparison. (authors)

  11. Molecular Structures, Vibrational Spectroscopy, and Normal-Mode Analysis of M(2)(C&tbd1;CR)(4)(PMe(3))(4) Dimetallatetraynes. Observation of Strongly Mixed Metal-Metal and Metal-Ligand Vibrational Modes.

    Science.gov (United States)

    John, Kevin D.; Miskowski, Vincent M.; Vance, Michael A.; Dallinger, Richard F.; Wang, Louis C.; Geib, Steven J.; Hopkins, Michael D.

    1998-12-28

    The nature of the skeletal vibrational modes of complexes of the type M(2)(C&tbd1;CR)(4)(PMe(3))(4) (M = Mo, W; R = H, Me, Bu(t)(), SiMe(3)) has been deduced. Metrical data from X-ray crystallographic studies of Mo(2)(C&tbd1;CR)(4)(PMe(3))(4) (R = Me, Bu(t)(), SiMe(3)) and W(2)(C&tbd1;CMe)(4)(PMe(3))(4) reveal that the core bond distances and angles are within normal ranges and do not differ in a statistically significant way as a function of the alkynyl substituent, indicating that their associated force constants should be similarly invariant among these compounds. The crystal structures of Mo(2)(C&tbd1;CSiMe(3))(4)(PMe(3))(4) and Mo(2)(C&tbd1;CBu(t)())(4)(PMe(3))(4) are complicated by 3-fold disorder of the Mo(2) unit within apparently ordered ligand arrays. Resonance-Raman spectra ((1)(delta-->delta) excitation, THF solution) of Mo(2)(C&tbd1;CSiMe(3))(4)(PMe(3))(4) and its isotopomers (PMe(3)-d(9), C&tbd1;CSiMe(3)-d(9), (13)C&tbd1;(13)CSiMe(3)) exhibit resonance-enhanced bands due to a(1)-symmetry fundamentals (nu(a) = 362, nu(b) = 397, nu(c) = 254 cm(-)(1) for the natural-abundance complex) and their overtones and combinations. The frequencies and relative intensities of the fundamentals are highly sensitive to isotopic substitution of the C&tbd1;CSiMe(3) ligands, but are insensitive to deuteration of the PMe(3) ligands. Nonresonance-Raman spectra (FT-Raman, 1064 nm excitation, crystalline samples) for the Mo(2)(C&tbd1;CSiMe(3))(4)(PMe(3))(4) compounds and for Mo(2)(C&tbd1;CR)(4)(PMe(3))(4) (R = H, D, Me, Bu(t)(), SiMe(3)) and W(2)(C&tbd1;CMe)(4)(PMe(3))(4) exhibit nu(a), nu(b), and nu(c) and numerous bands due to alkynyl- and phosphine-localized modes, the latter of which are assigned by comparisons to FT-Raman spectra of Mo(2)X(4)L(4) (X = Cl, Br, I; L = PMe(3), PMe(3)-d(9))(4) and Mo(2)Cl(4)(AsMe(3))(4). Valence force-field normal-coordinate calculations on the model compound Mo(2)(C&tbd1;CH)(4)P(4), using core force constants transferred from a calculation

  12. Some of Physical Properties of Nanostructured (Mg1-xCoxFe2O4 Ferrites Prepared by Sol-Gel Method

    Directory of Open Access Journals (Sweden)

    Muhammad Abdul Ammer Alsherefi

    2018-01-01

    Full Text Available Sol-gel auto combustion technique was used to prepare nanoparticles of magnesium-cobalt ferrites with the chemical formula Mg1-xCoxFe2O4 for  (x=0, 0.2, 0.4, 0.6, 0.8, 1, where x added as weight  percentages, and sintering  at temperature (1100 oC. The X-ray patterns of prepared powder has confirmed the structure of cubic spinel structure (fcc. The prepared samples were composed of nearly spherical nano particles .An average particle size of  magnesium-cobalt ferrite  were  calculated  using  Debye Scherer’s relation is equal 53.12 nm. The surface structure of the samples was investigated by Scanning Electron Microscope(SEM. The electromagnetic properties for prepared samples were investigated using Vector Network Analyzer (VNA in X-band microwave region.

  13. Irreversibility Curve on Y1xLuxBa2Cu3O7–δ (x=0.4, 0.5 and 0.6) superconducting

    International Nuclear Information System (INIS)

    Grimaldos, J F Cepeda; Supelano G, I; Santos, A Sarmiento; Chiquillo, M V; Martínez B, D; Vargas, C A Parra

    2014-01-01

    The irreversibility line in the H–T plane divides the irreversible and reversible behaviour of the magnetization which is of importance for the characterization of high T c superconductors. In this work, we report the production of Y 1X Lu X Ba 2 Cu 3 O 7–δ (X=0.4, 0.5 and 0.6) superconducting system using the usual solid state reaction method. The irreversibility line H–T plane for the Y 1X Lu X Ba 2 Cu 3 O 7–δ polycrystalline sample was investigated. The curves of magnetization ZFC (cero field cooled)- FC (field cooled) were measured in magnetic fields between 100 Oe and 4000 Oe, and allowed to obtain the values for irreversibility and critical temperatures

  14. Production and characterization of a murine monoclonal IgM antibody to human C1q receptor (C1qR)

    International Nuclear Information System (INIS)

    Ghebrehiwet, B.

    1986-01-01

    A hybridoma cell line that produces a monoclonal antibody (MAb) to cell surface C1q receptor (C1qr) has been produced by fusion of the P3 x 63-Ag8.653 mouse myeloma cell line with the spleen cells of a CD-1 mouse that had been hyperimmunized with viable Raji cell suspensions (5 x 10 7 cells/inoculum). This MAb, designated II1/D1, is an IgM antibody with lambda-light chain specificity. Radiolabeled or unlabeled, highly purified II1/D1 was used to determine that: a) this antibody competes for C1q binding sites on C1qR-bearing cells; b) the molecule recognized by this MAb is the C1qR; and c) cells that are known to bind C1q also bind II1/D1 in a specific manner. Western blot analysis of solubilized Raji, or U937 cell membranes, showed that the 125 I-MAb detected a major protein band of approximately 85000 m.w. in its unreduced state, indicating that the C1qR is similar, if not identical, in both types of cells. Analyses of 125 I-II/D1 binding experiments revealed that the antibody bound to Raji cells or u937 cells in a specific manner. Uptake of the antibody was saturable, with equilibrium virtually attained within 35 min. Scatchard analysis of the binding data using the intact MAb suggests that the affinity constant K/sub D/ is 2.9 x 10 -10 M, and at apparent saturation, 24.6 ng of the antibody were bound per 2 x 10 6 cells, giving an estimated 7.8 x 10 3 antibody molecules bound per cell. That the II1/D1 antibody is specifically directed to the C1q was further evidenced by an ELISA in which the ability of C1qR-bearing cells to bind the MAb was abrogated by c-C1q in a specific dose-dependent manner

  15. Electrical properties of Be-implanted GaAssub(1-x)Psub(x)

    International Nuclear Information System (INIS)

    Chatterjee, P.K.; McLevige, W.V.; Streetman, B.G.

    1976-01-01

    Hall effect and resistivity measurements on Be implanted GaAssub(1-x)Psub(x)(x approximately 0.38) indicate that essentially 100% doping efficiency may be obtained for normal Be concentrations after a 900 0 C anneal using either SiO 2 or Si 3 N 4 as an encapsulant. The temperature dependence of hole mobility in these samples exhibits impurity banding effects similar to those reported in heavily Zn doped GaAs. Hall effect measurements in conjunction with successive thin layer removal techniques indicate there is no significant diffusion of the implanted Be during anneal for a fluence of 6 x 10 13 ions/cm 2 . (author)

  16. Study of TiO2(1 1 0)-p(1x1), p(1x2) and p(1x3) surface structures by impact collision ion scattering spectroscopy (ICISS)

    International Nuclear Information System (INIS)

    Asari, E.; Souda, R.

    2000-01-01

    The surface structure of TiO 2 (1 1 0)-p(1x1), p(1x2) and p(1x3) were studied using impact collision ion scattering spectroscopy (ICISS). We found that (i) the height of bridging oxygen for the p(1x1) is comparative to that of bulk structure, (ii) the p(1x2) surface has the added Ti 2 O 3 unit rows proposed by Onishi et al. and also the oxygen atoms rows between Ti 2 O 3 unit rows and (iii) the p(1x3) surface is constructed with the same added Ti 2 O 3 unit rows as that in the p(1x2) surface, but the bridging oxygen rows exist between the Ti 2 O 3 unit rows

  17. Structural, magnetic and transport properties of Pb{sub 2}Cr{sub 1+x}Mo{sub 1x}O{sub 6} (−1≤x≤1/3)

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, H.F. [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); School of Mathematics and Physics, University of Science and Technology, Beijing 100083 (China); Cao, L.P. [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Song, Y.J. [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); School of Mathematics and Physics, University of Science and Technology, Beijing 100083 (China); Feng, S.M.; Shen, X. [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Ni, X.D. [School of Mathematics and Physics, University of Science and Technology, Beijing 100083 (China); Yao, Y.; Wang, Y.G. [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Wang, R.M. [School of Mathematics and Physics, University of Science and Technology, Beijing 100083 (China); Jin, C.Q. [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Yu, R.C., E-mail: rcyu@aphy.iphy.ac.cn [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China)

    2017-02-15

    Pb{sub 2}Cr{sub 1+x}Mo{sub 1-x}O{sub 6} (−1≤x≤1/3) samples were synthesized via a high pressure and high temperature route. X-ray diffraction results suggest the samples crystallize in a disordered double perovskite structure (Pm-3m). X-ray photoemission spectroscopy results confirm the presence of Mo{sup 4+} for x=−1 and Mo{sup 6+} for x=1/3. The measured magnetic and electrical properties exhibit systematic change with increasing x. - Highlights: • A series of Pb{sub 2}Cr{sub 1+x}Mo{sub 1x}O{sub 6} samples were synthesized under high pressure. • Magnetic and electrical properties of the series samples were investigated. • Valence states of Cr and Mo were determined through the analyses of XRD and XPS results. • Ground state of PbMoO{sub 3} were determined through the transport study and first-principles calculations.

  18. Magnetism in ordered metallic perovskite compound GdPd{sub 3}B{sub x}C{sub 1-x}

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, Abhishek [S.N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Experimental Condensed Matter Physics Division, Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700064 (India)], E-mail: abhishek.phy@gmail.com; Mazumdar, Chandan [Experimental Condensed Matter Physics Division, Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700064 (India)], E-mail: chandan.mazumdar@saha.ac.in; Ranganathan, R. [Experimental Condensed Matter Physics Division, Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700064 (India); Dattagupta, S. [Indian Institute of Science Education and Research, Block-HC, Sector-III, Salt Lake, Kolkata 700106 (India)

    2009-08-15

    We report results of dc-magnetization, ac-susceptibility and magnetoresistance measurements on crystalline metallic-perovskite compounds GdPd{sub 3}B{sub x}C{sub 1-x} (x=0.25, 0.50, 0.75 and 1.00) and the parent cubic compound GdPd{sub 3}. The interest in these materials stems from the observation of negative temperature coefficient of resistance and negative thermal expansion in some of the members of this series. In the present study, we show that by substitution of non-magnetic elements, boron and carbon, the nature of the magnetic interaction can be varied from dominating ferromagnetic to antiferromagnetic and finally to a canted magnetic structure without altering the crystal symmetry of the compounds. The variation of magnetic interaction by modifying the lattice parameter resembles Ruderman-Kittel-Kasuya-Yosida (RKKY) oscillations.

  19. High strain rate tensile properties of annealed 2 1/4 Cr--1 Mo steel

    International Nuclear Information System (INIS)

    Klueh, R.L.; Oakes, R.E. Jr.

    1975-01-01

    The high strain rate tensile properties of annealed 2 1 / 4 Cr-1 Mo steel were determined and the tensile behavior from 25 to 566 0 C and strain rates of 2.67 x 10 -6 to 144/s were described. Above 0.1/s at 25 0 C, both the yield stress and the ultimate tensile strength increased rapidly with increasing strain rate. As the temperature was increased, a dynamic strain aging peak appeared in the ultimate tensile strength-temperature curves. The peak height was a maximum at about 350 0 C and 2.67 x 10 -6 /s. With increasing strain rate, a peak of decreased height occurred at progressively higher temperatures. The major effect of strain rate on ductility occurred at elevated temperatures, where a decrease in strain rate caused an increase in total elongation and reduction in area

  20. Interfacial hydrothermal synthesis of nanorod-like CdMo{sub 1x}W{sub x}O{sub 4} solid solutions with enhanced photocatalytic performance

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Linrui, E-mail: houlr629@163.com; Lian, Lin; Zhang, Longhai; Zhou, Lu; Yuan, Changzhou, E-mail: ayuancz@163.com

    2014-12-15

    In the work, CdMo{sub 1x}W{sub x}O{sub 4} solid solutions with various compositions in the entire range of 0 ≤ x ≤ 1 have been prepared successfully by a facile interfacial hydrothermal method. All CdMo{sub 1x}W{sub x}O{sub 4} products are composed of one-dimensional (1D) nanorods (NRs) with tetragonal structure. The composition-dependent structure, absorption properties and photocatalytic efficiencies of the resulting 1D CdMo{sub 1x}W{sub x}O{sub 4} samples are systematically investigated. The photocatalytic degradation of methylene blue (MB) under ultraviolet (UV) light irradiation was utilized as a model reaction to evaluate the photocatalytic activities of all the samples. The sample, CdMo{sub 0.5}W{sub 0.5}O{sub 4} (i.e., x = 0.5) NRs, exhibits the highest photocatalytic activity and appealing stability for widespread photocatalytic application, owing to the unique 1D nanoscale architecture, suitable band gap and strong absorption in the UV region. Our approach developed here provides an elegant technique to tune both the nanoarchitecture and band gap of the photocatalysts by simply adjusting the composition of the solid solutions, resulting in the enhanced photocatalytic activity. Moreover, the method we proposed can be further extended to the smart design and controllable synthesis of other novel and highly efficient multi-component photocatalysts for environmental remediation. - Graphical abstract: 1D nanorod-based CdMo{sub 1x}W{sub x}O{sub 4} solid solutions with various W compositions in the entire range of 0 ≤ x ≤ 1 were fabricated by a facile interfacial hydrothermal strategy, and exhibited intriguing photodecomposition of the MB under UV light irradiation. - Highlights: • CdMo{sub 1x}W{sub x}O{sub 4} solid solutions with W compositions of 0 ≤ x ≤ 1 were prepared. • Facile interfacial hydrothermal strategy was developed. • 1D nanorod-based CdMo{sub 1x}W{sub x}O{sub 4} photocatalysts were synthesized.

  1. Structural and magnetic properties of Mg-Zn ferrites (Mg{sub 1x}Zn{sub x}Fe{sub 2}O{sub 4}) prepared by sol-gel method

    Energy Technology Data Exchange (ETDEWEB)

    Reyes-Rodríguez, Pamela Yajaira, E-mail: pamela2244_4@hotmail.com [Cinvestav-Unidad Saltillo, Av. Industrial Metalúrgica #1062, Parque Industrial Saltillo-Ramos Arizpe, CP 25900, México (Mexico); Cortés-Hernández, Dora Alicia; Escobedo-Bocardo, José Concepción; Almanza-Robles, José Manuel; Sánchez-Fuentes, Héctor Javier; Jasso-Terán, Argentina; De León-Prado, Laura Elena [Cinvestav-Unidad Saltillo, Av. Industrial Metalúrgica #1062, Parque Industrial Saltillo-Ramos Arizpe, CP 25900, México (Mexico); Méndez-Nonell, Juan [Centro de Investigación en Materiales Avanzados, Ave. Miguel Cervantes #120, Complejo Industrial Chihuahua, CP 31109 Chihuahua, México (Mexico); Hurtado-López, Gilberto Francisco [Centro de Investigación en Química Aplicada, Blvd. Enrique Reyna Hermosillo #140, CP 25294 Saltillo, Coahuila, México (Mexico)

    2017-04-01

    In this study, the Mg{sub 1x}Zn{sub x}Fe{sub 2}O{sub 4} nanoparticles (x=0–0.9) were prepared by sol-gel method. These ferrites exhibit an inverse spinel structure and the lattice parameter increases as the substitution of Zn{sup 2+} ions is increased. At lower Zn content (0.1≤x≤0.5), saturation magnetization (Ms) increases, while it decreases at higher Zn content (x≥6). The remnant magnetization (0.17–2.0 emu/g) and coercive field (6.0–60 Oe) indicate a ferrimagnetic behavior. The average core diameter of selected ferrites is around 15 nm and the nanoparticles morphology is quasi spherical. The heating ability of some Mg{sub 0.9}Zn{sub 0.1}Fe{sub 2}O{sub 4} and Mg{sub 0.7}Zn{sub 0.3}Fe{sub 2}O{sub 4} aqueous suspensions indicates that the magnetic nanoparticles can increase the medium temperature up to 42 °C in a time less than 10 min - Highlights: • Magnetic nanoparticles of Mg{sub 1x}Zn{sub x}Fe{sub 2}O{sub 4} were synthesized by sol-gel method. • Nanoparticles showing a single spinel crystalline structure were obtained. • Aqueous suspensions of Mg{sub 0.7}Zn{sub 0.3}Fe{sub 2}O{sub 4} and Mg{sub 0.9}Zn{sub 0.1}Fe{sub 2}O{sub 4} show heating ability.

  2. Electrical conductivity, differential scanning calorimetry, X-ray diffraction, and 7Li nuclear magnetic resonance studies of n-C x H(2 x+1)OSO3Li ( x = 12, 14, 16, 18, and 20)

    Science.gov (United States)

    Hirakawa, Satoru; Morimoto, Yoshiaki; Honda, Hisashi

    2015-04-01

    Electrical conductivity ( σ), differential scanning calorimetry (DSC), and X-ray diffraction (XRD) measurements of n-C x H (2 x+1) OSO 3Li ( x= 12, 14, 16, 18, and 20) crystals were performed as a function of temperature. In addition, σ, DSC, and XRD observations of n-C x H (2 x+1) OSO 3Na and n-C x H (2 x+1) OSO 3K ( x= 12, 14, 16, 18, and 20) crystals were carried out for comparison. DSC results of the salts revealed several solid-solid phase transitions with large entropy changes (Δ S). For n-C 18 H 37 OSO 3Li and n-C 20 H 41 OSO 3Li salts, each melting point produced a small Δ S mp value compared with the total entropy change in the solid phases (Δ S tr1+Δ S tr2). Additionally, Li + ion diffusion was detected in the highest temperature solid phases. For K salts, larger σ values were detected for potassium alkylsulfates compared with those reported for alkyl carboxylate. 7Li NMR spectra of n-C 18 H 37 OSO 3Li crystals recorded in the low-temperature phase showed large asymmetry parameters, suggesting the Li + ions are localized at asymmetric sites in the crystals.

  3. Reaction of the C2H radical with 1-butyne (C4H6): Low Temperature Kinetics and Isomer-Specific Product Detection

    Energy Technology Data Exchange (ETDEWEB)

    Soorkia, Satchin; Trevitt, Adam J.; Selby, Talitha M.; Osborn, David L.; Taatjes, Craig A.; Wilson, Kevin R.; Leone, Stephen R.

    2009-12-22

    The rate coefficient for the reaction of the ethynyl radical (C{sub 2}H) with 1-butyne (H-C{triple_bond}C-CH{sub 2}-CH{sub 3}) is measured in a pulsed Laval nozzle apparatus. Ethynyl radicals are formed by laser photolysis of acetylene (C{sub 2}H{sub 2}) at 193 nm and detected via chemiluminescence (C{sub 2}H + O{sub 2} {yields} CH (A{sup 2}{Delta}) + CO{sub 2}). The rate coefficients are measured over the temperature range of 74-295 K. The C{sub 2}H + 1-butyne reaction exhibits no barrier and occurs with rate constants close to the collision limit. The temperature dependent rate coefficients can be fit within experimental uncertainties by the expression k = (2.4 {+-} 0.5) x 10{sup -10} (T/295 K)-(0.04 {+-} 0.03) cm{sup 3} molecule{sup -1}s{sup -1}. Reaction products are detected at room temperature (295 K) and 533 Pa using a Multiplexed Photoionization Mass Spectrometer (MPIMS) coupled to the tunable VUV synchrotron radiation from the Advanced Light Source at the Lawrence Berkeley National Laboratory. Two product channels are identified for this reaction: m/z = 64 (C{sub 5}H{sub 4}) and m/z = 78 (C{sub 6}H{sub 6}) corresponding to the CH{sub 3}- and H-loss channels, respectively. Photoionization efficiency (PIE) curves are used to analyze the isomeric composition of both product channels. The C{sub 5}H{sub 4} products are found to be exclusively linear isomers composed of ethynylallene and methyldiacetylene in a 4:1 ratio. In contrast, the C{sub 6}H{sub 6} product channel includes two cyclic isomers, fulvene 18({+-}5)% and 3,4-dimethylenecyclobut-1-ene 32({+-}8)%, as well as three linear isomers, 2-ethynyl-1,3-butadiene 8({+-}5)%, 3,4-hexadiene-1-yne 28({+-}8)% and 1,3-hexadiyne 14({+-}5)%. Within experimental uncertainties, we do not see appreciable amounts of benzene and an upper limit of 10% is estimated. Diacetylene (C{sub 4}H{sub 2}) formation via the C{sub 2}H{sub 5}-loss channel is also thermodynamically possible but cannot be observed due to experimental

  4. Characterization of thin films of the solid electrolyte Li(x)Mg(1-2x)Al(2+x)O4 (x = 0, 0.05, 0.15, 0.25).

    Science.gov (United States)

    Put, Brecht; Vereecken, Philippe M; Mees, Maarten J; Rosciano, Fabio; Radu, Iuliana P; Stesmans, Andre

    2015-11-21

    RF-sputtered thin films of spinel Li(x)Mg(1-2x)Al(2+x)O4 were investigated for use as solid electrolyte. The usage of this material can enable the fabrication of a lattice matched battery stack, which is predicted to lead to superior battery performance. Spinel Li(x)Mg(1-2x)Al(2+x)O4 thin films, with stoichiometry (x) ranging between 0 and 0.25, were formed after a crystallization anneal as shown by X-ray diffraction and transmission electron microscopy. The stoichiometry of the films was evaluated by elastic recoil detection and Rutherford backscattering and found to be slightly aluminum rich. The excellent electronic insulation properties were confirmed by both current-voltage measurements as well as by copper plating tests. The electrochemical stability window of the material was probed using cyclic voltammetry. Lithium plating and stripping was observed together with the formation of a Li-Pt alloy, indicating that Li-ions passed through the film. This observation contradicted with impedance measurements at open circuit potential, which showed no apparent Li-ion conductivity of the film. Impedance spectroscopy as a function of potential showed the occurrence of Li-ion intercalation into the Li(x)Mg(1-2x)Al(2+x)O4 layers. When incorporating Li-ions in the material the ionic conductivity can be increased by 3 orders of magnitude. Therefore it is anticipated that the response of Li(x)Mg(1-2x)Al(2+x)O4 is more adequate for a buffer layer than as the solid electrolyte.

  5. Magnetic properties of magnetic Co1-xMgxFe2O4 spinel by HTSE method

    International Nuclear Information System (INIS)

    Hamedoun, M.; Benyoussef, A.; Bousmina, M.

    2011-01-01

    Magnetic properties and exchange-coupling interactions of diluted magnetic spinels A 1-x A' x B 2 X 4 , where A and B are magnetic ions, namely Co 1-x Mg x Fe 2 O 4 , were investigated using the high-temperature series expansion method (HTSE) and the distribution method of magnetic cations in the range 0≤x≤1. The magnetic phase diagram and transition temperature versus dilution x were determined using the Pade approximants method along with HTSE. The critical exponent associated with the magnetic susceptibility γ was then deduced. The obtained results are in good agreement with experimental results and critical exponent values are consistent with those suggested by the universality hypothesis.

  6. Measurement of the Deuteron Spin Structure Function g_1^d(x) for 1 (GeV/c)^2 < Q^2 < 40 (GeV/c)^2

    OpenAIRE

    E155 Collaboration

    1999-01-01

    New measurements are reported on the deuteron spin structure function g_1^d. These results were obtained from deep inelastic scattering of 48.3 GeV electrons on polarized deuterons in the kinematic range 0.01 < x < 0.9 and 1 < Q^2 < 40 (GeV/c)^2. These are the first high dose electron scattering data obtained using lithium deuteride (6Li2H) as the target material. Extrapolations of the data were performed to obtain moments of g_1^d, including Gamma_1^d, and the net quark polarization Delta Si...

  7. Measurement of the deuteron spin structure function $g^{d}_1(x)$ for $1\\ (GeV/c)^2 < Q^2 < 40\\ (GeV/c)^2$.

    OpenAIRE

    Anthony , P.L.; Arnold , R.G.; Averett , T.; Band , H.R.; Berisso , M.C.; Borel , H.; Bosted , P.E.; Bultmann , S.L.; Buenerd , M.; Chupp , T.; Churchwell , S.; Court , G.R.; Crabb , D.; Day , D.; Decowski , P.

    1999-01-01

    New measurements are reported on the deuteron spin structure function g_1^d. These results were obtained from deep inelastic scattering of 48.3 GeV electrons on polarized deuterons in the kinematic range 0.01 < x < 0.9 and 1 < Q^2 < 40 (GeV/c)^2. These are the first high dose electron scattering data obtained using lithium deuteride (6Li2H) as the target material. Extrapolations of the data were performed to obtain moments of g_1^d, including Gamma_1^d, and the net quark polarization Delta Si...

  8. Magnetism in ordered metallic perovskite compound GdPd3BxC1-x

    International Nuclear Information System (INIS)

    Pandey, Abhishek; Mazumdar, Chandan; Ranganathan, R.; Dattagupta, S.

    2009-01-01

    We report results of dc-magnetization, ac-susceptibility and magnetoresistance measurements on crystalline metallic-perovskite compounds GdPd 3 B x C 1-x (x=0.25, 0.50, 0.75 and 1.00) and the parent cubic compound GdPd 3 . The interest in these materials stems from the observation of negative temperature coefficient of resistance and negative thermal expansion in some of the members of this series. In the present study, we show that by substitution of non-magnetic elements, boron and carbon, the nature of the magnetic interaction can be varied from dominating ferromagnetic to antiferromagnetic and finally to a canted magnetic structure without altering the crystal symmetry of the compounds. The variation of magnetic interaction by modifying the lattice parameter resembles Ruderman-Kittel-Kasuya-Yosida (RKKY) oscillations.

  9. Possible indicators for low dimensional superconductivity in the quasi-1D carbide Sc{sub 3}CoC{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Scheidt, E-W; Hauf, C; Reiner, F; Eickerling, G; Scherer, W, E-mail: Ernst-Wilhelm.Scheidt@physik.uni-augsburg.de [CPM, Institut fuer Physik, Universitaet Augsburg, 86159 Augsburg (Germany)

    2011-01-01

    The transition metal carbide Sc{sub 3}CoC{sub 4} consists of a quasi-one-dimensional (1D) structure with [CoC{sub 4}]{sub {infinity}} polyanionic chains embedded in a scandium matrix. At ambient temperatures Sc{sub 3}CoC{sub 4} displays metallic behavior. At lower temperatures, however, charge density wave formation has been observed around 143 K which is followed by a structural phase transition at 72 K. Below T{sub c}{sup onset} = 4.5 K the polycrystalline sample becomes superconductive. From H{sub c1}(0) and H{sub c2}(0) values we could estimate the London penetration depth ({lambda}{sub L} {approx_equal} 9750 A) and the Ginsburg-Landau (GL) coherence length ({xi}{sub GL} {approx_equal} 187 A). The resulting GL-parameter ({kappa} {approx_equal} 52) classifies Sc{sub 3}CoC{sub 4} as a type II superconductor. Here we compare the puzzling superconducting features of Sc{sub 3}CoC{sub 4}, such as the unusual temperature dependence i) of the specific heat anomaly and ii) of the upper critical field H{sub c2}(T) at T{sub c}, and iii) the magnetic hysteresis curve, with various related low dimensional superconductors: e.g., the quasi-1D superconductor (SN){sub x} or the 2D transition-metal dichalcogenides. Our results identify Sc{sub 3}CoC{sub 4} as a new candidate for a quasi-1D superconductor.

  10. Alkali/TX sub 2 catalysts for CO/H sub 2 conversion to C sub 1 -C sub 4 alcohols

    Energy Technology Data Exchange (ETDEWEB)

    Klier, K.; Herman, R. G.; Bastian, R.

    1990-01-01

    The objective of this research is to investigate and develop novel catalysts for the conversion of coal-derived synthesis gas into C{sub 1}-C{sub 4} alcohols by a highly selective process. Therefore, the variations of catalyst activity and selectivity for the synthesis of alcohols from H{sub 2}/CO {le}1 synthesis gas for a series of A/TX{sub 2} compounds, where A is a surface alkali dopant, T is a transition metal, and X ia a S, Se, or Te, will be determined. This quarter, a fresh batch of MoS{sub 2} was synthesized, and new Cs/MoS{sub 2} catalysts were prepared by alkali doping and were tested to demonstrate that the preparation and testing procedures were reproducible by different personnel. Preparations of RuS{sub 2} and Cs/RuS{sub 2} catalysts were initiated, and the preparations and testing of these catalysts will be described in the next quarterly report. 2 refs., 1 fig., 1 tab.

  11. Study of 4f hybridization in CeNiX with X=SnδGe1-δ, 0≤δ≤1

    International Nuclear Information System (INIS)

    Fuente, C. de la; Moral, A. del; Adroja, D.T.; Fraile, A.; Arnaudas, J.I.

    2010-01-01

    We report inelastic neutron scattering and core-level X-ray photoemission spectroscopy experiments for studying the Kondo problem in the CeNiX, X=Sn δ Ge 1-δ 0≤δ≤1 series. The neutron results confirm that they behave like a Kondo lattice for δ≥0.85, showing broad maxima at around 30 meV, typical of a crystal field magnetic scattering. So, the Ge doping could produce the suppression of the cerium magnetism observed for δ≤0.25. To open a more deep sight on this point, we have analyzed the 3d core-level XPS spectra by using the well-known Gunnarsson-Schoenhammer model. From this analysis, we have obtained the 'on-site' Coulomb bare repulsion for f states, U, and hybridization parameter, Δ, related with the hopping from the f states to the conduction ones. These U values are very similar for all compounds, about 7 eV, but the hybridization parameter slightly changes from 0.2 to 0.16 eV on increasing the Sn concentration. In Sn-rich compounds, the 4f occupation is close to spin limit fluctuation, which allows us to obtain an estimation of the Kondo temperatures, ∼1200 K, and the static 0 K susceptibility, ∼1.1x10 -3 emu/mol. Finally, we have done 'ab-initio' calculations based on the LDA+U+SO which confirm the existence of a small electronic gap opening in the DOS of Ge-rich compounds for U values lower than 7 eV.

  12. 1,1′-{1,4-Phenylene bis[3-(6-chloro-2-methyl-4-phenylquinolin-3-yl-4,5-dihydro-1H-pyrazole-5,1-diyl]}dibutan-1-one

    Directory of Open Access Journals (Sweden)

    Allaoua Kedjadja

    2015-10-01

    Full Text Available A new polycyclic compound, 1,1′-{1,4-phenylene bis[3-(6-chloro-2-methyl-4-phenylquinolin-3-yl-4,5-dihydro-1H-pyrazole-5,1-diyl]}dibutan-1-one (3 has been synthesized by cyclocondensation of (2E,2′E-1,1′-bis(6-chloro-2-methyl-4-phenylquinolin-3-yl-3,3′-(1,4-phenylenediprop-2-en-1-one (2 and hydrazine hydrate in butanoic acid. The structure of this compound was established by elemental analysis, 1H-NMR, 13C-NMR, mass and IR spectroscopy.

  13. Microscopic evidence for significant ionic disorder in the Yb sup 3 sup + -chain in Yb sub 4 (As sub 1 sub - sub x P sub x) sub 3 : sup 3 sup 1 P NMR studies

    CERN Document Server

    Tanida, H; Aoki, H; Ochiai, A

    2003-01-01

    We report unambiguous microscopic evidence from sup 3 sup 1 P NMR under H sub e sub x sub t approx = 7.3 T for significant ionic disorder in the Yb sup 3 sup + chain in Yb sub 4 (As sub 1 sub - sub x P sub x) sub 3 (x=0.05 and 0.40), which have similar characteristic chi(T) and C sub p (T, H sub e sub x sub t) behavior to the antiferromagnetic quantum spin chain (AFQSC) system Yb sub 4 As sub 3. Our conclusion is based on the observations only below the charge-ordering transition at T sub 0 approx = 292 K of clear structures in the spectrum, which can be fitted well by the superpositions of almost equally spaced five Gaussian components. Since perfect ordering of Yb sup 3 sup + in the chain sites would lead to a single-line spectrum also below T sub 0 , the structures should be ascribed to significant ionic disorder in the Yb sup 3 sup + chain and resulting distribution of local configurations of Yb sup 3 sup + in the eight nearest-neighboring Yb sites around sup 3 sup 1 P. Quantitative comparisons with a sim...

  14. Effect of second introduced phase on magnetic and magnetotransport properties of (1-x)La0.7Sr0.3Mn0.9Co0.1O3/x% Ag (x=0%, 2%, 4%) nanocomposites

    Science.gov (United States)

    Shah, Hiral D.; Bhalodia, J. A.

    2018-05-01

    The structural, magnetic and magnetotransport properties of (1-x)La0.7Sr0.3Mn0.9Co0.1O3(LSMCO)/x% Ag (x=0%, 2%, 4%) nanocomposites were investigated to explore the role of second introduced phase. (1-x) LSMCO/x% Ag (x=0%, 2%, 4%) nanocomposites are prepared via solid-state reaction method. X-ray diffraction (XRD) and SEM analysis indicated that x% of Ag are not substituted into the main LSMCO phase and remains an additive to the second phase at grain boundaries [1]. The structural parameters and the reliability factors for all the samples were successfully determined by the Rietveld refinement. Magnetization and transport properties of (1-x)LSMCO/x% Ag nanocomposites have been reported. Resistivity of the composite samples increases with Ag content in comparison with the pure LSMCO, and suppressed with applied magnetic field in all the composite samples [2]. The metal-insulator transition (TMI) and accompanied paramagnetic-ferromagnetic transition (TC) temperatures decrease with increase in Ag content. The electrical resistivity of the experimental results is explored by theoretical model below TMI. The maximum MR was observed to be 55% in the x=4% sample at 5 K temperature under 7 T magnetic field, this value is larger than that of pure LSMCO (19% at 5 K and 7 T), which is encouraging for practical application. Summarily, the addition of Ag in LSMCO improves MR% values significantly due to the more grain boundary contribution and result in better physical properties of the parent manganite system.

  15. Human prostate supports more efficient replication of HIV-1 R5 than X4 strains ex vivo

    Directory of Open Access Journals (Sweden)

    Denis Hélène

    2008-12-01

    Full Text Available Abstract Background In order to determine whether human prostate can be productively infected by HIV-1 strains with different tropism, and thus represent a potential source of HIV in semen, an organotypic culture of prostate from men undergoing prostatic adenomectomy for benign prostate hypertrophy (BPH was developed. The presence of potential HIV target cells in prostate tissues was investigated using immunohistochemistry. The infection of prostate explants following exposures with HIV-1 R5, R5X4 and X4 strains was analyzed through the measure of RT activity in culture supernatants, the quantification of HIV DNA in the explants and the detection of HIV RNA+ cells in situ. Results The overall prostate characteristics were retained for 21/2 weeks in culture. Numerous potential HIV-1 target cells were detected in the prostate stroma. Whilst HIV-1 R5SF162 strain consistently productively infected prostatic T lymphocytes and macrophages, the prototypic X4IIIB strain and a primary R5X4 strain showed less efficient replication in this organ. Conclusion The BPH prostate is a site of HIV-1 R5 replication that could contribute virus to semen. A limited spreading of HIV-1 X4 and R5X4 in this organ could participate to the preferential sexual transmission of HIV-1 R5 strains.

  16. Ferri-magnetic order in Mn induced spinel Co3-xMnxO4 (0.1≤x≤1.0) ceramic compositions

    Science.gov (United States)

    Meena, P. L.; Sreenivas, K.; Singh, M. R.; Kumar, Ashok; Singh, S. P.; Kumar, Ravi

    2016-04-01

    We report structural and magnetic properties of spinel Co3-xMnxO4 (x=0.1-1.0) synthesized by solid state reaction technique. Rietveld refinement analysis of X-ray diffraction (XRD) data, revealed the formation of polycrystalline single phase Co3-xMnxO4 without any significant structural change in cubic crystal symmetry with Mn substitution, except change in lattice parameter. Temperature dependent magnetization data show changes in magnetic ordering temperature, indicating formation of antiferromagnetic (AFM) and ferrimagnetic (FM) phase at low Mn concentration (x≤0.3) and well-defined FM phase at high Mn concentration (x≥0.5). The isothermal magnetization records established an AFM/FM mixed phase for composition ranging 0.10.5.

  17. Mn doping effect on structure and magnetism of epitaxial (FePt)1-xMnx films

    International Nuclear Information System (INIS)

    Huang, J.C.A.; Chang, Y.C.; Yu, C.C.; Yao, Y.D.; Hu, Y.M.; Fu, C.M.

    2003-01-01

    We study the structure and perpendicular magnetism of molecular beam epitaxy grown (FePt) 1-x Mn x films with doping concentration x=0, 1%, 2%, 3%, 4%, and 5%. The (FePt) 1-x Mn x films were made by multilayers growth of [Fe/Pt/Mn]xN at 100 deg. C and annealed at 600 deg. C. X-ray diffraction scans indicate that relatively better L1 0 ordered structure for low Mn doping (x 3%. The perpendicular magnetic anisotropy effect of the (FePt) 1-x Mn x films tends to decrease with the increase of Mn doping for x>1%. However, the x=1% doped films possess slightly better perpendicular magnetic anisotropy effect than the zero doped film. The perpendicular magnetic anisotropy constant are of about 1.3x10 7 and 1.6x10 7 erg/cm 3 for x=0% and x=1%, respectively

  18. Uji Aktivitas Antibakteri 1-[(Kuinazolin-4-on-2-ilmetil]piridin-1-ium Bromida dan 2-Bromometilkuinazolin-4-on

    Directory of Open Access Journals (Sweden)

    Hayun

    2014-04-01

    Full Text Available Antibacterial activity tests of quinazolin-4-one derivates: 1-[(6-nitroquinazolin-4-one- 2-ylmethyl]piridin-1-ium bromide (1, 1-[(6-aminoquinazolin-4-on-2-ylmethyl]piridin-1-um bromide (2, 2-bromomethylquinazolin-4-one (3 and 2-bromomethyl-6-nitroquinazolin-4-one (4 with trimethoprim (5 as a positive standard were conducted. The antibacterial activity tests were carried out using disc diffusion method againts E. coli, S. aureus and S. thyposa, and determination of minimum inhibitory concentration (MIC. The results showed that compounds 1 and 2 are inactive as antibacterial, whereas compounds 3 and 4 are active. The activities to E. coli were ¼ times the activity of trimethoprim (MIC: 5 x 102 µg/ml compared to 1.25 x102 µg/ml . The activity to S. typhosa were ½-1 times the activity of trimethoprim (MIC: 2.5 and 1.25x102 µg/ml compared to 1.25x102 µg/ml; but they are not active to S. aureus. Trimethoprim active to S. aureus with MIC: 0.62 x102 µg/ ml.

  19. 5-(4-Methylphenylsulfonyl-1,3-dithiolo[4,5-c]pyrrole-2-thione

    Directory of Open Access Journals (Sweden)

    Ning-Juan Zheng

    2012-04-01

    Full Text Available The asymmetric unit of the title compound, C12H9NO2S4, contains one half-molecule with the N, two S amd four C atoms lying on a mirror plane. The molecule exhibits a V-shaped conformation, with a dihedral angle of 87.00 (7° between the benzene and dithiolopyrrole rings. The methyl group was treated as rotationally disordered between two orientations in a 1:1 ratio. In the crystal, weak C—H...O hydrogen bonds link the molecules into chains in [010].

  20. Preparation of 14-C-labelled 1,4-Dideoxy-1,4-imino-D-arabinitol: Cyanosilylation of Cyclic Imines using KCN in a One-Pot Synthesis

    DEFF Research Database (Denmark)

    Lundt, Inge; Malle, Birgitte Mølholm; Foged, Christian

    1999-01-01

    A new method for C-C bond formation was developed based on in situ cyanosilylation of cyclic Schiff bases using KCN, TMSCl, KI and ZnI2. This method was used to prepare the potent -glucosidase inhibitor 1,4-dideoxy-1,4-imino-D-arabinitol 14-C labelled at C-5.Keywords: in situ cyanosilylation; 14-C...

  1. Pentaatomic planar tetracoordinate carbon molecules [XCAl(3)](q) [(X,q) = (B,-2), (C,-1), (N,0)] with C-X multiple bonding.

    Science.gov (United States)

    Cui, Zhong-Hua; Shao, Chang-Bin; Gao, Si-Meng; Ding, Yi-Hong

    2010-11-07

    Among the fascinating planar tetracoordinate carbon (ptC) species, pentaatomic molecules belong to the smallest class, well-known as "pptC". It has been generally accepted that the planarity of pptC structure is realized via the "delocalization" of the p(z) lone pair at the central carbon and the ligand-ligand bonding interaction. Although "localization" is as key driving force in organic chemistry as "delocalization", the "localization" concept has not been applied to the design of pptC molecules, to the best of our knowledge. In this paper, we apply the "localization" strategy to design computationally a series of new pptC. It is shown that the central carbon atom and one "electronegative" ligand atom X (compared to the Al ligand) effectively form a highly localized C-X multiple bond, converting the lone pair at the central carbon to a two-center two-electron π-bond. At the aug-cc-pVTZ-B3LYP, MP2 and CCSD(T) levels, the designed 18-valence-electron pptC species [XCAl(3)](q); [(X,q) = (B,-2), (C,-1), (N,0)] are found to each possess a stable ptC structure bearing a C-X double bond, indicated by the structural, molecular orbital, Wiberg bonding, potential energy surface and Born-Oppenheimer molecular dynamics (BOMD) analysis. Moreover, our OVGF calculations showed that the presently disclosed (yet previously unconsidered) pptC structure of [C(2)Al(3)](-) could well account for the observed photoelectron spectrum (previously only ascribed to a close-energy fan-like structure). Therefore, [C(2)Al(3)](-) could be the first pptC that bears the highly localized C-X double bond that has been experimentally generated. Notably, the pptC structure is the respective global minimum point for [BCAl(3)](2-) and [NCAl(3)], and the counterion(s) would further stabilize [BCAl(3)](2-) and [C(2)Al(3)](-). Thus, these newly designed pptC species with interesting bonding structure should be viable for future experimental characterization. The presently applied "localization" approach

  2. A first-principles study on the structural, mechanical, electronic and optical properties of the Cr2(AlxGe1x)C alloys

    International Nuclear Information System (INIS)

    Zhao-Yong, Jiao; Shu-Hong, Ma; Xiao-Fen, Huang

    2014-01-01

    Highlights: • The structural, mechanical and optical properties of Cr 2 (Al x Ge 1x )C are studied. • The sound velocity and the Debye temperatures for the Cr 2 (Al x Ge 1x )C are predicted. • Results classify the Cr 2 (Al x Ge 1x )C (x ⩽ 0.5) as ductile while (x = 0.75, 1) as brittle. • Cr 2 (Al x Ge 1x )C are predicted to be promising good coating materials. -- Abstract: According to the new experimentally discovered Cr 2 (Al x Ge 1x )C (x = 0, 0.25, 0.5, 0.75, 1) alloys, we have studied the structural, mechanical, electronic and optical properties based on the first-principles calculation. Obtained structural parameters and distortion parameters are in good agreement with experimental results. It is shown that all the considered compounds are elastically stable and present results classify the Cr 2 (Al x Ge 1x )C (x ⩽ 0.5) alloys as ductile while the Cr 2 (Al 0.75 Ge 0.25 )C and Cr 2 AlC as brittle. Electronic and optical properties demonstrate that all the considered M 2 AX compounds have a metallic character, and they are predictive of promising good coating materials

  3. Manufacturing and characterization of ceramic pigment Zn{sub 1-x}Fe{sub x}Cr{sub 2}O{sub 4} by synthetic non conventional methods; Fabricacion y caracterizacion del pigmento ceramico Zn{sub 1-x}Fe{sub x}Cr{sub 2}O{sub 4} por metodos de sintesis no convencionales

    Energy Technology Data Exchange (ETDEWEB)

    Nieves, Leidy Johana Jaramillo; Baena, Oscar Jaime Restrepo, E-mail: ojrestre@unal.edu.co [Universidad Nacional de Colombia, Medellin (Colombia). Facultad de Minas

    2012-07-01

    The ceramic pigment with structure Zn{sub 1-x}Fe{sub x}Cr{sub 2}O{sub 4} (x = 0, 0.5, 1) was synthesized by non conventional methods of coprecipitation assisted by ultrasound and milling of high energy. This pigment was characterized by XRD, XRF, SEM, UV-VIS spectrophotometry and CIELab colorimetry. The aim of this work was studied two alternative methods to the traditional method of synthesis, evaluating the pigment properties, varying the stoichiometry, such as structure, composition, morphology and colorimetric coordinates. The results showed that is possible to obtain the desired crystalline structure at temperatures below 1000 ° C in both cases, also expected hues are obtained according to each stoichiometry, which shows the advantages of using methods non conventional when produce these pigments, since it has a higher controlling the composition, stoichiometry and is obtained at temperatures below compared with traditional ceramic method.

  4. Transmission Electron Microscopy (TEM) Sample Preparation of Si(1-x)Gex in c-Plane Sapphire Substrate

    Science.gov (United States)

    Kim, Hyun Jung; Choi, Sang H.; Bae, Hyung-Bin; Lee, Tae Woo

    2012-01-01

    The National Aeronautics and Space Administration-invented X-ray diffraction (XRD) methods, including the total defect density measurement method and the spatial wafer mapping method, have confirmed super hetero epitaxy growth for rhombohedral single crystalline silicon germanium (Si1-xGex) on a c-plane sapphire substrate. However, the XRD method cannot observe the surface morphology or roughness because of the method s limited resolution. Therefore the authors used transmission electron microscopy (TEM) with samples prepared in two ways, the focused ion beam (FIB) method and the tripod method to study the structure between Si1-xGex and sapphire substrate and Si1?xGex itself. The sample preparation for TEM should be as fast as possible so that the sample should contain few or no artifacts induced by the preparation. The standard sample preparation method of mechanical polishing often requires a relatively long ion milling time (several hours), which increases the probability of inducing defects into the sample. The TEM sampling of the Si1-xGex on sapphire is also difficult because of the sapphire s high hardness and mechanical instability. The FIB method and the tripod method eliminate both problems when performing a cross-section TEM sampling of Si1-xGex on c-plane sapphire, which shows the surface morphology, the interface between film and substrate, and the crystal structure of the film. This paper explains the FIB sampling method and the tripod sampling method, and why sampling Si1-xGex, on a sapphire substrate with TEM, is necessary.

  5. The persistence of the magnetocaloric effect in (La1-x)A(x)(0.67)Ba0.33Mn1.05O3-δ

    DEFF Research Database (Denmark)

    Ancona-Torres, Carlos Eugenio; Pryds, Nini; Kuhn, Luise Theil

    2010-01-01

    Polycrystalline samples of (La1-xAx)0.67Ba0.33Mn1.05O3-δ, with A being a mixture of lanthanides containing 66% La, 22% Nd, 8% Pr and 4% Ce, were prepared by the glycine-nitrate method, with target compositions of x = 0, 0.33, 0.67 and 1. The effect of the mixture of lanthanides on the Curie...... temperature, TC, and the magnetocaloric properties was investigated. The prepared samples are single phase, with space group R-3c. The lattice parameters and average A-site ionic radius, rA decrease linearly with x while the size disorder, as characterized by the variance, σ2, increases from 0.014 to 0...

  6. Synthesis of 1-benzyl-4-((5,6-dimethoxy(2- sup 14 C)-1-indanon)-2-YL)-methylpiperidine hydrochloride (E2020- sup 14 C)

    Energy Technology Data Exchange (ETDEWEB)

    Iimura, Youichi; Mishima, Mannen; Sugimoto, Hachiro (Eisai Co., Ltd., Ibaraki (Japan). Tsukuba Research Labs.)

    1989-07-01

    1-Benzyl-4-((5,6-dimethoxy(2-{sup 14}C)-1-indanon)-2-yl)-methylpiperidine hydrochloride (E2020-{sup 14}C), and acetylcholinesterase inhibitor for studying the pharmacokinetic profiles of E2020, was synthesized from 5,6-dimethoxy(2-{sup 14}C)-1-indanone as the labelled starting material. (author).

  7. Structural, magnetic and magnetocaloric properties of La{sub 0.7}Ca{sub 0.2}Sr{sub 0.1}Mn{sub 1x}Cr{sub x}O{sub 3} compounds with x = 0, 0.05 and 0.1

    Energy Technology Data Exchange (ETDEWEB)

    Dhahri, Ah., E-mail: dhahri.ahmad@outlook.fr [Laboratoire de Physique Appliquée, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Jemmali, M. [Laboratoire des Sciences des Matériaux et de l’Environnement, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Taibi, K. [Département SDM, FGMGP/USTHB, 16311 (Algeria); Dhahri, E. [Laboratoire de Physique Appliquée, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Hlil, E.K. [Institut Néel, CNRS et Université J. Fourier, BP 166, 38042 Grenoble (France)

    2015-01-05

    Highlights: • The samples crystallize in the rhombohedral structure with the R3{sup ¯}c space group. • Enhancement of T{sub C} for the rhombohedral samples. • The relative cooling power increases with Cr-doping. • All samples exhibit a large magnetocaloric effect. • High values of the magnetoresistance in all samples. - Abstract: Structural, magnetic and magnetocaloric properties of La{sub 0.7}Sr{sub 0.1}Ca{sub 0.2}Mn{sub 1x}Cr{sub x}O{sub 3} compounds with x = 0, 0.05 and 0.1 have been investigated to shed light on Cr-doping influence. X-ray diffraction studies show that all samples crystallize in the rhombohedral symmetry with R3{sup ¯}c space group. Rietveld refinement structure shows that the insertion of Cr in Mn network modifies the structural parameters such as the volume, Mn–O–Mn angles and the Mn–O bond length. The substitution of Mn by Cr decreases the 2p-3d hybridization between O and Mn ions, reduces the bandwidth and increases the electron–phonon coupling. The investigation of magnetic and magnetocaloric properties reveals that the samples exhibit a paramagnetic(PM)–ferromagnetic (FM) transition with decreasing Curie temperature (T{sub C}) from 294 K to 255 K when Cr doping level increases. The magnetic entropy change (ΔS{sub M}{sup max}) also decreases from 6.20 J kg{sup −1} K{sup −1} for x = 0 to3.80 J kg{sup −1} K{sup −1} for x = 0.1, while the relative cooling power (RCP) increases from 234.5 to 240 J kg{sup −1}, respectively, under a magnetic field of 5 T. These outcomes suggest that Mn-site Cr doping inhibits the enhancement of the magnetocaloric effect in some perovskite manganites. This is explained by the weakening of the ferromagnetic double-exchange interaction between Mn{sup 3+} and Mn{sup 4+} ions.

  8. The immuno-regulatory impact of orally-administered Hypericum perforatum extract on Balb/C mice inoculated with H1n1 influenza A virus.

    Directory of Open Access Journals (Sweden)

    Nan Huang

    Full Text Available Hypericumperforatum (H. perforatum ethanol extract has been found to inhibit lipopolysaccharide-induced production of inflammatory mediators and cytokines in cultured macrophages. Therefore, it may be able to protect the host from excessive inflammation during viral infection. In the current study, the immune-regulatory effect of H. perforatum extract was evaluated in A549 lung epithelial cells and BALB/c mice exposed to Influenza A/PR/8/34 H1N1 virus. In A549 cells, the extract (30 µg/mL significantly inhibited influenza virus induced monocyte chemotactic protein (MCP-1 and interferon-γ induced protein 10 kD (IP-10, but dramatically increased interleukin-6 (IL-6. In mice inoculated intranasally with 10(7.9 EID50 of Influenza A/PR/8/34 H1N1 (high dose, daily oral treatment of H. perforatum extract at a rate of 110 mg/kg of body weight increased lung viral titer, bronchoalveolar lavage (BAL pro-inflammatory cytokine and chemokine levels, and the infiltration of pro-inflammatory cells in the lung 5 days post-inoculation, as compared to ethanol vehicle treated mice. Transcription of suppressor of cytokine signaling 3 (SOCS3 was increased by H. perforatum extract both in A549 cells and BALB/c mice, which could have interrupted anti-viral immune response and thus led to the inefficient viral clearance and increased lung inflammation. H. perforatum treatment resulted in minor reduction in viral titer without affecting body weight when mice were inoculated with a lower dose (~10(5.0 EID50 and H. perforatum was applied in the later phase of infection. Mice challenged intranasally with high dose of influenza virus (10(7.9 EID50 suffered from a higher mortality rate when dosed with H. perforatum extract. In conclusion, the current study showed that SOCS3 elevation by H. perforatum may cause impaired immune defense against influenza virus infection and lead to higher mortality.

  9. Photoluminescent properties of LiSrxBa1-xPO4:RE3+ (RE = Sm3+, Eu3+) f-f transition phosphors

    International Nuclear Information System (INIS)

    Tu Dong; Liang Yujun; Liu Rong; Cheng Zheng; Yang Fan; Yang Wenlong

    2011-01-01

    Highlights: → Novel phosphors LiSr x Ba 1-x PO 4 : Sm 3+ and LiSr x Ba 1-x PO 4 : Eu 3+ have been synthesized by solid-state reaction method. → The LiSr x Ba 1-x PO 4 : Sm 3+ and LiSr x Ba 1-x PO 4 : Eu 3+ phosphors may be potential f-f transition phosphors used in LED. → The emission intensity of the LiSr x Ba 1-x PO 4 : Sm 3+ and LiSr x Ba 1-x PO 4 : Eu 3+ phosphors can be enhanced by increasing the value of x. - Abstract: Rare-earth ions (Sm 3+ or Eu 3+ ) doped LiSr x Ba 1-x PO 4 (x = 0, 0.2, 0.4, 0.6, 0.8, 1.0) f-f transition phosphor powders were prepared by a high temperature solid-state reaction. The resulted phosphors were characterized by X-ray diffraction (XRD) and photoluminescence (PL) spectroscopy. The results of XRD indicate that the phase structure of the sample changes from LiBaPO 4 to LiSrPO 4 when x changes from 0 to 1.0. The excitation spectra indicate that only direct excitation of rare earth ions (Sm 3+ or Eu 3+ ) can be observed. The doped rare earth ions show their characteristic emission in LiSr x Ba 1-x PO 4 , i.e., Eu 3+5 D 0 - 7 F J (J = 0, 1, 2, 3, 4), Sm 3+4 G 5/2 → 6 H J (J = 5/2, 7/2, 9/2, 11/2), respectively. The dependence of the emission intensities of the LiSr x Ba 1-x PO 4 :Sm 3+ and LiSr x Ba 1-x PO 4 :Eu 3+ phosphors on the x value and Ln 3+ (Ln 3+ = Sm 3+ , Eu 3+ ) concentration is also investigated.

  10. 26 CFR 1.381(c)(5)-1 - Inventories.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Inventories. 1.381(c)(5)-1 Section 1.381(c)(5)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(5)-1 Inventories. (a) Carryover requirement—(1...

  11. Chemsearch Journal Volume 4 Number 1, June, 2013

    African Journals Online (AJOL)

    Magashi

    2013-06-01

    Jun 1, 2013 ... They were labeled as FS1-1 to FS1-4 for leaves extract and FS2-1 to FS2-4 for fruit extract. Each of ... steroid glycoside, reducing sugars and saponins. The extract is said to be ..... Food Technology 9(3):72-74. Ferguson, LR.

  12. Analysis of gamma irradiated pepper constituents, 1

    International Nuclear Information System (INIS)

    Takagi, Kazuko; Okuyama, Tsuneo

    1988-01-01

    A reversed phase high performance liquid chromatographic (HPLC) method was developed for the analysis of many constituents of pepper at the same time. And a extraction method of ultraviolet absorbing constituents from pepper was developed for the HPLC analysis. The Ultraviolet absorbing constituents were extracted by precooled Automatic Air-Hammer from frozen pepper with 20% acetonitrile in water. The process of extraction was achieved under cooling by liquid nitrogen from start to end. The extracted constituents were separated on a reversed phase C 8 (LiChrospher 300 RP - 8 10 μm 0.4 I.D. x 0.4 cm and LiChrosorb RP - 8 SelectB 0.4 I. D. x 25 cm) column with a concave gradient from 0.1% trifluoro acetic acid (TFA) in water to 75% acetonitrile and 0.1% TFA in water for 60 minutes. The eluted constituents were detected 210 nm and 280 nm. The present method permits the detection of about 50 peaks by 280 nm. (author)

  13. The determination of the surface potential for the CdxHg1-xTe crystals and the V-CdxHg1-xTe and Ni-V-CdxMg1-xTe structures

    International Nuclear Information System (INIS)

    Veliyulin, Eh.I.; Ragimova, R.A.; Mamedov, A.A.

    1996-01-01

    Surface potential of semiconductor crystals n-Cd x Hg 1-x Te (unannealed and annealed in mercury vapors) and of the structures V-Cd x Hg 1-x Te, Ni-V-Cd x Hg 1-x Te has been defined using spectroscopy of weak-field electric reflection. It is shown that a deep penetration of vanadium atoms in near the surface region of the crystal occurs in the structures on the basis of unannealed Cd x Hg 1-x Te. 1 ref.; 4 figs

  14. Ionic conductivity of the lithium titanium phosphate (Li/sub 1+x/M/sub x/Ti/sub 2-x/(PO/sub 4/)/sub 3/, M=Al, Sc, Y, and La) systems

    International Nuclear Information System (INIS)

    Aono, H.; Sugimoto, E.; Sadaaka, Y.; Imanaka, N.; Adachi, G.Y.

    1989-01-01

    High lithium ionic conductivity was obtained in Li/sub 1+X/M/sub X/Ti/sub 2-X/(PO/sub 4/)/sub 3/ (M=Al, Sc, Y, and La) systems. Lithium titanium phosphate, LiTi/sub 2/(PO/sub 4/)/sub 3/, is composed of both TiO/sub 6/ octahedra and PO/sub 4/ tetrahedra, which are linked by corners to form a three dimensional network, with a space group R3-barC. Some workers have already described that the conductivity increased considerably if Ti/sup 4+/ in LiTi/sub 2/(PO/sub 4/)/sub 3/ was substituted by slightly larger cations such as Ga/sup 3+/(1),Sc/sup 3+/(2), and In/sup 3+/(3,4). These results are similar to each other because of their close ionic radii. In this communication, substitution effects of Ti/sup 4+/ in LiTi/sub 2/(PO/sub 4/)/sub 3/ by various ions (Al/sup 3+/, Sc/sup 3+/, Y/sup 3+/, and La/sup 3+/) on their conductivities are reported

  15. 1 Synthesis of Selected Phenylalanine Esters C1 to C4 and their ...

    African Journals Online (AJOL)

    Figure 1 Synthesis of Taxol via the Wieland Miescher Ketone. Important natural products .... ml) at 0°C. Thionyl chloride (1ml, 13.8 mmol) was added dropwise to the reaction mixture ... L-Phenylalanine propyl ester hydrochloride. (Yield: 93%).

  16. Extraction - spectrophotometric determination of tantalum (V) with 2-(2-thiazolylazo)-5-dimethylaminophenol and 1,3-diphenylguanidine

    International Nuclear Information System (INIS)

    Tsurumi, C.; Furuya, K.; Kamada, H.

    1981-01-01

    Tantalum(V)-2-(2-thiazolylazo)-5-dimethylaminophenol (TAM) chelate anion is extracted quantitatively into benzyl alcohol with 1,3-diphenylguanidine (DPG) to form a ternary complex. In the organic phase, the complex has an absorption maximum at 605 nm. The optimum pH range for the extraction is 4.1 to 4.9 and the ternary complex is stable for at least 50 min. Beer's law is obeyed over a concentration range of 2 to 18 μg of tantalum(V) in 10 ml of the organic phase. The molar absorptivity of the ternary complex is 4.1 x 10 4 l mol -1 at 605 nm. The composition of the ternary complex is considered to be (TaO 2 ) 2 (TAM) 3 (DPG + ). (author)

  17. Structural and magnetic properties of Mg-Zn ferrites (Mg1xZnxFe2O4) prepared by sol-gel method

    International Nuclear Information System (INIS)

    Reyes-Rodríguez, Pamela Yajaira; Cortés-Hernández, Dora Alicia; Escobedo-Bocardo, José Concepción; Almanza-Robles, José Manuel; Sánchez-Fuentes, Héctor Javier; Jasso-Terán, Argentina; De León-Prado, Laura Elena; Méndez-Nonell, Juan; Hurtado-López, Gilberto Francisco

    2017-01-01

    In this study, the Mg 1x Zn x Fe 2 O 4 nanoparticles (x=0–0.9) were prepared by sol-gel method. These ferrites exhibit an inverse spinel structure and the lattice parameter increases as the substitution of Zn 2+ ions is increased. At lower Zn content (0.1≤x≤0.5), saturation magnetization (Ms) increases, while it decreases at higher Zn content (x≥6). The remnant magnetization (0.17–2.0 emu/g) and coercive field (6.0–60 Oe) indicate a ferrimagnetic behavior. The average core diameter of selected ferrites is around 15 nm and the nanoparticles morphology is quasi spherical. The heating ability of some Mg 0.9 Zn 0.1 Fe 2 O 4 and Mg 0.7 Zn 0.3 Fe 2 O 4 aqueous suspensions indicates that the magnetic nanoparticles can increase the medium temperature up to 42 °C in a time less than 10 min - Highlights: • Magnetic nanoparticles of Mg 1x Zn x Fe 2 O 4 were synthesized by sol-gel method. • Nanoparticles showing a single spinel crystalline structure were obtained. • Aqueous suspensions of Mg 0.7 Zn 0.3 Fe 2 O 4 and Mg 0.9 Zn 0.1 Fe 2 O 4 show heating ability.

  18. Retracing the phenomenology of the flipped SU(5)xU(1) superstring model

    Energy Technology Data Exchange (ETDEWEB)

    Rizos, J.; Tamvakis, K. (Ioannina Univ. (Greece). Dept. of Physics)

    1990-11-22

    We study in detail gauge symmetry breaking in the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSO(6) superstring model, solving the D- and F-flatness conditions and taking into account quartic and quintic superpotential terms. We find that, to this order, the model describes two massive generations of quarks and leptons as well as a massless generation expected to receive naturally suppressed masses from higher order non-renormalizable terms. We show that D-flatness restricts the number of massless isodoublets to four. We also extract an inequality relating the top quark mass to M{sub W}. (orig.).

  19. Bi{sub 1x}Nb{sub x}O{sub 1.5+x} (x=0.0625, 0.12) fast ion conductors: Structures, stability and oxide ion migration pathways

    Energy Technology Data Exchange (ETDEWEB)

    Tate, Matthew L. [Department of Chemistry, Durham University, Science Site, South Road, Durham DH1 3LE (United Kingdom); Australian Nuclear Science and Technology Organisation, Lucas Heights 2234, NSW (Australia); Hack, Jennifer [Department of Chemistry, Durham University, Science Site, South Road, Durham DH1 3LE (United Kingdom); Institut Laue-Langevin, Grenoble (France); Kuang, Xiaojun [Department of Chemistry, Durham University, Science Site, South Road, Durham DH1 3LE (United Kingdom); McIntyre, Garry J. [Australian Nuclear Science and Technology Organisation, Lucas Heights 2234, NSW (Australia); Withers, Ray L. [Research School of Chemistry, Australian National University, Canberra, ACT (Australia); Johnson, Mark R. [Institut Laue-Langevin, Grenoble (France); Radosavljevic Evans, Ivana, E-mail: ivana.radosavljevic@durham.ac.uk [Department of Chemistry, Durham University, Science Site, South Road, Durham DH1 3LE (United Kingdom); Australian Nuclear Science and Technology Organisation, Lucas Heights 2234, NSW (Australia)

    2015-05-15

    A combined experimental and computational study of Bi{sub 1x}Nb{sub x}O{sub 1.5+x} (x=0.0625 and 0.12) has been carried out using laboratory X-ray, neutron and electron diffraction, impedance measurements and ab-initio molecular dynamics. We demonstrate that Bi{sub 0.9375}Nb{sub 0.0625}O{sub 1.5625}, previously reported to adopt a cubic fluorite-type superstructure, can form two different polymorphs depending on the synthetic method: a metastable cubic phase is produced by quenching; while slower cooling yields a stable material with a tetragonal √2×√2×1 superstructure, which undergoes a reversible phase transition into the cubic form at ~680 °C on subsequent reheating. Neutron diffraction reveals that the tetragonal superstructure arises mainly from ordering in the oxygen sublattice, with Bi and Nb remaining disordered, although structured diffuse scattering observed in the electron diffraction patterns suggests a degree of short-range ordering. Both materials are oxide ion conductors. On thermal cycling, Bi{sub 0.88}Nb{sub 0.12}O{sub 1.62} exhibits a decrease in conductivity of approximately an order of magnitude due to partial transformation into the tetragonal phase, but still exhibits conductivity comparable to yttria-stabilised zirconia (YSZ). Ab-initio molecular dynamics simulations performed on Bi{sub 0.9375}Nb{sub 0.0625}O{sub 1.5625} show that oxide ion diffusion occurs by O{sup 2−} jumps between edge- and corner-sharing OM{sub 4} groups (M=Bi, Nb) via tetrahedral □M{sub 4} and octahedral □M{sub 6} vacancies. - Graphical abstract: Oxide ion migration in tetragonal Bi{sub 0.9375}Nb{sub 0.0625}O{sub 1.5625} occurs by O{sup 2−} jumps between edge- and corner-sharing OM{sub 4} groups (M=Bi, Nb) via tetrahedral M{sub 4} and octahedral M{sub 6} vacancies. - Highlights: • Bi{sub 0.9375}Nb{sub 0.0625}O{sub 1.5625} adopts a tetragonal √2×√2×1 fluorite superstructure. • Superstructure is due to ordering in the O-sublattice, with Bi

  20. AFSC/NMML/CCEP: Channel Islands Pinniped Census

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Marine Mammal Laboratories' California Current Ecosystem Program (AFSC/NOAA) initiated and maintains census programs for California sea lions (Zalophus...

  1. (C6H16N2)Zn3(HPO3)4H2O: a new layered zinc phosphite templated by diprotonated trans-1,4-diaminocyclohexane

    International Nuclear Information System (INIS)

    Wang Yu; Yu Jihong; Li Yi; Du Yu; Xu Ruren; Ye Ling

    2003-01-01

    Employing trans-1,4-diaminocyclohexane (trans-1,4-DACH) as a template, a new two-dimensional layered zinc phosphite (C 6 H 16 N 2 )Zn 3 (HPO 3 ) 4 H 2 O (1) has been prepared hydrothermally. Single-crystal X-ray diffraction analysis shows that it crystallizes in the monoclinic space group P2 1 /n with a=10.458(2) A, b=14.720(3) A, c=13.079(3) A, β=97.93(3) deg. , V=1994.1(7) A 3 , Z=4, R 1 =0.0349 (I>2σ(I)) and wR 2 =0.0605 (all data). The inorganic layer is built up by alternation of ZnO 4 tetrahedra and HPO 3 pseudo pyramids forming a 4.6.8-net. The sheet is featured by a series of capped six-membered rings. The diprotonated trans-1,4-DACH molecules reside in the interlayer region and interact with the inorganic network through H-bonds

  2. Magnetic and crystallographic properties of Gd(Cu/sub 1-x/Ni/sub x/)2 and Gd(Cu/sub 1-x/Al/sub x/)2 intermetallic compounds

    International Nuclear Information System (INIS)

    Borombaev, M.K.; Levitin, R.Z.; Markosyan, A.S.; Snegirev, V.V.

    1986-01-01

    Magnetization, paramagnetic susceptibility, and temperature dependence of lattice parameters of Gd(Cu/sub 1-x/Ni/sub x/) 2 (0 2 (0 2 -type structure have been studied in a wide range of temperatures. Below the ordering temperature anomalies in thermal expansion along the crystallographic axes a, b, and c enabled to distinguish between various types of magnetic arrangements. The Gd(Cu/sub 1-x/Ni/sub x/) 2 system has two types of antiferromagnetic phases: AF1 (0 = 0.13 the system orders ferromagnetically. In the Gd(Cu/sub 1-x/Al/sub x/) 2 system two magnetic phases AF1 and AF3 occur in the concentration regions 0 <= x <= 0.035 and 0.04 <= x <= 0.07, respectively. The obtained results are discussed in terms of the RKKY model via the changing conduction electron concentration. (author)

  3. [14C]-radiolabeling of {[trans-(8β)]-6-methyl-1-(1-methylethyl) ergoline-8-carboxylic acid, 4-methoxycyclohexyl ester (Z)-2-buteneidioate (1:1)}

    International Nuclear Information System (INIS)

    Marzoni, G.; Wheeler, W.J.; Garbrecht, W.L.

    1988-01-01

    The 5HT 2 -receptor antagonist, [ 14 C]-labeled brace[trans-(8β)]-6-methyl-1-(1-methylethyl)ergoline-8-carboxylic acid, 4-methoxycyclohexyl ester (Z)-2-butenedioate (1:1)brace (LY281067) was synthesized from unlabeled 6-methyl-1-(1-methylethyl)ergoline-8-carboxylic acid. The [ 14 C] label was introduced into the carboxyl group attached to the 8 position of the ergoline nucleus. This site is stable to metabolism. The synthesis involves removal of an unlabeled carboxyl group and subsequent reinsertion of a [ 14 C]-labeled carboxyl group into the same position. The radiolabel is not introduced until near the end of the synthesis which allows for ease of handling and scale-up of intermediates. (author)

  4. The study of variations and environmental applications "1"4C

    International Nuclear Information System (INIS)

    Simon, J.

    2010-01-01

    The primary aim of the presented thesis is to explain experimentally observed "1"4C variations in the outer atmosphere. Physical models have been developed to quantify directly immeasurable phenomena relevant in the field of radiocarbon dynamics. Namely atmospheric stability, "1"4C transport from the stratosphere to the lower troposphere and fossil carbon dioxide emissions to the atmosphere. Finally these models have been used as the pillars of the united theory of Δ"1"4C dynamics. Besides the presented main theoretical outputs, this thesis also provides couple of potentially implementable by-products. First of them is a method to evaluate so called 'equivalent mixing height' and turbulent diffusion coefficient using temporal changes of "2"2"2Rn concentration in the boundary layer of the atmosphere. The elaborated mathematical apparatus for the evaluation of aerosol scavenging by raindrops can be utilized in the models of pollutant dispersion. Information on turbulent diffusion coefficient at higher atmospheric levels is important for the models of stratospheric and ozonospheric dynamics. Nowadays, when one can measure and even feel the greenhouse effect consequences, the importance of an independent method for carbon dioxide fossil emissions assessment is obvious. Besides theoretical outcome, the thesis also presents experimental results. A network of CO_2 sampling sites has been established in Bratislava and the outskirts in the vicinity of the town. Together with mountain site Chopok the network brought a unique information on "1"4C distribution. Atmospheric measurements of "7Be and "2"2"2Rn activity are also presented here. Finally the PC codes have been developed to bridge a gap between experimental and theoretical results. (author)

  5. Characterization of mixed Nd :LuxGd1-xVO4 laser crystals

    Science.gov (United States)

    Yu, H. H.; Zhang, H. J.; Wang, Z. P.; Wang, J. Y.; Yu, Y. G.; Cheng, X. F.; Shao, Z. S.; Jiang, M. H.; Ling, Z. C.; Xia, H. R.

    2007-06-01

    A series of laser crystals Nd :LuxGd1-xVO4 (x=0.14,0.32,0.50,0.61,0.70,0.80) was grown by the Czochralski method. The thermal properties, including the average linear thermal expansion coefficients, thermal diffusion coefficients, specific heats, and thermal conductivities, of the mixed crystals were obtained. The material constants Ms for the thermal stress resistance figure were calculated and showed that the thermal fracture limits of the mixed crystals should be comparable with that of Nd :YVO4. The polarization absorption spectra from 240to1000nm were measured at room temperature and the absorption cross sections at 809nm were calculated. Using the Judd-Ofelt theory, the theoretical radiative lifetimes were calculated and compared with the experimental results. Continuous wave laser performances were achieved with the mixed crystals at the wavelength of 1.06μm when they were pumped by a laser diode. Thermal, optical, and laser properties have shown variation as a function of x and proved that the mixed crystals are good laser materials.

  6. Magnetic behavior of the alloys (Ce{sub 1-x}Y{sub x}){sub 2}PdSi{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Mallik, R [Tata Inst. of Fundamental Res., Colaba, Mumbai (India); Sampathkumaran, E V [Tata Inst. of Fundamental Res., Colaba, Mumbai (India)

    1996-11-01

    The results of X-ray diffraction (Cu K{sub {alpha}}), electrical resistivity ({rho}), heat capacity (C) and magnetic susceptibility ({chi}) measurements are reported for a new pseudoternary solid solution, (Ce{sub 1-x}Y{sub x}){sub 2}PdSi{sub 3} (x=0.0, 0.2, 0.5, 0.8, 1.0). The X-ray diffraction patterns indicate that single phase alloys can be formed in a derived version of the AlB{sub 2}-type hexagonal structure for x{>=}0.2, while for x=0.0, apparently there is an additional weak phase. In the case of the alloy Ce{sub 2}PdSi{sub 3}, the majority of Ce ions do not exhibit magnetic ordering down to 1.4 K, though magnetic ordering at 7 K from one of the two crystallographically inequivalent sites cannot be ruled out. For other compositions, no magnetic ordering is observed above 1.4 K. The Kondo effect is operative in all these alloys, with the strength of the Kondo effect increasing with the compression of the lattice by the gradual replacement of Ce by Y. The C/T exhibits a low temperature enhancement in all Ce containing alloys. (orig.).

  7. Induced 3d and 4f magnetism in Gd{sub 1-x}Pr{sub x}Ni{sub 2} Laves phase alloys

    Energy Technology Data Exchange (ETDEWEB)

    Bouziane, K [Department of Physics, College of Science, Sultan Qaboos University, PO Box 36, Al-Khodh 123 (Oman); Carboni, C [Department of Physics, College of Science, Sultan Qaboos University, PO Box 36, Al-Khodh 123 (Oman); Morrison, C [School of Physics and Astronomy, University of Southampton, Highfield, Southampton SO17 1BJ (United Kingdom)

    2008-01-16

    The series of Gd{sub 1-x}Pr{sub x}Ni{sub 2} (x = 0.25, 0.40, and 0.60) polycrystalline samples has been investigated using x-ray diffraction and magnetometry. The x-ray diffraction measurements showed that the lattice constant and the relative intensities of the C15 superstructure I{sub 511}/I{sub 440} and I{sub 511}/I{sub 220} increase with the praseodymium content, reflecting an increasing number of ordered vacancies at the 4a sites. The temperature dependences of the zero-field cooled (M{sub ZFC}(T)) and field cooled (M{sub FC}(T)) magnetizations show that a moment is induced by the gadolinium on the Pr{sup 3+} ion and on the nickel subsystem. In the ordered phase both induced moments are antiparallel to that of the Gd{sup 3+} ion. A cusp is observed at a temperature T{sub max} in the M{sub ZFC}(T) curve. Both critical temperatures T{sub c} and T{sub max} are found to decrease with increasing praseodymium content, indicating a reduction in strength of the antiparallel coupling for Gd-Pr and Gd-Ni pairs.

  8. Inhibitory Effects of Commonly Used Herbal Extracts on UDP-Glucuronosyltransferase 1A4, 1A6, and 1A9 Enzyme Activities

    Science.gov (United States)

    Mohamed, Mohamed-Eslam F.

    2011-01-01

    The aim of this study was to investigate the effect of commonly used botanicals on UDP-glucuronosyltransferase (UGT) 1A4, UGT1A6, and UGT1A9 activities in human liver microsomes. The extracts screened were black cohosh, cranberry, echinacea, garlic, ginkgo, ginseng, milk thistle, saw palmetto, and valerian in addition to the green tea catechin epigallocatechin gallate (EGCG). Formation of trifluoperazine glucuronide, serotonin glucuronide, and mycophenolic acid phenolic glucuronide was used as an index reaction for UGT1A4, UGT1A6, and UGT1A9 activities, respectively, in human liver microsomes. Inhibition potency was expressed as the concentration of the inhibitor at 50% activity (IC50) and the volume in which the dose could be diluted to generate an IC50-equivalent concentration [volume/dose index (VDI)]. Potential inhibitors were EGCG for UGT1A4, milk thistle for both UGT1A6 and UGT1A9, saw palmetto for UGT1A6, and cranberry for UGT1A9. EGCG inhibited UGT1A4 with an IC50 value of (mean ± S.E.) 33.8 ± 3.1 μg/ml. Milk thistle inhibited both UGT1A6 and UGT1A9 with IC50 values of 59.5 ± 3.6 and 33.6 ± 3.1 μg/ml, respectively. Saw palmetto and cranberry weakly inhibited UGT1A6 and UGT1A9, respectively, with IC50 values >100 μg/ml. For each inhibition, VDI was calculated to determine the potential of achieving IC50-equivalent concentrations in vivo. VDI values for inhibitors indicate a potential for inhibition of first-pass glucuronidation of UGT1A4, UGT1A6, and UGT1A9 substrates. These results highlight the possibility of herb-drug interactions through modulation of UGT enzyme activities. Further clinical studies are warranted to investigate the in vivo extent of the observed interactions. PMID:21632963

  9. Crystallization of Zr2PdxCu1-x and Zr2NixCu1-x Metallic Glass

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Min [Iowa State Univ., Ames, IA (United States)

    2008-01-01

    One interesting aspect of rretallic glasses is the numerous instances of the deviation of the phase selection from the amorphous state to thermodynamically stable phases during the crystallization process. Their devitrification pathways allow us to study the relationship between the original amorphous structure and their crystalline counter parts. Among the various factors of phase selections, size and electronic effects have been most extensively studied. Elucidating the phase selection process of a glassy alloy will be helpful to fill in the puzzle of the changes from disordered to ordered structures. In this thesis, Two model Zr2PdxCu1-x and Zr2NixCu1-x (x = 0, 0.25, 0.5, 0.75 and 1) glassy systems were investigated since: (1) All of the samples can be made into a homogenous metallic glass; (2) The atomic radii differ from Pd to Cu is by 11%, while Ni has nearly the identical atomic size compare to Cu. Moreover, Pd and Ni differ by only one valence electron from Cu. Thus, these systems are ideal to test the idea of the effects of electronic structure and size factors; (3) The small number of components in these pseudo binary systems readily lend themselves to theoretical modeling. Using high temperature X-ray diffraction (HTXRD) and thermal analysis, topological, size, electronic, bond and chemical distribution factors on crystallization selections in Zr2PdxCu1-x and Zr2NixCu1-x metallic glass have been explored. All Zr2PdxCu1-x compositions share the same Cu11b phase with different pathways of meta-stable, icosahedral quasicrystalline phase (i-phase), and C16 phase formations. The quasicrystal phase formation is topologically related to the increasing icosahedral short range order (SRO) with Pd content in Zr2PdxCu1-x system. Meta-stable C16 phase is competitive with

  10. Surface functionalized Cu{sub 2}Zn{sub 1-x}Cd{sub x}SnS{sub 4} quinternary alloyed nanostructure for DNA sensing

    Energy Technology Data Exchange (ETDEWEB)

    Ibraheam, A.S.; Voon, C.H.; Foo, K.L.; Azizah, N. [University Malaysia Perlis, Institute of Nano Electronic Engineering, Kangar, Perlis (Malaysia); Al-Douri, Y. [University of Sidi-Bel-Abbes, Physics Department, Faculty of Science, Sidi Bel-Abbes (Algeria); Gopinath, S.C.B. [University Malaysia Perlis, Institute of Nano Electronic Engineering, Kangar, Perlis (Malaysia); Universiti Malaysia Perlis, School of Bioprocess Engineering, Arau, Perlis (Malaysia); Ameri, M. [Universite Djilali Liabes de Sidi Bel-Abbes, Laboratoire Physico-Chimie des Materiaux Avances (LPCMA), Sidi Bel-Abbes (Algeria); Ibrahim, Sattar S. [University of Anbar, Chemisty Department, College of Science, Al Rumadi (Iraq)

    2017-03-15

    A sensing plate of extended Cu{sub 2}Zn{sub 1-x}Cd{sub x}SnS{sub 4} quinternary alloy nanostructures, fabricated on an oxidized silicon substrate by the sol-gel method, is reported in this paper. The fabricated device was characterized and analyzed via field emission-scanning electron microscopy, X-ray diffraction (XRD), and photoluminescence (PL). The XRD peaks shifted towards the lower angle side alongside increasing concentration of cadmium. The average diameter of the Cu{sub 2}Zn{sub 1-x}Cd{sub x}SnS{sub 4} quinternary alloy nanostructures falls between 21.55 and 43.12 nm, while the shift of the PL bandgap was from 1.81 eV (x = 0) to 1.72 eV (x = 1). The resulting Cu{sub 2}Zn{sub 1-x}Cd{sub x}SnS{sub 4} quinternary alloy nanostructures components were functionalized with oligonucleotides probe DNA molecules and interacted with the target, exhibiting good sensing capabilities due to its large surface-to-volume ratio. The fabrication, immobilization, and hybridization processes were analyzed via representative current-voltage (I-V) plots. Its electrical profile shows that the device is capable to distinguish biomolecules. Its high performance was evident from the linear relationship between the probe DNA from cervical cancer and the target DNA, showing its applicability for medical applications. (orig.)

  11. 26 CFR 1.312-4 - Examples of adjustments provided in section 312(c).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Examples of adjustments provided in section 312... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Effects on Corporation § 1.312-4 Examples of adjustments... examples: Example 1. On December 2, 1954, Corporation X distributed to its sole shareholder, A, an...

  12. Ionic liquid promoted one pot approach for the synthesis of pyrido[1,2-c][1,3,5]thiadiazin-4-ones and thiazolo[3,2-c][1,3,5]thiadiazin-4-ones in water

    Directory of Open Access Journals (Sweden)

    I.R. Siddiqui

    2018-02-01

    Full Text Available A novel three component one pot methodology for rapid access to pyrido[1,2-c][1,3,5]thiadiazin-4-ones and thiazolo[3,2-c][1,3,5]thiadiazin-4-ones has been developed. A task specific ionic liquid [bmIm]SCN has been used as thiocyanating reagent. The reaction provides high yields of the product and proceeds at ambient reaction conditions in water. The use of water as the reaction medium and easy recyclability of the ionic liquid used as a reagent as well as promoter of the reaction endows the reaction with green aspects.

  13. Reduction of the Curie temperature in the multiferroic Bi5Fe1+xTi3−xO15 solid solution

    International Nuclear Information System (INIS)

    Salazar-Kuri, U; Mendoza, M E; Silva, R; Siqueiros, J M; Gervacio-Arciniega, J J

    2014-01-01

    In this work, the phase diagram of the system Bi 4 Ti 3 O 12 -BiFeO 3 in the region of the solid solution Bi 5 Fe 1+x Ti 3−x O 15 was refined. The limit of solubility was determined to be at x = 0.1. The Curie temperature (T C ) of the ferroelectric phase transition was determined by dielectric permittivity measurements at 100 kHz for the phase Bi 5 FeTi 3 O 15 as well as for the solid solution. A decrease in T C from 750 °C to 742 °C (solid solution at x = 0.1) was found. These results can be explained in terms of the perturbation of the oxygen octahedral perovskite layers resulting from the substitution of Ti 4+ by Fe 3+ ions. (paper)

  14. Effects of sulfurization on the optical properties of Cu2ZnxFe1-xSnS4 thin films

    Science.gov (United States)

    Hannachi, A.; Oueslati, H.; Khemiri, N.; Kanzari, M.

    2017-10-01

    In order to prepare thin films of novel semiconductor materials that contain only earth abundant, low cost and nontoxic elements, Cu2ZnxFe1-xSnS4 ingots were successfully synthesized by direct fusion method. Crushed powders of these ingots were used as raw materials for the thermal evaporation. Cu2ZnxFe1-xSnS4 (with x = 0, 0.25, 0.5, 0.75 and 1) thin films were deposited on non-heated glass substrates by vacuum evaporation method. The as deposited films were sulfurized for 30 min at sulfurization temperature Ts = 400 °C. The effects of the sulfurization on the structural and optical properties of CZFTS films were realized by X-ray diffraction (XRD) and UV-Vis spectroscopy. XRD patterns show that all sulfurized CZFTS films were polycrystalline in nature with a preferential orientation along the (112) plane. CFTS films exhibit a stannite structure while CZTS films had a kesterite structure. Optical measurements showed that CZFTS films sulfurized at 400 °C exhibited an optical transmittance between 60 and 80% and all materials had relatively high absorption coefficients in the range of 104-105 cm-1. The band gap energies of sulfurized CZFTS films decreased from 1.71 to 1.50 eV with the increase of the Zn content. The dispersion of the refractive index was discussed in terms of the single oscillator model proposed by Wemple and DiDomenico and the optical parameters such as refractive index, extinction coefficient, oscillator energy and dispersion energy were calculated. The electrical free carrier susceptibility and the carrier concentration on the effective mass ratio were evaluated according to the model of Spitzer and Fan. The hot probe analysis showed that all sulfurized CZFTS films are p-type conductivity.

  15. Magnetic tri-axial orientation in (Y1-xErx)2Ba4Cu7O15-y superconductors

    International Nuclear Information System (INIS)

    Horii, S.; Okuhira, S.; Yamaki, M.; Haruta, M.; Maeda, T.; Shimoyama, J.

    2011-01-01

    (Y 1-x Er x ) 2 Ba 4 Cu 7 O 15-y [(Y,Er)247] was synthesized for clarifying a magnetic role of Er ion. The three magnetization axes of (Y,Er)247 were obtained from tri-axial orientation using a modulated rotation magnetic field. Magnetic anisotropy of Er ion is roughly ten times higher than that for Y247 at room temperature. Importance of rare-earth ions was shown for reduction of required magnetic fields in the tri-axial magnetic orientation. We report the tri-axial grain-orientation effects under a modulated rotation magnetic field for (Y 1-x Er x ) 2 Ba 4 Cu 7 O y [(Y, Er)247]. The magnetic easy axis at room temperature was drastically changed around x ∼ 0.1; however, the Er-doping levels for the conversion of magnetic easy axes from the c-axis to the ab-direction and from the a- to b-axes were quite different. Tri-axial single-ion magnetic anisotropy of Er 3+ was roughly 10 times greater than tri-axial magnetic anisotropy generated by both the superconducting CuO 2 plane and the blocking Cu-O chain layer. An appropriate choice of rare-earth (RE) ions in RE-based cuprate superconductors enables the reduction of the required magnetic field for the production of bulks and thick films based on the magnetic orientation technique.

  16. Box-Behnken factorial design to obtain a phenolic-rich extract from the aerial parts of Chelidonium majus L.

    Science.gov (United States)

    Grosso, Clara; Ferreres, Federico; Gil-Izquierdo, Angel; Valentão, Patrícia; Sampaio, Maria; Lima, Júlio; Andrade, Paula B

    2014-12-01

    A Box-Behnken design (BBD) was developed to study the influence of four parameters (X1: % methanol; X2: extraction time; X3: extraction temperature; X4: solid/solvent ratio) on two responses, namely extraction yield and phenolics content of the aerial parts of Chelidonium majus L. The model presented a good fit to the experimental results for the extraction yield, being significantly influenced by X1 and X4. On the other hand a parameter reduction was necessary to run the model for phenolics content, showing that only X1 and X2 had great influence on the response. Two best extraction conditions were defined: X1=76.8% MeOH, X2=150.0 min, X3=60.0°C and X4=1:100 and X1=69.2%, X2=150 min, X3=42.5°C and X4=1:100. Moreover, the HPLC-DAD-ESI/MS(n) analysis conducted with the center point sample revealed the presence of 15 alkaloids and 15 phenolic compounds, from which the 9 flavonoids and 3 hydroxycinnamic acids are described for the first time. Only phenolic compounds were quantified by a validated HPLC-DAD method, the pair quercetin-3-O-rutinoside+quercetin-3-O-glucoside dominating all the 29 extracts. This study is of great importance for future works that seek to apply the phenolic profile to the quality control of C. majus samples. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. Dissociative adsorption of CCl 4 on the Fe 3O 4(1 1 1)-(2×2) selvedge of α-Fe 2O 3(0 0 0 1)

    Science.gov (United States)

    Adib, K.; Mullins, D. R.; Totir, G.; Camillone, N.; Fitts, J. P.; Rim, K. T.; Flynn, G. W.; Osgood, R. M.

    2003-02-01

    The surface reactions of CCl 4 with the Fe 3O 4(1 1 1)-(2×2) selvedge of naturally occurring α-Fe 2O 3(0 0 0 1) single-crystals have been investigated using synchrotron X-ray photoelectron spectroscopy (XPS) and temperature-programmed desorption (TPD). CCl 4 was found to dissociate on the Fe 3O 4 surface at 100 K producing chemisorbed Cl and adsorbed CCl 2. TPD shows that the large majority of the dissociatively adsorbed CCl 2 fragments extract lattice oxygen and desorb as phosgene at >275 K. However, the XPS spectra show no evidence for the formation of surface-bound phosgene, at 100 K, indicating that its formation involves two steps. The first step, dissociation, is spontaneous at 100 K, whereas the second, oxygen atom abstraction to form phosgene, requires thermal excitation. Cl chemisorption yielded two separate species, the mono- and dichloride terminations of surface iron sites. The identification of these two surface terminations is based on the coverage dependence and the surface temperature history of their Cl 2p 3/2 peak intensity. For example, heating to >450 K allows the monochloride to transform into iron dichloride, indicating Cl adatom mobility at these temperatures.

  18. Permeability and giant magnetoimpedance in Co69Fe4.5X1.5Si10B15 (X=Cr, Mn, Ni) amorphous ribbons

    International Nuclear Information System (INIS)

    Byon, Kwang Seok; Yu, Seong-Cho; Kim, Cheol Gi

    2001-01-01

    The magnetoimpedance (MI) has been measured in the amorphous ribbons of the soft ferromagnetic alloy Co 69 Fe 4.5 X 1.5 Si 10 B 15 (X=Cr, Mn, Ni) as functions of frequency (f). For all of the three samples, at low frequency, f≤5MHz, the MI ratio increases with increasing frequency, but the MI ratio decreases at high frequency, f≥5MHz. The MI profiles are not changed at low frequency regions of f≤1MHz in the amorphous ribbons. The MI ratio at high frequency of f=5MHz becomes 57% in Co 69 Fe 4.5 Cr 1.5 Si 10 B 15 , but the MI ratio becomes 30% in Co 69 Fe 4.5 Mn 1.5 Si 10 B 15 and Co 69 Fe 4.5 Ni 1.5 Si 10 B 15 . The MI ratio at f=10MHz becomes 45% in Co 69 Fe 4.5 Cr 1.5 Si 10 B 15 and the MI ratio becomes 23% in Co 69 Fe 4.5 Mn 1.5 Si 10 B 15 and Co 69 Fe 4.5 Ni 1.5 Si 10 B 15 , respectively. The maximum values of field sensitivity are 2.7(X=Cr), 2.5(X=Mn), 2.2(X=Ni)%/Oe for f=5MHz. [copyright] 2001 American Institute of Physics

  19. Vapor-Liquid Equilibrium in the Mixture 1,1-Difluoroethane C2H4F2 + C4H8 2-Methylpropene (EVLM1131, LB5730_E)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume A 'Binary Liquid Systems of Nonelectrolytes I' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Vapor-Liquid Equilibrium in the Mixture 1,1-Difluoroethane C2H4F2 + C4H8 2-Methylpropene (EVLM1131, LB5730_E)' providing data from direct measurement of pressure and mole fraction in vapor phase at variable mole fraction in liquid phase and constant temperature.

  20. Fe site occupancy and superconductivity in Y1-zCazBaz(Cu1-xFex)3O6+y

    International Nuclear Information System (INIS)

    Smith, M.G.; Taylor, R.D.; Oesterreicher, H.

    1990-01-01

    X-ray diffraction and 57 Fe Moessbauer spectroscopy studies show that partial substitution of Ca for Y in Y 1-z Ca z Ba 2 (Cu 1-x Fe x ) 3 O 6+y (0.05 ≤ z ≤ 0.15,0.003 ≤ x ≤ 0.20) result in increased Fe solubility and a larger percentage of Fe occupancy of the Cu(2) plane site (prepared conventionally). Materials with z > 0.00 have a slightly depressed superconducting transition onset temperature T c relative to the z = 0.00 compounds. It is also shown that Fe occupancy of the Cu(2) site in Y 1-z Ca z Ba 2 (Cu 1-x Fe x ) 3 O 6+y can be substantially increased when these materials are treated at high temperatures in inert atmospheres followed by oxygenation at low temperatures. T c decreases more rapidly in these latter materials compared to the conventionally prepared ones. Implications concerning ordered Fe cluster formation and superconducting pair breaking in the Cu(2) site are drawn. 7 refs., 4 tabs

  1. Synthesis and photocatalytic degradation study of methylene blue dye under visible light irradiation by Fe1-xBixVO4 solid solutions (0 ≤ x1.0)

    Science.gov (United States)

    Bera, Ganesh; Reddy, V. R.; Mal, Priyanath; Das, Pradip; Turpu, G. R.

    2018-05-01

    The novel hetero-structures Fe1-xBixVO4 solid solutions (0 ≤ x1.0) with the two dissimilar end member of FeVO4 - BiVO4, were successfully synthesized by the standard solid state reaction method. The structural and chemical properties of as prepared photo-catalyst samples were characterized by X-ray diffraction (XRD), Raman spectroscopy, Fourier transform infrared spectroscopy (FT-IR) and UV-visible absorption spectroscopy techniques. It is confirmed from the results of XRD, Raman and FT-IR that FeVO4 and BiVO4 are in triclinic (space group P-1 (2)) and monoclinic (space group I2/b (15)) phases respectively. The Bi incorporation into Fe site of FeVO4 emerges as hetero-structures of both the end members of the solid solutions. In addition, the photocatalytic activity in the degradation of methylene blue (MB) dye under visible light irradiation was carried out through UV-visible spectroscopy measurement of photo-catalysts FeVO4, BiVO4 and mixed phases of both photo-catalyst. The results indicate that under visible light irradiation the photocatalytic activity of mixed phases were very effective and higher than the both single phases of the solid solutions. The composition x= 0.25 exhibits an excellent photocatalytic property for the degradation of MB solution under visible light irradiation rather than other.

  2. LaNi1-xCoxO3-δ (x=0.4 to 0.7) cathodes for solid oxide fuel cells by infiltration

    DEFF Research Database (Denmark)

    Chrzan, Aleksander; Ovtar, Simona; Chen, Ming

    2015-01-01

    Performance of LaNi1-xCoxO3-δ (LNC) (x=0.4 to 0.7) as a cathode in solid oxide fuel cell (SOFC) is evaluated. Symmetrical cathode/electrolyte/cathode cells for electrochemical testing are prepared by infiltration of yttria stabilized zirconia (YSZ) backbone with LNC solutions. It is showed...... that the cathode infiltrated with LaNi0.5Co0.5O3-δ (LNC155) has the lowest polarization resistance and activation energy, 197 mΩ cm2 at 600 °C and 0.91 eV, respectively. Therefore it is the most promising material of the LNC group for electrochemical applications. X-ray diffraction analysis revealed that none...

  3. Zn{sub x-1}Cu{sub x}Mn{sub 2}O{sub 4} spinels; synthesis, structural characterization and electrical evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Mendez M, F.; Lima, E.; Bosch, P.; Pfeiffer, H. [UNAM, Instituto de Investigaciones en Materiales, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Gonzalez, F., E-mail: pfeiffer@iim.unam.m [Universidad Autonoma Metropolitana, Unidad Iztapalapa, Av. San Rafael Atlixco No. 186, Col. Vicentina, 09340 Mexico D. F. (Mexico)

    2010-07-01

    This work presents the structural characterization and electrical evaluation of Zn{sub x-1}Cu{sub x}Mn{sub 2}O{sub 4} spinels, which are materials presented as secondary phases into the vari stor ceramic systems. Samples were analyzed by X-ray diffraction, solid-state nuclear magnetic resonance, infrared spectroscopy, scanning electron microscopy and impedance spectroscopy. Although, the addition of copper to the ZnMn{sub 2}O{sub 4} spinel did not produce morphological changes, the structure and electrical behaviors changed considerably. Structurally, copper addition induced the formation of partial inverse spinels, and its addition increases significantly the electrical conductivity. Therefore, the formation of Zn{sub x-1}Cu{sub x}Mn{sub 2}O{sub 4} spinels, as secondary phases into the vari stor materials, may compromise significantly the vari stor efficiency. (Author)

  4. Mössbauer and magnetic studies of Mg{sub 1+2x}Sb{sub x}Fe{sub 2−3x}O{sub 4} spinel ferrites

    Energy Technology Data Exchange (ETDEWEB)

    Widatallah, H.M., E-mail: hishammw@squ.edu.om [Department of Physics, College of Science, Sultan Qaboos University, 123 Muscat (Oman); Al-Mamari, F.A.S.; Al-Saqri, N.A.M.; Gismelseed, A.M.; Al-Omari, I.A.; Al-Shahumi, T.M.H. [Department of Physics, College of Science, Sultan Qaboos University, 123 Muscat (Oman); Alhaj, A.F. [Department of Physics, Qasim University, Al-Qasim (Saudi Arabia); Abo El Ata, A.M. [Department of Physics, Faculty of Science, Tanta University, Tanta (Egypt); Elzain, M.E. [Department of Physics, College of Science, Sultan Qaboos University, 123 Muscat (Oman)

    2013-06-15

    Spinel-related Mg{sub 1+2x}Sb{sub x}Fe{sub 2−3x}O{sub 4} samples (x = 0.0, 0.05, 0.10, 0.15, 0.20, and 0.30) prepared using the conventional double sintering technique were investigated using {sup 57}Fe Mössbauer spectroscopy and magnetic measurements. Mössbauer spectra favor a cationic distribution of the form (Mg{sub δ}Fe{sub 1−δ}){sup A}[Mg{sub 1+2x−δ}Sb{sub x}Fe{sub 1+δ−3x}]{sup B}O{sub 4} among the tetrahedral-A and octahedral-B sites of the spinel structure. The cation distribution parameter (δ) was found to vary with the Sb{sup 5+} concentration (x). The Mössbauer hyperfine magnetic fields at both sites and the Curie temperatures of the ferrites decrease as x increases. This was attributed to gradual weakening in the magnetic exchange interaction as more Fe{sup 3+} ions are substituted by diamagnetic Sb{sup 5+} and Mg{sup 2+} ones. The sample with x = 0.30 exhibits short range magnetic order due to cationic clustering and/or superparamagnetism. The magnetization of all samples was found to be temperature-dependent implying that δ depends on temperature in addition to x. At low temperatures the substituted ferrites (x ≠ 0.0) unexpectedly exhibit higher magnetization values relative to that of the pure ferrite MgFe{sub 2}O{sub 4}. This behavior, while at variance with the Néel's model for ferrimagnetism, is explicable in terms of the spin canting mechanism proposed in the Yafet–Kittel model. - Highlights: ► A Mössbauer and magnetic study of Sb{sup 5+} and Mg{sup 2+} co-substituted ferrites of the composition Mg{sub 1+2x}Sb{sub x}Fe{sub 2−3x}O{sub 4} is reported. ► The cation distribution in Mg{sub 1+2x}Sb{sub x}Fe{sub 2−3x}O{sub 4} is shown to depend on both the Sb{sup 5+} ionic concentration and the temperature. ► The A–B magnetic exchange interaction and Mössbauer hyperfine fields weaken with increasing Sb{sup 5+} and Mg{sup 2+} concentrations. ► The magnetization of the substituted samples with x ≠ 0.00 increases

  5. Interpretation of the Raman spectra of the glassy states of Si{sub x}S{sub 1x} and Si{sub x}Se{sub 1x}

    Energy Technology Data Exchange (ETDEWEB)

    Devi, V. Radhika [M.L.R. Institute of Technology, Affiliated to Jawaharlal Nehru Technological University, Dundigal, Hyderabad 500043 (India); Zabidi, Noriza Ahmad [Department of Physics, Centre for Defence Foundation Studies, National Defence University of Malaysia, Kem Sungai Besi, Kuala Lumpur 57000 (Malaysia); Shrivastava, Keshav N., E-mail: keshav1001@yahoo.com [School of Physics, University of Hyderabad, Hyderabad 50046 (India); Department of Physics, University of Malaya, Kuala Lumpur 50603 (Malaysia)

    2013-09-16

    We use the density-functional theory to make models of Si{sub x}S{sub y} and Si{sub x}Se{sub y} for the values of x,y = 1–6. The vibrational frequencies are calculated for each model. The stable clusters are selected on the basis of positive vibrational frequencies. In the case of Si{sub x}S{sub 1x}, the values of the vibrational frequencies calculated from the first principles for Si{sub 2}S(triangular)cluster of atoms, 364.1 cm{sup −1} and 380.8 cm{sup −1}, agree with the experimentally measured values of 367 cm{sup −1} and 381 cm{sup −1}, indicating that Si{sub 2}S clusters occur in the glassy state of SiS. The calculated values of the vibrational frequencies of SiSe{sub 4} (pyramidal) which agree with the experimental Raman frequencies of glassy Si{sub x}Se{sub 1x} are 114, 166 and 361 cm{sup −1}. The calculated values for Si{sub 2}Se{sub 4} (bipyramidal) which agree with the experimental data of Si{sub x}Se{sub 1x} are 166 and 464 cm{sup −1}. In Si{sub 4}Se (pyramidal) the values 246 and 304 cm{sup −1} agree with the measured values. In Si{sub 4}Se{sub 2} (bipyramidal), the calculated values 162, 196 and 304 cm{sup −1} agree with the measured values. The calculated values of 473 cm{sup −1} for Si{sub 6}Se{sub 2} (bipyramidal) also agree with the experimentally measured values. We thus find that pyramidal structures are present in the amorphous Si{sub x}Se{sub 1x} glassy state. - Highlights: • A first principles calculation is performed to calculate the vibrational frequencies. • The calculated frequencies of clusters agree with measured Raman values. • The structures, bond lengths and symmetries are determined. • The importance of Jahn–Teller effect in SiS and in SiSe is clearly seen. • The clusters of SiS and SiSe are found to stabilize in different symmetries.

  6. Fitness and Recreation Career Ladder AFSC 741X1.

    Science.gov (United States)

    1987-12-01

    all first-termers who monitor equipment and weightlifters . Gymnasium Attendants are performing very few tasks (average of 27 tasks). Most of their...has a TD of 4.84 (below the average of 5). But this task, if not accomplished properly, could lead to injury . Therefore, TE was high on this task. A

  7. Studies on the Ln/sub 2/O/sub 3/ (Ln: rare-earth elements)-SrO-V/sub 2/O/sub 3/ system, 2. Some physical properties for Ln sub(1-x)Sr sub(x)VO sub(3-0. 1x) and SrO. Ln sub(1-x)Sr sub(x)VO sub(3-0. 1x) (Ln: Nd or Eu)

    Energy Technology Data Exchange (ETDEWEB)

    Shin-ike, T [Osaka Dental Coll., Hirakata (Japan); Adachi, G; Shiokawa, J

    1981-01-01

    Electrical and magnetic properties of the perovskite type solid solutions, Ln sub(1-x)Sr sub(x)VO sub(3-0.1x) (Ln: Nd or Eu), and the K/sub 2/NiF/sub 4/ type solid solutions, SrO.Ln sub(1-x)Sr sub(x)VO sub(3-0.1x) (Ln: Nd or Eu), were studied in the temperature range 77 - 300 K. The electrical conductivity increased with x for the perovskite type solid solutions and the reverse behavior was observed for the K/sub 2/NiF/sub 4/ type compounds. All the solid solutions examined exhibited a metal-insulator transition at some values of x. Both Nd sub(1-x)Sr sub(x)VO sub(3-0.1x) and Eu sub(1-x)Sr sub(x)VO sub(3-0.1x) were antiferromagnets having a weak ferromagnetism at a low value of x at a low temperature. The K/sub 2/NiF/sub 4/ type solid solutions revealed a weak ferromagnetism at a high value of x at a low temperature.

  8. Pinning-free GaAs MIS structures with Si interface control layers formed on (4 x 6) reconstructed (0 0 1) surface

    Energy Technology Data Exchange (ETDEWEB)

    Anantathanasarn, Sanguan; Hasegawa, Hideki

    2003-06-30

    (0 0 1)-Oriented GaAs metal-insulator-semiconductor (MIS) structures having a silicon interface control layer (Si ICL) were fabricated on surfaces having Ga-rich (4x6) reconstructions. Si ICL was grown by molecular beam epitaxy. MIS structures were fabricated by partially converting Si ICL to SiN{sub x} by direct nitridation, and further depositing a thick SiO{sub 2} layer on top as the main passivation dielectric by plasma-assisted chemical vapor deposition. Reflection high-energy electron diffraction, in situ X-ray photoelectron spectroscopy and MIS capacitance-voltage (C-V) techniques were used for characterization. The initial surface reconstruction was found to have a surprisingly strong effect on the degree of Fermi level pinning at the MIS interface. In contrast to the standard As-rich (2x4) surface, which results in strongly pinned MIS interfaces, the novel SiO{sub 2}/SiN{sub x}/Si ICL/GaAs MIS structures formed on ''genuine'' (4x6) surface realized complete unpinning of Fermi level over the entire band gap with a minimum interface state density of 4x10{sup 10} cm{sup -2} eV{sup -1} range.

  9. An Investigation of the Magnetic Structure and Excitations in K2CoxFe1-xF4

    DEFF Research Database (Denmark)

    Higgins, S.A.; Couley, R.A.; Hagen, M.

    1984-01-01

    Neutron scattering techniques have been used to investigate the magnetic structure of K2CoxF1-xF4 with x=0.2 and x=0.6. The x=0.6 sample exhibits only one magnetic phase transition, at TN=92.2+or-0.1K. The x=0.2 sample has two magnetic phase transitions; below TN=66+or-1K the axial spin components...

  10. Crystal structures of three co-crystals of 1,2-bis-(pyridin-4-yl)ethane with 4-alk-oxy-benzoic acids: 4-eth-oxy-benzoic acid-1,2-bis-(pyridin-4-yl)ethane (2/1), 4-n-propoxybenzoic acid-1,2-bis(pyridin-4-yl)ethane (2/1) and 4-n-but-oxy-benzoic acid-1,2-bis-(pyridin-4-yl)ethane (2/1).

    Science.gov (United States)

    Tabuchi, Yohei; Gotoh, Kazuma; Ishida, Hiroyuki

    2015-11-01

    The crystal structures of three hydrogen-bonded co-crystals of 4-alk-oxy-benzoic acid-1,2-bis-(pyridin-4-yl)ethane (2/1), namely, 2C9H10O3·C12H12N2, (I), 2C10H12O3·C12H12N2, (II), and 2C11H14O3·C12H12N2, (III), have been determined at 93, 290 and 93 K, respectively. In (I), the asymmetric unit consists of one 4-eth-oxy-benzoic acid mol-ecule and one half-mol-ecule of 1,2-bis-(pyridin-4-yl)ethane, which lies on an inversion centre. In (II) and (III), the asymmetric units each comprise two crystallographically independent 4-alk-oxy-benzoic acid mol-ecules and one 1,2-bis-(pyridin-4-yl)ethane mol-ecule. In each crystal, the two components are linked by O-H⋯N hydrogen bonds, forming a linear hydrogen-bonded 2:1unit of the acid and the base. Similar to the structure of 2:1 unit of (I), the units of (II) and (III) adopt nearly pseudo-inversion symmetry. The 2:1 units of (I), (II) and (III) are linked via C-H⋯O hydrogen bonds, forming tape structures.

  11. Global behavior of the difference equation $x_{n+1}=\\frac{Ax_{n-1}} {B-Cx_{n}x_{n-2}}$

    Directory of Open Access Journals (Sweden)

    R. Abo-Zeid

    2013-11-01

    Full Text Available The aim of this work is to investigate the global stability, periodic nature, oscillation and the boundedness of all admissible solutions of the difference equation $x_{n+1}=\\frac{Ax_{n-1}} {B-Cx_{n}x_{n-2}}$, n=0,1,2,... where A, B, C are positive real numbers.

  12. Galactagogue effects of Musa x paradisiaca flower extract on lactating rats.

    Science.gov (United States)

    Mahmood, Azizah; Omar, Muhammad Nor; Ngah, Nurziana

    2012-11-01

    To investigate the potential of Musa x paradisiaca (M. x paradisiaca) flower extracts in promoting milk production of lactating rats and its effects on growth of the suckling pups. Galactagogue activity was evaluated in terms of quantity of milk produced from the rats treated with petroleum ether, ethanol or water extracts of the flower. Lactating rats (n = 5) of Spraque Dawley with six pups each were administered with the extracts in the amount of 500 mg/kg body weight, while the control rats were given an equivalent amount of distilled water. The rats were daily administered via oral feeding starting from Day 5 until Day 14 and the performance of milk production was measured along the experimental period by weight-suckle-weight method. Results were statistically analyzed using SPSS by means of ANOVA at 0.05 and was expressed as their mean?standard deviation. The rates of pups' growth were measured as the weight gain along the experimental period. The rats treated with aqueous extract produced higher milk than control and ethanol groups. Aqueous extract was identified to increase milk production by 25%, while petroleum ether extract by 18%. The mean of yields produced by the rats during suckling period for aqueous, petroleum ether, ethanol and control were 4.62±2.45, 4.37±1.93, 3.65±1.89 and 3.69±1.79, respectively. Growth rates of pups for the rats treated with control, aqueous, ethanol extract and petroleum ether were (1.85±0.49), (1.78±0.56), (1.65±0.46) and (1.56±0.42) g/pup, respectively. The present study reveals the potential of M. x paradisiaca flower to enhance milk production of nursing mothers which could be exploited for commercialization of the isolated extract. Copyright © 2012 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

  13. Deposition and characterization of graded Cu(In{sub 1-x}Ga{sub x})Se{sub 2} thin films by spray pyrolysis

    Energy Technology Data Exchange (ETDEWEB)

    Babu, B.J. [Department of Electrical Engineering-SEES, CINVESTAV-IPN, Avenida IPN 2508, San Pedro Zacatenco, D.F. C.P 07360 (Mexico); Institute of Molecules and Materials, UMR-CNRS 6283, Université du Maine, Avenue O. Messiaen, F-72085 Le Mans (France); Velumani, S., E-mail: velu@cinvestav.mx [Department of Electrical Engineering-SEES, CINVESTAV-IPN, Avenida IPN 2508, San Pedro Zacatenco, D.F. C.P 07360 (Mexico); College of Information and Communication Engineering, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Kassiba, A. [Institute of Molecules and Materials, UMR-CNRS 6283, Université du Maine, Avenue O. Messiaen, F-72085 Le Mans (France); Asomoza, R. [Department of Electrical Engineering-SEES, CINVESTAV-IPN, Avenida IPN 2508, San Pedro Zacatenco, D.F. C.P 07360 (Mexico); Chavez-Carvayar, J.A. [Instituto Investigaciones en Materiales-UNAM, Ciudad Universitario, D.F.Mexico (Mexico); Yi, Junsin, E-mail: yi@yurim.skku.ac.kr [College of Information and Communication Engineering, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of)

    2015-07-15

    Cu(In{sub 1-x}Ga{sub x})Se{sub 2} (CIGS) thin films and their graded (x = 1 to 0) layer were grown on soda lime glass substrates using chemical spray pyrolysis (CSP) at different substrate temperatures (T{sub s}). After optimization of T{sub s}, depositions were carried out at different gallium composition (x) at optimized temperature of 350 °C. All the films deposited at T{sub s} ≥ 350 °C were polycrystalline chalcopyrite structure, with a preferential orientation of (112), including the graded layer. With increase in x, lattice parameters a and c were observed to decrease. Line scan of the CIGS layer showed intersection of gallium and indium concentrations, revealing the graded nature of the film. Composition dependence of Raman peak for CuInSe{sub 2} (CIS) deposited by CSP was analyzed. Optical transmittance at a wavelength of 800 nm of the film with x = 0 (CIS) (30%) was found lower than that of the film grown with x = 0.82 (CIGS) (50%). Cusp-shape of the resistivity was observed with an increase of x leading to steep rise in resistivity of the films (1.61–71.68 Ω-cm) till x = 0.42 and then decreased to 4.78 Ω-cm at x = 0.82. Carrier concentrations of the films were evaluated in the order of 10{sup 16}–10{sup 19} cm{sup −3} with p-type conductivity. These results indicate that graded CIGS thin films with modulated gallium composition can be prepared by CSP. - Graphical abstract: Display Omitted - Highlights: • Optimization of the spray deposition system for device grade chalcopyrite CIGS films. • Optimized substrate temperature to obtain single-phase CIGS by spray deposition. • Detailed report on compositional dependence of CuInSe{sub 2} (CIS) thin films. • Systematic analysis of the influence of Ga in CIS by spray deposition. • Bowing parameter is extracted from the experiment values.

  14. Control of Ge1-x-ySixSny layer lattice constant for energy band alignment in Ge1-xSnx/Ge1-x-ySixSny heterostructures

    Science.gov (United States)

    Fukuda, Masahiro; Watanabe, Kazuhiro; Sakashita, Mitsuo; Kurosawa, Masashi; Nakatsuka, Osamu; Zaima, Shigeaki

    2017-10-01

    The energy band alignment of Ge1-xSnx/Ge1-x-ySixSny heterostructures was investigated, and control of the valence band offset at the Ge1-xSnx/Ge1-x-ySixSny heterointerface was achieved by controlling the Si and Sn contents in the Ge1-x-ySixSny layer. The valence band offset in the Ge0.902Sn0.098/Ge0.41Si0.50Sn0.09 heterostructure was evaluated to be as high as 330 meV, and its conduction band offset was estimated to be 150 meV by considering the energy bandgap calculated from the theoretical prediction. In addition, the formation of the strain-relaxed Ge1-x-ySixSny layer was examined and the crystalline structure was characterized. The epitaxial growth of a strain-relaxed Ge0.64Si0.21Sn0.15 layer with the degree of strain relaxation of 55% was examined using a virtual Ge substrate. Moreover, enhancement of the strain relaxation was demonstrated by post-deposition annealing, where a degree of strain relaxation of 70% was achieved after annealing at 400 °C. These results indicate the possibility for enhancing the indirect-direct crossover with a strained and high-Sn-content Ge1-xSnx layer on a strain-relaxed Ge1-x-ySixSny layer, realizing preferable carrier confinement by type-I energy band alignment with high conduction and valence band offsets.

  15. X-ray diffraction and Moessbauer study of (Fe1-xNi x)4N (0.2 ≤ x ≤ 0.6) films

    International Nuclear Information System (INIS)

    El Khiraoui, S.; Sajieddine, M.; Vergnat, M.; Sahlaoui, M.; Bauer, Ph.; Mabrouki, M.

    2007-01-01

    Single phase (Fe 1-x Ni x ) 4 N compounds (0.2 ≤ x ≤ 0.6) have been synthesized by reactive evaporation and investigated by X-ray diffraction and Moessbauer spectrometry. The lattice parameters of the nitrides decrease from 3.796 to 3.774 A with increasing Ni concentration. The fitting results of Moessbauer spectra indicate that the average hyperfine field have the same changing tendency with lattice parameter and the nickel atoms have a tendency to be located at the corner site

  16. Biphasic effect of duodenal ulcerogens cysteamine (C), mepirizole (M) and 1-methyl-4-phenyl-1,2,3,6-tetrahydropryridine (MPTP) on gastric emptying in the rat

    Energy Technology Data Exchange (ETDEWEB)

    Pihan, G.; Kline, T.J.; Szabo, S.

    1986-03-01

    The effect of acute or chronic administration of duodenal ulcerogens on gastric emptying (GE) of a liquid meal was investigated. In Sprague-Dawley rats (150-200g) 2 ml of /sup 51/Cr in 2% dextrose (5000 CPM) was given intragastrically and the GE half life was established as 7.6 min (controls). In acute experiments, C (30mg/100g), M (40mg/100g) or MPTP (4mg/100g) injected subcutaneously all delayed GE at 1, 2, 4, 8 and 24 hr by 15-77%. Maximal GE delay (p<0.05) by 77, 48 or 71% was found 1, 1 or 2 hr after C, M or MPTP, respectively. In chronic experiments, C (22mg/100g) was given x3 on the first day and once daily (25mg/100g) for 3 or 10 additional days. M (20mg/100g) once daily and MPTP (4mg/100g) x3 daily were given for 4 or 11 days. GE was measured on the 5th and 12th day. Chronically, MPTP accelerated GE by 63 and 31% at 5 and 12 days (p<0.05) and C and M did not change GE. The severity of duodenal ulcers correlated (p<0.05) with the amount of /sup 51/Cr remaining in the stomach: r=-0.68, -0.74 and -0.70 after C, M and MPTP, respectively. Acute administration of duodenal ulcerogens delay GE in rats. Chronic treatment with duodenal ulcerogens either accelerates or does not change GE. The most severe chronic ulcers exhibit the most rapid emptying. The authors data suggest that rapid GE might be a secondary rather than a primary alteration in duodenal ulceration.

  17. Implantation induced electrical isolation of sulphur doped GaN xAs1-x layers

    International Nuclear Information System (INIS)

    Ahmed, S.; Lin, J.; Haq, A.; Sealy, B.

    2005-01-01

    The study of III-N-V semiconductor alloys, especially GaN x As 1-x has been increasing in the last few years. The strong dependence of the band gap on the nitrogen content has made this material important for a variety of applications, including long wavelength optoelectronic devices and high efficiency solar cells. We report on the effects of sulphur doping implants on the achieved electrical isolation in GaN x As 1-x layers using proton bombardment. Sulphur ions were implanted in MOCVD-grown GaN x As 1-x layers (1.4 μm thick with nominal x = 1%) with multiple energies creating approximately uniform doping profiles in the range of about 1 x 10 18 -5 x 10 19 cm -3 . Several proton implants were performed in order to find the threshold dose (minimum dose to achieve maximum sheet resistivity) for the electrical isolation of n-type GaN x As 1-x layers. Results show that the sheet resistance of n-type layers can be increased by about five orders of magnitude by proton implantation and the threshold dose to convert a conductive layer to a highly resistive one depends on the original free carrier concentration. The study of annealing temperature dependence of sheet resistivity in proton-isolated GaN x As 1-x layers shows that the electrical isolation can be preserved up to 450 and 500 deg. C when the implantation is performed at RT and 77 K with threshold dose, respectively. These results for n-type GaN x As 1-x layers are novel and have ramifications for device engineers

  18. Legendre polynomial modeling for vibrations of guided Lamb waves modes in [001]c, [011]c and [111]c polarized (1-x)Pb(Mg1/3Nb2/3)O3-xPbTiO3 (x = 0.29 and 0.33) piezoelectric plates: Physical phenomenon of multiple intertwining of An and Sn modes

    Science.gov (United States)

    Othmani, Cherif; Takali, Farid; Njeh, Anouar

    2017-12-01

    Guided wave devices have recently become one of the most important applications in the industry because such waves are directly related to applications in sensor technology, chemical sensing, agricultural science, fields of bio-sensing and surface acoustic wave (SAW) devices that are used in electronic filters and signal processing. On that account, this numerical investigation aims to study the propagation behavior of guided Lamb waves in a (1-x)Pb(Mg1/3Nb2/3)O3- x PbTiO3 [PMN- x PT] ( x=0.29 or 0.33) piezoelectric single crystal plate. In fact, the PMN- xPT ( x=0.29 or 0.33) piezoelectric crystals are being polarized along [001]c, [011]c and [111]c of the cubic reference directions so that the macroscopic symmetries are tetragonal 4 mm, orthogonal mm2 and rhombohedral 3 m, respectively. Both open- and short-circuit conditions are considered. Here, the Legendre polynomial method is proposed to solve the guided Lamb waves equations. The validity of the proposed method is illustrated by comparison with the ordinary differential equation (ODE). The convergence of this method is discussed. Consequently, the converged results are obtained with very low truncation order M . This constitutes a major advantage of the present method when compared with the other matrix methods. There is cross-crossings among multiple modes for both symmetric ( Sn) and the anti-symmetric ( An) guided Lamb waves propagation. A displacement field has been illustrated to judge whether Sn and An modes cross with each other. Moreover, electric displacement, stress field and electric potential for the open-circuit case were presented for both S0 and A0 Lamb modes.

  19. The Use of C-MnO2 as Hybrid Precursor Support for a Pt/C-MnxO1+x Catalyst with Enhanced Activity for the Methanol Oxidation Reaction (MOR

    Directory of Open Access Journals (Sweden)

    Alessandro H.A. Monteverde Videla

    2015-07-01

    Full Text Available Platinum (Pt nanoparticles are deposited on a hybrid support (C-MnO2 according to a polyol method. The home-made catalyst, resulted as Pt/C-MnxO1+x, is compared with two different commercial platinum based materials (Pt/C and PtRu/C. The synthesized catalyst is characterized by means of FESEM, XRD, ICP-MS, XPS and μRS analyses. MnO2 is synthesized and deposited over a commercial grade of carbon (Vulcan XC72 by facile reduction of potassium permanganate in acidic solution. Pt nanoparticles are synthesized on the hybrid support by a polyol thermal assisted method (microwave irradiation, followed by an annealing at 600 °C. The obtained catalyst displays a support constituted by a mixture of manganese oxides (Mn2O3 and Mn3O4 with a Pt loading of 19 wt. %. The electro-catalytic activity towards MOR is assessed by RDE in acid conditions (0.5 M H2SO4, evaluating the ability to oxidize methanol in 1 M concentration. The synthesized Pt/C-MnxO1+x catalyst shows good activity as well as good stability compared to the commercial Pt/C based catalyst.

  20. Crystal structure of cyclo-tris(μ-3,4,5,6-tetrafluoro-o-phenylene-κ2C1:C2trimercury–tetracyanoethylene (1/1

    Directory of Open Access Journals (Sweden)

    Raúl Castañeda

    2015-11-01

    Full Text Available The title compound, [Hg3(C6F43]·C6N4, contains one molecule of tetracyanoethylene B per one molecule of mercury macrocycle A, i.e., A•B, and crystallizes in the monoclinic space group C2/c. Macrocycle A and molecule B both occupy special positions on a twofold rotation axis and the inversion centre, respectively. The supramolecular unit [A•B] is built by the simultaneous coordination of one of the nitrile N atoms of B to the three mercury atoms of the macrocycle A. The Hg...N distances range from 2.990 (4 to 3.030 (4 Å and are very close to those observed in the related adducts of the macrocycle A with other nitrile derivatives. The molecule of B is almost perpendicular to the mean plane of the macrocycle A at the dihedral angle of 88.20 (5°. The donor–acceptor Hg...N interactions do not affect the C[triple-bond]N bond lengths [1.136 (6 and 1.140 (6 Å]. The trans nitrile group of B coordinates to another macrocycle A, forming an infinite mixed-stack [A•B]∞ architecture toward [101]. The remaining N atoms of two nitrile groups of B are not engaged in any donor–acceptor interactions. In the crystal, the mixed stacks are held together by intermolecular C—F...C[triple-bond]N secondary interactions [2.846 (5–2.925 (5 Å].