WorldWideScience

Sample records for expert tepee jb

  1. Geophysical analysis for the Ada Tepe region (Bulgaria) - case study

    Science.gov (United States)

    Trifonova, Petya; Metodiev, Metodi; Solakov, Dimcho; Simeonova, Stela; Vatseva, Rumiana

    2013-04-01

    According to the current archeological investigations Ada Tepe is the oldest gold mine in Europe with Late Bronze and Early Iron age. It is a typical low-sulfidation epithermal gold deposit and is hosted in Maastrichtian-Paleocene sedimentary rocks above a detachment fault contact with underlying Paleozoic metamorphic rocks. Ada Tepe (25o.39'E; 41o.25'N) is located in the Eastern Rhodope unit. The region is highly segmented despite the low altitude (470-750 m) due to widespread volcanic and sediment rocks susceptible to torrential erosion during the cold season. Besides the thorough geological exploration focused on identifying cost-effective stocks of mineral resources, a detailed geophysical analysis concernig diferent stages of the gold extraction project was accomplished. We present the main results from the geophysical investigation aimed to clarify the complex seismotectonic setting of the Ada Tepe site region. The overall study methodology consists of collecting, reviewing and estimating geophysical and seismological information to constrain the model used for seismic hazard assessment of the area. Geophysical information used in the present work consists of gravity, geomagnetic and seismological data. Interpretation of gravity data is applied to outline the axes of steep gravity transitions marked as potential axes of faults, flexures and other structures of dislocation. Direct inverse techniques are also utilized to estimate the form and depth of anomalous sources. For the purposes of seismological investigation of the Ada Tepe site region an earthquake catalogue is compiled for the time period 510BC - 2011AD. Statistical parameters of seismicity - annual seismic rate parameter, ?, and the b-value of the Gutenberg-Richter exponential relation for Ada Tepe site region, are estimated. All geophysical datasets and derived results are integrated using GIS techniques ensuring interoperability of data when combining, processing and visualizing obtained

  2. Main: 1JB9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...

  3. GÖBEKLI TEPE: AN OUTSTANDING PRE-POTTERY NEOLITHIC SITE IN THE GERMUŞ MOUNTAINS

    DEFF Research Database (Denmark)

    Kinzel, Moritz

    as previously thought). Since the first excavations, starting in the mid-1990s, Göbekli Tepe has repeatedly been referred to as a mountain sanctuary and pilgrimage site. However, more recent fieldwork is now beginning to reveal a more complex story. New archaeological results and the re-appraisal of existing...

  4. A technological study of Hassuna culture ceramics (Yarim Tepe I settlement

    Directory of Open Access Journals (Sweden)

    Natalia Yu. Petrova

    2012-12-01

    Full Text Available The article presents the results of a comparative technological analysis of Hassuna culture pottery from Yarim Tepe I (6th millennium BC from the lower and middle horizons. The technological stages of selecting the clay and organic materials, the composition of the clay paste and the surface treatment, but also certain issues related to the ornamentation and firing of the pottery are presented in the article.

  5. OPHRYS GENERA IN THE TERRITORY OF THE TEPE-OBA BOTANICAL RESERVE. POPULATION'S ANALYSIS

    Directory of Open Access Journals (Sweden)

    Viktoria Ju. Letukhova

    2017-01-01

    Full Text Available Abstract. Aim. To determine the amount and age structure of Ophrys oestrifera and O. apifera populations on the territory of the Tepe-Oba botanical reserve (South-East Crimea, study the morphological features of plants. To evaluate the current populations' state and identify factors of threats. Material. Three populations of Ophrys oestrifera and one population of O. apifera were found and studied on the territory of Tepe-Oba, their quantitative and age composition (structure were determined, vitality of individuals for O. oestrifera populations was defined. Results. O. oestrifera grows in three localities on the areas of 10 to 400 m2 and in the numbers of 28 to 342 individuals. The population of O. apifera has its area of 10 m2 and its size is 15 generative specimens. Populations O. oestrifera No. 1, 2 are young, normal and stable. Populations of O. oestrifera No. 3 and O. apifera have not yet reached their dynamic equilibrium (balance. O. oestrifera index of vitality doesn't significantly different in three populations (IVC=1,00– 1,09, that indicates approximately the same kind of growing conditions in the studying territory. However, growing in the same conditions O. apifera has some biometric differences from the O. oestrifera. For example, O. oestrifera plants are 1.5 times higher, inflorescence length is on average 2.5–3 times longer, and number of flowers in the inflorescence is 1,5 times more than those O. apifera. Main conclusions. The condition of O. oestrifera population in the territory of Tepe-Oba is satisfactory. Insignificant differences diversity in their vital structure can be associated with a e condition of O. apifera population is threatening because of its low size, small area and the lack of pregenerative plants in the age spectrum.

  6. TEPE/GReAT (General Relativity Accuracy Test in an Einstein Elevator): ready to start

    International Nuclear Information System (INIS)

    Iafolla, V.; Fiorenza, E.; Lefevre, C.

    2008-01-01

    TEPEE/GReAT is an experiment aimed at testing the principle of equivalence at a level of accuracy equal to 5 parts in 10 15 by means of a differential acceleration detector free falling inside a co-moving, endogenic, evacuated capsule, released from a stratospheric balloon. The detector is spun about a horizontal axis during the fall in order to modulate the equivalence principle violation signal at the spin frequency. Thanks to the recent funding of the Italian side, the project is ready- to enter its second phase. The main activities related to detector prototype (both non-cryogenic and cryogenic versions) development and testing, free-fall tests, signal extraction from noise (in particular related to the common-mode rejection factor) and flight model requirements are discussed.

  7. JB*-Algebras of Topological Stable Rank 1

    Directory of Open Access Journals (Sweden)

    Akhlaq A. Siddiqui

    2007-01-01

    Full Text Available In 1976, Kaplansky introduced the class JB*-algebras which includes all C*-algebras as a proper subclass. The notion of topological stable rank 1 for C*-algebras was originally introduced by M. A. Rieffel and was extensively studied by various authors. In this paper, we extend this notion to general JB*-algebras. We show that the complex spin factors are of tsr 1 providing an example of special JBW*-algebras for which the enveloping von Neumann algebras may not be of tsr 1. In the sequel, we prove that every invertible element of a JB*-algebra is positive in certain isotope of ; if the algebra is finite-dimensional, then it is of tsr 1 and every element of is positive in some unitary isotope of . Further, it is established that extreme points of the unit ball sufficiently close to invertible elements in a JB*-algebra must be unitaries and that in any JB*-algebras of tsr 1, all extreme points of the unit ball are unitaries. In the end, we prove the coincidence between the λ-function and λu-function on invertibles in a JB*-algebra.

  8. Required characteristics of Paenibacillus polymyxa JB-0501 as potential probiotic.

    Science.gov (United States)

    Naghmouchi, Karim; Baah, John; Cudennec, Benoit; Drider, Djamel

    2013-08-01

    The ability of Paenibacillus polymyxa to inhibit the growth of Escherichia coli generic ATCC 25922 (Escherichia coli ATCC 25922) and to adhere to monolayers of the enterocyte-like human cell line Caco-2 was evaluated. P. polymyxa JB-0501 (P. polymyxa JB-0501), found in a livestock feed probiotic supplement, was compared to P. polymyxa reference strain ATCC 43685 and ATCC 7070 (P. polymyxa ATCC) in terms of carbohydrate utilization and resistance to lysozyme, acid, bile salts, and hydrogen peroxide. JB-0501 grew at pH 4.5 and at H2O2 concentrations less than 7.3 μg/ml and presented a higher affinity to hexadecane and decane. Bile salts at 0.2 % inhibited the growth of all three strains. P. polymyxa JB-0501 and P. polymyxa ATCC 43865 adhered to Caco-2 cell monolayers. The percentage of cells that adhered ranged from about 0.35 to 6.5 % and was partially proportional to the number applied. Contact time (from 15 min to 1 h) had little impact on adhesion. P. polymyxa JB-0501 inhibited the growth of E. coli ATCC 25922, as proven by the diffusion tests in agar. Taken together, these results suggested that P. polymyxa JB-0501 has the potential probiotic properties to justify its consideration as a livestock feed supplement.

  9. JB-300: An advanced medium size transport for 2005

    Science.gov (United States)

    Debrouwer, Giles; Graham, Katherine; Ison, Jim; Juarez, Vince; Moskalik, Steve; Pankonin, Jon; Weinstein, Arnold

    1993-01-01

    In the fall of 1992, the TAC Team was presented with a Request for Proposal (PFP) for a mid-size (250-350 passenger) commercial transport. The aircraft was to be extremely competitive in the areas of passenger comfort, performance, and economic aspects. Through the use of supercritical airfoils, a technologically advanced Very High By-pass Ratio (VHBR) turbofan engine, a low overall drag configuration, a comparable interior layout, and mild use of composites, the JB-300 offers an economically viable choice to the airlines. The cents per passenger mile of the JB-300 is 1.76, which is considerably lower than current aircraft in the same range. Overall, the JB-300 is a technologically advanced aircraft, which will meet the demands of the 21st century.

  10. Genetic Characterization of Bacillus anthracis 17 JB strain.

    Science.gov (United States)

    Seyed-Mohamadi, Sakineh; Moradi Bidhendi, Soheila; Tadayon, Keyvan; Ghaderi, Rainak

    2015-06-01

    Bacillus anthracis is one of the most homogenous bacteria ever described. Some level of diversity. Bacillus anthracis 17JB is a laboratory strain It is broadly used as a challenge strain in guinea pigs for potency test of anthrax vaccine. This work describes genetic characterization of B. anthracis 17 JB strain using the SNPs and MLVA genotyping. In SNPs typing, the originally French 17JB strain represented the A.Br. 008/009 subgroup. In Levy's genotyping method, 843, 451 and 864 bp long fragments were identified at AA03, AJ03 and AA07 loci, respectively. In the vaccine manufacturer perspective these findings are much valuable on their own account, but similar research is required to extend molecular knowledge of B. anthracis epidemiology in Persia.

  11. JB-9322, a new selective histamine H2-receptor antagonist with potent gastric mucosal protective properties.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; Román, L S

    1995-05-01

    1. JB-9322 is a selective histamine H2-receptor antagonist with gastric antisecretory activity and mucosal protective properties. 2. The affinity of JB-9322 for the guinea-pig atria histamine H2-receptor was approximately 2 times greater than that of ranitidine. 3. In vivo, the ID50 value for the inhibition of gastric acid secretion in pylorus-ligated rats was 5.28 mg kg-1 intraperitoneally. JB-9322 also dose-dependently inhibited gastric juice volume and pepsin secretion. In gastric lumen-perfused rats, intravenous injection of JB-9322 dose-dependently reduced histamine-, pentagastrin- and carbachol-stimulated gastric acid secretion. 4. JB-9322 showed antiulcer activity against aspirin and indomethacin-induced gastric lesions and was more potent than ranitidine. 5. JB-9322 effectively inhibited macroscopic gastric haemorrhagic lesions induced by ethanol. Intraperitoneal injection was effective in preventing the lesions as well as oral treatment. The oral ID50 value for these lesions was 1.33 mg kg-1. By contrast, ranitidine (50 mg kg-1) failed to reduce these lesions. In addition, the protective effect of JB-9322 was independent of prostaglandin synthesis. 6. These results indicate that JB-9322 is a new antiulcer drug that exerts a potent cytoprotective effect in addition to its gastric antisecretory activity.

  12. Pharmacology of JB-9315, a new selective histamine H2-receptor antagonist.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; San Román, L

    1998-02-01

    1. The histamine H2-receptor antagonistic activity and antisecretory and antiulcer effects of JB-9315 were studied in comparison with the standard H2 blocker ranitidine. 2. In vitro, JB-9315 is a competitive antagonist of histamine H2 receptors in the isolated, spontaneously beating guinea-pig right atrium, with a pA2 value of 7.30 relative to a value of 7.36 for ranitidine. JB-9315 was specific for the histamine H2 receptor because, at high concentration, it did not affect histamine- or acetylcholine-induced contractions in guinea-pig isolated ileum or rat isolated duodenum, respectively. 3. JB-9315 dose dependently inhibited histamine-, pentagastrin- or carbachol-stimulated acid secretion and basal secretion in the perfused stomach preparation of the anesthetized rat. In the pylorus-ligated rat after intraperitoneal administration, total acid output over 4 h was inhibited by JB-9315 with an ID50 of 32.8 mg/kg, confirming its H2-receptor antagonist properties. 4. JB-9315 showed antiulcer activity against cold stress plus indomethacin-induced lesions with an ID50 of 6.8 mg/kg. 5. JB-9315, 50 and 100 mg/kg, inhibited macroscopic gastric hemorrhagic lesions induced by ethanol. In contrast, ranitidine (50 mg/kg) failed to reduce these lesions. 6. These results indicate that JB-9315 is a new antiulcer drug that exerts a cytoprotective effect in addition to its gastric antisecretory activity.

  13. Pharmacological, neurochemical, and behavioral profile of JB-788, a new 5-HT1A agonist.

    Science.gov (United States)

    Picard, M; Morisset, S; Cloix, J F; Bizot, J C; Guerin, M; Beneteau, V; Guillaumet, G; Hevor, T K

    2010-09-01

    A novel pyridine derivative, 8-{4-[(6-methoxy-2,3-dihydro-[1,4]dioxino[2,3-b]pyridine-3-ylmethyl)-amino]-butyl}-8-aza-spiro[4.5]decane-7,9-dione hydrochloride, termed JB-788, was designed to selectively target 5-HT(1A) receptors. In the present study, the pharmacological profile of JB-788 was characterized in vitro using radioligands binding tests and in vivo using neurochemical and behavioural experiments. JB-788 bound tightly to human 5-HT(1A) receptor expressed in human embryonic kidney 293 (HEK-293) cells with a K(i) value of 0.8 nM. Its binding affinity is in the same range as that observed for the (+/-)8-OH-DPAT, a reference 5HT(1A) agonist compound. Notably, JB-788 only bound weakly to 5-HT(1B) or 5-HT(2A) receptors and moreover the drug displayed only weak or indetectable binding to muscarinic, alpha(2), beta(1) and beta(2) adrenergic receptors, or dopaminergic D(1) receptors. JB-788 was found to display substantial binding affinity for dopaminergic D(2) receptors and, to a lesser extend to alpha(1) adrenoreceptors. JB-788 dose-dependently decreased forskolin-induced cAMP accumulation in HEK cells expressing human 5-HT(1A), thus acting as a potent 5-HT(1A) receptor agonist (E(max.) 75%, EC(50) 3.5 nM). JB-788 did not exhibit any D(2) receptor agonism but progressively inhibited the effects of quinpirole, a D(2) receptor agonist, in the cAMP accumulation test with a K(i) value of 250 nM. JB-788 induced a weak change in cAMP levels in mouse brain but, like some antipsychotics, transiently increased glycogen contents in various brain regions. Behavioral effects were investigated in mice using the elevated plus-maze. JB-788 was found to increase the time duration spent by animals in anxiogenic situations. Locomotor hyperactivity induced by methamphetamine in mouse, a model of antipsychotic activity, was dose-dependently inhibited by JB-788. Altogether, these results suggest that JB-788 displays pharmacological properties, which could be of interest in the area

  14. Rapid geomagnetic field intensity variations in the Near East during the 6th millennium BC: New archeointensity data from Halafian site Yarim Tepe II (Northern Iraq)

    Science.gov (United States)

    Yutsis-Akimova, Stanislava; Gallet, Yves; Amirov, Shahmardan

    2018-01-01

    We present new archeointensity results from a series of groups of pottery fragments that were collected from the multi-layered archeological site Yarim Tepe II in Northern Iraq (Northern Mesopotamia) dated to the 6th millennium BC. This site comprises a 7-m-thick sequence of archeological deposits encompassing the Middle Halaf, Late Halaf and the Halaf-Ubaid Transitional (HUT), between ∼5750 and ∼5000 BC according to the chronology currently considered for the Halafian archeological period. Three new radiocarbon dates obtained from bone fragments confirm that Yarim Tepe II was likely not occupied before the Middle Halaf, as was independently established from archeological constraints. Archeointensity determinations were carried out using the protocol developed for the Triaxe magnetometer. This procedure takes into account thermoremanent magnetization anisotropy and cooling rate effects. 114 fragments fulfilled our set of archeointensity selection criteria, with intensity data obtained from at least two but most often three specimens per fragment. Mean archeointensity values were estimated for 23 groups of fragments well distributed across the entire stratigraphic sequence from the averaging of the data obtained from a minimum of three fragments per group. These values were dated using a bootstrap procedure relying on the stratigraphic position of the different groups of fragments and on the different age constraints available inside the Yarim Tepe II sequence. The new data show a significant decrease in geomagnetic field intensity by ∼12 μT between the Middle Halaf and the Late Halaf-HUT time interval. This decrease was accompanied by a short intensity peak, which may have lasted only a few decades, around the Middle Halaf-Late Halaf boundary, at ∼5500 BC. This evolution is quite similar to that observed from Syrian and Bulgarian archeointensity data, even though the precise duration of the intensity peak is presently questionable. The Bulgarian data set

  15. Göbekli Tepe – the Stone Age Sanctuaries. New results of ongoing excavations with a special focus on sculptures and high reliefs

    Directory of Open Access Journals (Sweden)

    Klaus Schmidt

    2010-12-01

    Full Text Available The transition from non-food producing to farming societies first took place during the Pre-Pottery Neolithic (PPN of the Near East. It happened immediately after the end of the Pleistocene, between the 10th to the 8th millennium BC. One of the main questions that have exercised the minds of generations of archaeologists is why people first gave up a hunting and gathering way of life and start to domesticate plants and animals. In other words, why did the Neolithic Revolution take place? The new discoveries at Göbekli Tepe have turned up evidence for explanations that differ from the generally accepted wisdom on this issue.

  16. Psychoactive bacteria Lactobacillus rhamnosus (JB-1) elicits rapid frequency facilitation in vagal afferents.

    Science.gov (United States)

    Perez-Burgos, Azucena; Wang, Bingxian; Mao, Yu-Kang; Mistry, Bhavik; McVey Neufeld, Karen-Anne; Bienenstock, John; Kunze, Wolfgang

    2013-01-15

    Mounting evidence supports the influence of the gut microbiome on the local enteric nervous system and its effects on brain chemistry and relevant behavior. Vagal afferents are involved in some of these effects. We previously showed that ingestion of the probiotic bacterium Lactobacillus rhamnosus (JB-1) caused extensive neurochemical changes in the brain and behavior that were abrogated by prior vagotomy. Because information can be transmitted to the brain via primary afferents encoded as neuronal spike trains, our goal was to record those induced by JB-1 in vagal afferents in the mesenteric nerve bundle and thus determine the nature of the signals sent to the brain. Male Swiss Webster mice jejunal segments were cannulated ex vivo, and serosal and luminal compartments were perfused separately. Bacteria were added intraluminally. We found no evidence for translocation of labeled bacteria across the epithelium during the experiment. We recorded extracellular multi- and single-unit neuronal activity with glass suction pipettes. Within minutes of application, JB-1 increased the constitutive single- and multiunit firing rate of the mesenteric nerve bundle, but Lactobacillus salivarius (a negative control) or media alone were ineffective. JB-1 significantly augmented multiunit discharge responses to an intraluminal distension pressure of 31 hPa. Prior subdiaphragmatic vagotomy abolished all of the JB-1-evoked effects. This detailed exploration of the neuronal spike firing that encodes behavioral signaling to the brain may be useful to identify effective psychoactive bacteria and thereby offer an alternative new perspective in the field of psychiatry and comorbid conditions.

  17. New Archeointensity Data from Late Neolithic Yarim Tepe 1 and 2 Settlements (Northern Iraq) Dated From The Pre-Halaf and Halaf Periods (7TH-6TH Millennia BC)

    Science.gov (United States)

    Akimova, S.; Gallet, Y.; Amirov, S.; Petrova, N.

    2016-12-01

    The main objective of this study is to recover the geomagnetic field intensity variations in the Middle East during the 7th and 6th millennia BC, with a particular focus on rapid fluctuations. We will report on new archeointensity data obtained from two ancient Late Neolithic settlements called Yarim Tepe I and II, located today in Northern Iraq, which were excavated by Soviet archeologists in the seventies. Yarim Tepe II, comprising a 7-m thick sequence of cultural deposits divided into nine successive levels, is dated from the Halaf period ( 5950-5300 BC). Yarim Tepe I is dated from the Pre-Halaf period ( 6300-5950 BC), with three recognized cultural phases referred to as Hassuna I, II and III. There, the deposits form a sequence of 6.5 m, which were divided into 12 archeological levels. Most of the archeological artifacts discovered during the excavations, in particular thousands of potsherds, are stored at the repository of Archeological Institute in Moscow, where our sampling was undertaken. We collected 29 groups of potsherds from Yarim Tepe II and 22 groups from Yarim Tepe I from superimposed stratigraphic layers having on average a thickness of about 20 cm. Each group consists of at least 3 (up to 10) fragments. All analyses were carried out using the three-axis vibrating sample magnetometer Triaxe, which allows magnetization measurements of a small sample (developed for the Triaxe magnetometer takes into account both the anisotropy and cooling rate effects on thermoremanent magnetization acquisition. Together with other data previously obtained from Syria and Bulgaria, the new archeointensity results show the occurrence of rapid geomagnetic field fluctuations in the Middle East during the Late Neolithic period, in particular during the 6th millennium BC. The data from Yarim Tepe II indeed confirm the occurrence of a short-lasting intensity peak around 5500 BC, with intensity variation rates as high as 0.35 - 0.15 µT/year over a few decades. We will also

  18. ERZURUM ŞARTLARINDA DİKİM ZAMANI VE TEPE ALMANIN PATATESTE VERİM VE ÇEŞİTLİ ÖZELLİKLERİNE ETKİSİ /

    OpenAIRE

    Şenol, Sabahattin

    2010-01-01

    ÖZETErzurum Ekolojik şartlarında dikim ve tepe alma zamanmm patatesteverime ve diğer bazı agronomik karekterlere etkisini tesbitetmek için bu çalışma yapılmış, erkenci ve geç olgunlaşan 34/962 ve49/962 çeşitler bu denemeye alınmıştır. Neticede, en fazıa verim enerken dikim zamanı olarak tayin ediıen 13 Mayıs tarihinde a.ltlnmış,tepe aımanm· veya sürgün öıdürmenin önemli etkisi g&ou...

  19. Draft genome sequences of Streptococcus bovis strains ATCC 33317 and JB1

    Science.gov (United States)

    We report the draft genome sequences of Streptococcus bovis type strain ATTC 33317 (CVM42251) isolated from cow dung and strain JB1 (CVM42252) isolated from a cow rumen in 1977. Strains were subjected to Next Generation sequencing and the genome sizes are approximately 2 MB and 2.2 MB, respectively....

  20. Cometabolic Degradation of Dibenzofuran and Dibenzothiophene by a Naphthalene-Degrading Comamonas sp. JB.

    Science.gov (United States)

    Ji, Xiangyu; Xu, Jing; Ning, Shuxiang; Li, Nan; Tan, Liang; Shi, Shengnan

    2017-12-01

    Comamonas sp. JB was used to investigate the cometabolic degradation of dibenzofuran (DBF) and dibenzothiophene (DBT) with naphthalene as the primary substrate. Dehydrogenase and ATPase activity of the growing system with the presence of DBF and DBT were decreased when compared to only naphthalene in the growing system, indicating that the presence of DBF and DBT inhibited the metabolic activity of strain JB. The pathways and enzymes involved in the cometabolic degradation were tested. Examination of metabolites elucidated that strain JB cometabolically degraded DBF to 1,2-dihydroxydibenzofuran, subsequently to 2-hydroxy-4-(3'-oxo-3'H-benzofuran-2'-yliden)but-2-enoic acid, and finally to catechol. Meanwhile, strain JB cometabolically degraded DBT to 1,2-dihydroxydibenzothiophene and subsequently to the ring cleavage product. A series of naphthalene-degrading enzymes including naphthalene dioxygenase, 1,2-dihydroxynaphthalene dioxygenase, salicylaldehyde dehydrogenase, salicylate hydroxylase, and catechol 2,3-oxygenase have been detected, confirming that naphthalene was the real inducer of expression the degradation enzymes and metabolic pathways were controlled by naphthalene-degrading enzymes.

  1. Reactive flow modeling of initial density effect on divergence JB-9014 detonation driving

    Science.gov (United States)

    Yu, Xin; Huang, Kuibang; Zheng, Miao

    2016-06-01

    A serious of experiments were designed and the results were represented in this paper, in which 2mm thickness cooper shells were impacted by explosives named JB-9014 with different densities, and the surface velocities of the OFHC shells were measured. The comparison of experimental data shows the free surface velocity of the OFHC shell increase with the IHE density. Numerical modeling, which occupied phenomenological reactive flow rate model using the two-dimensional Lagrange hydrodynamic code, were carried out to simulate the above experiments, and empirical adjustments on detonation velocity and pressure and Pier Tang's adjustments on EOS of detonation products were both introduced in our numerical simulation work. The computational results agree well with that of experiments, and the numerical results with original parameters of products and the adjusted ones of JB-9014 could describe the density effect distinctly.

  2. Embedding, serial sectioning and staining of zebrafish embryos using JB-4 resin.

    Science.gov (United States)

    Sullivan-Brown, Jessica; Bisher, Margaret E; Burdine, Rebecca D

    2011-01-01

    Histological techniques are critical for observing tissue and cellular morphology. In this paper, we outline our protocol for embedding, serial sectioning, staining and visualizing zebrafish embryos embedded in JB-4 plastic resin-a glycol methacrylate-based medium that results in excellent preservation of tissue morphology. In addition, we describe our procedures for staining plastic sections with toluidine blue or hematoxylin and eosin, and show how to couple these stains with whole-mount RNA in situ hybridization. We also describe how to maintain and visualize immunofluorescence and EGFP signals in JB-4 resin. The protocol we outline-from embryo preparation, embedding, sectioning and staining to visualization-can be accomplished in 3 d. Overall, we reinforce that plastic embedding can provide higher resolution of cellular details and is a valuable tool for cellular and morphological studies in zebrafish.

  3. Biosorption of cationic basic dye and cadmium by the novel biosorbent Bacillus catenulatus JB-022 strain.

    Science.gov (United States)

    Kim, Su Young; Jin, Mi Ra; Chung, Chang Ho; Yun, Yeoung-Sang; Jahng, Kwang Yeop; Yu, Kang-Yeol

    2015-04-01

    Biosorption of heavy metals and dyes is a promising technology that involves the removal of toxic metals from industrial wastes. The present study aims to screen the bacterial strains isolated from soils and polluted pond for their potential biosorption of both cationic dye and cadmium. Bacillus catenulatus JB-022 strain removed 58% and 66% of cationic basic blue 3 (BB3) and cadmium (Cd(II)) at the respective concentrations of 2000 mg/L and 150 mg/L. The biosorption equilibrium data were well fitted by the Langmuir adsorption isotherm, and the kinetic studies indicated that the biosorption followed the pseudo-second-order model. The biosorption kinetics showed that the equilibrium was reached within 10 min and 5 min for BB3 and Cd(II), respectively. According to the Langmuir model, the maximum uptakes of BB3 and Cd(II) by the JB-022 biomass were estimated to be 139.74 and 64.28 mg/g, respectively. To confirm the surface morphology and functional groups, field emission scanning electron microscope, energy-dispersive X-ray spectrometer, X-ray diffraction, and Fourier transform infrared spectroscopy analyses were carried out, and the results revealed that the biomass of JB-022 has carboxyl and phosphonate groups as potential surface functional groups capable of binding to cationic pollutants. In conclusion, B. catenulatus JB-022 is proposed as an excellent biosorbent with potentially important applications in removal of cationic pollutants from wastewaters. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  4. Expert systems

    International Nuclear Information System (INIS)

    Haldy, P.A.

    1988-01-01

    The definitions of the terms 'artificial intelligence' and 'expert systems', the methodology, areas of employment and limits of expert systems are discussed. The operation of an expert system is described, especially the presentation and organization of knowledge as well as interference and control. Methods and tools for expert system development are presented and their application in nuclear energy are briefly addressed. 7 figs., 2 tabs., 6 refs

  5. Expert Systems

    OpenAIRE

    Lucas, P.J.F.

    2005-01-01

    Expert systems mimic the problem-solving activity of human experts in specialized domains by capturing and representing expert knowledge. Expert systems include a knowledge base, an inference engine that derives conclusions from the knowledge, and a user interface. Knowledge may be stored as if-then rules, orusing other formalisms such as frames and predicate logic. Uncertain knowledge may be represented using certainty factors, Bayesian networks, Dempster-Shafer belief functions, or fuzzy se...

  6. EXPERT SYSTEMS

    OpenAIRE

    Georgiana Marin; Mihai Catalin Andrei

    2011-01-01

    In recent decades IT and computer systems have evolved rapidly in economic informatics field. The goal is to create user friendly information systems that respond promptly and accurately to requests. Informatics systems evolved into decision assisted systems, and such systems are converted, based on gained experience, in expert systems for creative problem solving that an organization is facing. Expert systems are aimed at rebuilding human reasoning on the expertise obtained from experts, sto...

  7. Expert System

    DEFF Research Database (Denmark)

    Hildebrandt, Thomas Troels; Cattani, Gian Luca

    2016-01-01

    An expert system is a computer system for inferring knowledge from a knowledge base, typically by using a set of inference rules. When the concept of expert systems was introduced at Stanford University in the early 1970s, the knowledge base was an unstructured set of facts. Today the knowledge b...... for the application of expert systems, but also raises issues regarding privacy and legal liability....

  8. Copper and dyes enhance laccase production in gamma-proteobacterium JB.

    Science.gov (United States)

    Malhotra, Kanam; Sharma, Prince; Capalash, Neena

    2004-07-01

    Laccase production in gamma-proteobacterium JB was enhanced 13-fold by adding 0.1 mM CuSO(4) 24 h after the onset of growth. Ethidium bromide (2.5 microM), Malachite Green, Phenol Red and Thymol Blue (10 microM each) enhanced laccase production 17-, 19-, 4- and 2-fold, respectively. Among the fourteen aromatic/organic compounds tried, p-aminobenzoic acid and an industrial effluent, from where the organism was isolated, showed 1.2- and 1.26-fold increases in production.

  9. Xenobiotics enhance laccase activity in alkali-tolerant γ-proteobacterium JB.

    Science.gov (United States)

    Singh, Gursharan; Batish, Mona; Sharma, Prince; Capalash, Neena

    2009-01-01

    Various genotoxic textile dyes, xenobiotics, substrates (10 µM) and agrochemicals (100 µg/ml) were tested for enhancement of alkalophilic laccase activity in γ-proteobacterium JB. Neutral Red, Indigo Carmine, Naphthol Base Bordears and Sulphast Ruby dyes increased the activity by 3.7, 2.7, 2.6 and 2.3 fold respectively. Xenobiotics/substrates like p-toluidine, 8-hydroxyquinoline and anthracine increased it by 3.4, 2.8 and 2.3 fold respectively. Atrazine and trycyclozole pesticides enhanced the activity by 1.95 and 1.5 fold respectively.

  10. Expert ease

    Energy Technology Data Exchange (ETDEWEB)

    1984-04-01

    Expert-ease allows the most inexperienced of computer users to build an expert system in a matter of hours. It is nothing more or less than a computer based problem-solving system. It allows the expert to preserve his or her knowledge in the form of rules, which can be applied to problems put to the system by the non-expert. The crucial piece of software at the heart of Expert-Ease extracts rules from data, and is called the analogue concept learning system. It was developed by Intelligent Terminals Ltd. and supplied to Export Software International to be incorporated into a commercially attractive package for business users. The resulting product runs on the Act Sirius and the IBM PC and compatibles. It is a well conceived and polished product with a popular appeal that should ensure widespread acceptance even at a cost of >1500 plus vat.

  11. Lactobacillus rhamnosus strain JB-1 reverses restraint stress-induced gut dysmotility.

    Science.gov (United States)

    West, C; Wu, R Y; Wong, A; Stanisz, A M; Yan, R; Min, K K; Pasyk, M; McVey Neufeld, K-A; Karamat, M I; Foster, J A; Bienenstock, J; Forsythe, P; Kunze, W A

    2017-01-01

    Environmental stress affects the gut with dysmotility being a common consequence. Although a variety of microbes or molecules may prevent the dysmotility, none reverse the dysmotility. We have used a 1 hour restraint stress mouse model to test for treatment effects of the neuroactive microbe, L. rhamnosus JB-1 ™ . Motility of fluid-filled ex vivo gut segments in a perfusion organ bath was recorded by video and migrating motor complexes measured using spatiotemporal maps of diameter changes. Stress reduced jejunal and increased colonic propagating contractile cluster velocities and frequencies, while increasing contraction amplitudes for both. Luminal application of 10E8 cfu/mL JB-1 restored motor complex variables to unstressed levels within minutes of application. L. salivarius or Na.acetate had no treatment effects, while Na.butyrate partially reversed stress effects on colonic frequency and amplitude. Na.propionate reversed the stress effects for jejunum and colon except on jejunal amplitude. Our findings demonstrate, for the first time, a potential for certain beneficial microbes as treatment of stress-induced intestinal dysmotility and that the mechanism for restoration of function occurs within the intestine via a rapid drug-like action on the enteric nervous system. © 2016 John Wiley & Sons Ltd.

  12. Expert Witness

    African Journals Online (AJOL)

    Adele

    formal rules of evidence apply) to help it understand the issues of a case and ... statements on medical expert witness by professional representative bodies in .... determining the size of the financial settlement that may have to be made to the.

  13. A novel chimeric prophage vB_LdeS-phiJB from commercial Lactobacillus delbrueckii subsp. bulgaricus.

    Science.gov (United States)

    Guo, Tingting; Zhang, Chenchen; Xin, Yongping; Xin, Min; Kong, Jian

    2016-05-01

    Prophage vB_LdeS-phiJB (phiJB) was induced by mitomycin C and UV radiation from the Lactobacillus delbrueckii subsp. bulgaricus SDMCC050201 isolated from a Chinese yoghurt sample. It has an isometric head and a non-contractile tail with 36,969 bp linear double-stranded DNA genome, which is classified into the group a of Lb. delbrueckii phages. The genome of phiJB is highly modular with functionally related genes clustered together. Unexpectedly, there is no similarity of its DNA replication module to any phages that have been reported, while it consists of open-reading frames homologous to the proteins of Lactobacillus strains. Comparative genomic analysis indicated that its late gene clusters, integration/lysogeny modules and DNA replication module derived from different evolutionary ancestors and integrated into a chimera. Our results revealed a novel chimeric phage of commercial Lb. delbrueckii and will broaden the knowledge of phage diversity in the dairy industry.

  14. Biodegradation of Benzene, Toluene, Ethylbenzene, and o-, m-, and p-Xylenes by the Newly Isolated Bacterium Comamonas sp. JB.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Tao, Wei; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan

    2015-07-01

    A bacterium designated strain JB, able to degrade six benzene, toluene, ethylbenzene, and o-, m-, and p-xylene (BTEX) compounds, was isolated from petroleum-contaminated soil. Taxonomic analyses showed that the isolate belonged to Comamonas, and until now, the genus Comamonas has not included any known BTEX degraders. The BTEX biodegradation rate was slightly low on the mineral salt medium (MSM), but adding a small amount of yeast extract greatly enhanced the biodegradation. The relationship between specific degradation rate and individual BTEX was described well by Michaelis-Menten kinetics. The treatment of petrochemical wastewater containing BTEX mixture and phenol was shown to be highly efficient by BTEX-grown JB. In addition, toxicity assessment indicated the treatment of the petrochemical wastewater by BTEX-grown JB led to less toxicity than untreated wastewater.

  15. Isolation of Burkholderia cepacia JB12 from lead- and cadmium-contaminated soil and its potential in promoting phytoremediation with tall fescue and red clover.

    Science.gov (United States)

    Jin, Zhong Min; Sha, Wei; Zhang, Yan Fu; Zhao, Jing; Ji, Hongyang

    2013-07-01

    Phytoremediation combined with suitable microorganisms and biodegradable chelating agents can be a means of reclaiming lands contaminated by toxic heavy metals. We investigated the ability of a lead- and cadmium-resistant bacterial strain (JB12) and the biodegradable chelator ethylenediamine-N,N'-disuccinic acid (EDDS) to improve absorption of these metals from soil by tall fescue and red clover. Strain JB12 was isolated from contaminated soil samples, analysed for lead and cadmium resistance, and identified as Burkholderia cepacia. Tall fescue and red clover were grown in pots to which we added JB12, (S,S)-EDDS, combined JB12 and EDDS, or water only. Compared with untreated plants, the biomass of plants treated with JB12 was significantly increased. Concentrations of lead and cadmium in JB12-treated plants increased significantly, with few exceptions. Plants treated with EDDS responded variably, but in those treated with combined EDDS and JB12, heavy metal concentrations increased significantly in tall fescue and in the aboveground parts of red clover. We conclude that JB12 is resistant to lead and cadmium. Its application to the soil improved the net uptake of these heavy metals by experimental plants. The potential for viable phytoremediation of lead- and cadmium-polluted soils with tall fescue and red clover combined with JB12 was further enhanced by the addition of EDDS.

  16. Basic Fibroblast Growth Factor Regulates Persistent ERK Osciliations in Premaligant but not Malignant JB6 Cells

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Thomas J.; Shankaran, Harish; Wiley, H. S.; Opresko, Lee K.; Chrisler, William B.; Quesenberry, Ryan D.

    2010-05-02

    basic fibroblast growth factor (bFGF or FGF2) plays an important role in epidermal wound healing in vivo and is associated with a persistent increased in the extracellular signal-regulated kinase (ERK) pathway in vitro. Here we have examined whether bFGF induces the closure of an experimental scratch wound in JB6 mouse epidermal cells and have explored the regulation of the ERK pathway by bFGF in the context of kinase oscillations. bFGF stimulation is associated with increases in cellular phospho-ERK and phospho-c-Jun levels. In addition, bFGF increases cell proliferation and a change in cell morphology (stellate appearance) in a dose-dependent fashion (0.1 – 100 ng/ml). bFGF treatment also promoted the closure of an experimental scratch wound in vitro. JB6 cells were stably transfected with an ERK1-GFP chimera to follow temporal ERK subcellular distribution patterns. We observe a persistent upregulation of the ERK pathway, as evidenced by a significant increase in nuclear ERK1-GFP levels at time points up to 24 hr after bFGF treatment. Interestingly, at the single cell level, ERK is observed to oscillate between nuclear and cytosolic compartments in response to bFGF treatment. Because this oscillatory behavior is asynchronous in the cell population, it is only clearly resolved at the single cell level. Collectively, data presented here are consistent with an important role for bFGF in wound healing and suggest a more complex regulation of the ERK pathway by bFGF than has previously been appreciated.

  17. Loss of retrovirus production in JB/RH melanoma cells transfected with H-2Kb and TAP-1 genes.

    Science.gov (United States)

    Li, M; Xu, F; Muller, J; Huang, X; Hearing, V J; Gorelik, E

    1999-01-20

    JB/RH1 melanoma cells, as well as other melanomas of C57BL/6 mice (B16 and JB/MS), express a common melanoma-associated antigen (MAA) encoded by an ecotropic melanoma-associated retrovirus (MelARV). JB/RH1 cells do not express the H-2Kb molecules due to down-regulation of the H-2Kb and TAP-1 genes. When JB/RH1 cells were transfected with the H-2Kb and cotransfected with the TAP-1 gene, it resulted in the appearance of H-2Kb molecules and an increase in their immunogenicity, albeit they lost expression of retrovirus-encoded MAA recognized by MM2-9B6 mAb. Loss of MAA was found to result from a complete and stable elimination of ecotropic MelARV production in the H-2Kb/TAP-1-transfected JB/RH1 cells. Northern blot analysis showed no differences in ecotropic retroviral messages in MelARV-producing and -nonproducing melanoma cells, suggesting that loss of MelARV production was not due to down-regulation of MelARV transcription. Southern blot analysis revealed several rearrangements in the proviral DNA of H-2Kb-positive JB/RH1 melanoma cells. Sequence analysis of the ecotropic proviral DNA from these cells showed numerous nucleotide substitutions, some of which resulted in the appearance of a novel intraviral PstI restriction site and the loss of a HindIII restriction site in the pol region. PCR amplification of the proviral DNAs indicates that an ecotropic provirus found in the H-2Kb-positive cells is novel and does not preexist in the parental H-2Kb-negative melanoma cells. Conversely, the ecotropic provirus of the parental JB/RH1 cells was not amplifable from the H-2Kb-positive cells. Our data indicate that stable loss of retroviral production in the H-2Kb/TAP-1-transfected melanoma cells is probably due to the induction of recombination between a productive ecotropic MelARV and a defective nonecotropic provirus leading to the generation of a defective ecotropic provirus and the loss of MelARV production and expression of the retrovirus-encoded MAA. Copyright 1999

  18. Expert Systems: What Is an Expert System?

    Science.gov (United States)

    Duval, Beverly K.; Main, Linda

    1994-01-01

    Describes expert systems and discusses their use in libraries. Highlights include parts of an expert system; expert system shells; an example of how to build an expert system; a bibliography of 34 sources of information on expert systems in libraries; and a list of 10 expert system shells used in libraries. (Contains five references.) (LRW)

  19. Sesquiterpene lactones isolated from indigenous Middle Eastern plants inhibit tumor promoter-induced transformation of JB6 cells

    Directory of Open Access Journals (Sweden)

    Saikali Melody

    2012-07-01

    Full Text Available Abstract Background Sesquiterpene lactones (SL are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan isolated from Achillea falcata and salograviolide A (Sal A isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. Methods The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. Results β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. Conclusions These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to

  20. Sesquiterpene lactones isolated from indigenous Middle Eastern plants inhibit tumor promoter-induced transformation of JB6 cells.

    Science.gov (United States)

    Saikali, Melody; Ghantous, Akram; Halawi, Racha; Talhouk, Salma N; Saliba, Najat A; Darwiche, Nadine

    2012-07-09

    Sesquiterpene lactones (SL) are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan) isolated from Achillea falcata and salograviolide A (Sal A) isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to the Middle East may provide opportunities for complementary

  1. Isolation of perchlorate-reducing Azospira suillum strain JB524 from tidal flats of the Yellow Sea

    Directory of Open Access Journals (Sweden)

    Nirmala Bardiya

    2016-11-01

    Full Text Available Objective: To isolate and identify perchlorate-reducing bacterium from an enriched consortium from tidal flats of the Yellow Sea. Methods: A perchlorate-enriched consortium from tidal flats of the Yellow Sea was used to isolate Azospira suillum (A. suillum strain JB524. The strain was identified based on partial 16S rDNA sequencing. Perchlorate reduction by the strain was tested with acetate as the e - donor in the presence of NaCl, nitrate and at different growth temperatures using standard anaerobic techniques. The complete enzymatic destruction of perchlorate was confirmed as evolution of O2 by chlorite dismutase in the absence of acetate. Results: Strain JB524 shared 100% 16S rDNA sequence similarity with the type strain A. suillum PST isolated from a swine waste treatment lagoon. Perchlorate reduction coincided with concomitant increase in cell density. Although, acclimatization of the strain PST at suboptimal temperature for perchlorate reduction is not reported, the newly isolated strain could rapidly reduce perchlorate at 22 °C after brief acclimatization. Conclusions: Reduction of perchlorate by A. suillum strain JB524 was negatively affected in the presence of NaCl, suboptimal temperature, presence of nitrate, and limiting amount of acetate as the e-donor.

  2. Bioremediation of Petrochemical Wastewater Containing BTEX Compounds by a New Immobilized Bacterium Comamonas sp. JB in Magnetic Gellan Gum.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan; Gao, Shan; Yang, Aifu; Chen, Zhong; Sun, Hongjuan

    2015-05-01

    In this study, we investigated the bioremediation of petrochemical wastewater containing BTEX compounds by immobilized Comamonas sp. JB cells. Three kinds of magnetic nanoparticles were evaluated as immobilization supports for strain JB. After comparison with Fe3O4 and a-Fe2O3 nanoparticles, r-Fe2O3 nanoparticle was selected as the optimal immobilization support. The highest biodegradation activity of r-Fe2O3-magnetically immobilized cells was obtained when the concentration of r-Fe2O3 nanoparticle was 120 mg L(-1). Additionally, the recycling experiments demonstrated that the degradation activity of r-Fe2O3-magnetically immobilized cells was still high and led to less toxicity than untreated wastewater during the eight recycles. qPCR suggested the concentration of strain JB in r-Fe2O3-magnetically immobilized cells was evidently increased after eight cycles of degradation experiments. These results supported developing efficient biocatalysts using r-Fe2O3-magnetically immobilized cells and provided a promising technique for improving biocatalysts used in the bioremediation of not only petrochemical wastewater but also other hazardous wastewater.

  3. Mouse Strain Affects Behavioral and Neuroendocrine Stress Responses Following Administration of Probiotic Lactobacillus rhamnosus JB-1 or Traditional Antidepressant Fluoxetine

    Directory of Open Access Journals (Sweden)

    Karen-Anne McVey Neufeld

    2018-05-01

    Full Text Available Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair—BALB/c and Swiss Webster—with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.

  4. Mouse Strain Affects Behavioral and Neuroendocrine Stress Responses Following Administration of Probiotic Lactobacillus rhamnosus JB-1 or Traditional Antidepressant Fluoxetine.

    Science.gov (United States)

    McVey Neufeld, Karen-Anne; Kay, Sebastian; Bienenstock, John

    2018-01-01

    Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST) and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair-BALB/c and Swiss Webster-with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.

  5. Comparison of the insulin reaction of peripheral blood T cells between healthy Holstein dairy cows and JB during the periparturient period.

    Science.gov (United States)

    Ohtsuka, Hiromichi; Kitagawa, Madoka; Kohiruimaki, Masayuki; Tanami, Erika; Masui, Machiko; Hayashi, Tomohito; Ando, Takaaki; Watanabe, Daisaku; Koiwa, Masateru; Sato, Shigeru; Kawamura, Seiichi

    2006-11-01

    To compare the changes in the insulin reaction of Holstein dairy cows and Japanese Black cows (JB) during the periparturient period, the insulin resistance test in vivo and lymphocytes proliferation with insulin in vitro were performed. Ten healthy Holstein dairy cows (Holstein group) and 10 healthy JB cows (JB group) used in this study were observed on days 60, 40, and 20 before calving and days 7 and 20 after calving. In insulin resistance reaction in vivo and in vitro, a low insulin-stimulated glucose disposal rate and lymphocyte proliferation with insulin were observed in the Holstein group compared with the JB group during the experimental period. An analysis of the lymphocytes cultured with insulin showed that the percentage of CD4+CD45R- T cells in the Holstein group was significantly lower than that of the JB group before day 20. These findings indicate that T cells reaction to insulin in healthy periparturient Holstein cows is lower than that in Japanese Black.

  6. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Directory of Open Access Journals (Sweden)

    Patrycja Konieczna

    Full Text Available The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1. Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  7. Human Dendritic Cell DC-SIGN and TLR-2 Mediate Complementary Immune Regulatory Activities in Response to Lactobacillus rhamnosus JB-1

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O’Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses. PMID:25816321

  8. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O'Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  9. SN 2008jb: A 'LOST' CORE-COLLAPSE SUPERNOVA IN A STAR-FORMING DWARF GALAXY AT ∼10 Mpc

    International Nuclear Information System (INIS)

    Prieto, J. L.; Lee, J. C.; Drake, A. J.; Djorgovski, S. G.; McNaught, R.; Garradd, G.; Beacom, J. F.; Beshore, E.; Catelan, M.; Pojmanski, G.; Stanek, K. Z.; Szczygieł, D. M.

    2012-01-01

    We present the discovery and follow-up observations of SN 2008jb, a core-collapse supernova in the southern dwarf irregular galaxy ESO 302–14 (M B = –15.3 mag) at 9.6 Mpc. This nearby transient was missed by galaxy-targeted surveys and was only found in archival optical images obtained by the Catalina Real-time Transient Survey and the All-Sky Automated Survey. The well-sampled archival photometry shows that SN 2008jb was detected shortly after explosion and reached a bright optical maximum, V max ≅ 13.6 mag (M V,max ≅ –16.5). The shape of the light curve shows a plateau of ∼100 days, followed by a drop of ∼1.4 mag in the V band to a slow decline with an approximate 56 Co decay slope. The late-time light curve is consistent with 0.04 ± 0.01 M ☉ of 56 Ni synthesized in the explosion. A spectrum of the supernova obtained two years after explosion shows a broad, boxy Hα emission line, which is unusual for normal Type II-Plateau supernovae at late times. We detect the supernova in archival Spitzer and WISE images obtained 8-14 months after explosion, which show clear signs of warm (600-700 K) dust emission. The dwarf irregular host galaxy, ESO 302–14, has a low gas-phase oxygen abundance, 12 + log(O/H) = 8.2 (∼1/5 Z ☉ ), similar to those of the Small Magellanic Cloud and the hosts of long gamma-ray bursts and luminous core-collapse supernovae. This metallicity is one of the lowest among local (∼ 5 M ☉ for the star formation complex, assuming a single-age starburst. These properties are consistent with the expanding Hα supershells observed in many well-studied nearby dwarf galaxies, which are tell-tale signs of feedback from the cumulative effect of massive star winds and supernovae. The age estimated for the star-forming region where SN 2008jb exploded suggests a relatively high-mass progenitor star with an initial mass M ∼ 20 M ☉ and warrants further study. We discuss the implications of these findings in the study of core

  10. Medical Expert Systems Survey

    OpenAIRE

    Abu-Nasser, Bassem S.

    2017-01-01

    International audience; There is an increased interest in the area of Artificial Intelligence in general and expert systems in particular. Expert systems are rapidly growing technology. Expert systems are a branch of Artificial Intelligence which is having a great impact on many fields of human life. Expert systems use human expert knowledge to solve complex problems in many fields such as Health, science, engineering, business, and weather forecasting. Organizations employing the technology ...

  11. Expert auditors’ services classification

    OpenAIRE

    Jolanta Wisniewska

    2013-01-01

    The profession of an expert auditor is a public trust occupation with a distinctive feature of taking responsibility for actions in the public interest. The main responsibility of expert auditors is performing financial auditing; however, expert auditors are prepared to carry out different tasks which encompass a wide plethora of financial and auditing services for different kinds of institutions and companies. The aim of the article is first of all the description of expert auditors’ service...

  12. Delegating Decisions to Experts

    Science.gov (United States)

    Li, Hao; Suen, Wing

    2004-01-01

    We present a model of delegation with self-interested and privately informed experts. A team of experts with extreme but opposite biases is acceptable to a wide range of decision makers with diverse preferences, but the value of expertise from such a team is low. A decision maker wants to appoint experts who are less partisan than he is in order…

  13. Expert status and performance.

    Directory of Open Access Journals (Sweden)

    Mark A Burgman

    Full Text Available Expert judgements are essential when time and resources are stretched or we face novel dilemmas requiring fast solutions. Good advice can save lives and large sums of money. Typically, experts are defined by their qualifications, track record and experience. The social expectation hypothesis argues that more highly regarded and more experienced experts will give better advice. We asked experts to predict how they will perform, and how their peers will perform, on sets of questions. The results indicate that the way experts regard each other is consistent, but unfortunately, ranks are a poor guide to actual performance. Expert advice will be more accurate if technical decisions routinely use broadly-defined expert groups, structured question protocols and feedback.

  14. Performance of an alkalophilic and halotolerant laccase from gamma-proteobacterium JB in the presence of industrial pollutants.

    Science.gov (United States)

    Singh, Gursharan; Sharma, Prince; Capalash, Neena

    2009-08-01

    An alkalophilic and halotolerant laccase from gamma-proteobacterium JB catalyzed in high concentrations of organic solvents and various salts. The enzyme retained 80-100% activity in 10% concentration of dimethylsulfoxide (DMSO), ethanol, acetone or methanol; 100, 85 and 50% activity in 20 mM MgCl(2), 5.0 mM MnCl(2) and 0.1 mM CuCl(2); 140, 120 and 110% activity in 5.0 mM MnSO(4), 10 mM MgSO(4) and 1mM CaSO(4), respectively. Sodium halides inhibited the enzyme in the order: F(-)> Br(-)> I(-)> Cl(-). In 0.5 M NaCl, pH 6.0, laccase was approximately 60% active. Decolorization of indigo carmine by laccase at pH 9.0 was not inhibited even in the presence of 0.5 M NaCl. Release of chromophoric, reducing and hydrophobic compounds during biobleaching of straw rich-soda pulp by laccase was not inhibited when the enzyme was applied in the presence of 1 M NaCl at pH 8.0. Laccase retained 50% residual activity even when incubated with 5% calcium hypochlorite for 30 min.

  15. Pappas and Tepe's Pathways to Knowledge Model.

    Science.gov (United States)

    Zimmerman, Nancy P.; Pappas, Marjorie L.; Tepe, Ann E.

    2002-01-01

    Describes the Pathways to Knowledge model for helping students achieve information literacy in library media programs. Discusses the searcher's thinking, information search or seeking, and instructional strategies; information skills; the six stages in the model, including appreciation, presearch, search, interpretation, communication, and…

  16. Application of expert systems

    Energy Technology Data Exchange (ETDEWEB)

    Basden, A

    1983-11-01

    This article seeks to bring together a number of issues relevant to the application of expert systems by discussing their advantages and limitations, their roles and benefits, and the influence that real-life applications might have on the design of expert systems software. Part of the expert systems strategy of one major chemical company is outlined. Because it was in constructing one particular expert system that many of these issues became important this system is described briefly at the start of the paper and used to illustrate much of the later discussion. It is of the plausible-inference type and has application in the field of materials engineering. 22 references.

  17. Being an expert

    International Nuclear Information System (INIS)

    Brechet, Y.; Musseau, O.; Bruna, G.; Sperandio, M.; Roulleaux-Dugage, M.; Andrieux, S.; Metteau, L.

    2014-01-01

    This series of short articles are dedicated to the role of the expert in the enterprise. There is an important difference between a scientific counsellor and an expert, the expert, recognized by his peers, can speak publicly in his field of expertise but has a duty of transparency while the job of a scientific counsellor requires confidentiality. The making and the use of an expert in an enterprise requires a dedicated organization. The organization of the expertise in 5 enterprises in nuclear industry are considered: CEA (French Alternative Energies and Atomic Energy Commission), IRSN (Institute of Radioprotection and Nuclear Safety), AREVA, ANDRA (National Radioactive Waste Management Agency) and EDF (Electricity of France)

  18. c-Jun/AP-1 pathway-mediated cyclin D1 expression participates in low dose arsenite-induced transformation in mouse epidermal JB6 Cl41 cells

    International Nuclear Information System (INIS)

    Zhang Dongyun; Li Jingxia; Gao Jimin; Huang Chuanshu

    2009-01-01

    Arsenic is a well-documented human carcinogen associated with skin carcinogenesis. Our previous work reveals that arsenite exposure is able to induce cell transformation in mouse epidermal cell JB6 Cl41 through the activation of ERK, rather than JNK pathway. Our current studies further evaluate downstream pathway in low dose arsenite-induced cell transformation in JB6 Cl41 cells. Our results showed that treatment of cells with low dose arsenite induced activation of c-Jun/AP-1 pathway, and ectopic expression of dominant negative mutant of c-Jun (TAM67) blocked arsenite-induced transformation. Furthermore, our data indicated that cyclin D1 was an important downstream molecule involved in c-Jun/AP-1-mediated cell transformation upon low dose arsenite exposure, because inhibition of cyclin D1 expression by its specific siRNA in the JB6 Cl41 cells resulted in impairment of anchorage-independent growth of cells induced by low dose arsenite. Collectively, our results demonstrate that c-Jun/AP-1-mediated cyclin D1 expression is at least one of the key events implicated in cell transformation upon low dose arsenite exposure

  19. AR42J-B-13 cell: An expandable progenitor to generate an unlimited supply of functional hepatocytes

    International Nuclear Information System (INIS)

    Wallace, Karen; Fairhall, Emma A.; Charlton, Keith A.; Wright, Matthew C.

    2010-01-01

    Hepatocytes are the preparation of choice for Toxicological research in vitro. However, despite the fact that hepatocytes proliferate in vivo during liver regeneration, they are resistant to proliferation in vitro, do not tolerate sub-culture and tend to enter a de-differentiation program that results in a loss of hepatic function. These limitations have resulted in the search for expandable rodent and human cells capable of being directed to differentiate into functional hepatocytes. Research with stem cells suggests that it may be possible to provide the research community with hepatocytes in vitro although to date, significant challenges remain, notably generating a sufficiently pure population of hepatocytes with a quantitative functionality comparable with hepatocytes. This paper reviews work with the AR42J-B-13 (B-13) cell line. The B-13 cell was cloned from the rodent AR42J pancreatic cell line, express genes associated with pancreatic acinar cells and readily proliferates in simple culture media. When exposed to glucocorticoid, 75-85% of the cells trans-differentiate into hepatocyte-like (B-13/H) cells functioning at a level quantitatively similar to freshly isolated rat hepatocytes (with the remaining cells retaining the B-13 phenotype). Trans-differentiation of pancreatic acinar cells also appears to occur in vivo in rats treated with glucocorticoid; in mice with elevated circulating glucocorticoid and in humans treated for long periods with glucocorticoid. The B-13 response to glucocorticoid therefore appears to be related to a real pathophysiological response of a pancreatic cell to glucocorticoid. An understanding of how this process occurs and if it can be generated or engineered in human cells would result in a cell line with the ability to generate an unlimited supply of functional human hepatocytes in a cost effective manner.

  20. Computer Based Expert Systems.

    Science.gov (United States)

    Parry, James D.; Ferrara, Joseph M.

    1985-01-01

    Claims knowledge-based expert computer systems can meet needs of rural schools for affordable expert advice and support and will play an important role in the future of rural education. Describes potential applications in prediction, interpretation, diagnosis, remediation, planning, monitoring, and instruction. (NEC)

  1. Real time expert systems

    International Nuclear Information System (INIS)

    Asami, Tohru; Hashimoto, Kazuo; Yamamoto, Seiichi

    1992-01-01

    Recently, aiming at the application to the plant control for nuclear reactors and traffic and communication control, the research and the practical use of the expert system suitable to real time processing have become conspicuous. In this report, the condition for the required function to control the object that dynamically changes within a limited time is presented, and the technical difference between the real time expert system developed so as to satisfy it and the expert system of conventional type is explained with the actual examples and from theoretical aspect. The expert system of conventional type has the technical base in the problem-solving equipment originating in STRIPS. The real time expert system is applied to the fields accompanied by surveillance and control, to which conventional expert system is hard to be applied. The requirement for the real time expert system, the example of the real time expert system, and as the techniques of realizing real time processing, the realization of interruption processing, dispersion processing, and the mechanism of maintaining the consistency of knowledge are explained. (K.I.)

  2. Expert systems: An overview

    International Nuclear Information System (INIS)

    Verdejo, F.

    1985-01-01

    The purpose of this article is to introduce readers to the basic principles of rule-based expert systems. Four topics are discussed in subsequent sections: (1) Definition; (2) Structure of an expert system; (3) State of the art and (4) Impact and future research. (orig.)

  3. Trendwatch combining expert opinion

    NARCIS (Netherlands)

    Hendrix, E.M.T.; Kornelis, M.; Pegge, S.M.; Galen, van M.A.

    2006-01-01

    In this study, focus is on a systematic way to detect future changes in trends that may effect the dynamics in the agro-food sector, and on the combination of opinions of experts. For the combination of expert opinions, the usefulness of multilevel models is investigated. Bayesian data analysis is

  4. Expert Panel Elicitation

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, M. [Swedish Radiation Protection Authority, Stockholm (Sweden). Dept. of Waste Management and Environmental Protection; Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    2005-09-15

    Scientists are now frequently in a situation where data cannot be easily assessed, since they may have conflicting or uncertain sources. While expert judgment reflects private choices, it is possible both reduce the personal aspect as well as in crease confidence in the judgments by using formal protocols for choice and elicitation of experts. A full-scale elicitation made on seismicity following glaciation, now in its late phase and presented here in a preliminary form, illustrates the value of the technique and some essential issues in connection with the decision to launch such a project. The results show an unusual low variation between the experts.

  5. Experts on public trial

    DEFF Research Database (Denmark)

    Blok, Anders

    2007-01-01

    a case study of the May 2003 Danish consensus conference on environmental economics as a policy tool, the article reflects on the politics of expert authority permeating practices of public participation. Adopting concepts from the sociology of scientific knowledge (SSK), the conference is seen......-than-successful defense in the citizen perspective. Further, consensus conferences are viewed alternatively as "expert dissent conferences," serving to disclose a multiplicity of expert commitments. From this perspective, some challenges for democratizing expertise through future exercises in public participation...

  6. Experts' meeting: Maintenance '83

    International Nuclear Information System (INIS)

    1983-01-01

    The brochure presents, in full wording, 20 papers read at the experts' meeting ''Maintenance '83'' in Wiesbaden. Most of the papers discuss reliability data (acquisition, evaluation, processing) of nearly all fields of industry. (RW) [de

  7. Metallic nickel nano- and fine particles induce JB6 cell apoptosis through a caspase-8/AIF mediated cytochrome c-independent pathway

    Directory of Open Access Journals (Sweden)

    Castranova Vincent

    2009-04-01

    Full Text Available Abstract Background Carcinogenicity of nickel compounds has been well documented. However, the carcinogenic effect of metallic nickel is still unclear. The present study investigates metallic nickel nano- and fine particle-induced apoptosis and the signal pathways involved in this process in JB6 cells. The data obtained from this study will be of benefit for elucidating the pathological and carcinogenic potential of metallic nickel particles. Results Using 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, we found that metallic nickel nanoparticles exhibited higher cytotoxicity than fine particles. Both metallic nickel nano- and fine particles induced JB6 cell apoptosis. Metallic nickel nanoparticles produced higher apoptotic induction than fine particles. Western-blot analysis showed an activation of proapoptotic factors including Fas (CD95, Fas-associated protein with death domain (FADD, caspase-8, death receptor 3 (DR3 and BID in apoptotic cells induced by metallic nickel particles. Immunoprecipitation (IP western blot analysis demonstrated the formation of the Fas-related death-inducing signaling complex (DISC in the apoptotic process. Furthermore, lamin A and beta-actin were cleaved. Moreover, we found that apoptosis-inducing factor (AIF was up-regulated and released from mitochondria to cytoplasm. Interestingly, although an up-regulation of cytochrome c was detected in the mitochondria of metallic nickel particle-treated cells, no cytochrome c release from mitochondria to cytoplasm was found. In addition, activation of antiapoptotic factors including phospho-Akt (protein kinase B and Bcl-2 was detected. Further studies demonstrated that metallic nickel particles caused no significant changes in the mitochondrial membrane permeability after 24 h treatment. Conclusion In this study, metallic nickel nanoparticles caused higher cytotoxicity and apoptotic induction than fine particles in JB6 cells. Apoptotic cell death

  8. Waste disposal experts meet

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1959-01-15

    Problems connected with the disposal into the sea of radioactive wastes from peaceful uses of atomic energy are being examined by a panel of experts, convened by the International Atomic Energy Agency. These experts from eight different countries held a first meeting at IAEA headquarters in Vienna from 4-9 December 1958, under the chairmanship of Dr. Harry Brynielsson, Director General of the Swedish Atomic Energy Company. The countries represented are: Canada, Czechoslovakia, France, Japan, Netherlands, United Kingdom and United States. The group will meet again in 1959. (author)

  9. Price competition between an expert and a non-expert

    OpenAIRE

    Bouckaert, J.M.C.; Degryse, H.A.

    1998-01-01

    This paper characterizes price competition between an expert and a non-expert. In contrast with the expert, the non-expert’s repair technology is not always successful. Consumers visit the expert after experiencing an unsuccessful match at the non-expert. This re-entry affects the behaviour of both sellers. For low enough probability of successful repair at the non-expert, all consumers first visit the non-expert, and a ‘timid-pricing’ equilibrium results. If the non-expert’s repair technolog...

  10. A highly thermostable alkaline cellulase-free xylanase from thermoalkalophilic Bacillus sp. JB 99 suitable for paper and pulp industry: purification and characterization.

    Science.gov (United States)

    Shrinivas, Dengeti; Savitha, Gunashekaran; Raviranjan, Kumar; Naik, Gajanan Ramchandra

    2010-11-01

    A highly thermostable alkaline xylanase was purified to homogeneity from culture supernatant of Bacillus sp. JB 99 using DEAE-Sepharose and Sephadex G-100 gel filtration with 25.7-fold increase in activity and 43.5% recovery. The molecular weight of the purified xylanase was found to be 20 kDA by SDS-PAGE and zymogram analysis. The enzyme was optimally active at 70 °C, pH 8.0 and stable over pH range of 6.0-10.0.The relative activity at 9.0 and 10.0 were 90% and 85% of that of pH 8.0, respectively. The enzyme showed high thermal stability at 60 °C with 95% of its activity after 5 h. The K (m) and V (max) of enzyme for oat spelt xylan were 4.8 mg/ml and 218.6 µM min(-1) mg(-1), respectively. Analysis of N-terminal amino acid sequence revealed that the xylanase belongs to glycosyl hydrolase family 11 from thermoalkalophilic Bacillus sp. with basic pI. Substrate specificity showed a high activity on xylan-containing substrate and cellulase-free nature. The hydrolyzed product pattern of oat spelt xylan on thin-layer chromatography suggested xylanase as an endoxylanase. Due to these properties, xylanase from Bacillus sp. JB 99 was found to be highly compatible for paper and pulp industry.

  11. Expert Systems Research.

    Science.gov (United States)

    Duda, Richard O.; Shortliffe, Edward H.

    1983-01-01

    Discusses a class of artificial intelligence computer programs (often called "expert systems" because they address problems normally thought to require human specialists for their solution) intended to serve as consultants for decision making. Also discusses accomplishments (including information systematization in medical diagnosis and…

  12. Computers Simulate Human Experts.

    Science.gov (United States)

    Roberts, Steven K.

    1983-01-01

    Discusses recent progress in artificial intelligence in such narrowly defined areas as medical and electronic diagnosis. Also discusses use of expert systems, man-machine communication problems, novel programing environments (including comments on LISP and LISP machines), and types of knowledge used (factual, heuristic, and meta-knowledge). (JN)

  13. Expert Cold Structure Development

    Science.gov (United States)

    Atkins, T.; Demuysere, P.

    2011-05-01

    The EXPERT Program is funded by ESA. The objective of the EXPERT mission is to perform a sub-orbital flight during which measurements of critical aero- thermodynamic phenomena will be obtained by using state-of-the-art instrumentation. As part of the EXPERT Flight Segment, the responsibility of the Cold Structure Development Design, Manufacturing and Validation was committed to the Belgian industrial team SONACA/SABCA. The EXPERT Cold Structure includes the Launcher Adapter, the Bottom Panel, the Upper Panel, two Cross Panels and the Parachute Bay. An additional Launcher Adapter was manufactured for the separation tests. The selected assembly definition and manufacturing technologies ( machined parts and sandwich panels) were dictated classically by the mass and stiffness, but also by the CoG location and the sensitive separation interface. Used as support for the various on-board equipment, the Cold Structure is fixed to but thermally uncoupled from the PM 1000 thermal shield. It is protect on its bottom panel by a thermal blanket. As it is a protoflight, analysis was the main tool for the verification. Low level stiffness and modal analysis tests have also been performed on the Cold Structure equipped with its ballast. It allowed to complete its qualification and to prepare SONACA/SABCA support for the system dynamic tests foreseen in 2011. The structure was finally coated with a thermal control black painting and delivered on time to Thales Alenia Space-Italy end of March 201.

  14. Expert PLSQL Practices

    CERN Document Server

    Beresniewicz, John

    2011-01-01

    Expert PL/SQL Practices is a book of collected wisdom on PL/SQL programming from some of the best and the brightest in the field. Each chapter is a deep-dive into a specific problem, technology, or feature set that you'll face as a PL/SQL programmer. Each author has chosen their topic out of the strong belief that what they share can make a positive difference in the quality and scalability of code that you write. The path to mastery begins with syntax and the mechanics of writing statements to make things happen. If you've reached that point with PL/SQL, then let the authors of Expert PL/SQL

  15. Bioethics for Technical Experts

    Science.gov (United States)

    Asano, Shigetaka

    Along with rapidly expanding applications of life science and technology, technical experts have been implicated more and more often with ethical, social, and legal problems than before. It should be noted that in this background there are scientific and social uncertainty elements which are inevitable during the progress of life science in addition to the historically-established social unreliability to scientists and engineers. In order to solve these problems, therefore, we should establish the social governance with ‘relief’ and ‘reliance’ which enables for both citizens and engineers to share the awareness of the issues, to design social orders and criterions based on hypothetical sense of values for bioethics, to carry out practical use management of each subject carefully, and to improve the sense of values from hypothetical to universal. Concerning these measures, the technical experts can learn many things from the present performance in the medical field.

  16. Expert tool use

    DEFF Research Database (Denmark)

    Thorndahl, Kathrine Liedtke; Ravn, Susanne

    2017-01-01

    on a case study of elite rope skipping, we argue that the phenomenological concept of incorporation does not suffice to adequately describe how expert tool users feel when interacting with their tools. By analyzing a combination of insights gained from participant observation of 11 elite rope skippers......According to some phenomenologists, a tool can be experienced as incorporated when, as a result of habitual use or deliberate practice, someone is able to manipulate it without conscious effort. In this article, we specifically focus on the experience of expertise tool use in elite sport. Based...... and autoethnographic material from one former elite skipper, we take some initial steps toward the development of a more nuanced understanding of the concept of incorporation; one that is able to accommodate the experiences of expert tool users. In sum, our analyses indicate that the possibility for experiencing...

  17. ALICE Expert System

    CERN Document Server

    Ionita, C

    2014-01-01

    The ALICE experiment at CERN employs a number of human operators (shifters), who have to make sure that the experiment is always in a state compatible with taking Physics data. Given the complexity of the system and the myriad of errors that can arise, this is not always a trivial task. The aim of this paper is to describe an expert system that is capable of assisting human shifters in the ALICE control room. The system diagnoses potential issues and attempts to make smart recommendations for troubleshooting. At its core, a Prolog engine infers whether a Physics or a technical run can be started based on the current state of the underlying sub-systems. A separate C++ component queries certain SMI objects and stores their state as facts in a Prolog knowledge base. By mining the data stored in dierent system logs, the expert system can also diagnose errors arising during a run. Currently the system is used by the on-call experts for faster response times, but we expect it to be adopted as a standard tool by reg...

  18. ALICE Expert System

    International Nuclear Information System (INIS)

    Ionita, C; Carena, F

    2014-01-01

    The ALICE experiment at CERN employs a number of human operators (shifters), who have to make sure that the experiment is always in a state compatible with taking Physics data. Given the complexity of the system and the myriad of errors that can arise, this is not always a trivial task. The aim of this paper is to describe an expert system that is capable of assisting human shifters in the ALICE control room. The system diagnoses potential issues and attempts to make smart recommendations for troubleshooting. At its core, a Prolog engine infers whether a Physics or a technical run can be started based on the current state of the underlying sub-systems. A separate C++ component queries certain SMI objects and stores their state as facts in a Prolog knowledge base. By mining the data stored in different system logs, the expert system can also diagnose errors arising during a run. Currently the system is used by the on-call experts for faster response times, but we expect it to be adopted as a standard tool by regular shifters during the next data taking period

  19. Pigeon pea waste as a novel, inexpensive, substrate for production of a thermostable alkaline protease from thermoalkalophilic Bacillus sp. JB-99.

    Science.gov (United States)

    Johnvesly, B; Manjunath, B R; Naik, G R

    2002-03-01

    Thermoalkaliphilic Bacillus sp. JB-99 was grown in a 250 ml Erlenmeyer flask containing 50 ml medium containing (g/l) Pigeon pea waste 10; NaNO3, 5.0; K2HPO4, 5.0; MgSO4 x 2H2O, 0.2 and Na2CO3, 10.0. Incubations were carried out at 50 degrees C on a rotary incubator shaker for 15 h. A high level of extra cellular thermostable protease activity was observed after 24 h incubation. The optimum temperature and pH for activity were 70 degrees C and 11, respectively, so this enzyme showed stable activity at high temperature and under alkaline conditions.

  20. Expert Oracle Exadata

    CERN Document Server

    Johnson, Randy

    2011-01-01

    Throughout history, advances in technology have come in spurts. A single great idea can often spur rapid change as the idea takes hold and is propagated, often in totally unexpected directions. Exadata embodies such a change in how we think about and manage relational databases. The key change lies in the concept of offloading SQL processing to the storage layer. That concept is a huge win, and its implementation in the form of Exadata is truly a game changer. Expert Oracle Exadata will give you a look under the covers at how the combination of hardware and software that comprise Exadata actua

  1. The naked experts

    International Nuclear Information System (INIS)

    Martin, B.

    1982-01-01

    In an article critical of experts, the cases argued for and against nuclear power are discussed under the headings: environmental hazards arising from the nuclear fuel cycle; proliferation of nuclear weapons capabilities via expansion of the nuclear power industry; political and social threats and restraints of a nuclear society (terrorism, reduction in civil liberties, centralised political and economic power); economic and employment disadvantages of nuclear power; impact of uranium mining on (Australian) aboriginal culture; inadequacy of nuclear power as a solution to energy problems; advantages of a 'soft energy path' based around conservation and renewable energy technologies. (U.K.)

  2. [Deontology of the medical expert].

    Science.gov (United States)

    Raszeja, S

    1995-09-01

    The authority of prosecuting organ to choose the expert, set his task and verify the following opinion is defined. The qualities of the medical expert and his duties are described, referring to: -his expertise; -his morality; -his ability to issue an independent (objective) opinion. Detailed rules, which can be ascribed to a specific medical expert's deontological code, are listed and explained.

  3. Hybrid expert system

    International Nuclear Information System (INIS)

    Tsoukalas, L.; Ikonomopoulos, A.; Uhrig, R.E.

    1991-01-01

    This paper presents a methodology that couples rule-based expert systems using fuzzy logic, to pre-trained artificial neutral networks (ANN) for the purpose of transient identification in Nuclear Power Plants (NPP). In order to provide timely concise, and task-specific information about the may aspects of the transient and to determine the state of the system based on the interpretation of potentially noisy data a model-referenced approach is utilized. In it, the expert system performs the basic interpretation and processing of the model data, and pre-trained ANNs provide the model. having access to a set of neural networks that typify general categories of transients, the rule based system is able to perform identification functions. Membership functions - condensing information about a transient in a form convenient for a rule-based identification system characterizing a transient - are the output of neural computations. This allows the identification function to be performed with a speed comparable to or faster than that of the temporal evolution of the system. Simulator data form major secondary system pipe rupture is used to demonstrate the methodology. The results indicate excellent noise-tolerance for ANN's and suggest a new method for transient identification within the framework of Fuzzy Logic

  4. Der Patient als Experte.

    Science.gov (United States)

    Dubs

    1998-01-01

    Patients as Experts: Determining Benefit by Using Assessments of Ability (ICIDH)When health economy and quality mangement are dealing with the cost-benefit relationship, to this day description, calculation, and assessment of the benefit are missing to a great extent. Deliberations in terms of cause and effect do not go beyond the model of pathogenesis (etiology - pathology - manifestation) and descriptions on the organ level (ICD). Only the international classification of impairments, disabilities, and handicaps (ICIDH) as a separate estimation of the resulting manifestations of illness on the levels of organ, individual, and society is capable to elucidate this benefit. It is the patient who is the expert to decide what he needs, what he wants, and what he can do, thus, evaluating on an individual level his loss of capability. The ICIDH is regarded as the key for the management of chronic diseases. The characteristics of being chronically ill require the integration of salutogenesis and the consideration of the hierarchy of needs. The specially developed MARA model serves as pragmatic basis for the description of the benefits of carried out and omitted interventions as changes of abilities by using the MARA curve (mean age-related ability) as ethical guideline. In quality circles the MARA model, which is based on ICIDH, hierarchy of needs and salutogenesis, can offer apatient-oriented basis of discussion for benefit assessments, and, in a pragmatical way, it can facilitate the introduction of evidence-based medicine. By the change of view from the organ level with multifactorial aspects to the individual level, in which the abilities can be understood as a monofactor, a high consensus potential between several participants of discussion in health service is possible.

  5. Expert system in PNC, 5

    International Nuclear Information System (INIS)

    Tobita, Yoshimasa; Yamaguchi, Takashi; Matsumoto, Mitsuo; Ono, Kiyoshi.

    1990-01-01

    The computer code system which can evaluate the mass balance and cycle cost in nuclear fuel cycle has been developing a PNC using an artificial intelligence technique. This system is composed of the expert system, data base and analysis codes. The expert system is the most important one in the system and the content of the expert system is explained in this paper. The expert system has the three functions. The first is the function of understanding the meaning of user's questions by natural language, the second is the function of selecting the best way to solve the problem given by the user using the knowledge which is already installed in the system, and the last is the function of answering the questions. The knowledge of the experts installed in the expert system is represented by the frame-type rules. Therefore, the knowledge will be simply added to the system, and consequently the system will be easily extended. (author)

  6. The First Expert CAI System

    Science.gov (United States)

    Feurzeig, Wallace

    1984-01-01

    The first expert instructional system, the Socratic System, was developed in 1964. One of the earliest applications of this system was in the area of differential diagnosis in clinical medicine. The power of the underlying instructional paradigm was demonstrated and the potential of the approach for valuably supplementing medical instruction was recognized. Twenty years later, despite further educationally significant advances in expert systems technology and enormous reductions in the cost of computers, expert instructional methods have found very little application in medical schools.

  7. Surgical experts: born or made?

    Science.gov (United States)

    Sadideen, Hazim; Alvand, Abtin; Saadeddin, Munir; Kneebone, Roger

    2013-01-01

    The concept of surgical expertise and the processes involved in its development are topical, and there is a constant drive to identify reliable measures of expert performance in surgery. This review explores the notion of whether surgical experts are "born" or "made", with reference to educational theory and pertinent literature. Peer-reviewed publications, books, and online resources on surgical education, expertise and training were reviewed. Important themes and aspects of expertise acquisition were identified in order to better understand the concept of a surgical expert. The definition of surgical expertise and several important aspects of its development are highlighted. Innate talent plays an important role, but is insufficient on its own to produce a surgical expert. Multiple theories that explore motor skill acquisition and memory are relevant, and Ericsson's theory of the development of competence followed by deliberate self-practice has been especially influential. Psychomotor and non-technical skills are necessary for progression in the current climate in light of our training curricula; surgical experts are adaptive experts who excel in these. The literature suggests that surgical expertise is reached through practice; surgical experts are made, not born. A deeper understanding of the nature of expert performance and its development will ensure that surgical education training programmes are of the highest possible quality. Surgical educators should aim to develop an expertise-based approach, with expert performance as the benchmark. Copyright © 2013 Surgical Associates Ltd. Published by Elsevier Ltd. All rights reserved.

  8. Expert Systems for the Analytical Laboratory.

    Science.gov (United States)

    de Monchy, Allan R.; And Others

    1988-01-01

    Discusses two computer problem solving programs: rule-based expert systems and decision analysis expert systems. Explores the application of expert systems to automated chemical analyses. Presents six factors to consider before using expert systems. (MVL)

  9. Expert Systems as Tools for Technical Communicators.

    Science.gov (United States)

    Grider, Daryl A.

    1994-01-01

    Discusses expertise, what an expert system is, what an expert system shell is, what expert systems can and cannot do, knowledge engineering and technical communicators, and planning and managing expert system projects. (SR)

  10. Mapping on complex neutrosophic soft expert sets

    Science.gov (United States)

    Al-Quran, Ashraf; Hassan, Nasruddin

    2018-04-01

    We introduce the mapping on complex neutrosophic soft expert sets. Further, we investigated the basic operations and other related properties of complex neutrosophic soft expert image and complex neutrosophic soft expert inverse image of complex neutrosophic soft expert sets.

  11. System Experts and Decision Making Experts in Transdisciplinary Projects

    Science.gov (United States)

    Mieg, Harald A.

    2006-01-01

    Purpose: This paper aims at a better understanding of expert roles in transdisciplinary projects. Thus, the main purpose is the analysis of the roles of experts in transdisciplinary projects. Design/methodology/approach: The analysis of the ETH-UNS case studies from the point of view of the psychology of expertise and the sociology of professions…

  12. Online-Expert: An Expert System for Online Database Selection.

    Science.gov (United States)

    Zahir, Sajjad; Chang, Chew Lik

    1992-01-01

    Describes the design and development of a prototype expert system called ONLINE-EXPERT that helps users select online databases and vendors that meet users' needs. Search strategies are discussed; knowledge acquisition and knowledge bases are described; and the Analytic Hierarchy Process (AHP), a decision analysis technique that ranks databases,…

  13. Plutonium - the ultrapoison? An expert's opinion about an expert opinion

    International Nuclear Information System (INIS)

    Stoll, W.; Becker, K.

    1989-01-01

    In an expert opinion written by Professor H. Kuni, Marburg, for the North Rhine-Westphalian state government, plutonium is called by far the most dangerous element in the Periodic Table. The Marburg medical expert holds that even improved legal instruments are unable to warrant effective protection of the workers handling this material, in the light of the present standards of industrial safety, because of radiological conditions and measuring problems with plutonium isotopes. In this article by an internationally renowned expert in the field, the ideas expressed in the expert opinion about the toxicity of plutonium, the cause-and-effect relationship in radiation damage by plutonium, and recent findings about the toxicity are subjected to a critical review. On the basis of results of radiation protection and of case studies, the statements in the expert opinion are contrasted with facts which make them appear in a very different light. (orig./RB) [de

  14. Biobleaching of wheat straw-rich soda pulp with alkalophilic laccase from gamma-proteobacterium JB: optimization of process parameters using response surface methodology.

    Science.gov (United States)

    Singh, Gursharan; Ahuja, Naveen; Batish, Mona; Capalash, Neena; Sharma, Prince

    2008-11-01

    An alkalophilic laccase from gamma-proteobacterium JB was applied to wheat straw-rich soda pulp to check its bleaching potential by using response surface methodology based on central composite design. The design was employed by selecting laccase units, ABTS (2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid)) concentration and pH as model factors. The results of second order factorial design experiments showed that all three independent variables had significant effect on brightness and kappa number of laccase-treated pulp. Optimum conditions for biobleaching of pulp with laccase preparation (specific activity, 65 nkat mg(-1) protein) were 20 nkat g(-1) of pulp, 2mM ABTS and pH 8.0 which enhanced brightness by 5.89% and reduced kappa number by 21.1% within 4h of incubation at 55 degrees C, without further alkaline extraction of pulp. Tear index (8%) and burst index (18%) also improved for laccase-treated pulp as compared to control raw pulp. Treatment of chemically (CEH1H2) bleached pulp with laccase showed significant effect on release of chromophores, hydrophobic and reducing compounds. Laccase-prebleaching of raw pulp reduced the use of hypochlorite by 10% to achieve brightness of resultant hand sheets similar to the fully chemically bleached pulp.

  15. Enhanced production of alkaline thermostable keratinolytic protease from calcium alginate immobilized cells of thermoalkalophilic Bacillus halodurans JB 99 exhibiting dehairing activity.

    Science.gov (United States)

    Shrinivas, Dengeti; Kumar, Raghwendra; Naik, G R

    2012-01-01

    The thermoalkalophilic Bacillus halodurans JB 99 cells known for production of novel thermostable alkaline keratinolytic protease were immobilized in calcium alginate matrix. Batch and repeated batch cultivation using calcium alginate immobilized cells were studied for alkaline protease production in submerged fermentation. Immobilized cells with 2.5% alginate and 350 beads/flask of initial cell loading showed enhanced production of alkaline protease by 23.2% (5,275 ± 39.4 U/ml) as compared to free cells (4,280 ± 35.4 U/ml) after 24 h. In the semicontinuous mode of cultivation, immobilized cells under optimized conditions produced an appreciable level of alkaline protease in up to nine cycles and reached a maximal value of 5,975 U/ml after the seventh cycle. The enzyme produced from immobilized cells efficiently degraded chicken feathers in the presence of a reducing agent which can help the poultry industry in the management of keratin-rich waste and obtaining value-added products.

  16. Law for nuclear experts only

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, H [Kernforschungszentrum Karlsruhe G.m.b.H. (Germany, F.R.)

    1980-02-01

    The Federal Ministry of the Interior is preparing an ordinance on expert consultants under the Atomic Energy Act which, among other topics, is to include legal norms for the criteria to be met by experts in terms of non-partisanship, training, capabilities, technical equipment and cooperation in expert organizations of members of various scientific and technical disciplines. A summary of general criteria relating to the qualification, selection and status of experts called in by the legislative and executive branches and by courts of law, which could be organized as a series of guidelines without any original qualities of legal norms, could be recommended in view of the increasing quantitative and qualitative importance of experts. However, passing an ordinance merely fixing and putting into concrete terms the image of an 'expert under the Atomic Energy Act' is intolerable, because the status of scientific and technical experts by far extends beyond the field of nuclear law in our industrial society characterized by a far reaching division of labor. Weak points in the organization of expert services are not confined to technology or nuclear power. Separate rules establishing legal norms are not convincing also for reasons of technology policy and legal policy as well as for those of social psychology and practice.

  17. Expert Systems in Reference Services.

    Science.gov (United States)

    Roysdon, Christine, Ed.; White, Howard D., Ed.

    1989-01-01

    Eleven articles introduce expert systems applications in library and information science, and present design and implementation issues of system development for reference services. Topics covered include knowledge based systems, prototype development, the use of artificial intelligence to remedy current system inadequacies, and an expert system to…

  18. Artificial Intelligence: The Expert Way.

    Science.gov (United States)

    Bitter, Gary G.

    1989-01-01

    Discussion of artificial intelligence (AI) and expert systems focuses on their use in education. Characteristics of good expert systems are explained; computer software programs that contain applications of AI are described, highlighting one used to help educators identify learning-disabled students; and the future of AI is discussed. (LRW)

  19. Reflection group on 'Expert Culture'

    International Nuclear Information System (INIS)

    Eggermont, G.

    2000-01-01

    As part of SCK-CEN's social sciences and humanities programme, a reflection group on 'Expert Culture' was established. The objectives of the reflection group are: (1) to clarify the role of SCK-CEN experts; (2) to clarify the new role of expertise in the evolving context of risk society; (3) to confront external views and internal SCK-CEN experiences on expert culture; (4) to improve trust building of experts and credibility of SCK-CEN as a nuclear actor in society; (5) to develop a draft for a deontological code; (6) to integrate the approach in training on assertivity and communication; (7) to create an output for a topical day on the subject of expert culture. The programme, achievements and perspectives of the refection group are summarised

  20. Preserving experience through expert systems

    International Nuclear Information System (INIS)

    Jelinek, J.B.; Weidman, S.H.

    1989-01-01

    Expert systems technology, one of the branches in the field of computerized artificial intelligence, has existed for >30 yr but only recently has been made available on commercially standard hardware and software platforms. An expert system can be defined as any method of encoding knowledge by representing that knowledge as a collection of facts or objects. Decisions are made by the expert program by obtaining data about the problem or situation and correlating encoded facts (knowledge) to the data until a conclusion can be reached. Such conclusions can be relayed to the end user as expert advice. Realizing the potential of this technology, General Electric (GE) Nuclear Energy (GENE) has initiated a development program in expert systems applications; this technology offers the potential for packaging, distributing, and preserving nuclear experience in a software form. The paper discusses application fields, effective applications, and knowledge acquisition and knowledge verification

  1. Expert software for accident identification

    International Nuclear Information System (INIS)

    Dobnikar, M.; Nemec, T.; Muehleisen, A.

    2003-01-01

    Each type of an accident in a Nuclear Power Plant (NPP) causes immediately after the start of the accident variations of physical parameters that are typical for that type of the accident thus enabling its identification. Examples of these parameter are: decrease of reactor coolant system pressure, increase of radiation level in the containment, increase of pressure in the containment. An expert software enabling a fast preliminary identification of the type of the accident in Krsko NPP has been developed. As input data selected typical parameters from Emergency Response Data System (ERDS) of the Krsko NPP are used. Based on these parameters the expert software identifies the type of the accident and also provides the user with appropriate references (past analyses and other documentation of such an accident). The expert software is to be used as a support tool by an expert team that forms in case of an emergency at Slovenian Nuclear Safety Administration (SNSA) with the task to determine the cause of the accident, its most probable scenario and the source term. The expert software should provide initial identification of the event, while the final one is still to be made after appropriate assessment of the event by the expert group considering possibility of non-typical events, multiple causes, initial conditions, influences of operators' actions etc. The expert software can be also used as an educational/training tool and even as a simple database of available accident analyses. (author)

  2. Intelligent programs-expert systems

    Energy Technology Data Exchange (ETDEWEB)

    Gledhill, V X

    1982-01-01

    In recent years, computer scientists have developed what are called expert systems. These programs have three fundamental components: a knowledge base, which changes with experience; an inference engine which enables the program to make decisions; and an interface that allows the program to communicate with the person using the system. Expert systems have been developed successfully in areas such as medical diagnosis, geology, and computer maintenance. This paper describes the evolution and basic principles of expert systems and give some examples of their use.

  3. Production and Its Anti-hyperglycemic Effects of γ-Aminobutyric Acid from the Wild Yeast Strain Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1.

    Science.gov (United States)

    Han, Sang-Min; Lee, Jong-Soo

    2017-09-01

    This study was done to produce γ-aminobutyric acid (GABA) from wild yeast as well as investigate its anti-hyperglycemic effects. Among ten GABA-producing yeast strains, Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1 produced high GABA concentration of 134.4 µg/mL and 179.2 µg/mL, respectively. P. silvicola UL6-1 showed a maximum GABA yield of 136.5 µg/mL and 200.8 µg/mL from S. carnicolor 402-JB-1 when they were cultured for 30 hr at 30℃ in yeast extract-peptone-dextrose medium. The cell-free extract from P. silvicola UL6-1 and S. carnicolor 402-JB-1 showed very high anti-hyperglycemic α-glucosidase inhibitory activity of 72.3% and 69.9%, respectively. Additionally, their cell-free extract-containing GABA showed the anti-hyperglycemic effect in streptozotocin-induced diabetic Sprague-Dawley rats.

  4. Cr(VI) induces mitochondrial-mediated and caspase-dependent apoptosis through reactive oxygen species-mediated p53 activation in JB6 Cl41 cells

    International Nuclear Information System (INIS)

    Son, Young-Ok; Hitron, J. Andrew; Wang Xin; Chang Qingshan; Pan Jingju; Zhang Zhuo; Liu Jiankang; Wang Shuxia; Lee, Jeong-Chae; Shi Xianglin

    2010-01-01

    Cr(VI) compounds are known to cause serious toxic and carcinogenic effects. Cr(VI) exposure can lead to a severe damage to the skin, but the mechanisms involved in the Cr(VI)-mediated toxicity in the skin are unclear. The present study examined whether Cr(VI) induces cell death by apoptosis or necrosis using mouse skin epidermal cell line, JB6 Cl41 cells. We also investigated the cellular mechanisms of Cr(VI)-induced cell death. This study showed that Cr(VI) induced apoptotic cell death in a dose-dependent manner, as demonstrated by the appearance of cell shrinkage, the migration of cells into the sub-G1 phase, the increase of Annexin V positively stained cells, and the formation of nuclear DNA ladders. Cr(VI) treatment resulted in the increases of mitochondrial membrane depolarization and caspases activation. Electron spin resonance (ESR) and fluorescence analysis revealed that Cr(VI) increased intracellular levels of reactive oxygen species (ROS) such as hydrogen peroxide and superoxide anion radical in dose-dependent manner. Blockage of p53 by si-RNA transfection suppressed mitochondrial changes of Bcl-2 family composition, mitochondrial membrane depolarization, caspase activation and PARP cleavage, leading to the inhibition of Cr(VI)-induced apoptosis. Further, catalase treatment prevented p53 phosphorylation stimulated by Cr(VI) with the concomitant inhibition of caspase activation. These results suggest that Cr(VI) induced a mitochondrial-mediated and caspase-dependent apoptosis in skin epidermal cells through activation of p53, which are mainly mediated by reactive oxidants generated by the chemical.

  5. Lost in translation? The potential psychobiotic Lactobacillus rhamnosus (JB-1) fails to modulate stress or cognitive performance in healthy male subjects.

    Science.gov (United States)

    Kelly, John R; Allen, Andrew P; Temko, Andriy; Hutch, William; Kennedy, Paul J; Farid, Niloufar; Murphy, Eileen; Boylan, Geraldine; Bienenstock, John; Cryan, John F; Clarke, Gerard; Dinan, Timothy G

    2017-03-01

    Preclinical studies have identified certain probiotics as psychobiotics - live microorganisms with a potential mental health benefit. Lactobacillus rhamnosus (JB-1) has been shown to reduce stress-related behaviour, corticosterone release and alter central expression of GABA receptors in an anxious mouse strain. However, it is unclear if this single putative psychobiotic strain has psychotropic activity in humans. Consequently, we aimed to examine if these promising preclinical findings could be translated to healthy human volunteers. To determine the impact of L. rhamnosus on stress-related behaviours, physiology, inflammatory response, cognitive performance and brain activity patterns in healthy male participants. An 8week, randomized, placebo-controlled, cross-over design was employed. Twenty-nine healthy male volunteers participated. Participants completed self-report stress measures, cognitive assessments and resting electroencephalography (EEG). Plasma IL10, IL1β, IL6, IL8 and TNFα levels and whole blood Toll-like 4 (TLR-4) agonist-induced cytokine release were determined by multiplex ELISA. Salivary cortisol was determined by ELISA and subjective stress measures were assessed before, during and after a socially evaluated cold pressor test (SECPT). There was no overall effect of probiotic treatment on measures of mood, anxiety, stress or sleep quality and no significant effect of probiotic over placebo on subjective stress measures, or the HPA response to the SECPT. Visuospatial memory performance, attention switching, rapid visual information processing, emotion recognition and associated EEG measures did not show improvement over placebo. No significant anti-inflammatory effects were seen as assessed by basal and stimulated cytokine levels. L. rhamnosus was not superior to placebo in modifying stress-related measures, HPA response, inflammation or cognitive performance in healthy male participants. These findings highlight the challenges associated with

  6. Expert robots in nuclear plants

    International Nuclear Information System (INIS)

    Byrd, J.S.; Fisher, J.J.; DeVries, K.R.; Martin, T.P.

    1987-01-01

    Expert robots enhance a safety and operations in nuclear plants. E.I. du Pont de Nemours and Company, Savannah River Laboratory, is developing expert mobile robots for deployment in nuclear applications at the Savannah River Plant. Knowledge-based expert systems are being evaluated to simplify operator control, to assist in navigation and manipulation functions, and to analyze sensory information. Development work using two research vehicles is underway to demonstrate semiautonomous, intelligence, expert robot system operation in process areas. A description of the mechanical equipment, control systems, and operating modes is presented, including the integration of onboard sensors. A control hierarchy that uses modest computational methods is being used to allow mobile robots to autonomously navigate and perform tasks in known environments without the need for large computer systems

  7. Expert Systems: An Introduction -46 ...

    Indian Academy of Sciences (India)

    Research Scientist in the. Knowledge Based. Computer Systems Group at NeST. He is one of the ... Expert systems encode human expertise in limited domains ... answers questions the user has and provides an explanation of its reasoning.

  8. Introducing Managers to Expert Systems.

    Science.gov (United States)

    Finlay, Paul N.; And Others

    1991-01-01

    Describes a short course to expose managers to expert systems, consisting of (1) introductory lecture; (2) supervised computer tutorial; (3) lecture and discussion about knowledge structuring and modeling; and (4) small group work on a case study using computers. (SK)

  9. Expert system in PNC, 6

    International Nuclear Information System (INIS)

    Tsubota, Koji

    1990-01-01

    The application of Artificial Intelligence (AI) as a tool for mineral exploration started only a decade ago. The systems that have been reported are in the most cases the expert systems that can simulate the decision of the experts or help numerical calculation for more reasonable and/or fast decision making. PNC started the development of the expert system for uranium exploration in 1983. Since then, KOGITO, a expert system to find the favorability of the target area, has been developed. Two years ago, the second generation development, Intelligent Research Environment and Support System, IRESS was initiated aiming at the establishment of a total support system for a project evaluation. We will review our effort for development of our system and introduce the application of the Data directed Numerical method as a new tool to Ahnemland area in Australia. (author)

  10. Cornell Mixing Zone Expert System

    Science.gov (United States)

    This page provides an overview Cornell Mixing Zone Expert System water quality modeling and decision support system designed for environmental impact assessment of mixing zones resulting from wastewater discharge from point sources

  11. Robust Trust in Expert Testimony

    Directory of Open Access Journals (Sweden)

    Christian Dahlman

    2015-05-01

    Full Text Available The standard of proof in criminal trials should require that the evidence presented by the prosecution is robust. This requirement of robustness says that it must be unlikely that additional information would change the probability that the defendant is guilty. Robustness is difficult for a judge to estimate, as it requires the judge to assess the possible effect of information that the he or she does not have. This article is concerned with expert witnesses and proposes a method for reviewing the robustness of expert testimony. According to the proposed method, the robustness of expert testimony is estimated with regard to competence, motivation, external strength, internal strength and relevance. The danger of trusting non-robust expert testimony is illustrated with an analysis of the Thomas Quick Case, a Swedish legal scandal where a patient at a mental institution was wrongfully convicted for eight murders.

  12. Expert opinion vs. empirical evidence

    Science.gov (United States)

    Herman, Rod A; Raybould, Alan

    2014-01-01

    Expert opinion is often sought by government regulatory agencies when there is insufficient empirical evidence to judge the safety implications of a course of action. However, it can be reckless to continue following expert opinion when a preponderance of evidence is amassed that conflicts with this opinion. Factual evidence should always trump opinion in prioritizing the information that is used to guide regulatory policy. Evidence-based medicine has seen a dramatic upturn in recent years spurred by examples where evidence indicated that certain treatments recommended by expert opinions increased death rates. We suggest that scientific evidence should also take priority over expert opinion in the regulation of genetically modified crops (GM). Examples of regulatory data requirements that are not justified based on the mass of evidence are described, and it is suggested that expertise in risk assessment should guide evidence-based regulation of GM crops. PMID:24637724

  13. Artificial Intelligence and Expert Systems.

    Science.gov (United States)

    Wilson, Harold O.; Burford, Anna Marie

    1990-01-01

    Delineates artificial intelligence/expert systems (AI/ES) concepts; provides an exposition of some business application areas; relates progress; and creates an awareness of the benefits, limitations, and reservations of AI/ES. (Author)

  14. Expert systems in clinical microbiology.

    Science.gov (United States)

    Winstanley, Trevor; Courvalin, Patrice

    2011-07-01

    This review aims to discuss expert systems in general and how they may be used in medicine as a whole and clinical microbiology in particular (with the aid of interpretive reading). It considers rule-based systems, pattern-based systems, and data mining and introduces neural nets. A variety of noncommercial systems is described, and the central role played by the EUCAST is stressed. The need for expert rules in the environment of reset EUCAST breakpoints is also questioned. Commercial automated systems with on-board expert systems are considered, with emphasis being placed on the "big three": Vitek 2, BD Phoenix, and MicroScan. By necessity and in places, the review becomes a general review of automated system performances for the detection of specific resistance mechanisms rather than focusing solely on expert systems. Published performance evaluations of each system are drawn together and commented on critically.

  15. Expert robots in nuclear plants

    International Nuclear Information System (INIS)

    Byrd, J.S.; Fisher, J.J.; DeVries, K.R.; Martin, T.P.

    1987-01-01

    Expert robots will enhance safety and operations in nuclear plants. E. I. du Pont de Nemours and Company, Savannah River Laboratory, is developing expert mobile robots for deployment in nuclear applications at the Savannah River Plant. Knowledge-based expert systems are being evaluated to simplify operator control, to assist in navigation and manipulation functions, and to analyze sensory information. Development work using two research vehicles is underway to demonstrate semiautonomous, intelligent, expert robot system operation in process areas. A description of the mechanical equipment, control systems, and operating modes is presented, including the integration of onboard sensors. A control hierarchy that uses modest computational methods is being used to allow mobile robots to autonomously navigate and perform tasks in known environments without the need for large computer systems

  16. Nickel Hydrogen Battery Expert System

    Science.gov (United States)

    Johnson, Yvette B.; Mccall, Kurt E.

    1992-01-01

    The Nickel Cadmium Battery Expert System-2, or 'NICBES-2', which was used by the NASA HST six-battery testbed, was subsequently converted into the Nickel Hydrogen Battery Expert System, or 'NICHES'. Accounts are presently given of this conversion process and future uses being contemplated for NICHES. NICHES will calculate orbital summary data at the end of each orbit, and store these files for trend analyses and rules-generation.

  17. Expert opinion vs. empirical evidence

    OpenAIRE

    Herman, Rod A; Raybould, Alan

    2014-01-01

    Expert opinion is often sought by government regulatory agencies when there is insufficient empirical evidence to judge the safety implications of a course of action. However, it can be reckless to continue following expert opinion when a preponderance of evidence is amassed that conflicts with this opinion. Factual evidence should always trump opinion in prioritizing the information that is used to guide regulatory policy. Evidence-based medicine has seen a dramatic upturn in recent years sp...

  18. Experts in science and society

    CERN Document Server

    Gigerenzer, Gerd

    2004-01-01

    In today's complex world, we have come to rely increasingly on those who have expertise in specific areas and can bring their knowledge to bear on crucial social, political and scientific questions. Taking the viewpoint that experts are consulted when there is something important at stake for an individual, a group, or society at large, Experts in Science and Society explores expertise as a relational concept. How do experts balance their commitment to science with that to society? How does a society actually determine that a person has expertise? What personal traits are valued in an expert? From where does the expert derive authority? What makes new forms of expertise emerge? These and related questions are addressed from a wide range of areas in order to be inclusive, as well as to demonstrate similarities across areas. Likewise, in order to be culturally comparative, this volume includes examples and discussions of experts in different countries and even in different time periods. The topics include the r...

  19. Counselor Expert System | Debretsion | Zede Journal

    African Journals Online (AJOL)

    An expert system plays an important role on alleviating primarily shortage of experts in a specific area of interest. With the help of an expert system, personnel with little expertise can solve problems that require expert knowledge. In this paper all major aspects of an expert system development have been presented.

  20. JB_518_ESM.doc

    Indian Academy of Sciences (India)

    Jian Zeng and Shunv Cai. J. Biosci. 42(1), March 2017 © Indian Academy of Sciences. Supplementary material. Supplementary figure 1. Overexpression of miR-7 enhanced A549 cell apoptosis in response to BVP (100 µM). A TUNEL assay was performed according to the manufacturer's instructions (Promega Corporation, ...

  1. JB_224_ESM.docx

    Indian Academy of Sciences (India)

    121

    (A) Subcellular localization of CFP-AtMBD6 along with YFP protein was performed in onion epidermal cells. YFP was present in both cytoplasm and nucleus. It did not show a pattern of localization in the nucleus, which was similar to that of the interacting partners. The energy transfer between CFP-AtMBD6 and YFP was ...

  2. JB_378_ESM.docx

    Indian Academy of Sciences (India)

    Sushila

    Paraffin sections hybridized with antisense probe are shown. Purple staining indicates a positive reaction only in the corpus luteum but not in the corpus (B) and cauda (C). Supplementary figure 2. Determining specificity of amplicons of Ovgp1 (A) and Gapdh (B) by melt curve analysis. Melt peak for Ovgp1 PCR fragment is ...

  3. Inductive acquisition of expert knowledge

    Energy Technology Data Exchange (ETDEWEB)

    Muggleton, S.H.

    1986-01-01

    Expert systems divide neatly into two categories: those in which (1) the expert decisions result in changes to some external environment (control systems), and (2) the expert decisions merely seek to describe the environment (classification systems). Both the explanation of computer-based reasoning and the bottleneck (Feigenbaum, 1979) of knowledge acquisition are major issues in expert-systems research. The author contributed to these areas of research in two ways: 1. He implemented an expert-system shell, the Mugol environment, which facilitates knowledge acquisition by inductive inference and provides automatic explanation of run-time reasoning on demand. RuleMaster, a commercial version of this environment, was used to advantage industrially in the construction and testing of two large classification systems. 2. He investigated a new techniques called 'sequence induction' that can be used in construction of control systems. Sequence induction is based on theoretical work in grammatical learning. He improved existing grammatical learning algorithms as well as suggesting and theoretically characterizing new ones. These algorithms were successfully applied to acquisition of knowledge for a diverse set of control systems, including inductive construction of robot plans and chess end-gam strategies.

  4. Expert systems and nuclear safety

    International Nuclear Information System (INIS)

    Beltracchi, L.

    1990-01-01

    The US Nuclear Regulatory Commission (NRC) and the Electric Power Research Institute have initiated a broad-based exploration of means to evaluate the potential applications of expert systems in the nuclear industry. This exploratory effort will assess the use of expert systems to augment the diagnostic and decision-making capabilities of personnel with the goal of enhancing productivity, reliability, and performance. The initial research effort is the development and documentation of guidelines for verifying and validating (V and V) expert systems. An initial application of expert systems in the nuclear industry is to aid operations and maintenance personnel in decision-making tasks. The scope of the decision aiding covers all types of cognitive behavior consisting of skill, rule, and knowledge-based behavior. For example, procedure trackers were designed and tested to support rule-based behavior. Further, these systems automate many of the tedious, error-prone human monitoring tasks, thereby reducing the potential for human error. The paper version of the procedure contains the knowledge base and the rules and thus serves as the basis of the design verification of the procedure tracker. Person-in-the-loop tests serve as the basis for the validation of a procedure tracker. When conducting validation tests, it is important to ascertain that the human retains the locus of control in the use of the expert system

  5. Expert system application education project

    Science.gov (United States)

    Gonzelez, Avelino J.; Ragusa, James M.

    1988-01-01

    Artificial intelligence (AI) technology, and in particular expert systems, has shown potential applicability in many areas of operation at the Kennedy Space Center (KSC). In an era of limited resources, the early identification of good expert system applications, and their segregation from inappropriate ones can result in a more efficient use of available NASA resources. On the other hand, the education of students in a highly technical area such as AI requires an extensive hands-on effort. The nature of expert systems is such that proper sample applications for the educational process are difficult to find. A pilot project between NASA-KSC and the University of Central Florida which was designed to simultaneously address the needs of both institutions at a minimum cost. This project, referred to as Expert Systems Prototype Training Project (ESPTP), provided NASA with relatively inexpensive development of initial prototype versions of certain applications. University students likewise benefit by having expertise on a non-trivial problem accessible to them at no cost. Such expertise is indispensible in a hands-on training approach to developing expert systems.

  6. Expert systems in clinical practice

    International Nuclear Information System (INIS)

    Renaud-Salis, J.L.

    1987-01-01

    The first expert systems prototypes intended for advising physicians on diagnosis or therapy selection have been designed more than ten years ago. However, a few of them are already in use in clinical practice after years of research and development efforts. The capabilities of these systems to reason symbolically and to mimic the hypothetico-deductive processes used by physicians distinguishes them from conventional computer programs. Their power comes from their knowledge-base which embeds a large quantity of high-level, specialized knowledge captured from medical experts. Common methods for knowledge representation include production rules and frames. These methods also provide a mean for organizing and structuring the knowledge according to hierarchical or causal links. The best expert-systems perform at the level of the experts. They are easy to learn and use, and can communicate with the user in pseudo-natural language. Moreover they are able to explain their line of reasoning. These capabilities make them potentially useful, usable and acceptable by physicians. However if the problems related to difficulties and costs in building expert-systems are on the way to be solved within the next few years, forensic and ethical issues should have to be addressed before one can envisage their routine use in clinical practice [fr

  7. Expert systems: an alternative paradigm

    Energy Technology Data Exchange (ETDEWEB)

    Coombs, M.; Alty, J.

    1984-01-01

    There has recently been a significant effort by the AI community to interest industry in the potential of expert systems. However, this has resulted in far fewer substantial applications projects than might be expected. This article argues that this is because human experts are rarely required to perform the role that computer-based experts are programmed to adopt. Instead of being called in to answer well-defined problems, they are more often asked to assist other experts to extend and refine their understanding of a problem area at the junction of their two domains of knowledge. This more properly involves educational rather than problem-solving skills. An alternative approach to expert system design is proposed based upon guided discovery learning. The user is provided with a supportive environment for a particular class of problem, the system predominantly acting as an adviser rather than directing the interaction. The environment includes a database of domain knowledge, a set of procedures for its application to a concrete problem, and an intelligent machine-based adviser to judge the user's effectiveness and advise on strategy. The procedures focus upon the use of user generated explanations both to promote the application of domain knowledge and to expose understanding difficulties. Simple database PROLOG is being used as the subject material for the prototype system which is known as MINDPAD. 30 references.

  8. Expert judgment for nuclear energy

    International Nuclear Information System (INIS)

    Choi, Young Sung; Lee, Sun Ho; Lee, Byong Whi

    2000-01-01

    Public perception on nuclear energy is much influenced by subjective impressions mostly formed through sensational and dramatic news of mass media or anti-nuclear groups. However, nuclear experts, those who have more relevant knowledge and information about nuclear energy, may have reasonable opinion based on scientific facts or inferences. Thus their opinion and consensus should be examined and taken into account during the process of nuclear energy policy formulation. For the purpose of eliciting experts' opinion, the web-based on-line survey system (eBOSS) was developed. Using the survey system, experts' views on nuclear energy were tallied, analyzed and compared with the public's. Based on the survey results, the paper suggests some recommendations about the future direction of the public information program in Korea

  9. A Phenomenology of Expert Musicianship

    DEFF Research Database (Denmark)

    Høffding, Simon

    This dissertation develops a phenomenology of expert musicianship through an interdisciplinary approach that integrates qualitative interviews with the Danish String Quartet with philosophical analyses drawing on ideas and theses found in phenomenology, philosophy of mind, cognitive science...... and psychology of music. The dissertation is structured through the asking, analyzing and answering of three primary questions, namely: 1) What is it like to be an expert? 2) What is the general phenomenology of expert musicianship? 3) What happens to the self in deep musical absorption? The first question...... targets a central debate in philosophy and psychology on whether reflection is conducive for, or detrimental to, skillful performance. My analyses show that the concepts assumed in the literature on this question are poorly defined and gloss over more important features of expertise. The second question...

  10. Expert systems as decision tools

    International Nuclear Information System (INIS)

    Scott, C.K.

    1989-01-01

    The feasibility of using expert systems as an aid in regulatory compliance functions has been investigated. A literature review was carried out to identify applications of expert systems to regulatory affairs. A bibliography of the small literature on such applications was prepared. A prototype system, ARIES, was developed to demonstrate the use of an expert system as an aid to a Project Officer in assuring compliance with licence requirements. The system runs on a personal computer with a graphical interface. Extensive use is made of hypertext to link interrelated rules and requirements as well as to provide an explanation facility. Based on the performance of ARIES the development of a field version is recommended

  11. QUEST: Quality of Expert Systems

    NARCIS (Netherlands)

    Perre, M.

    1991-01-01

    TNO Physics and Electronics laboratory, in collaboration with the University of Limburg and the Research Institute for Knowledge Systems, worked on a technology project named 'QUEST: Quality of Expert Systems' [FEL90]. QUEST was carried out under commision of the Dutch Ministry of Defence. A strong

  12. Expert Systems: An Introduction -46 ...

    Indian Academy of Sciences (India)

    C++, and Microsoft C/C++ compilers. The personal edition is licensed for educational, research, and hobby use. Applications created with RT -Expert personal edition are not licensed for commercial purposes. Professional editions are available for commercial applications using DOS, Windows, and. Unix environments.

  13. Expert systems for superalloy studies

    Science.gov (United States)

    Workman, Gary L.; Kaukler, William F.

    1990-01-01

    There are many areas in science and engineering which require knowledge of an extremely complex foundation of experimental results in order to design methodologies for developing new materials or products. Superalloys are an area which fit well into this discussion in the sense that they are complex combinations of elements which exhibit certain characteristics. Obviously the use of superalloys in high performance, high temperature systems such as the Space Shuttle Main Engine is of interest to NASA. The superalloy manufacturing process is complex and the implementation of an expert system within the design process requires some thought as to how and where it should be implemented. A major motivation is to develop a methodology to assist metallurgists in the design of superalloy materials using current expert systems technology. Hydrogen embrittlement is disasterous to rocket engines and the heuristics can be very complex. Attacking this problem as one module in the overall design process represents a significant step forward. In order to describe the objectives of the first phase implementation, the expert system was designated Hydrogen Environment Embrittlement Expert System (HEEES).

  14. Teen Experts Guide Makerspace Makeover

    Science.gov (United States)

    Graves, Colleen

    2014-01-01

    A makerspace is a place where makers can envision a project, find an expert, and create something. Libraries have always held programming during which patrons were able to come in and create. The makerspace at the Lamar Middle School in Flower Mound, Texas, is available for students every day, so that they can daily create and play with innovative…

  15. Expert incentives: cure versus prevention

    NARCIS (Netherlands)

    de Jaegher, K.

    This paper distinguishes between two scenarios for the expert-client encounter. In the cure scenario, the client does not know whether a loss can be recovered. In the prevention scenario, the client faces a threat but does not know whether this threat is real enough to justify preventive action. The

  16. The role of the expert

    International Nuclear Information System (INIS)

    Smeesters, P.

    1998-01-01

    The expert's role in the involvement in decisions on nuclear risks is discussed. The responsibility of scientists in ethics and in several sociological problems is highlighted. The mandates, the positivist reaction, way to knowledge, the scientist as a subject studying an object, and application in the domain of radioprotection are the main issues of the somewhat philosophical essay. (R.P.)

  17. Partners for development: Expert assistant in Malaysia

    International Nuclear Information System (INIS)

    Daud, A.H.

    1996-01-01

    This report reviews the expert assignments received by Malaysia under the TC programme over the 1980-95 time period. It provides data about the type of assignments and expert services, the institutions receiving the experts, and duration of the assignment. Also reviewed is the process of requesting and implementing an expert assignment in Malaysia, as well as the country's related objectives and plans

  18. Expert judgement in performance assessment

    International Nuclear Information System (INIS)

    Wilmot, R.D.; Galson, D.A.

    2000-01-01

    This report is a pilot study that systematically describes the various types of expert judgement that are made throughout the development of a PA, and summarizes existing tools and practices for dealing with expert judgements. The report also includes recommendations for further work in the area of expert judgement. Expert judgements can be classified in a number of ways, including classification according to why the judgements are made and according to how the judgements are made. In terms of why judgements are made, there is a broad distinction between: Judgements concerning data that are made because alternatives are not feasible; and Judgements about the conduct of a PA that are made because there are no alternative approaches for making the decision. In the case of how judgements are made, the report distinguishes between non-elicited judgements made by individuals, non-elicited judgements made by groups, and elicited judgements made by individuals or groups. These types of judgement can generally be distinguished by the extent of the associated documentation, and hence their traceability. Tools for assessing judgements vary depending on the type of judgements being examined. Key tools are peer review, an appropriate QA regime, documentation, and elicitation. Dialogue with stake holders is also identified as important in establishing whether judgements are justified in the context in which they are used. The PA process comprises a number of stages, from establishing the assessment context, through site selection and repository design, to scenario and model development and parametrisation. The report discusses how judgements are used in each of these stages, and identifies which of the tools and procedures for assessing judgements are most appropriate at each stage. Recommendations for further work include the conduct of a trial expert elicitation to gain experience in the advantages and disadvantages of this technique, the development of guidance for peer

  19. Expert judgement in performance assessment

    Energy Technology Data Exchange (ETDEWEB)

    Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom)

    2000-01-01

    This report is a pilot study that systematically describes the various types of expert judgement that are made throughout the development of a PA, and summarizes existing tools and practices for dealing with expert judgements. The report also includes recommendations for further work in the area of expert judgement. Expert judgements can be classified in a number of ways, including classification according to why the judgements are made and according to how the judgements are made. In terms of why judgements are made, there is a broad distinction between: Judgements concerning data that are made because alternatives are not feasible; and Judgements about the conduct of a PA that are made because there are no alternative approaches for making the decision. In the case of how judgements are made, the report distinguishes between non-elicited judgements made by individuals, non-elicited judgements made by groups, and elicited judgements made by individuals or groups. These types of judgement can generally be distinguished by the extent of the associated documentation, and hence their traceability. Tools for assessing judgements vary depending on the type of judgements being examined. Key tools are peer review, an appropriate QA regime, documentation, and elicitation. Dialogue with stake holders is also identified as important in establishing whether judgements are justified in the context in which they are used. The PA process comprises a number of stages, from establishing the assessment context, through site selection and repository design, to scenario and model development and parametrisation. The report discusses how judgements are used in each of these stages, and identifies which of the tools and procedures for assessing judgements are most appropriate at each stage. Recommendations for further work include the conduct of a trial expert elicitation to gain experience in the advantages and disadvantages of this technique, the development of guidance for peer

  20. Expert system based radionuclide identification

    International Nuclear Information System (INIS)

    Aarnio, P.A.; Ala-Heikkil, J.J.; Hakulinen, T.T.; Nikkinen, M.T.

    1998-01-01

    An expert system coupled with the gamma spectrum analysis system SAMPO has been developed for automating the qualitative identification of radionuclides as well as for determining the quantitative parameters of the spectrum components. The program is written in C-language and runs in various environments ranging from PCs to UNIX workstations. The expert system utilizes a complete gamma library with over 2600 nuclides and 80,000 lines, and a rule base of about fifty criteria including energies, relative peak intensities, genesis modes, half lives, parent-daughter relationships, etc. The rule base is furthermore extensible by the user. This is not an original contribution but a somewhat updated version of papers and reports previously published elsewhere. (author)

  1. Expert Systems in Government Administration

    OpenAIRE

    Weintraub, Joseph

    1989-01-01

    Artificial Intelligence is solving more and more real world problems, but penetration into the complexities of government administration has been minimal. The author suggests that combining expert system technology with conventional procedural computer systems can lead to substantial efficiencies. Business rules can be removed from business-oriented computer systems and stored in a separate but integrated knowledge base, where maintenance will be centralized. Fourteen specific practical appli...

  2. Adaptive capture of expert knowledge

    Energy Technology Data Exchange (ETDEWEB)

    Barrett, C.L.; Jones, R.D. [Los Alamos National Lab., NM (United States); Hand, Un Kyong [Los Alamos National Lab., NM (United States)]|[US Navy (United States)

    1995-05-01

    A method is introduced that can directly acquire knowledge-engineered, rule-based logic in an adaptive network. This adaptive representation of the rule system can then replace the rule system in simulated intelligent agents and thereby permit further performance-based adaptation of the rule system. The approach described provides both weight-fitting network adaptation and potentially powerful rule mutation and selection mechanisms. Nonlinear terms are generated implicitly in the mutation process through the emergent interaction of multiple linear terms. By this method it is possible to acquire nonlinear relations that exist in the training data without addition of hidden layers or imposition of explicit nonlinear terms in the network. We smoothed and captured a set of expert rules with an adaptive network. The motivation for this was to (1) realize a speed advantage over traditional rule-based simulations; (2) have variability in the intelligent objects not possible by rule-based systems but provided by adaptive systems: and (3) maintain the understandability of rule-based simulations. A set of binary rules was smoothed and converted into a simple set of arithmetic statements, where continuous, non-binary rules are permitted. A neural network, called the expert network, was developed to capture this rule set, which it was able to do with zero error. The expert network is also capable of learning a nonmonotonic term without a hidden layer. The trained network in feedforward operation is fast running, compact, and traceable to the rule base.

  3. Expert witness and Jungian archetypes.

    Science.gov (United States)

    Lallave, Juan Antonio; Gutheil, Thomas Gordon

    2012-01-01

    Jung's theories of archetype, shadow, and the personal and collective unconscious provide a postmodern framework in which to consider the role of the expert witness in judicial proceedings. Archetypal themes, motifs, and influences help to illuminate the shadow of the judicial system and projections and behaviors among the cast of the court in pursuing justice. This article speaks to archetypal influences and dialectical tensions encountered by the expert witness in this judicial drama. The archetype of Justice is born from the human need for order and relational fairness in a world of chaos. The persona of justice is the promise of truth in the drama. The shadow of justice is untruth, the need to win by any means. The dynamics of the trickster archetype serve and promote injustice. These influences are examined by means of a case example. This approach will deepen understanding of court proceedings and the role of the expert witness in the heroic quest for justice. Copyright © 2012 Elsevier Ltd. All rights reserved.

  4. Expert System for ASIC Imaging

    Science.gov (United States)

    Gupta, Shri N.; Arshak, Khalil I.; McDonnell, Pearse; Boyce, Conor; Duggan, Andrew

    1989-07-01

    With the developments in the techniques of artificial intelligence over the last few years, development of advisory, scheduling and similar class of problems has become very convenient using tools such as PROLOG. In this paper an expert system has been described which helps lithographers and process engineers in several ways. The methodology used is to model each work station according to its input, output and control parameters, combine these work stations in a logical sequence based on past experience and work out process schedule for a job. In addition, all the requirements vis-a-vis a particular job parameters are converted into decision rules. One example is the exposure time, develop time for a wafer with different feature sizes would be different. This expert system has been written in Turbo Prolog. By building up a large number of rules, one can tune the program to any facility and use it for as diverse applications as advisory help, trouble shooting etc. Leitner (1) has described an advisory expert system that is being used at National Semiconductor. This system is quite different from the one being reported in the present paper. The approach is quite different for one. There is stress on job flow and process for another.

  5. Yağ Gülü (Rosa damascena Mill.’nde Tepe Boşluğu Katı Faz Mikro Ekstraksiyonu (HS-SPME ve Konvansiyonel Su Distilasyonu Yöntemleri ile Elde Edilen Uçucu Bileşenlerin Karşılaştırılması

    Directory of Open Access Journals (Sweden)

    Hasan BAYDAR

    2016-04-01

    Full Text Available Yağ gülü (Rosa damascena Mill., kendine özgü doğal koku bileşenleri nedeniyle parfüm ve kozmetik endüstrisinde değerlendirilen en önemli kokulu gül türüdür. Bu araştırmada, taze yağ gülü çiçeklerinin sepal (çanak yaprak, petal (taç yaprak, stamen (erkek organ ve pistil (dişi organ olarak ayrılan kısımlarının uçucu bileşenleri gaz kromatografisi/kütle spektrometresi (GC-MS ile kombine edilmiş Tepe Boşluğu-Katı Faz Mikro Ekstraksiyon (HS-SPME tekniği ile tespit edilmiştir. Ayrıca taze yağ gülü çiçekleri konvansiyonel hidro-Clevenger su distilasyonu yöntemi ile damıtılmış, elde edilen uçucu yağların bileşenleri GC-MS ile belirlendikten sonra HS-SPME sonuçları ile karşılaştırılmıştır. HS-SPME yönteminin yağ gülünde uçucu bileşenleri analizinde oldukça hassas ve etkili olduğu anlaşılmış, bir yağ gülü çiçeğinin farklı kısımların farklı koku bileşenlerine sahip olduğu belirlenmiştir. Ayrıca su distilasyonu ile elde edilen gül yağının uçucu yağ bileşenlerinin çiçeğin doğal koku bileşenlerinden farklı olduğu ve distilasyon sürecinde önemli bazı bileşenlerde değişimler ve kayıplar olduğu tespit edilmiştir. Taze gül çiçeğinin en önemli bileşeni olan feniletil alkol çiçeğin en fazla pembe renkli petallerinde (taç yapraklarında, gül yağında varlığı istenmeyen metil öjenol ise çiçeğin en fazla stamenlerinde (erkek organlarında bulunduğu belirlenmiştir.

  6. Use of expert judgement in NUREG-1150

    International Nuclear Information System (INIS)

    Ortiz, N.R.; Wheeler, T.A.; Breeding, R.J.; Hora, S.; Meyer, M.A.; Kenney, R.L.

    1991-01-01

    The explicit expert judgment process used in NUREG-1150, 'Severe Accident Risks: An Assessment for Five US Nuclear Plants', is discussed in this paper. The main steps of the process are described, including selection of issues and experts, elicitation training, presentation of issues to the experts, preparation of issue analyses by the experts, discussion of issue analyses and elicitation, and recomposition and aggregation of results. To demonstrate the application of the expert judgment process to NUREG-1150, two issues are summarized: one from the accident frequency analysis, and one from the accident progression analysis. Recommendations and insights are provided to improve the use of explicit expert judgment in complex technical issues. (orig.)

  7. Acquisition of Expert/Non-Expert Vocabulary from Reformulations.

    Science.gov (United States)

    Antoine, Edwige; Grabar, Natalia

    2017-01-01

    Technical medical terms are complicated to be correctly understood by non-experts. Vocabulary, associating technical terms with layman expressions, can help in increasing the readability of technical texts and their understanding. The purpose of our work is to build this kind of vocabulary. We propose to exploit the notion of reformulation following two methods: extraction of abbreviations and of reformulations with specific markers. The segments associated thanks to these methods are aligned with medical terminologies. Our results allow to cover over 9,000 medical terms and show precision of extractions between 0.24 and 0.98. The results and analyzed and compared with the existing work.

  8. A demonstration of expert systems applications in transportation engineering : volume I, transportation engineers and expert systems.

    Science.gov (United States)

    1987-01-01

    Expert systems, a branch of artificial-intelligence studies, is introduced with a view to its relevance in transportation engineering. Knowledge engineering, the process of building expert systems or transferring knowledge from human experts to compu...

  9. NESSUS/EXPERT - An expert system for probabilistic structural analysis methods

    Science.gov (United States)

    Millwater, H.; Palmer, K.; Fink, P.

    1988-01-01

    An expert system (NESSUS/EXPERT) is presented which provides assistance in using probabilistic structural analysis methods. NESSUS/EXPERT is an interactive menu-driven expert system that provides information to assist in the use of the probabilistic finite element code NESSUS/FEM and the fast probability integrator. NESSUS/EXPERT was developed with a combination of FORTRAN and CLIPS, a C language expert system tool, to exploit the strengths of each language.

  10. Cataloging Expert Systems: Optimism and Frustrated Reality.

    Science.gov (United States)

    Olmstadt, William J.

    2000-01-01

    Discusses artificial intelligence and attempts to catalog expert systems. Topics include the nature of expertise; examples of cataloging expert systems; barriers to implementation; and problems, including total automation, cataloging expertise, priorities, and system design. (LRW)

  11. Expert Oracle RAC 12c

    CERN Document Server

    Shamsudeen, Riyaj; Yu, Kai; Farooq, Tariq

    2013-01-01

    Expert Oracle RAC 12c is a hands-on book helping you understand and implement Oracle Real Application Clusters (RAC), and to reduce the total-cost-of-ownership (TCO) of a RAC database. As a seasoned professional, you are probably aware of the importance of understanding the technical details behind the RAC stack. This book provides deep understanding of RAC concepts and implementation details that you can apply toward your day-to-day operational practices. You'll be guided in troubleshooting and avoiding trouble in your installation. Successful RAC operation hinges upon a fast-performing netwo

  12. Expert Oracle GoldenGate

    CERN Document Server

    Prusinski, Ben; Chung, Richard

    2011-01-01

    Expert Oracle GoldenGate is a hands-on guide to creating and managing complex data replication environments using the latest in database replication technology from Oracle. GoldenGate is the future in replication technology from Oracle, and aims to be best-of-breed. GoldenGate supports homogeneous replication between Oracle databases. It supports heterogeneous replication involving other brands such as Microsoft SQL Server and IBM DB2 Universal Server. GoldenGate is high-speed, bidirectional, highly-parallelized, and makes only a light impact on the performance of databases involved in replica

  13. Fuzzy expert systems using CLIPS

    Science.gov (United States)

    Le, Thach C.

    1994-01-01

    This paper describes a CLIPS-based fuzzy expert system development environment called FCLIPS and illustrates its application to the simulated cart-pole balancing problem. FCLIPS is a straightforward extension of CLIPS without any alteration to the CLIPS internal structures. It makes use of the object-oriented and module features in CLIPS version 6.0 for the implementation of fuzzy logic concepts. Systems of varying degrees of mixed Boolean and fuzzy rules can be implemented in CLIPS. Design and implementation issues of FCLIPS will also be discussed.

  14. Expert opinion on climatic change

    International Nuclear Information System (INIS)

    Nordhaus, W.D.

    1994-01-01

    This paper discusses the results of an indepth interview survey of experts, both social and natural scientists, about estimates of the economic impact of potential greenhouse warming. The range of estimate impacts was enormous as was the difference between disciplines, particularly mainstream economists and natural scientists. The nineteen survey participants and their affiliations are listed. The general areas discussed in the paper include the following: survey development; estimation of subjective probabilities; description of different scenarios presented; discussion of pertinent answers and general trends in answers including influence of point of view; magnitude of problem; ecosystems; secondary effects; ability to adapt; regional distribution of impacts; nonmarket effects; limits to understanding. 7 figs

  15. Consumer versus expert hazard identification

    DEFF Research Database (Denmark)

    Hagemann, Kit S.; Scholderer, Joachim

    2007-01-01

    Novel foods have been the object of intense public debate in recent years. Despite efforts to communicate the outcomes of risk assessments to consumers, public confidence in the management of potential risks has been low. Various reasons behind this have been identified, chiefly a disagreement...... between technical experts and consumers over the nature of the hazards on which risk assessments should focus, and perceptions of insufficient openness about uncertainties in risk assessment. Whilst previous research has almost exclusively focused on genetically modified foods, the present paper...

  16. An expert system for uranium exploration

    International Nuclear Information System (INIS)

    Chhipa, V.K.; Sengupta, M.

    1989-01-01

    Artificial intelligence is an emerging technology in the field of computer application. Expert systems have been developed to imitate human intelligence and reasoning process. Expert systems have much scope of application in the decision making process in mineral exploration as such decisions are highly subjective and expert opinions are very helpful. This paper presents a small expert system to analyze the reasoning process in exploring for uranium deposits in sandstone

  17. Hierarchical Model of Assessing and Selecting Experts

    OpenAIRE

    Chernysheva, Tatiana Yurievna; Korchuganova, Mariya Anatolievna; Borisov, V. V.; Minkov, S. L.

    2016-01-01

    Revealing experts' competences is a multi-objective issue. Authors of the paper deal with competence assessing methods of experts seen as objects, and criteria of qualities. An analytic hierarchy process of assessing and ranking experts is offered, which is based on paired comparison matrices and scores, quality parameters are taken into account as well. Calculation and assessment of experts is given as an example.

  18. Fire Effects, Education, and Expert Systems

    Science.gov (United States)

    Robert E. Martin

    1987-01-01

    Predicting the effects of fires in the year 2000 and beyond will be enhanced by the use of expert systems. Although our predictions may have broad confidence limits, expert systems should help us to improve the predictions and to focus on the areas where improved knowledge is most needed. The knowledge of experts can be incorporated into previously existing knowledge...

  19. Differentiating Experts' Anticipatory Skills in Beach Volleyball

    Science.gov (United States)

    Canal-Bruland, Rouwen; Mooren, Merel; Savelsbergh, Geert J. P.

    2011-01-01

    In this study, we examined how perceptual-motor expertise and watching experience contribute to anticipating the outcome of opponents' attacking actions in beach volleyball. To this end, we invited 8 expert beach volleyball players, 8 expert coaches, 8 expert referees, and 8 control participants with no beach volleyball experience to watch videos…

  20. Expert systems in process control systems

    International Nuclear Information System (INIS)

    Wittig, T.

    1987-01-01

    To illustrate where the fundamental difference between expert systems in classical diagnosis and in industrial control lie, the work of process control instrumentation is used as an example for the job of expert systems. Starting from the general process of problem-solving, two classes of expert systems can be defined accordingly. (orig.) [de

  1. Expert Systems for auditing management information systems

    Directory of Open Access Journals (Sweden)

    Gheroghe Popescu

    2007-05-01

    Full Text Available Expert systems are built with the help of: specialised programming languages or expert system generators (shell. But this structure was reached after tens of years of work and research, because expert systems are nothing but pragmatic capitalisation of the results of research carried out in artificial intelligence and theory of knowledge.

  2. Expert system validation in prolog

    Science.gov (United States)

    Stock, Todd; Stachowitz, Rolf; Chang, Chin-Liang; Combs, Jacqueline

    1988-01-01

    An overview of the Expert System Validation Assistant (EVA) is being implemented in Prolog at the Lockheed AI Center. Prolog was chosen to facilitate rapid prototyping of the structure and logic checkers and since February 1987, we have implemented code to check for irrelevance, subsumption, duplication, deadends, unreachability, and cycles. The architecture chosen is extremely flexible and expansible, yet concise and complementary with the normal interactive style of Prolog. The foundation of the system is in the connection graph representation. Rules and facts are modeled as nodes in the graph and arcs indicate common patterns between rules. The basic activity of the validation system is then a traversal of the connection graph, searching for various patterns the system recognizes as erroneous. To aid in specifying these patterns, a metalanguage is developed, providing the user with the basic facilities required to reason about the expert system. Using the metalanguage, the user can, for example, give the Prolog inference engine the goal of finding inconsistent conclusions among the rules, and Prolog will search the graph intantiations which can match the definition of inconsistency. Examples of code for some of the checkers are provided and the algorithms explained. Technical highlights include automatic construction of a connection graph, demonstration of the use of metalanguage, the A* algorithm modified to detect all unique cycles, general-purpose stacks in Prolog, and a general-purpose database browser with pattern completion.

  3. Expert systems: A 5-year perspective

    International Nuclear Information System (INIS)

    MacAllister, D.J.; Day, R.; McCormack, M.D.

    1996-01-01

    This paper gives an overview of a major integrated oil company's experience with artificial intelligence (AI) over the last 5 years, with an emphasis on expert systems. The authors chronicle the development of an AI group, including details on development tool selection, project selection strategies, potential pitfalls, and descriptions of several completed expert systems. Small expert systems produced by teams of petroleum technology experts and experienced expert system developers that are focused in well-defined technical areas have produced substantial benefits and accelerated petroleum technology transfer

  4. Operational expert system applications in Canada

    CERN Document Server

    Suen, Ching Y

    1992-01-01

    This book is part of a new series on operational expert systems worldwide. Expert systems are now widely used in different parts of the world for various applications. The past four years have witnessed a steady growth in the development and deployment of expert systems in Canada. Research in this field has also gained considerable momentum during the past few years. However, the field of expert systems is still young in Canada. This book contains 13 chapters contributed by 31 experts from both universities and industries across Canada covering a wide range of applications related to electric

  5. Database, expert systems, information retrieval

    International Nuclear Information System (INIS)

    Fedele, P.; Grandoni, G.; Mammarella, M.C.

    1989-12-01

    The great debate concerning the Italian high-school reform has induced a ferment of activity among the most interested and sensible of people. This was clearly demonstrated by the course 'Innovazione metodologico-didattica e tecnologie informatiche' organized for the staff of the 'lstituto Professionale L. Einaudi' of Lamezia Terme. The course was an interesting opportunity for discussions and interaction between the world of School and computer technology used in the Research field. This three day course included theoretical and practical lessons, showing computer facilities that could be useful for teaching. During the practical lessons some computer tools were presented from the very simple Electronic Sheets to the more complicated information Retrieval on CD-ROM interactive realizations. The main topics will be discussed later. They are: Modelling, Data Base, Integrated Information Systems, Expert Systems, Information Retrieval. (author)

  6. The useability of expert systems

    International Nuclear Information System (INIS)

    Martin, D.J.

    1990-01-01

    This talk presents the case that it is the user of an Expert System (ES), and the user alone, who must decide on the acceptability of such a system. Further, the useability of an ES is principally a function of the user interface: if a system takes a long time to learn, it will not be used effectively. Some ES are implemented on computers with command line interfaces. It is shown (via a live demonstration using a computer) that such systems restrict the AI professiona's ability to deliver a system which is satisfactory from the use's viewpoint: the limitations of the computer system will dictate the user interface, independently of the user requirements. Only a computer system with a graphical interface can supply the versatility and functionality required by the user. Examples of graphical interface facilities are given

  7. Database and Expert Systems Applications

    DEFF Research Database (Denmark)

    Viborg Andersen, Kim; Debenham, John; Wagner, Roland

    schemata, query evaluation, semantic processing, information retrieval, temporal and spatial databases, querying XML, organisational aspects of databases, natural language processing, ontologies, Web data extraction, semantic Web, data stream management, data extraction, distributed database systems......This book constitutes the refereed proceedings of the 16th International Conference on Database and Expert Systems Applications, DEXA 2005, held in Copenhagen, Denmark, in August 2005.The 92 revised full papers presented together with 2 invited papers were carefully reviewed and selected from 390...... submissions. The papers are organized in topical sections on workflow automation, database queries, data classification and recommendation systems, information retrieval in multimedia databases, Web applications, implementational aspects of databases, multimedia databases, XML processing, security, XML...

  8. Experts' perceptions on the entrepreneurial framework conditions

    Science.gov (United States)

    Correia, Aldina; e Silva, Eliana Costa; Lopes, I. Cristina; Braga, Alexandra; Braga, Vitor

    2017-11-01

    The Global Entrepreneurship Monitor is a large scale database for internationally comparative entrepreneurship. This database includes information of more than 100 countries concerning several aspects of entrepreneurship activities, perceptions, conditions, national and regional policy, among others, in two main sources of primary data: the Adult Population Survey and the National Expert Survey. In the present work the National Expert Survey datasets for 2011, 2012 and 2013 are analyzed with the purpose of studying the effects of different type of entrepreneurship expert specialization on the perceptions about the Entrepreneurial Framework Conditions (EFCs). The results of the multivariate analysis of variance for the 2013 data show significant differences of the entrepreneurship experts when compared the 2011 and 2012 surveys. For the 2013 data entrepreneur experts are less favorable then most of the other experts to the EFCs.

  9. Expert system technology for nondestructive waste assay

    International Nuclear Information System (INIS)

    Becker, G.K.; Determan, J.C.

    1998-01-01

    Nondestructive assay waste characterization data generated for use in the National TRU Program must be of known and demonstrable quality. Each measurement is required to receive an independent technical review by a qualified expert. An expert system prototype has been developed to automate waste NDA data review of a passive/active neutron drum counter system. The expert system is designed to yield a confidence rating regarding measurement validity. Expert system rules are derived from data in a process involving data clustering, fuzzy logic, and genetic algorithms. Expert system performance is assessed against confidence assignments elicited from waste NDA domain experts. Performance levels varied for the active, passive shielded, and passive system assay modes of the drum counter system, ranging from 78% to 94% correct classifications

  10. Expert system for fast reactor diagnostic

    International Nuclear Information System (INIS)

    Parcy, J.P.

    1982-09-01

    A general description of expert systems is given. The operation of a fast reactor is reviewed. The expert system to the diagnosis of breakdowns limited to the reactor core. The structure of the system is described: specification of the diagnostics; structure of the data bank and evaluation of the rules; specification of the prediagnostics and evaluation; explanation of the diagnostics; time evolution of the system; comparison with other expert systems. Applications to some cases of faults are finally presented [fr

  11. Hierarchical Model of Assessing and Selecting Experts

    Science.gov (United States)

    Chernysheva, T. Y.; Korchuganova, M. A.; Borisov, V. V.; Min'kov, S. L.

    2016-04-01

    Revealing experts’ competences is a multi-objective issue. Authors of the paper deal with competence assessing methods of experts seen as objects, and criteria of qualities. An analytic hierarchy process of assessing and ranking experts is offered, which is based on paired comparison matrices and scores, quality parameters are taken into account as well. Calculation and assessment of experts is given as an example.

  12. WINE ADVISOR EXPERT SYSTEM USING DECISION RULES

    Directory of Open Access Journals (Sweden)

    Dinuca Elena Claudia

    2013-07-01

    Full Text Available In this article I focus on developing an expert system for advising the choice of wine that best matches a specific occasion. An expert system is a computer application that performs a task that would be performed by a human expert. The implementation is done using Delphi programming language. I used to represent the knowledge bases a set of rules. The rules are of type IF THEN ELSE rules, decision rules based on different important wine features.

  13. Succession planning for technical experts

    International Nuclear Information System (INIS)

    Kirk, Bernadette Lugue; Cain, Ronald A.; Dewji, Shaheen A.; Agreda, Carla L.

    2017-01-01

    This report describes a methodology for identifying, evaluating, and mitigating the loss of key technical skills at nuclear operations facilities. The methodology can be adapted for application within regulatory authorities and research and development organizations, and can be directly applied by international engagement partners of the Department of Energy’s National Nuclear Security Administration (NNSA). The resultant product will be of direct benefit to two types of NNSA missions: (1) domestic human capital development programs tasked to provide focused technical expertise to succeed an aging nuclear operations workforce, and (2) international safeguards programs charged with maintaining operational safeguards for developing/existing nuclear power program in nations where minimal available resources must be used effectively. This report considers succession planning and the critical skills necessary to meet an institution’s goals and mission. Closely tied to succession planning are knowledge management and mentorship. In considering succession planning, critical skill sets are identified and are greatly dependent on the subject matter expert in question. This report also provides examples of critical skills that are job specific.

  14. Succession planning for technical experts

    Energy Technology Data Exchange (ETDEWEB)

    Kirk, Bernadette Lugue [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Cain, Ronald A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dewji, Shaheen A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Agreda, Carla L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report describes a methodology for identifying, evaluating, and mitigating the loss of key technical skills at nuclear operations facilities. The methodology can be adapted for application within regulatory authorities and research and development organizations, and can be directly applied by international engagement partners of the Department of Energy’s National Nuclear Security Administration (NNSA). The resultant product will be of direct benefit to two types of NNSA missions: (1) domestic human capital development programs tasked to provide focused technical expertise to succeed an aging nuclear operations workforce, and (2) international safeguards programs charged with maintaining operational safeguards for developing/existing nuclear power program in nations where minimal available resources must be used effectively. This report considers succession planning and the critical skills necessary to meet an institution’s goals and mission. Closely tied to succession planning are knowledge management and mentorship. In considering succession planning, critical skill sets are identified and are greatly dependent on the subject matter expert in question. This report also provides examples of critical skills that are job specific.

  15. Prediabetes in Colombia: Expert Consensus

    Science.gov (United States)

    Calderón, Carlos; Castillo, Jorge; Escobar, Iván Darío; Melgarejo, Enrique; Parra, Gustavo Adolfo

    2017-01-01

    Abstract The prevalence of Prediabetes in Colombia is high, and despite being recognized and categorized in the main Medical Guidelines and included in the International Classification of Diseases in Colombia, knowledge and awareness of it is limited amongst healthcare professionals and in the community. Our expert group recommends that educational programs emphasize a global approach to risk which includes a recognition of the importance of prediabetes and its evaluation along with and other risk factors such as a family history of DM2, overweight and obesity, dislipidemia and hypertension. Studies conducted in Colombia demonstrate the value of the FINDRIS questionnaire as a tool to identify subjects at risk of prediabetes and DM2, and we recommend that it should be systematic applied throughout the country as part of government policy. Prediabetes progresses to DM2 at an annual rate of 10%, but it has also been shown that prediabetes is an independent risk factor for cardiovascular outcomes. On this basis, the Committee recommends that once prediabetes is detected and diagnosed, immediate management of the disease begins through lifestyle changes, with follow up assessments performed at 3 and 6 months. If the patient does not respond with a weight loss of at least 5% and if the HbA1C values ​​are not normalized, pharmacological management should be initiated with a metformin dose of 500 mg / day, increasing up to 1,500 - 1,700 mg / day, according to tolerance. PMID:29662261

  16. Expert system development (ESD) shell

    International Nuclear Information System (INIS)

    Padmini, S.; Diwakar, M.P.; Rathode, N.C.; Bairi, B.R.

    1991-01-01

    An Expert System Development (ESD) Shell design implementation is desribed in detail. The shell provides high-level generic facilities for Knowledge Representation (KR) and inferencing and tools for developing user interfaces. Powerful set of tools in the shell relieves much of the programming burden in the ES development. The shell is written in PROLOG under IBM PC/AT. KR facilities are based on two very powerful formalisms namely, frames and rules. Inference Engine (IE) draws most of its power from unification and backward reasoning strategy in PROLOG. This basic mechanism is enhanced further by incorporating both forward and backward chaining of rules and frame-based inferencing. Overall programming style integrates multiple paradigms including logic, object oriented, access-oriented and imperative programming. This permits ES designer a lot of flexibility in organizing inference control. Creation and maintainance of knowledge base is a major activity. The shell, therefore, provides number of facilities to simplify these tasks. Shell design also takes note of the fact that final success of any system depends on end-user satisfaction and hence provides features to build use-friendly interfaces. The shell also provides a set of interfacing predicates so that it can be embedded within any PROLOG program to incorporate functionalilty of the shell in the user program. (author). 10 refs., 8 figs

  17. Prediabetes in Colombia: Expert Consensus.

    Science.gov (United States)

    López-Jaramillo, Patricio; Calderón, Carlos; Castillo, Jorge; Escobar, Iván Darío; Melgarejo, Enrique; Parra, Gustavo Adolfo

    2017-12-30

    The prevalence of Prediabetes in Colombia is high, and despite being recognized and categorized in the main Medical Guidelines and included in the International Classification of Diseases in Colombia, knowledge and awareness of it is limited amongst healthcare professionals and in the community. Our expert group recommends that educational programs emphasize a global approach to risk which includes a recognition of the importance of prediabetes and its evaluation along with and other risk factors such as a family history of DM2, overweight and obesity, dislipidemia and hypertension. Studies conducted in Colombia demonstrate the value of the FINDRIS questionnaire as a tool to identify subjects at risk of prediabetes and DM2, and we recommend that it should be systematic applied throughout the country as part of government policy. Prediabetes progresses to DM2 at an annual rate of 10%, but it has also been shown that prediabetes is an independent risk factor for cardiovascular outcomes. On this basis, the Committee recommends that once prediabetes is detected and diagnosed, immediate management of the disease begins through lifestyle changes, with follow up assessments performed at 3 and 6 months. If the patient does not respond with a weight loss of at least 5% and if the HbA1C values ​​are not normalized, pharmacological management should be initiated with a metformin dose of 500 mg / day, increasing up to 1,500 - 1,700 mg / day, according to tolerance.

  18. Operational expert system applications in Europe

    CERN Document Server

    Zarri, Gian Piero

    1992-01-01

    Operational Expert System Applications in Europe describes the representative case studies of the operational expert systems (ESs) that are used in Europe.This compilation provides examples of operational ES that are realized in 10 different European countries, including countries not usually examined in the standard reviews of the field.This book discusses the decision support system using several artificial intelligence tools; expert systems for fault diagnosis on computerized numerical control (CNC) machines; and expert consultation system for personal portfolio management. The failure prob

  19. Expert database system for quality control

    Science.gov (United States)

    Wang, Anne J.; Li, Zhi-Cheng

    1993-09-01

    There are more competitors today. Markets are not homogeneous they are fragmented into increasingly focused niches requiring greater flexibility in the product mix shorter manufacturing production runs and above allhigher quality. In this paper the author identified a real-time expert system as a way to improve plantwide quality management. The quality control expert database system (QCEDS) by integrating knowledge of experts in operations quality management and computer systems use all information relevant to quality managementfacts as well as rulesto determine if a product meets quality standards. Keywords: expert system quality control data base

  20. BWR recirculation pump diagnostic expert system

    International Nuclear Information System (INIS)

    Chiang, S.C.; Morimoto, C.N.; Torres, M.R.

    2004-01-01

    At General Electric (GE), an on-line expert system to support maintenance decisions for BWR recirculation pumps for nuclear power plants has been developed. This diagnostic expert system is an interactive on-line system that furnishes diagnostic information concerning BWR recirculation pump operational problems. It effectively provides the recirculation pump diagnostic expertise in the plant control room continuously 24 hours a day. The expert system is interfaced to an on-line monitoring system, which uses existing plant sensors to acquire non-safety related data in real time. The expert system correlates and evaluates process data and vibration data by applying expert rules to determine the condition of a BWR recirculation pump system by applying knowledge based rules. Any diagnosis will be automatically displayed, indicating which pump may have a problem, the category of the problem, and the degree of concern expressed by the validity index and color hierarchy. The rules incorporate the expert knowledge from various technical sources such as plant experience, engineering principles, and published reports. These rules are installed in IF-THEN formats and the resulting truth values are also expressed in fuzzy terms and a certainty factor called a validity index. This GE Recirculation Pump Expert System uses industry-standard software, hardware, and network access to provide flexible interfaces with other possible data acquisition systems. Gensym G2 Real-Time Expert System is used for the expert shell and provides the graphical user interface, knowledge base, and inference engine capabilities. (author)

  1. Cooperative expert system reasoning for waste remediations

    International Nuclear Information System (INIS)

    Bohn, S.J.; Pennock, K.A.; Franklin, A.L.

    1991-12-01

    The United States Department of Energy (DOE) is facing a large task in completing Remedial Investigations and Feasibility Studies (RI/FS) for hazardous waste sites across the nation. One of the primary objectives of an RI/FS is the specification of viable sequences of technology treatment trains which can provide implementable site solutions. We present a methodology which integrates expert system technology within an object-oriented framework to create a cooperative reasoning system designed to provide a comprehensive list of these implementable solutions. The system accomplishes its goal of specifying technology trains by utilizing a ''team'' of expert system objects. The system distributes the problem solving among the individual expert objects, and then coordinates the combination of individual decisions into a joint solution. Each expert object possesses the knowledge of an expert in a particular technology. An expert object can examine the parameters and characteristics of the waste site, seek information and support from other expert objects, and then make decisions concerning its own applicability. This methodology has at least two primary benefits. First, the creation of multiple expert objects provides a more direct mapping from the actual process to a software system, making the system easier to build. Second, the distribution of the inferencing among a number of loosely connected expert objects allows for a more robust and maintainable final product

  2. Liquid low level waste management expert system

    International Nuclear Information System (INIS)

    Ferrada, J.J.; Abraham, T.J.; Jackson, J.R.

    1991-01-01

    An expert system has been developed as part of a new initiative for the Oak Ridge National Laboratory (ORNL) systems analysis program. This expert system will aid in prioritizing radioactive waste streams for treatment and disposal by evaluating the severity and treatability of the problem, as well as the final waste form. The objectives of the expert system development included: (1) collecting information on process treatment technologies for liquid low-level waste (LLLW) that can be incorporated in the knowledge base of the expert system, and (2) producing a prototype that suggests processes and disposal technologies for the ORNL LLLW system. 4 refs., 9 figs

  3. Hilar cholangiocarcinoma: expert consensus statement.

    Science.gov (United States)

    Mansour, John C; Aloia, Thomas A; Crane, Christopher H; Heimbach, Julie K; Nagino, Masato; Vauthey, Jean-Nicolas

    2015-08-01

    An American Hepato-Pancreato-Biliary Association (AHPBA)-sponsored consensus meeting of expert panellists met on 15 January 2014 to review current evidence on the management of hilar cholangiocarcinoma in order to establish practice guidelines and to agree consensus statements. It was established that the treatment of patients with hilar cholangiocarcinoma requires a coordinated, multidisciplinary approach to optimize the chances for both durable survival and effective palliation. An adequate diagnostic and staging work-up includes high-quality cross-sectional imaging; however, pathologic confirmation is not required prior to resection or initiation of a liver transplant trimodal treatment protocol. The ideal treatment for suitable patients with resectable hilar malignancy is resection of the intra- and extrahepatic bile ducts, as well as resection of the involved ipsilateral liver. Preoperative biliary drainage is best achieved with percutaneous transhepatic approaches and may be indicated for patients with cholangitis, malnutrition or hepatic insufficiency. Portal vein embolization is a safe and effective strategy for increasing the future liver remnant (FLR) and is particularly useful for patients with an FLR of hilar cholangiocarcinoma should be evaluated for a standard trimodal protocol incorporating external beam and endoluminal radiation therapy, systemic chemotherapy and liver transplantation. Post-resection chemoradiation should be offered to patients who show high-risk features on surgical pathology. Chemoradiation is also recommended for patients with locally advanced, unresectable hilar cancers. For patients with locally recurrent or metastatic hilar cholangiocarcinoma, first-line chemotherapy with gemcitabine and cisplatin is recommended based on multiple Phase II trials and a large randomized controlled trial including a heterogeneous population of patients with biliary cancers. © 2015 International Hepato-Pancreato-Biliary Association.

  4. Expert Systems: An Overview for Teacher-Librarians.

    Science.gov (United States)

    Orwig, Gary; Barron, Ann

    1992-01-01

    Provides an overview of expert systems for teacher librarians. Highlights include artificial intelligence and expert systems; the development of the MYCIN medical expert system; rule-based expert systems; the use of expert system shells to develop a specific system; and how to select an appropriate application for an expert system. (11 references)…

  5. 20 CFR 405.10 - Medical and Vocational Expert System.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Medical and Vocational Expert System. 405.10... Vocational Expert System. (a) General. The Medical and Vocational Expert System is comprised of the Medical... Vocational Expert System. (3) Experts who provide evidence at your request. Experts whom you ask to provide...

  6. 40 CFR 194.26 - Expert judgment.

    Science.gov (United States)

    2010-07-01

    ... CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification General Requirements... experts (by name and employer) involved in any expert judgment elicitation processes used to support the... judgment elicitation processes and the reasoning behind those results. Documentation of interviews used to...

  7. A law for nuclear experts only

    International Nuclear Information System (INIS)

    Wagner, H.

    1980-01-01

    The Federal Ministry of the Interior is preparing an ordinance on expert consultants under the Atomic Energy Act which, among other topics, is to include legal norms for the criteria to be met by experts in terms of non-partisanship, training, capabilities, technical equipment and cooperation in expert organizations of members of various scientific and technical disciplines. A summary of general criteria relating to the qualification, selection and status of experts called in by the legislative and executive branches and by courts of law, which could be organized as a series of guidelines without any original qualities of legal norms, could be recommended in view of the increasing quantitative and qualitative importance of experts. However, passing an ordinance merely fixing and putting into concrete terms the image of an 'expert under the Atomic Energy Act' is intolerable, because the status of scientific and technical experts by far extends beyond the field of nuclear law in our industrial society characterized by a far reaching division of labor. Weak points in the organization of expert services are not confined to technology or nuclear power. Separate rules establishing legal norms are not convincing also for reasons of technology policy and legal policy as well as for those of social psychology and practice. (orig.) 891 HP/orig. 892 MKO [de

  8. Tropospheric ozone. Formation, properties, effects. Expert opinion

    International Nuclear Information System (INIS)

    Elstner, E.F.

    1996-01-01

    The formation and dispersion of tropospheric ozone are discussed only marginally in this expert opinion; the key interest is in the effects of ground level ozone on plants, animals, and humans. The expert opinion is based on an analysis of the available scientific publications. (orig./MG) [de

  9. Toward the Development of Expert Assessment Systems.

    Science.gov (United States)

    Hasselbring, Ted S.

    1986-01-01

    The potential application of "expert systems" to the diagnosis and assessment of special-needs children is examined and existing prototype systems are reviewed. The future of this artificial intelligence technology is discussed in relation to emerging development tools designed for the creation of expert systems by the lay public. (Author)

  10. TU Delft expert judgment data base

    International Nuclear Information System (INIS)

    Cooke, Roger M.; Goossens, Louis L.H.J.

    2008-01-01

    We review the applications of structured expert judgment uncertainty quantification using the 'classical model' developed at the Delft University of Technology over the last 17 years [Cooke RM. Experts in uncertainty. Oxford: Oxford University Press; 1991; Expert judgment study on atmospheric dispersion and deposition. Report Faculty of Technical Mathematics and Informatics No.01-81, Delft University of Technology; 1991]. These involve 45 expert panels, performed under contract with problem owners who reviewed and approved the results. With a few exceptions, all these applications involved the use of seed variables; that is, variables from the experts' area of expertise for which the true values are available post hoc. Seed variables are used to (1) measure expert performance, (2) enable performance-based weighted combination of experts' distributions, and (3) evaluate and hopefully validate the resulting combination or 'decision maker'. This article reviews the classical model for structured expert judgment and the performance measures, reviews applications, comparing performance-based decision makers with 'equal weight' decision makers, and collects some lessons learned

  11. An Expert System for Designing Fire Prescriptions

    Science.gov (United States)

    Elizabeth Reinhardt

    1987-01-01

    Managers use prescribed fire to accomplish a variety of resource objectives. The knowledge needed to design successful prescriptions is both quantitative and qualitative. Some of it is available through publications and computer programs, but much of the knowledge of expert practitioners has never been collected or published. An expert system being developed at the,...

  12. Expert group formation using facility location analysis

    NARCIS (Netherlands)

    Neshati, M.; Beigy, H.; Hiemstra, Djoerd

    In this paper, we propose an optimization framework to retrieve an optimal group of experts to perform a multi-aspect task. While a diverse set of skills are needed to perform a multi-aspect task, the group of assigned experts should be able to collectively cover all these required skills. We

  13. Expert group formation using facility location analysis

    NARCIS (Netherlands)

    Neshati, Mahmood; Beigy, Hamid; Hiemstra, Djoerd

    2014-01-01

    In this paper, we propose an optimization framework to retrieve an optimal group of experts to perform a multi-aspect task. While a diverse set of skills are needed to perform a multi-aspect task, the group of assigned experts should be able to collectively cover all these required skills. We

  14. Counseling, Artificial Intelligence, and Expert Systems.

    Science.gov (United States)

    Illovsky, Michael E.

    1994-01-01

    Considers the use of artificial intelligence and expert systems in counseling. Limitations are explored; candidates for counseling versus those for expert systems are discussed; programming considerations are reviewed; and techniques for dealing with rational, nonrational, and irrational thoughts and feelings are described. (Contains 46…

  15. Safety Tips from the Expert Witness.

    Science.gov (United States)

    Gray, Gary R.

    1995-01-01

    Many physical educators and coaches use the potential for liability to guide their decisions about conducting activities. By understanding expert witnesses' roles in negligence actions, surer planning, teaching, and coaching are possible. The paper describes issues that expert witnesses examine in negligence actions against physical educators,…

  16. The assessment of argumentation from expert opinion

    NARCIS (Netherlands)

    Wagemans, J.H.M.

    2011-01-01

    In this contribution, I will develop a comprehensive tool for the reconstruction and evaluation of argumentation from expert opinion. This is done by analyzing and then combining two dialectical accounts of this type of argumentation. Walton’s account of the ‘appeal to expert opinion’ provides a

  17. Expert system technology for the military

    International Nuclear Information System (INIS)

    Franklin, J.E.; Carmody, C.L.; Buteau, B.L.; Keller, K.; Levitt, T.S.

    1988-01-01

    This paper is concerned with the applications of expert systems to complex military problems. A brief description of needs for expert systems in the military arena is given. A short tutorial on some of the elements of an expert system is found in Appendix I. An important aspect of expert systems concerns using uncertain information and ill-defined procedures. Many of the general techniques of dealing with uncertainty are described in Appendix II. These techniques include Bayesian certainty factors, Dempster-Shafer theory of uncertainty, and Zadeh's fuzzy set theory. The major portion of the paper addresses specific expert system examples such as resource allocation, identification of radar images, maintenance and troubleshooting of electronic equipment, and the interpretation and understanding of radar images. Extensions of expert systems to incorporate learning are examined in the context of military intelligence to determine the disposition, location, and intention of the adversary. The final application involves the use of distributed communicating cooperating expert systems for battle management. Finally, the future of expert systems and their evolving capabilities are discussed

  18. Expert system for estimating LWR plutonium production

    International Nuclear Information System (INIS)

    Sandquist, G.M.

    1988-01-01

    An Artificial Intelligence-Expert System called APES (Analysis of Proliferation by Expert System) has been developed and tested to permit a non proliferation expert to evaluate the capability and capacity of a specified LWR reactor and PUREX reprocessing system for producing and separating plutonium even when system information may be limited and uncertain. APES employs an expert system coded in LISP and based upon an HP-RL (Hewlett Packard-Representational Language) Expert System Shell. The user I/O interface communicates with a blackboard and the knowledge base which contains the quantitative models required to describe the reactor, selected fission product production and radioactive decay processes, Purex reprocessing and ancillary knowledge

  19. Expert Evidence and International Criminal Justice

    DEFF Research Database (Denmark)

    Appazov, Artur

    The book is a comprehensive narration of the use of expertise in international criminal trials offering reflection on standards concerning the quality and presentation of expert evidence. It analyzes and critiques the rules governing expert evidence in international criminal trials...... and the strategies employed by counsel and courts relying upon expert evidence and challenges that courts face determining its reliability. In particular, the author considers how the procedural and evidentiary architecture of international criminal courts and tribunals influences the courts' ability to meaningfully...... incorporate expert evidence into the rational fact-finding process. The book provides analysis of the unique properties of expert evidence as compared with other forms of evidence and the challenges that these properties present for fact-finding in international criminal trials. It draws conclusions about...

  20. Contextual Factors for Finding Similar Experts

    DEFF Research Database (Denmark)

    Hofmann, Katja; Balog, Krisztian; Bogers, Toine

    2010-01-01

    -seeking models, are rarely taken into account. In this article, we extend content-based expert-finding approaches with contextual factors that have been found to influence human expert finding. We focus on a task of science communicators in a knowledge-intensive environment, the task of finding similar experts......, given an example expert. Our approach combines expertise-seeking and retrieval research. First, we conduct a user study to identify contextual factors that may play a role in the studied task and environment. Then, we design expert retrieval models to capture these factors. We combine these with content......-based retrieval models and evaluate them in a retrieval experiment. Our main finding is that while content-based features are the most important, human participants also take contextual factors into account, such as media experience and organizational structure. We develop two principled ways of modeling...

  1. Expert and competent non-expert visual cues during simulated diagnosis in intensive care.

    Science.gov (United States)

    McCormack, Clare; Wiggins, Mark W; Loveday, Thomas; Festa, Marino

    2014-01-01

    The aim of this study was to examine the information acquisition strategies of expert and competent non-expert intensive care physicians during two simulated diagnostic scenarios involving respiratory distress in an infant. Specifically, the information acquisition performance of six experts and 12 competent non-experts was examined using an eye-tracker during the initial 90 s of the assessment of the patient. The results indicated that, in comparison to competent non-experts, experts recorded longer mean fixations, irrespective of the scenario. When the dwell times were examined against specific areas of interest, the results revealed that competent non-experts recorded greater overall dwell times on the nurse, where experts recorded relatively greater dwell times on the head and face of the manikin. In the context of the scenarios, experts recorded differential dwell times, spending relatively more time on the head and face during the seizure scenario than during the coughing scenario. The differences evident between experts and competent non-experts were interpreted as evidence of the relative availability of task-specific cues or heuristics in memory that might direct the process of information acquisition amongst expert physicians. The implications are discussed for the training and assessment of diagnostic skills.

  2. Expert and Competent Non-Expert Visual Cues during Simulated Diagnosis in Intensive Care

    Directory of Open Access Journals (Sweden)

    Clare eMcCormack

    2014-08-01

    Full Text Available The aim of this study was to examine the information acquisition strategies of expert and competent non-expert intensive care physicians during two simulated diagnostic scenarios involving respiratory distress in an infant. Specifically, the information acquisition performance of six experts and 12 competent non-experts was examined using an eye tracker during the initial 90 seconds of the assessment of the patient. The results indicated that, in comparison to competent non-experts, experts recorded longer mean fixations, irrespective of the scenario. When the dwell times were examined against specific areas of interest, the results revealed that competent non-experts recorded greater overall dwell times on the nurse, where experts recorded relatively greater dwell times on the head and face of the manikin. In the context of the scenarios, experts recorded differential dwell times, spending relatively more time on the head and face during the seizure scenario than during the coughing scenario. The differences evident between experts and competent non-experts were interpreted as evidence of the relative availability of task-specific cues or heuristics in memory that might direct the process of information acquisition amongst expert physicians. The implications are discussed for the training and assessment of diagnostic skills.

  3. Expert Judgement Assessment & SCENT Ontological Analysis

    Directory of Open Access Journals (Sweden)

    NICHERSU Iulian

    2018-05-01

    Full Text Available This study aims to provide insights in the starting point of the Horizon 2020 ECfunded project SCENT (Smart Toolbox for Εngaging Citizens into a People-Centric Observation Web Citizen Observatory (CO in terms of existing infrastructure, existing monitoring systems and some discussion on the existing legal and administrative framework that relate to flood monitoring and management in the area of Danube Delta. The methodology used in this approach is based on expert judgement and ontological analysis, using the information collected from the identified end-users of the SCENT toolbox. In this type of analysis the stages of flood monitoring and management that the experts are involved in are detailed. This is done through an Expert Judgement Assessment analysis. The latter is complemented by a set of Key Performance Indicators that the stakeholders have assessed and/or proposed for the evaluation of the SCENT demonstrations, for the impact of the project and finally for SCENT toolbox performance and usefulness. The second part of the study presents an analysis that attempts to map the interactions between different organizations and components of the existing monitoring systems in the Danube Delta case study. Expert Judgement (EJ allows to gain information from specialists in a specific field through a consultation process with one or more experts that have experience in similar and complementary topics. Expert judgment, expert estimates, or expert opinion are all terms that refer to the contents of the problem; estimates, outcomes, predictions, uncertainties, and their corresponding assumptions and conditions are all examples of expert judgment. Expert Judgement is affected by the process used to gather it. On the other hand, the ontological analysis comes to complete this study, by organizing and presenting the connections behind the flood management and land use systems in the three phases of the flood event.

  4. Sherlock Holmes: an expert's view of expertise.

    Science.gov (United States)

    André, Didierjean; Fernand, Gobet

    2008-02-01

    In recent years, there has been an intense research effort to understand the cognitive processes and structures underlying expert behaviour. Work in different fields, including scientific domains, sports, games and mnemonics, has shown that there are vast differences in perceptual abilities between experts and novices, and that these differences may underpin other cognitive differences in learning, memory and problem solving. In this article, we evaluate the progress made in the last years through the eyes of an outstanding, albeit fictional, expert: Sherlock Holmes. We first use the Sherlock Holmes character to illustrate expert processes as described by current research and theories. In particular, the role of perception, as well as the nature and influence of expert knowledge, are all present in the description of Conan Doyle's hero. In the second part of the article, we discuss a number of issues that current research on expertise has barely addressed. These gaps include, for example, several forms of reasoning, the influence of emotions on cognition, and the effect of age on experts' knowledge and cognitive processes. Thus, although nearly 120-year-old, Conan Doyle's books show remarkable illustrations of expert behaviour, including the coverage of themes that have mostly been overlooked by current research.

  5. Expert system aids transport regulation users

    International Nuclear Information System (INIS)

    Cheshire, R.D.; Straw, R.J.

    1990-01-01

    During late 1984 the IAEA Regulations were identified as an area of application for an expert system adviser which could offer many advantages. Over the following year some simple tests were carried out to examine its feasibility, but TRANAID did not get underway until 1986 when British Nuclear Fuels (BNFL) Corporate Management services were engaged on the product. By this time a greater choice of suitable software, in the form of expert system shells, had become available. After a number of trial systems the shell Leonardo was finally adopted for the final system. In order for TRANAID to emulate the expert it was necessary to spend time extracting and documenting the expert knowledge. This was a matter of investigating how the regulations are used and was achieved by a series of meetings including opportunity for the computer specialists to interview the regulations experts. There are several benefits in having an expert system advisor in this area. It is useful to both experienced and inexperienced users of regulations. For those who are learning to use the regulations it is an excellent training aid. For those who know the regulations but use them infrequently it can save time and provide a valuable reassurance. The adviser has enabled the expert user's know how to be captured and to be made widely available to those with less experience. (author)

  6. Expert judgement models in quantitative risk assessment

    Energy Technology Data Exchange (ETDEWEB)

    Rosqvist, T. [VTT Automation, Helsinki (Finland); Tuominen, R. [VTT Automation, Tampere (Finland)

    1999-12-01

    Expert judgement is a valuable source of information in risk management. Especially, risk-based decision making relies significantly on quantitative risk assessment, which requires numerical data describing the initiator event frequencies and conditional probabilities in the risk model. This data is seldom found in databases and has to be elicited from qualified experts. In this report, we discuss some modelling approaches to expert judgement in risk modelling. A classical and a Bayesian expert model is presented and applied to real case expert judgement data. The cornerstone in the models is the log-normal distribution, which is argued to be a satisfactory choice for modelling degree-of-belief type probability distributions with respect to the unknown parameters in a risk model. Expert judgements are qualified according to bias, dispersion, and dependency, which are treated differently in the classical and Bayesian approaches. The differences are pointed out and related to the application task. Differences in the results obtained from the different approaches, as applied to real case expert judgement data, are discussed. Also, the role of a degree-of-belief type probability in risk decision making is discussed.

  7. Expert judgement models in quantitative risk assessment

    International Nuclear Information System (INIS)

    Rosqvist, T.; Tuominen, R.

    1999-01-01

    Expert judgement is a valuable source of information in risk management. Especially, risk-based decision making relies significantly on quantitative risk assessment, which requires numerical data describing the initiator event frequencies and conditional probabilities in the risk model. This data is seldom found in databases and has to be elicited from qualified experts. In this report, we discuss some modelling approaches to expert judgement in risk modelling. A classical and a Bayesian expert model is presented and applied to real case expert judgement data. The cornerstone in the models is the log-normal distribution, which is argued to be a satisfactory choice for modelling degree-of-belief type probability distributions with respect to the unknown parameters in a risk model. Expert judgements are qualified according to bias, dispersion, and dependency, which are treated differently in the classical and Bayesian approaches. The differences are pointed out and related to the application task. Differences in the results obtained from the different approaches, as applied to real case expert judgement data, are discussed. Also, the role of a degree-of-belief type probability in risk decision making is discussed

  8. Expert systems and computer based industrial systems

    International Nuclear Information System (INIS)

    Dunand, R.

    1989-01-01

    Framentec is the artificial intelligence subsidiary of FRAMATOME. It is involved in expert-system activities of Shells, developments, methodology and software for maintenance (Maintex) and consulting and methodology. Specific applications in the nuclear field are presented. The first is an expert system to assist in the piping support design prototype, the second is an expert system that assists an ultrasonic testing operator in determining the nature of a welding defect and the third is a welding machine diagnosis advisor. Maintex is a software tool to provide assistance in the repair of complex industrial equipment. (author)

  9. Expert systems for assisting in design reviews

    International Nuclear Information System (INIS)

    Brtis, J.S.; Johnson, W.J.; Weber, N.; Naser, J.

    1990-01-01

    This paper discusses Sargent and Lundy's (S and L's) use of expert system technologies to computerize the procedures used for engineering design reviews. This paper discusses expert systems and the advantages that result from using them to computerize the decision-making process. This paper also discusses the design review expert systems that S and L has developed to perform fire protection and ALARA (as low as reasonably achievable) design reviews, and is currently developing for the Electric Power Research Institute (EPRI) to perform 10 CFR 50.59 safety reviews

  10. Risks, doubt, scientific and technical expert appraisement

    International Nuclear Information System (INIS)

    Decrop, G.

    1993-01-01

    In complex systems which compose modern societies, expert report is going to take an increasing place. In its usual definition, expert is justified by a superior authority, his knowledge comes from experience, he is present as a third party where he has to work. It is often forgotten two other important points, connected with the situation: it is a tangling of technical or natural systems with a social system and above all there is a risk of uncertainty. Then, the job of expert is different from scientific work done in laboratories and different from operational work done by engineers

  11. An expert system for dispersion model interpretation

    International Nuclear Information System (INIS)

    Skyllingstad, E.D.; Ramsdell, J.V.

    1988-10-01

    A prototype expert system designed to diagnose dispersion model uncertainty is described in this paper with application to a puff transport model. The system obtains qualitative information from the model user and through an expert-derived knowledge base, performs a rating of the current simulation. These results can then be used in combination with dispersion model output for deciding appropriate evacuation measures. Ultimately, the goal of this work is to develop an expert system that may be operated accurately by an individual uneducated in meteorology or dispersion modeling. 5 refs., 3 figs

  12. Computers start to think with expert systems

    Energy Technology Data Exchange (ETDEWEB)

    1983-03-21

    A growing number of professionals-notably in oil and mineral exploration, plasma research, medicine, VLSI circuit design, drug design and robotics-are beginning to use computerised expert systems. A computer program uses knowledge and inference procedures to solve problems which are sufficiently difficult to require significant human expertise for their solution. The facts constitute a body of information that is widely shared, publicly available and generally agreed upon by experts in the field. The heuristics are mostly private, and little discussed, rules of good judgement (rules of plausible reasoning, rules of good guessing, etc.) that characterise expert-level decision making in the field.

  13. Expert - Non-expert differences in visual behaviour during alpine slalom skiing.

    Science.gov (United States)

    Decroix, Marjolein; Wazir, Mohd Rozilee Wazir Norjali; Zeuwts, Linus; Deconinck, Frederik F J A; Lenoir, Matthieu; Vansteenkiste, Pieter

    2017-10-01

    The aim of this study was to investigate visual behaviour of expert and non-expert ski athletes during an alpine slalom. Fourteen non-experts and five expert slalom skiers completed an alpine slalom course in an indoor ski slope while wearing a head-mounted eye tracking device. Experts completed the slalom clearly faster than non-experts, but no significant difference was found in timing and position of the turn initiation. Although both groups already looked at future obstacles approximately 0,5s before passing the upcoming pole, the higher speed of experts implied that they shifted gaze spatially earlier in the bend than non-experts. Furthermore, experts focussed more on the second next pole while non-expert slalom skiers looked more to the snow surface immediately in front of their body. No difference was found in the fixation frequency, average fixation duration, and quiet eye duration between both groups. These results suggest that experts focus on the timing of their actions while non-experts still need to pay attention to the execution of these actions. These results also might suggest that ski trainers should instruct non-experts and experts to focus on the next pole and, shift their gaze to the second next pole shortly before reaching it. Based on the current study it seems unadvisable to instruct slalom skiers to look several poles ahead during the actual slalom. However, future research should test if these results still hold on a real outdoor slope, including multiple vertical gates. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. School Construction Management: Expert Administrators Speak.

    Science.gov (United States)

    Fickes, Michael

    2001-01-01

    Presents expert opinion on school construction management communication concerning educational needs, obtaining consensus among diverse groups, and envisioning what schools must offer in the future. Why furniture issues are also important is highlighted. (GR)

  15. National Cyber Expert Addresses ELP Class

    OpenAIRE

    Center for Homeland Defense and Security

    2012-01-01

    Center for Homeland Defense and Security, PRESS RELEASES Governments, businesses and educational institutions should be making cybersecurity a top priority, a leading expert told a class of the Center for Homeland Defense and Security’s Executive Leaders Program. Brian...

  16. A fuzzy expert system based on relations

    International Nuclear Information System (INIS)

    Hall, L.O.; Kandel, A.

    1986-01-01

    The Fuzzy Expert System (FESS) is an expert system which makes use of the theory of fuzzy relations to perform inference. Relations are very general and can be used for any application, which only requires different types of relations be implemented and used. The incorporation of fuzzy reasoning techniques enables the expert system to deal with imprecision in a well-founded manner. The knowledge is represented in relational frames. FESS may operate in either a forward chaining or backward chaining manner. It uses primarily implication and factual relations. A unique methodology for combination of evidence has been developed. It makes uses of a blackboard for communication between the various knowledge sources which may operate in parallel. The expert system has been designed in such a manner that it may be used for diverse applications

  17. Implicit Communication in Novice and Expert Teams

    National Research Council Canada - National Science Library

    Swain, Kelly

    2003-01-01

    ... (military, sporting or business teams). This suggests that expert teams may be utilising shared mental models of both the roles of their teammates and how they should be working together in a group situation...

  18. Expert systems to assist plant operation

    International Nuclear Information System (INIS)

    Matsumoto, Yoshihiro; Mori, Nobuyuki; Wada, Norio

    1985-01-01

    Large-scale real-time process control systems, such as those for electric power dispatching, large thermal and nuclear power stations, steel mill plants and manufacturing automation systems, need expert systems to assist operator's decision. The expert systems newly developed to fulfill the requirement are founded on OKBS (object oriented knowledge based system). OKBS provides various object types: fuzzy logic type, production rule type, frame type, state transition type, abstract data type and input/output transformation type. (author)

  19. Jess, the Java expert system shell

    Energy Technology Data Exchange (ETDEWEB)

    Friedman-Hill, E.J.

    1997-11-01

    This report describes Jess, a clone of the popular CLIPS expert system shell written entirely in Java. Jess supports the development of rule-based expert systems which can be tightly coupled to code written in the powerful, portable Java language. The syntax of the Jess language is discussed, and a comprehensive list of supported functions is presented. A guide to extending Jess by writing Java code is also included.

  20. An expert system for turbogenerator diagnostics

    International Nuclear Information System (INIS)

    Bessenyei, Z.; Tomcsanyi, T.; Toth, Z.; Laczay, I.

    1992-01-01

    In 1990, an expert system for turbo-generator diagnostics (EST-D) was installed at the 3rd and 4th units of the Paks NPP (Hungary). The expert system is strongly integrated to the ARGUS II vibration monitoring and diagnostics system. The system works on IBM PC AT. The VEIKI's and the NPP's human experts were interviewed to fill up the knowledgebase. The system is able to identify 13 different faults of the parts of a turbogenerator. The knowledgebase consists of ca 200 rules. The rules were built in and the system was verified and validated using a model of the turbines and using the experiences gathered with ARGUS II during the last 3 years. The maintenance personnel is authorized to modify and/or extend the knowledgebase. The input data for evaluation come from measured vibration patterns produced by the ARGUS II system, database of events, and maintenance data input by the maintenance personnel. The expert system is based on the modified GENESYS 2.1 shell (developed by SZAMALK, Hungary). Some limitations from PC application were eliminated, and a new, independent explanation module and man-machine interface were developed. Using this man-machine interface, one of the basic goals of the expert system developments was achieved: the human experts contribution is not necessary for diagnoses. The operator of the diagnostics system is able to produce the reports of diagnoses. Of course the interface allows the human experts to see the diagnoses through. It should be mentioned, at the beginning of 1991, we installed a similar expert system at the 1st 1000 MW WWER type unit of the Kalinin NPP (Soviet Union). In this paper, the operation of the EST-D, the man-machine interface and the operational experiences of the first 4 months work are explained. 2 refs., 14 figs

  1. Key attributes of expert NRL referees.

    Science.gov (United States)

    Morris, Gavin; O'Connor, Donna

    2017-05-01

    Experiential knowledge of elite National Rugby League (NRL) referees was investigated to determine the key attributes contributing to expert officiating performance. Fourteen current first-grade NRL referees were asked to identify the key attributes they believed contributed to their expert refereeing performance. The modified Delphi method involved a 3-round process of an initial semi-structured interview followed by 2 questionnaires to reach consensus of opinion. The data revealed 25 attributes that were rated as most important that underpin expert NRL refereeing performance. Results illustrate the significance of the cognitive category, with the top 6 ranked attributes all cognitive skills. Of these, the referees ranked decision-making accuracy as the most important attribute, followed by reading the game, communication, game understanding, game management and knowledge of the rules. Player rapport, positioning and teamwork were the top ranked game skill attributes underpinning performance excellence. Expert referees also highlighted a number of psychological attributes (e.g., concentration, composure and mental toughness) that were significant to performance. There were only 2 physiological attributes (fitness, aerobic endurance) that were identified as significant to elite officiating performance. In summary, expert consensus was attained which successfully provided a hierarchy of the most significant attributes of expert NRL refereeing performance.

  2. Earthquakes and Tectonics Expert Judgment Elicitation Project

    International Nuclear Information System (INIS)

    Coppersmith, K.J.; Perman, R.C.; Youngs, R.R.

    1993-02-01

    This report summarizes the results of the Earthquakes and Tectonics Expert Judgement Excitation Project sponsored by the Electric Power Research Institute (EPRI). The objectives of this study were two-fold: (1) to demonstrate methods for the excitation of expert judgement, and (2) to quantify the uncertainties associated with earthquake and tectonics issues for use in the EPRI-HLW performance assessment. Specifically, the technical issue considered is the probability of differential fault displacement through the proposed repository at Yucca Mountain, Nevada. For this study, a strategy for quantifying uncertainties was developed that relies on the judgements of multiple experts. A panel of seven geologists and seismologists was assembled to quantify the uncertainties associated with earthquake and tectonics issues for the performance assessment model. A series of technical workshops focusing on these issues were conducted. Finally, each expert was individually interviewed in order to elicit his judgement regarding the technical issues and to provide the technical basis for his assessment. This report summarizes the methodologies used to elicit the judgements of the earthquakes and tectonics experts (termed ''specialists''), and summarizes the technical assessments made by the expert panel

  3. Measuring the Effectiveness of Gamesourcing Expert Oil Painting Annotations

    NARCIS (Netherlands)

    M.C. Traub (Myriam); J.R. van Ossenbruggen (Jacco); J. He (Jiyin); L. Hardman (Lynda); M. de Rijke (Maarten); T Kentner; A.P. de Vries (Arjen); F.M.G. de Jong (Franciska); C. Zhai (ChengXiang ); K. Hofmann (Katja); K. Radinsky

    2014-01-01

    htmlabstractTasks that require users to have expert knowledge are diffi- cult to crowdsource. They are mostly too complex to be carried out by non-experts and the available experts in the crowd are difficult to target. Adapting an expert task into a non-expert user task, thereby enabling the

  4. Enhancing Transparency in Multidisciplinary Expert Communication

    International Nuclear Information System (INIS)

    Hukki, Kristiina; Pulkkinen, Urho

    2003-01-01

    Faced with problems of public acceptance most nuclear waste management organisations now acknowledge the importance of transparency in their pursuit of solutions for high-level nuclear waste disposal. To make progress the implementing organizations need the trust of other stakeholders in the decision-making process. For such trust these outside stakeholders need knowledge on the grounds for the judgments and decisions made in different scientific and technical disciplines. Transparency is, however, at least as important for the multidisciplinary expert communication itself. As a matter of fact, the transparency of the internal expert interaction processes is a prerequisite for the true transparency of the communication between the implementer and the external stakeholder groups. The introduced conceptual framework has been developed for the identification of the requirements of safety-informed communication in multidisciplinary expert work in nuclear waste management. The framework offers a common thinking model and common concepts which can be utilized in the development of the communication practices. The basis of the framework is on the possibility to understand the safety-critical significance of one's work. The transparency of communication is, for its part, based on making explicit the relevant knowledge necessary for gaining the understanding. This supplementary knowledge, which is related to the substance issues but is not scientific-technical by nature, enhances the experts' awareness of the context of their own contribution and of the background of the other experts' contributions. The common conceptualization and modelling of the knowledge-related dependencies between the tasks make it possible to realize the significance of the supplementary knowledge for transparent communication in actual situations. They also facilitate the recognition of the need for different types of supplementary knowledge in the interfaces between the tasks. By enhancing mutual

  5. Use of expert systems in nuclear safety

    International Nuclear Information System (INIS)

    1990-02-01

    One dominant aspect of improvement in safe nuclear power plant operation is the very high speed in the development and introduction of computer technologies. This development commenced recently when advanced control technology was incorporated into the nuclear industry. This led to an increasing implementation of information displays, annunciator windows and other devices inside the control room, eventually overburdening the control room operator with detailed information. Expert systems are a further step in this direction being designed to apply large knowledge bases to solve practical problems. These ''intelligent'' systems have to incorporate enough knowledge to reach expert levels of importance and represent a very advanced man-machine interface. The aims of the Technical Committee were addressed by the three Working Groups and summarized in Sections 2, 3 and 4 of this report. Section 2 summarizes the results and discussions on the current capabilities of expert systems and identifies features for the future development and use of Expert Systems in Nuclear Power Plants. Section 3 provides an overview of the discussions and investigations into the current status of Expert Systems in NPPs. This section develops a method for assessing the overall benefit of different applications and recommends a broad strategy for priority developments of Expert Systems in NPPs. Section 4 assesses the overall use of PSA type studies in Expert Systems in NPPs and identifies specific features to be adopted in the design of these systems in future applications. The conclusions of the three Working Groups are presented in Section 5. The 15 papers presented at the meeting formed the Annex of this document. A separate abstract was prepared for each of these papers. Refs, figs, tabs and pictures

  6. Auditory memory function in expert chess players.

    Science.gov (United States)

    Fattahi, Fariba; Geshani, Ahmad; Jafari, Zahra; Jalaie, Shohreh; Salman Mahini, Mona

    2015-01-01

    Chess is a game that involves many aspects of high level cognition such as memory, attention, focus and problem solving. Long term practice of chess can improve cognition performances and behavioral skills. Auditory memory, as a kind of memory, can be influenced by strengthening processes following long term chess playing like other behavioral skills because of common processing pathways in the brain. The purpose of this study was to evaluate the auditory memory function of expert chess players using the Persian version of dichotic auditory-verbal memory test. The Persian version of dichotic auditory-verbal memory test was performed for 30 expert chess players aged 20-35 years and 30 non chess players who were matched by different conditions; the participants in both groups were randomly selected. The performance of the two groups was compared by independent samples t-test using SPSS version 21. The mean score of dichotic auditory-verbal memory test between the two groups, expert chess players and non-chess players, revealed a significant difference (p≤ 0.001). The difference between the ears scores for expert chess players (p= 0.023) and non-chess players (p= 0.013) was significant. Gender had no effect on the test results. Auditory memory function in expert chess players was significantly better compared to non-chess players. It seems that increased auditory memory function is related to strengthening cognitive performances due to playing chess for a long time.

  7. False confessions, expert testimony, and admissibility.

    Science.gov (United States)

    Watson, Clarence; Weiss, Kenneth J; Pouncey, Claire

    2010-01-01

    The confession of a criminal defendant serves as a prosecutor's most compelling piece of evidence during trial. Courts must preserve a defendant's constitutional right to a fair trial while upholding the judicial interests of presenting competent and reliable evidence to the jury. When a defendant seeks to challenge the validity of that confession through expert testimony, the prosecution often contests the admissibility of the expert's opinion. Depending on the content and methodology of the expert's opinion, testimony addressing the phenomenon of false confessions may or may not be admissible. This article outlines the scientific and epistemological bases of expert testimony on false confession, notes the obstacles facing its admissibility, and provides guidance to the expert in formulating opinions that will reach the judge or jury. We review the 2006 New Jersey Superior Court decision in State of New Jersey v. George King to illustrate what is involved in the admissibility of false-confession testimony and use the case as a starting point in developing a best-practice approach to working in this area.

  8. System and method for creating expert systems

    Science.gov (United States)

    Hughes, Peter M. (Inventor); Luczak, Edward C. (Inventor)

    1998-01-01

    A system and method provides for the creation of a highly graphical expert system without the need for programming in code. An expert system is created by initially building a data interface, defining appropriate Mission, User-Defined, Inferred, and externally-generated GenSAA (EGG) data variables whose data values will be updated and input into the expert system. Next, rules of the expert system are created by building appropriate conditions of the rules which must be satisfied and then by building appropriate actions of rules which are to be executed upon corresponding conditions being satisfied. Finally, an appropriate user interface is built which can be highly graphical in nature and which can include appropriate message display and/or modification of display characteristics of a graphical display object, to visually alert a user of the expert system of varying data values, upon conditions of a created rule being satisfied. The data interface building, rule building, and user interface building are done in an efficient manner and can be created without the need for programming in code.

  9. Methodology toward second generation expert systems

    International Nuclear Information System (INIS)

    Dormoy, J.L.

    1989-01-01

    So-called First Generation Expert Systems were aimed at capturing the expert's know-how. Though providing remarkable achievements, this first wave did not give the expected outcome. A new generation is getting out from the laboratories. Instead of remaining at a shallow level of knowledge - that is the unmotivated reasoning processes expressed by an expert when he is forced to tell them - one attempts to re-build this level of knowledge from the first principles which constitute the basis of an expert's knowledge. These systems are called deep knowledge-based, or second generation expert systems. Discussion in the three first parts rests on two examples: A first generation and a half system for process control in nuclear powers plants, than the system EXTRA for alarm processing in nuclear plants, wherein fonctional knowledge is explicitely represented. We show how deep knowledge can be implemented, and the advantages that can be expected from this methodology. Qualitative Physics is discussed in the next part. Future research developments as well as potential payoffs are mentioned [fr

  10. Experts' Views Regarding the Conceptualization of Narcissism.

    Science.gov (United States)

    Ackerman, Robert A; Hands, Aaron J; Donnellan, M Brent; Hopwood, Christopher J; Witt, Edward A

    2017-06-01

    There is debate over the definition of narcissism across social/personality and clinical psychology. The current article aims to quantify the level of disagreement by measuring experts' opinions concerning the attributes most central to narcissism. Accordingly, we developed a comprehensive list of attributes associated with narcissism and had 49 self-identified experts (among them 17 women, 23 psychologists from clinical psychology and 22 from social/personality psychology) rate these characteristics and provide their opinions on several issues related to the conceptualization of narcissism. Experts generally believe that the grandiose features of narcissism are more central than the vulnerable features. However, differences between clinical and social/personality psychologists were evident, especially regarding the relevance of self-esteem. Given the results, we suggest that researchers specify the kind of narcissism being assessed in a given study and consider using assessments of the full range of narcissistic features in future research to provide a more comprehensive perspective on the construct.

  11. Recruiting experts for technical assistance rogramme

    International Nuclear Information System (INIS)

    1974-01-01

    One of the objectives of the IAEA is the provision of technical assistance to its Member States to carry out their peaceful nuclear activities more efficiently and safely. This involves looking for and supplying experts, equipment and fellowships. Since 1958 the Agency has provided the services of more than 1800 experts valued at $11.5 million, 4300 fellowships valued at $14.3 million, and equipment worth $10.8 million. The efficiency of the programme can only be increased by a more prompt consideration of proposals forwarded by the Agency, and the continuing co-operation from national Governments and private institutions. The IAEA recruits an average of 200 experts a year to implement its Regular Technical Assistance Programme. These projects are financed by voluntary contributions from Member States, and by the United Nations Development Programme for those projects for which the IAEA is the executing agency

  12. Meanings & motives. Experts debating tobacco addiction.

    Science.gov (United States)

    Mars, Sarah G; Ling, Pamela M

    2008-10-01

    Over the last 50 years, tobacco has been excluded from and then included in the category of addictive substances. We investigated influences on these opposing definitions and their application in expert witness testimony in litigation in the 1990s and 2000s. A scientist with ties to the tobacco industry influenced the selection of a definition of addiction that led to the classification of tobacco as a "habituation" in the 1964 Surgeon General's Advisory Committee report. Tobacco was later defined as addictive in the 1988 surgeon general's report. Expert witnesses for tobacco companies used the 1964 report's definition until Philip Morris Tobacco Company publicly changed its position in 1997 to agree that nicotine was addictive. Expert witnesses for plaintiffs suing the tobacco industry used the 1988 report's definition, arguing that new definitions were superior because of scientific advance. Both sides viewed addiction as an objective entity that could be defined more or less accurately.

  13. Expert system aided operator's mental activities training

    International Nuclear Information System (INIS)

    Gieci, A.; Macko, J.; Mosny, J.; Gese, A.

    1994-01-01

    The operator's mental activity is the most important part of his work. A processing of a large amount of the information by the operator is possible only if he/she possesses appropriate cognitive skills. To facilitate the novice's acquisition of the experienced operator's cognitive skills of the decision-making process a special type of the expert system was developed. The cognitive engineering's models and problem-solving methodology constitutes the basis of this expert system. The article gives an account of the prototype of the mentioned expert system developed to aid the whole mental activity of the nuclear power plant operator during his decision-making process. (author). 6 refs, 6 figs

  14. An expert system in medical diagnosis

    International Nuclear Information System (INIS)

    Raboanary, R.; Raoelina Andriambololona; Soffer, J.; Raboanary, J.

    2001-01-01

    Health problem is still a crucial one in some countries. It is so important that it becomes a major handicap in economic and social development. In order to solve this problem, we have conceived an expert system that we called MITSABO, which means TO HEAL, to help the physicians to diagnose tropical diseases. It is clear that by extending the data base and the knowledge base, we can extend the application of the software to more general areas. In our expert system, we used the concept of 'self organization' of neural network based on the determination of the eigenvalues and the eigenvectors associated to the correlation matrix XX t . The projection of the data on the two first eigenvectors gives a classification of the diseases which is used to get a first approach in the diagnosis of the patient. This diagnosis is improved by using an expert system which is built from the knowledge base.

  15. An expert system approach for safety diagnosis

    International Nuclear Information System (INIS)

    Erdmann, R.C.; Sun, B.K.H.

    1988-01-01

    An expert system was developed with the intent to provide real-time information about an accident to an operator who is in the process of diagnosing and bringing that accident under control. Explicit use was made of probabilistic risk analysis techniques and plant accident response information in constructing this system. The expert system developed contains 70 logic rules and provides contextual messages during simulated accident sequences and logic sequence information on the entire sequence in graphical form for accident diagnosis. The present analysis focuses on integrated control system-related transients with Babcock and Wilcox-type reactors. While the system developed here is limited in extent and was built for a composite reactor, it demonstrates that an expert system may enhance the operator's capability in the control room

  16. Advisory expert system for test rig operator

    International Nuclear Information System (INIS)

    Zielczynski, P.

    1994-01-01

    The advisory expert system MAESTRO (Modular Advisory Expert System for Test Rig Operator) has been designed to guide the operator of large experimental installation during start-up, steady state and shut down. The installation is located in the research reactor MARIA in the Institute of Atomic Energy in Swierk, Poland. The system acquires and analyses on line signals from installation and performs two tasks in real time: leading the operator and monitoring of the installation (including signal validation). Systems tasks, architecture and knowledge representation concepts are described. The system is based on expert systems techniques what makes in phases of continuous change of process parameters and it has been achieved by special knowledge representation allowing its dynamical modification. (author). 147 refs, 42 figs, 5 tab

  17. An expert system for diesel generator diagnostics

    International Nuclear Information System (INIS)

    Bley, D.C.; Read, J.W.; Kaplan, S.; Liming, J.K.; Brosee, N.M.; Hanley, D.W.

    1987-01-01

    The idea of developing artificial intelligence (AI) systems to capture the knowledge of human experts is receiving much attention these days. The idea is even more attractive when important expertise resides within a single individual, especially one who is nearing retirement and who has not otherwise recorded or passed along his important knowledge and thought processes. The diesel generators at Pilgrim Nuclear Power Station have performed exceptionally well, primarily due to the care and attention of one man. Therefore, the authors are constructing an expert system for the diagnosis of diesel generator problems at Pilgrim. This paper includes a description of the expert system design and operation, examples from the knowledge base, and sample diagnoses, so the reader can observe the process in action

  18. Expert system for web based collaborative CAE

    Science.gov (United States)

    Hou, Liang; Lin, Zusheng

    2006-11-01

    An expert system for web based collaborative CAE was developed based on knowledge engineering, relational database and commercial FEA (Finite element analysis) software. The architecture of the system was illustrated. In this system, the experts' experiences, theories and typical examples and other related knowledge, which will be used in the stage of pre-process in FEA, were categorized into analysis process and object knowledge. Then, the integrated knowledge model based on object-oriented method and rule based method was described. The integrated reasoning process based on CBR (case based reasoning) and rule based reasoning was presented. Finally, the analysis process of this expert system in web based CAE application was illustrated, and an analysis example of a machine tool's column was illustrated to prove the validity of the system.

  19. Poor Agreement Among Expert Witnesses in Bile Duct Injury Malpractice Litigation An Expert Panel Survey

    NARCIS (Netherlands)

    de Reuver, Philip R.; Dijkgraaf, Marcel G. W.; Gevers, Sjef K. M.; Gouma, Dirk J.

    2008-01-01

    Objective: To determine the inter-rater agreement of expert witness testimonies in bile duct injury malpractice litigation. Background Data: Malpractice litigation is an increasing concern in modem surgical practice. As most of the lawyers are not educated in medicine, expert witnesses are asked to

  20. Poor agreement among expert witnesses in bile duct injury malpractice litigation: an expert panel survey.

    NARCIS (Netherlands)

    Reuver, P.R. de; Dijkgraaf, M.G.; Gevers, S.K.; Gouma, D.J.; Bleichrodt, R.P.; Cuesta, M.A.; Erp, W.F. van; Gerritsen, J.; Hesselink, E.J.; Laarhoven, C.J.H.M. van; Lange, J. de; Obertop, H.; Stassen, L.P.; Terpstra, O.T.; Tilanus, H.W.; Vroonhoven, T.J.; Wit, L. de

    2008-01-01

    OBJECTIVE: To determine the inter-rater agreement of expert witness testimonies in bile duct injury malpractice litigation. BACKGROUND DATA: Malpractice litigation is an increasing concern in modern surgical practice. As most of the lawyers are not educated in medicine, expert witnesses are asked to

  1. Temporal logics and real time expert systems.

    Science.gov (United States)

    Blom, J A

    1996-10-01

    This paper introduces temporal logics. Due to the eternal compromise between expressive adequacy and reasoning efficiency that must decided upon in any application, full (first order logic or modal logic based) temporal logics are frequently not suitable. This is especially true in real time expert systems, where a fixed (and usually small) response time must be guaranteed. One such expert system, Fagan's VM, is reviewed, and a delineation is given of how to formally describe and reason with time in medical protocols. It is shown that Petri net theory is a useful tool to check the correctness of formalised protocols.

  2. Distributed expert systems for nuclear reactor control

    International Nuclear Information System (INIS)

    Otaduy, P.J.

    1992-01-01

    A network of distributed expert systems is the heart of a prototype supervisory control architecture developed at the Oak Ridge National Laboratory (ORNL) for an advanced multimodular reactor. Eight expert systems encode knowledge on signal acquisition, diagnostics, safeguards, and control strategies in a hybrid rule-based, multiprocessing and object-oriented distributed computing environment. An interactive simulation of a power block consisting of three reactors and one turbine provides a realistic, testbed for performance analysis of the integrated control system in real-time. Implementation details and representative reactor transients are discussed

  3. Expert System Software Assistant for Payload Operations

    Science.gov (United States)

    Rogers, Mark N.

    1997-01-01

    The broad objective of this expert system software based application was to demonstrate the enhancements and cost savings that can be achieved through expert system software utilization in a spacecraft ground control center. Spacelab provided a valuable proving ground for this advanced software technology; a technology that will be exploited and expanded for future ISS operations. Our specific focus was on demonstrating payload cadre command and control efficiency improvements through the use of "smart" software which monitors flight telemetry, provides enhanced schematic-based data visualization, and performs advanced engineering data analysis.

  4. An expert system for USNRC emergency response

    International Nuclear Information System (INIS)

    Sebo, D.E.; Bray, M.A.; King, M.A.

    1986-01-01

    The Reactor Safety Assessment System (RSAS) is an expert system under development for the United States Nuclear Regulatory Commission (USNRC). RSAS is intended for use at the NRO's Operations Center in the event of a serious incident at a licensed nuclear power plant. RSAS is a situation assessment expert system which uses plant parametric data to generate conclusions for use by the NRC Reactor Safety Team. RSAS uses multiple rule bases and plant specific setpoint files in order to be applicable to all licensed power plants. RSAS currently covers several generic reactor types and power plants within those classes

  5. Expert system for USNRC emergency response

    International Nuclear Information System (INIS)

    Sebo, D.E.; Bray, M.A.; King, M.A.

    1986-01-01

    The Reactor Safety Assessment System (RSAS) is an expert system under development for the United States Nuclear Regulatory Commission (USNRC). RSAS is intended for use at the NRC's Operations Center in the event of a serious incident at a licensed nuclear power plant. RSAS is a situation assessment expert system which uses plant parametric data to generate conclusions for use by the NRC Reactor Safety Team. RSAS uses multiple rule bases and plant specific setpoint files in order to be applicable to all licensed power plants. RSAS currently covers several generic reactor types and power plants within those classes

  6. Oracle Hyperion Interactive Reporting 11 Expert Guide

    CERN Document Server

    Cody, Edward J

    2011-01-01

    This book is written in a simple, easy to understand format with screenshots, code samples, and step-by-step explanations that will guide you through the advanced techniques used by the experts. If you are an Oracle Hyperion Interactive reporting user or developer looking to become an expert in the product, then this book is for you. You will require a basic knowledge of Interactive Reporting, as this book starts with a brief overview and then dives into advanced techniques, functions, and best practices. Beginner users should consult The Business Analyst's Guide to Oracle Hyperion Interactive

  7. AN EXPERT SYSTEM USED IN DESIGN

    Directory of Open Access Journals (Sweden)

    Hüdayim BAŞAK

    2001-03-01

    Full Text Available In this work, an expert system used in computer aided design has been developed. In the developed program, the features which are used in the models prepared by a feature based design program are evaluated by the expert system module and are used in part modeling after determining of their compatibilty according to the rules. This program, particulary for those who do not know or know very little manufacturing stages, accomplishes the duty of informing and directing them. The program developed warns the user for design mistakes made during modeling.

  8. EXPERT SYSTEMS - DEVELOPMENT OF AGRICULTURAL INSURANCE TOOL

    Directory of Open Access Journals (Sweden)

    NAN Anca-Petruţa

    2013-07-01

    Full Text Available Because of the fact that specialty agricultural assistance is not always available when the farmers need it, we identified expert systems as a strong instrument with an extended potential in agriculture. This started to grow in scale recently, including all socially-economic activity fields, having the role of collecting data regarding different aspects from human experts with the purpose of assisting the user in the necessary steps for solving problems, at the performance level of the expert, making his acquired knowledge and experience available. We opted for a general presentation of the expert systems as well as their necessity, because, the solution to develop the agricultural system can come from artificial intelligence by implementing the expert systems in the field of agricultural insurance, promoting existing insurance products, farmers finding options in depending on their necessities and possibilities. The objective of this article consists of collecting data about different aspects about specific areas of interest of agricultural insurance, preparing the database, a conceptual presentation of a pilot version which will become constantly richer depending on the answers received from agricultural producers, with the clearest exposure of knowledgebase possible. We can justify picking this theme with the fact that even while agricultural insurance plays a very important role in agricultural development, the registered result got from them are modest, reason why solutions need to be found in the scope of developing the agricultural sector. The importance of this consists in the proposal of an immediate viable solution to correspond with the current necessities of agricultural producers and in the proposal of an innovative solution, namely the implementation of expert system in agricultural insurance as a way of promoting insurance products. Our research, even though it treats the subject at an conceptual level, it wants to undertake an

  9. A computerized expert system for mammography

    International Nuclear Information System (INIS)

    Jackson, V.P.; Dines, K.A.; Bassett, L.W.

    1988-01-01

    The authors have developed a computer-based expert system to aid in the interpretation of mammograms, breast sonograms, and clinical findings. The radiologist enters clinical and image data into the artificial intelligence system and receives a prediction of the etiology of lesions seen on breast imaging studies. This prototype interactive system has undergone preliminary clinical testing and evaluation. Ultimately, a more refined and complex system will be of value in mammography education, for general radiologists without ready access to mammography experts, for paramedical personnel, and for all mammographers in need of a breast imaging database and reporting systems

  10. The Management and Security Expert (MASE)

    Science.gov (United States)

    Miller, Mark D.; Barr, Stanley J.; Gryphon, Coranth D.; Keegan, Jeff; Kniker, Catherine A.; Krolak, Patrick D.

    1991-01-01

    The Management and Security Expert (MASE) is a distributed expert system that monitors the operating systems and applications of a network. It is capable of gleaning the information provided by the different operating systems in order to optimize hardware and software performance; recognize potential hardware and/or software failure, and either repair the problem before it becomes an emergency, or notify the systems manager of the problem; and monitor applications and known security holes for indications of an intruder or virus. MASE can eradicate much of the guess work of system management.

  11. Subject Matter Expert Workshop to Identify Cybersecurity ...

    Science.gov (United States)

    Report In recognition of the growing need to better address cyber risk and cyber management, the U.S. Environmental Protection Agency’s (EPA) National Homeland Security Research Center (NHSRC) held a Subject Matter Expert Workshop to Identify Cybersecurity Research Gaps and Needs of the Nation’s Water and Wastewater Systems Sector on March 30th and 31st, 2016, at the Ronald Reagan Building in Washington, D.C. The workshop was designed to create a forum for subject matter experts (SMEs) to exchange ideas and address important cybersecurity challenges facing the water sector.

  12. Inter-expert and intra-expert reliability in sleep spindle scoring

    DEFF Research Database (Denmark)

    Wendt, Sabrina Lyngbye; Welinder, Peter; Sørensen, Helge Bjarup Dissing

    2015-01-01

    Objectives To measure the inter-expert and intra-expert agreement in sleep spindle scoring, and to quantify how many experts are needed to build a reliable dataset of sleep spindle scorings. Methods The EEG dataset was comprised of 400 randomly selected 115 s segments of stage 2 sleep from 110...... with higher reliability than the estimation of spindle duration. Reliability of sleep spindle scoring can be improved by using qualitative confidence scores, rather than a dichotomous yes/no scoring system. Conclusions We estimate that 2–3 experts are needed to build a spindle scoring dataset...... with ‘substantial’ reliability (κ: 0.61–0.8), and 4 or more experts are needed to build a dataset with ‘almost perfect’ reliability (κ: 0.81–1). Significance Spindle scoring is a critical part of sleep staging, and spindles are believed to play an important role in development, aging, and diseases of the nervous...

  13. Sleep-spindle detection: crowdsourcing and evaluating performance of experts, non-experts and automated methods

    DEFF Research Database (Denmark)

    Warby, Simon C.; Wendt, Sabrina Lyngbye; Welinder, Peter

    2014-01-01

    to crowdsource spindle identification by human experts and non-experts, and we compared their performance with that of automated detection algorithms in data from middle- to older-aged subjects from the general population. We also refined methods for forming group consensus and evaluating the performance...... of event detectors in physiological data such as electroencephalographic recordings from polysomnography. Compared to the expert group consensus gold standard, the highest performance was by individual experts and the non-expert group consensus, followed by automated spindle detectors. This analysis showed...... that crowdsourcing the scoring of sleep data is an efficient method to collect large data sets, even for difficult tasks such as spindle identification. Further refinements to spindle detection algorithms are needed for middle- to older-aged subjects....

  14. JB_054_Supplementary_Tables.docx

    Indian Academy of Sciences (India)

    LENOVO

    TRI 10032, T. aestivum L. var. aestivum, Mexico, Spring, Q4 ... TRI 10311, T. aestivum L. var. aestivum, Japan, Spring, Q2 ..... precursor (sucrose export defective 1), dihydrolipoamide dehydrogenase precursor, disulfide-isomerase precursor.

  15. JB_054_Supplementary_Tables.docx

    Indian Academy of Sciences (India)

    LENOVO

    TRI 3569, T. aestivum L. var. lutescens, Uruguay, Spring, Q4 ..... putative resistance complex protein, putative disease resistance protein, cold shock protein, barley stem rust resistance protein, seven transmembrane protein, cytochrome P450, glutamate dehydrogenase, pyruvate decarboxylase, peroxidase and chaperonin.

  16. Experts and consensus in social science

    NARCIS (Netherlands)

    Martini, C.; Boumans, M.

    2014-01-01

    This book brings together the research of philosophers and social scientists. It examines those areas of scientific practice where reliance on the subjective judgment of experts and practitioners is the main source of useful knowledge to address, and, possibly, bring solutions to social problems. A

  17. Expert advisory services to other countries

    International Nuclear Information System (INIS)

    Orstein, Roberto M.

    1998-01-01

    Argentina has provided expert services in the nuclear field to almost all the countries of Latin America and to many countries of other continents, in the framework of bilateral and multilateral cooperation agreements. A short history of these services is outlined and some statistical data are presented

  18. EXPERT SYSTEMS SHOW PROMISE FOR CUSTOMER INQUIRIES

    Science.gov (United States)

    This article describes results of an agreement between the North Penn Water Authority in Lansdale, Pa., and the US Environmental Protection Agency, Drinking Water Research Division, Cincinnati, Ohio, to study use of expert systems technology in a water utility. The threeyear stud...

  19. Decisions, Decisions: A Schema for Expert Decisionmaking.

    Science.gov (United States)

    Stape, Christopher J.

    1999-01-01

    Presents a schema for expert decisionmaking that can be used as a performance support tool. The ringshaped schema can be used in two ways: (1) beginning at the center with problemsetting and working outward to other supporting factors, or (2) skimming over the factors located in the outer ring to find a topic related to information about the…

  20. Expert finder systems – design and use

    DEFF Research Database (Denmark)

    Lykke, Marianne; Weidel, Eva

    2011-01-01

    The survey aimed at investigating how companies deal with the challenge of sharing of employees’ expert knowledge. We wanted to find out which tools are being used to register, communicate and search employees as a knowledge resource. Specifically, we wanted to know how service organizations use ...

  1. The responsibility of the radiation protection expert

    International Nuclear Information System (INIS)

    Varescon, M.

    2008-01-01

    After having recalled the two main different types of responsibility in the French law system (civil liability and criminal responsibility), and how criminal law has been gradually introduced in companies, the author analyzes and describes how the radiation protection expert's responsibility is tightly related to that of his employer, and how both can be committed on a disciplinary and criminal level

  2. Using Expert Systems To Build Cognitive Simulations.

    Science.gov (United States)

    Jonassen, David H.; Wang, Sherwood

    2003-01-01

    Cognitive simulations are runnable computer programs for modeling human cognitive activities. A case study is reported where expert systems were used as a formalism for modeling metacognitive processes in a seminar. Building cognitive simulations engages intensive introspection, ownership and meaning making in learners who build them. (Author/AEF)

  3. Fuzzy Expert System to Characterize Students

    Science.gov (United States)

    Van Hecke, T.

    2011-01-01

    Students wanting to succeed in higher education are required to adopt an adequate learning approach. By analyzing individual learning characteristics, teachers can give personal advice to help students identify their learning success factors. An expert system based on fuzzy logic can provide economically viable solutions to help students identify…

  4. Laserjet Printer Troubleshooting Expert System | Adesola | West ...

    African Journals Online (AJOL)

    This paper model an expert system called LAPTEX for troubleshooting LaserJet printers' faults. Today, with the innumerable advances in information technologies, computerizing printer's fault troubleshooting and identifying faults is far becoming so vital. Also, printers' fault detection is a complicated process that requires a ...

  5. ROSIE: A Programming Environment for Expert Systems

    Science.gov (United States)

    1985-10-01

    ence on Artificial Inteligence , Tbilisi, USSR, 1975. Fain, J., D. Gorlin, F. Hayes-Roth, S. Rosenschein, H. Sowizral, and D. Waterman, The ROSIE Language...gramming environment for artificial intelligence (AI) applications. It provides particular support for designing expert systems, systems that embody

  6. Temporal logics and real time expert systems

    NARCIS (Netherlands)

    Blom, J.A.

    1996-01-01

    This paper introduces temporal logics. Due to the eternal compromise between expressive adequacy and reasoning efficiency that must decided upon in any application, full (first order logic or modal logic based) temporal logics are frequently not suitable. This is especially true in real time expert

  7. Expert system support and juridical quality

    NARCIS (Netherlands)

    Groothuis, Marga M.; Svensson, Jorgen S.; Breuker, J.; Leenes, R.E.; Winkels, R.

    2000-01-01

    This article discusses the use of expert systems as a means of achieving juridical quality within administrative organisations. Do these systems really improve the quality of decision making and provide the desired guarantees with respect to the correct treatment of clients?

  8. Propulsive efficiency and non- expert swimmers performance

    Directory of Open Access Journals (Sweden)

    Tiago Barbosa

    2009-12-01

    Full Text Available Propulsive efficiency is one of the most interesting issues for competitive swimming researchers, has it presents significant relationships with the swimmer’s biophysical behavior and his/her performance. Although propulsive efficiency is a variable that has been quite studied in elite swimmers, there is no research on this issue in young and non-expert swimmers. Thus, the aim of this study was to: (i estimate the propulsive efficiency on non-expert swimmers; (ii identify biomechanical and anthropometrical parameters that are associated with propulsive efficiency; (iii identify the association between the propulsive efficiency and swim performance. Twenty-eight non-expert swimmers participated on this study. It was assessed the propulsive efficiency, biomechanical and anthropometrical parameters, as well as, the swim performance. The propulsive efficiency of non-expert swimmers is lower than data reported in the literature to higher competitive levels swimmers and there are no significant differences between boys and girls. It was also noted that several biomechanical and anthropometrical parameters, as well as, the swim performance are associated with the propulsive efficiency.

  9. Visual Cues for an Adaptive Expert System.

    Science.gov (United States)

    Miller, Helen B.

    NCR (National Cash Register) Corporation is pursuing opportunities to make their point of sale (POS) terminals easy to use and easy to learn. To approach the goal of making the technology invisible to the user, NCR has developed an adaptive expert prototype system for a department store POS operation. The structure for the adaptive system, the…

  10. Expert system for transuranic waste assay

    Energy Technology Data Exchange (ETDEWEB)

    Zoolalian, M.L.; Gibbs, A.; Kuhns, J.D.

    1989-01-01

    Transuranic wastes are generated at the Savannah River Site (SRS) as a result of routine production of nuclear materials. These wastes contain Pu-238 and Pu-239 and are placed into lined 55-gallon waste drums. The drums are placed on monitored storage pads pending shipment to the Waste Isolation Pilot Plant in New Mexico. A passive-active neutron (PAN) assay system is used to determine the mass of the radioactive material within the waste drums. Assay results are used to classify the wastes as either low-level or transuranic (TRU). During assays, the PAN assay system communicates with an IBM-AT computer. A Fortran computer program, called NEUT, controls and performs all data analyses. Unassisted, the NEUT program cannot adequately interpret assay results. To eliminate this limitation, an expert system shell was used to write a new algorithm, called the Transuranic Expert System (TRUX), to drive the NEUT program and add decision making capabilities for analysis of the assay results. The TRUX knowledge base was formulated by consulting with human experts in the field of neutron assay, by direct experimentation on the PAN assay system, and by observing operations on a daily basis. TRUX, with its improved ability to interpret assay results, has eliminated the need for close supervision by a human expert, allowing skilled technicians to operate the PAN assay system. 4 refs., 1 fig., 4 tabs.

  11. Expert Behavior in Children's Video Game Play.

    Science.gov (United States)

    VanDeventer, Stephanie S.; White, James A.

    2002-01-01

    Investigates the display of expert behavior by seven outstanding video game-playing children ages 10 and 11. Analyzes observation and debriefing transcripts for evidence of self-monitoring, pattern recognition, principled decision making, qualitative thinking, and superior memory, and discusses implications for educators regarding the development…

  12. Knowledge representation and use. I. Expert systems

    Energy Technology Data Exchange (ETDEWEB)

    Lauriere, J L

    1982-01-01

    Expert systems are designed as aids in human reasoning in various specific areas. Symbolic knowledge manipulation, uncertain and incomplete deduction capabilities, natural communication with humans in non-procedural ways are their essential features. The paper describes their design and several implementations. 105 references.

  13. 16 CFR 255.3 - Expert endorsements.

    Science.gov (United States)

    2010-01-01

    ... packaging -is neither relevant nor available to consumers, and the basis for the hospital's decision is not..., take into account factors not within his or her expertise (e.g., matters of taste or price), the... characteristics with respect to which he or she is expert and which are relevant to an ordinary consumer's use of...

  14. Ethical Issues in Expert Opinions and Testimony.

    Science.gov (United States)

    Weed, Roger O.

    2000-01-01

    This article provides an overview of ethical issues in private for-profit practice, with particular focus on expert testimony, using examples from a sample of claims filed with the National Association of Rehabilitation Professionals in the Private Sector and malpractice insurance companies. Complaints most frequently involve issues related to…

  15. Expert system for transuranic waste assay

    International Nuclear Information System (INIS)

    Zoolalian, M.L.; Gibbs, A.; Kuhns, J.D.

    1989-01-01

    Transuranic wastes are generated at the Savannah River Site (SRS) as a result of routine production of nuclear materials. These wastes contain Pu-238 and Pu-239 and are placed into lined 55-gallon waste drums. The drums are placed on monitored storage pads pending shipment to the Waste Isolation Pilot Plant in New Mexico. A passive-active neutron (PAN) assay system is used to determine the mass of the radioactive material within the waste drums. Assay results are used to classify the wastes as either low-level or transuranic (TRU). During assays, the PAN assay system communicates with an IBM-AT computer. A Fortran computer program, called NEUT, controls and performs all data analyses. Unassisted, the NEUT program cannot adequately interpret assay results. To eliminate this limitation, an expert system shell was used to write a new algorithm, called the Transuranic Expert System (TRUX), to drive the NEUT program and add decision making capabilities for analysis of the assay results. The TRUX knowledge base was formulated by consulting with human experts in the field of neutron assay, by direct experimentation on the PAN assay system, and by observing operations on a daily basis. TRUX, with its improved ability to interpret assay results, has eliminated the need for close supervision by a human expert, allowing skilled technicians to operate the PAN assay system. 4 refs., 1 fig., 4 tabs

  16. Fuel reprocessing: Citizens' questions and experts' answers

    International Nuclear Information System (INIS)

    1982-10-01

    In connection with the intention of DWK to erect a fuel reprocessing plant in the Oberpfalz, citizens have asked a great number of questions which are of interest to the general public. They have been collected, grouped into subject categories and answered by experts. (orig./HSCH) [de

  17. Tribal Colleges: The Original Extreme Makeover Experts

    Science.gov (United States)

    Powless, Donna

    2015-01-01

    In this article, the author states "our experience with education is a prime example in proving we are experts at problem-solving and are the originators of the extreme makeover." Educational institutions were introduced to the Native people in an outrageous manner--often as a mask for assimilating American Indians, routinely resulting…

  18. Industrial disasters - the expert systems solution

    International Nuclear Information System (INIS)

    Sachs, P.

    1986-01-01

    Six mistakes by the operators led to the accident at the Cherobyl nuclear reactor. These have been studied. It is suggested that an expert systems approach could prevent similar accidents. The expert system is a new approach to software programming where programs are required to perform intelligent analyses of complex situations. It separates the knowledge of a problem from the procedural code that performs the decision. An expert system will evaluate data and indicate a priority on alarms in real time. Now software systems can detect the cause of a problem in a process plant and present their findings to the operators in the control room. This should enable operators to make the correct decisions as they will know which underlying process faults are causing the alarms to operate. The Chernobyl post-mortem meeting made 13 proposals for improving safety. Two in particular are noted as relevant to expert advice systems; international collaboration on man-reactor relationships and a conference to explore the balance of automation and human action to minimise operating errors. (U.K.)

  19. Expert Systems as a Mindtool To Facilitate Mental Model Learning.

    Science.gov (United States)

    Mason-Mason, Susan Dale; Tessmer, Martin A.

    2000-01-01

    This exploratory study investigated whether the process of constructing an expert system model promotes the formation of expert-like mental models. Discusses expert systems as mindtools, expert systems as learning tools, the assessment of mental models, results of pretests and posttests, and future research. (Contains 56 references.) (Author/LRW)

  20. The vulcain N expert fire system

    International Nuclear Information System (INIS)

    Roche, A.

    1989-03-01

    The Institute for Nuclear Safety and Protection (IPSN) has begun work on an expert system to aid in the diagnosis of fire hazards in nuclear installations. This system is called Vulcain N and is designed as a support tool for the analyses carried out by the IPSN. Vulcain N, is based on the Vulcain expert system already developed by Bertin for its own needs and incorporates the specific rules and know-how of the IPSN experts. The development of Vulcain N began in October 1986 with the drawing up of the technical specifications, and should be completed by the end of 1988. Vulcain N brings together knowledge from a number of different domains: the locations of the combustible materials, the thermal characteristics of the combustible materials and of the walls of the room, the ventilation conditions and, finally, knowledge of fire experts concerning the development of fire. The latter covers four levels of expert knowledge: standards and their associated calculations, the simplified physics of the fire enabling more precise values to be obtained for the figures given by the standards, the rules and knowledge which enables a certain number of deductions to be made concerning the development of the fire, and a numerical simulation code which can be used to monitor the variation of certain characteristic parameters with time. For a given fire out-break scenario, Vulcain N performs diagnosis of different aspects: development of fire, effect of ventilation, emergency action possibilities, propagation hazards, etc. Owing to its flexibility, it can be used in the analysis of fire hazards to simulate a number of possible scenarios and to very rapidly deduce the essential, predominant factors. It will also be used to assist in drafting emergency procedures for application in facilities with nuclear hazards

  1. REXS : A financial risk diagnostic expert system

    Directory of Open Access Journals (Sweden)

    W. Richter

    2012-01-01

    Full Text Available

    ENGLISH ABSTRACT: Artificial intelligence techniques are rapidly emerging as important contributors to more effective management. One of the greatest growth areas probably lies in the use of Expert System methodology for supporting managerial decision processes.
    Existing Decision Support Systems often attempt to apply analytical techniques in combination with traditional data access and retrieval functions. One of the problems usually encountered while developing such decision support systems is the need to transform an unstructured problem environment into a structured analytical model. Using an expert system approach to strategic decision making in such unstructured problem environments may provide significant advantages.
    The financial Risk diagnostic EXpert System (REXS concentrates on Financial Risk Analysis. Based on a Forecasting Model the system will, with the support of several expert system knowledge bases, attempt to evaluate the financial risk of a business and provide guidelines for improvement.

    AFRIKAANSE OPSOMMING: Tegnieke gebaseer op Kunsmatige Intelligensie toon tans die belofte om belangrike bydraes te maak tot meerBestaande Besluitsteunstelsels poog dikwels om analitiese tegnieke en lradisionele datatoegang- en onttrekkingsfunksies te kombineer. Een van die probleme wat gewoonlik ondervind word gedurende die ontwikkeling van '0 besluitsteunstelsel bestaan uit die behoefte om 'n ongestruktueerde probleemomgewing te transformeer na 'n gestruktueerde analitiese model. 'n Ekspertstelselbenadering lot strategiese besluitneming in 'n ongeSlruktureerde probleemomgewing mag betekenisvolle voordele inhou.
    Die "financial Risk diagnostic EXpert System (REXS" konsentreer op fmansiele risiko-analise. Uitgaande vanaf 'n Vooruitskattingsmode~ en deur gebruik te maak van verskeie ekspertstelselkennisbasisse, poog die stelsel om die fmansiele risiko van 'n onderneming te evalueer en riglyne vir moontlike verbetering

  2. Expert Coaching in Weight Loss: Retrospective Analysis.

    Science.gov (United States)

    Painter, Stefanie Lynn; Ahmed, Rezwan; Kushner, Robert F; Hill, James O; Lindquist, Richard; Brunning, Scott; Margulies, Amy

    2018-03-13

    Providing coaches as part of a weight management program is a common practice to increase participant engagement and weight loss success. Understanding coach and participant interactions and how these interactions impact weight loss success needs to be further explored for coaching best practices. The purpose of this study was to analyze the coach and participant interaction in a 6-month weight loss intervention administered by Retrofit, a personalized weight management and Web-based disease prevention solution. The study specifically examined the association between different methods of coach-participant interaction and weight loss and tried to understand the level of coaching impact on weight loss outcome. A retrospective analysis was performed using 1432 participants enrolled from 2011 to 2016 in the Retrofit weight loss program. Participants were males and females aged 18 years or older with a baseline body mass index of ≥25 kg/m², who also provided at least one weight measurement beyond baseline. First, a detailed analysis of different coach-participant interaction was performed using both intent-to-treat and completer populations. Next, a multiple regression analysis was performed using all measures associated with coach-participant interactions involving expert coaching sessions, live weekly expert-led Web-based classes, and electronic messaging and feedback. Finally, 3 significant predictors (Pcoaching session attendance (Pcoaching sessions, attending 60% of live weekly Web-based classes, and receiving a minimum of 1 food log feedback day per week were associated with clinically significant weight loss. Participant's one-on-one expert coaching session attendance, live weekly expert-led interactive Web-based class attendance, and the number of food log feedback days per week from expert coach were significant predictors of weight loss in a 6-month intervention. ©Stefanie Lynn Painter, Rezwan Ahmed, Robert F Kushner, James O Hill, Richard Lindquist, Scott

  3. Expert Coaching in Weight Loss: Retrospective Analysis

    Science.gov (United States)

    Kushner, Robert F; Hill, James O; Lindquist, Richard; Brunning, Scott; Margulies, Amy

    2018-01-01

    Background Providing coaches as part of a weight management program is a common practice to increase participant engagement and weight loss success. Understanding coach and participant interactions and how these interactions impact weight loss success needs to be further explored for coaching best practices. Objective The purpose of this study was to analyze the coach and participant interaction in a 6-month weight loss intervention administered by Retrofit, a personalized weight management and Web-based disease prevention solution. The study specifically examined the association between different methods of coach-participant interaction and weight loss and tried to understand the level of coaching impact on weight loss outcome. Methods A retrospective analysis was performed using 1432 participants enrolled from 2011 to 2016 in the Retrofit weight loss program. Participants were males and females aged 18 years or older with a baseline body mass index of ≥25 kg/m², who also provided at least one weight measurement beyond baseline. First, a detailed analysis of different coach-participant interaction was performed using both intent-to-treat and completer populations. Next, a multiple regression analysis was performed using all measures associated with coach-participant interactions involving expert coaching sessions, live weekly expert-led Web-based classes, and electronic messaging and feedback. Finally, 3 significant predictors (Pcoaching session attendance (Pcoaching sessions, attending 60% of live weekly Web-based classes, and receiving a minimum of 1 food log feedback day per week were associated with clinically significant weight loss. Conclusions Participant’s one-on-one expert coaching session attendance, live weekly expert-led interactive Web-based class attendance, and the number of food log feedback days per week from expert coach were significant predictors of weight loss in a 6-month intervention. PMID:29535082

  4. Influence of Professional Affiliation on Expert's View on Welfare Measures

    DEFF Research Database (Denmark)

    Dam Otten, Nina; Rousing, Tine; Forkman, Björn

    2017-01-01

    are not balanced in numbers of experts. At two time points (2012 and 2016), dairy cattle and swine experts from four different stakeholder groups, namely researchers (RES), production advisors (CONS), practicing veterinarians (VET) and animal welfare control officers (AWC) were asked to weigh eight different...... between expert groups among swine experts. Inter-expert differences were more pronounced for both species. The results highlight the challenges of using expert weightings in aggregated welfare assessment models, as the choice of expert affiliation may play a confounding role in the final aggregation due...

  5. Paradigms and building tools for real-time expert systems

    International Nuclear Information System (INIS)

    Behrens, U.; Flasinski, M.; Hagge, L.; Ohrenberg, K.

    1994-01-01

    An expert system is a software which can simulate the problem solving behavior of a human expert. The rule-based paradigm is chosen to describe the different aspects involved in expert system development. Differences between expert systems and common procedural or object-oriented programs are investigated. Expert system shells are introduced as a building tool for expert systems, together with some guidelines on the evaluation of such shells. A discussion of special needs for real-time expert system development concludes the paper

  6. Accelerator shielding experts meet at CERN

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    Fifteen years after its first CERN edition, the Shielding Aspects of Accelerator, Targets and Irradiation Facility (SATIF) conference was held again here from 2-4 June. Now at its 10th edition, SATIF10 brought together experts from all over the world to discuss issues related to the shielding techniques. They set out the scene for an improved collaboration and discussed novel shielding solutions.   This was the most attended meeting of the series with more than 65 participants from 34 institutions and 14 countries. “We welcomed experts from many different laboratories around the world. We come from different contexts but we face similar problems. In this year’s session, among other things, we discussed ways for improving the effectiveness of calculations versus real data, as well as experimental solutions to investigate the damage that radiation produces on various materials and the electronics”, says Marco Silari, Chair of the conference and member of the DGS/RP gro...

  7. Employing expert systems for process control

    International Nuclear Information System (INIS)

    Ahrens, W.

    1987-01-01

    The characteristic features of expert systems are explained in detail, and the systems' application in process control engineering. Four points of main interest are there, namely: Applications for diagnostic tasks, for safety analyses, planning, and training and expert training. For the modelling of the technical systems involved in all four task fields mentioned above, an object-centred approach has shown to be the suitable method, as process control techniques are determined by technical objects that in principle are specified by data sheets, schematic representations, flow charts, and plans. The graphical surface allows these data to be taken into account, so that the object can be displayed in the way best suited to the individual purposes. (orig./GL) [de

  8. The Expert Project Management System (EPMS)

    Science.gov (United States)

    Silverman, Barry G.; Diakite, Coty

    1986-01-01

    Successful project managers (PMs) have been shown to rely on 'intuition,' experience, and analogical reasoning heuristics. For new PMs to be trained and experienced PMs to avoid repeating others' mistakes, it is necessary to make the knowledge and heuristics of successful PMs more widely available. The preparers have evolved a model of PM thought processes over the last decade that is now ready to be implemented as a generic PM aid. This aid consists of a series of 'specialist' expert systems (CRITIC, LIBRARIAN, IDEA MAN, CRAFTSMAN, and WRITER) that communicate with each other via a 'blackboard' architecture. The various specialist expert systems are driven to support PM training and problem solving since any 'answers' they pass to the blackboard are subjected to conflict identification (AGENDA FORMULATOR) and GOAL SETTER inference engines.

  9. Spacecraft command and control using expert systems

    Science.gov (United States)

    Norcross, Scott; Grieser, William H.

    1994-01-01

    This paper describes a product called the Intelligent Mission Toolkit (IMT), which was created to meet the changing demands of the spacecraft command and control market. IMT is a command and control system built upon an expert system. Its primary functions are to send commands to the spacecraft and process telemetry data received from the spacecraft. It also controls the ground equipment used to support the system, such as encryption gear, and telemetry front-end equipment. Add-on modules allow IMT to control antennas and antenna interface equipment. The design philosophy for IMT is to utilize available commercial products wherever possible. IMT utilizes Gensym's G2 Real-time Expert System as the core of the system. G2 is responsible for overall system control, spacecraft commanding control, and spacecraft telemetry analysis and display. Other commercial products incorporated into IMT include the SYBASE relational database management system and Loral Test and Integration Systems' System 500 for telemetry front-end processing.

  10. Major dealers' expert power in distribution channels

    Directory of Open Access Journals (Sweden)

    Richard Chinomona

    2011-06-01

    Full Text Available The importance of major dealers’ expertise in distribution channels and effects on exchange relations is widely acknowledged by many SMEs in Africa and yet there seem to be a paucity of research on this matter. To address this dearth, the current study attempts to examine the impact of major dealers’ expert power on SME manufacturers’ channel cooperation and the mediating influence of their trust, relationship commitment and satisfaction. The conceptualized model and five hypotheses are empirically validated using a sample of 452 manufacturing SMEs in Zimbabwe. The findings indicate that major dealers’ expert power may influence SME manufacturers’ trust, relationship commitment, relationship satisfaction and channel cooperation in a significant way. Managerial implications of the research findings are provided.

  11. A way to the Photo Master Expert

    Science.gov (United States)

    Inagaki, Toshihiko

    After the author presided over the photographer's group for 15 years or more, the author met with the Photo Master certificate examination. And the author took the certificate examination, and was authorized as a Photo Master Expert in 2005. In this report, the outline how photographic technology has been mastered in order to adapt the photographer's group to the great change of photography from film to digital and how the contents of the activity of a photographer's group have changed is described. And the progress which took the Photo Master certificate examination as a good opportunity to prove the achievement level of those activities is described. And as a photographic activity after Photo Master Expert authorization, the shooting method of mural painting in the royal tomb of Amenophis III is described.

  12. Lay and expert perceptions of zoonotic risks

    DEFF Research Database (Denmark)

    Jensen, Karsten Klint; Lassen, Jesper; Robinson, P.

    2005-01-01

    As in many other areas, there is a divide between lay and expert perceptions of risk within the food sector, and this can lead to disagreement over priorities in food risk management. The risk perception literature tends to stress that the parties involved in this disagreement have different...... concepts of risk and hence are bound more or less to talk at cross-purposes. This paper suggests an alternative analysis: In the light of moral theory, the conflicting perspectives can be understood as a genuine moral conflict. When this conflict is conceptualised, a rational dialogue becomes possible....... The paper reports a series of qualitative interviews with lay people and experts on zoonotic food risks. The interviews are used to reconstruct the values underlying some of the dominant perspectives. The conflict between these stylised perspectives is then analysed with the help of moral theory. Finally...

  13. Developing Expert Tools for the LHC

    CERN Document Server

    AUTHOR|(CDS)2160780; Timkó, Helga

    2017-10-12

    This Thesis describes software tools developed for automated, precision setting-up of low-power level radio frequency (LLRF) loops, which will help expert users to have better control and faster setting-up of the radio-frequency (RF) system in the Large Hadron Collider (LHC) experiment. The aim was to completely redesign the software architecture, to add new features, to improve certain algorithms, and to increase the automation.

  14. Expert system for designing the manufacturing conditions

    International Nuclear Information System (INIS)

    Henin, F.

    1990-01-01

    The expert system TOTEM (French acronym for Material and Time Optimal Processing), used in computer aided manufacturing, is presented. The flow chart describing the TOTEM operation principles is given. The calculation rules which allow the optimization of the fabrication means are summarized. The steps of the TOTEM operations and an application example are included. TOTEM allows the standardization of the manufacturing specifications and takes into account technological improvements [fr

  15. Development of nickel hydrogen battery expert system

    Science.gov (United States)

    Shiva, Sajjan G.

    1990-01-01

    The Hubble Telescope Battery Testbed employs the nickel-cadmium battery expert system (NICBES-2) which supports the evaluation of performances of Hubble Telescope spacecraft batteries and provides alarm diagnosis and action advice. NICBES-2 also provides a reasoning system along with a battery domain knowledge base to achieve this battery health management function. An effort to modify NICBES-2 to accommodate nickel-hydrogen battery environment in testbed is described.

  16. The UK system of recognising qualified experts

    International Nuclear Information System (INIS)

    Bines, W.

    2002-01-01

    EURATOM Basic Safety Standards (BSS) Directives have long included requirements for the involvement of qualified experts, the definition of which has scarcely changed since at least 1976. The Directive requirement, in the definition of qualified expert,, for competent authorities to recognise the capacity to act as a qualified expert has been interpreted by Member States in widely differing ways, ranging from the minimalist or case by case to the highly detailed and prescriptive. In the United Kingdom (UK), the qualified expert for occupational radiation protection is the radiation protection adviser and the competent authority is the Health and Safety Executive (HSE). The Ionising Radiations Regulations 1985, which largely implemented the 1980 BSS Directive, required an employer to appoint one or more radiation protection advisers for the purpose of advising him as to the observance of these Regulations and other health and safety matters in connection with ionising radiation. The Regulations addressed the question of recognition by forbidding an employer to appoint a person as a radiation protection adviser unless: that person was suitably qualified and experienced; the employer had notified the Health and Safety Executive in writing of the intended appointment at least 28 days in advance, giving the name of the person and particulars of his qualifications and experience and the scope of the advice he would be required to give; and the employer had received from HSE an acknowledgement in writing of the notification. This system allowed HSE to follow up and query any apparently unsuitable potential appointments while applying a light overall administrative touch. The Approved Code of Practice supporting the Regulations included advice on the qualifications, experience and qualities that the employer should look for in a suitable radiation protection adviser

  17. Planning bioinformatics workflows using an expert system

    Science.gov (United States)

    Chen, Xiaoling; Chang, Jeffrey T.

    2017-01-01

    Abstract Motivation: Bioinformatic analyses are becoming formidably more complex due to the increasing number of steps required to process the data, as well as the proliferation of methods that can be used in each step. To alleviate this difficulty, pipelines are commonly employed. However, pipelines are typically implemented to automate a specific analysis, and thus are difficult to use for exploratory analyses requiring systematic changes to the software or parameters used. Results: To automate the development of pipelines, we have investigated expert systems. We created the Bioinformatics ExperT SYstem (BETSY) that includes a knowledge base where the capabilities of bioinformatics software is explicitly and formally encoded. BETSY is a backwards-chaining rule-based expert system comprised of a data model that can capture the richness of biological data, and an inference engine that reasons on the knowledge base to produce workflows. Currently, the knowledge base is populated with rules to analyze microarray and next generation sequencing data. We evaluated BETSY and found that it could generate workflows that reproduce and go beyond previously published bioinformatics results. Finally, a meta-investigation of the workflows generated from the knowledge base produced a quantitative measure of the technical burden imposed by each step of bioinformatics analyses, revealing the large number of steps devoted to the pre-processing of data. In sum, an expert system approach can facilitate exploratory bioinformatic analysis by automating the development of workflows, a task that requires significant domain expertise. Availability and Implementation: https://github.com/jefftc/changlab Contact: jeffrey.t.chang@uth.tmc.edu PMID:28052928

  18. Major dealers' expert power in distribution channels

    OpenAIRE

    Richard Chinomona; Marius Pretorius

    2011-01-01

    The importance of major dealers' expertise in distribution channels and effects on exchange relations is widely acknowledged by many SMEs in Africa and yet there seem to be a paucity of research on this matter. To address this dearth, the current study attempts to examine the relationship between major dealers' expert power and SME manufacturers' channel cooperation and the mediating influence of their trust, relationship commitment and satisfaction. The conceptualized model and five hypothes...

  19. Expert System Model for Educational Personnel Selection

    Directory of Open Access Journals (Sweden)

    Héctor A. Tabares-Ospina

    2013-06-01

    Full Text Available The staff selection is a difficult task due to the subjectivity that the evaluation means. This process can be complemented using a system to support decision. This paper presents the implementation of an expert system to systematize the selection process of professors. The management of software development is divided into 4 parts: requirements, design, implementation and commissioning. The proposed system models a specific knowledge through relationships between variables evidence and objective.

  20. Values and stances towards expert knowledge

    OpenAIRE

    Ahola, Salla

    2016-01-01

    Laypeople’s stances towards expert knowledge and the relationships of personal values to such stances are little studied and remain less than clear. The purpose of this dissertation was to shed more light on these stances and their relationships to personal values, and thereby to contribute to a greater understanding of them. More specifically, this study focusses on the readiness of laypeople to question experts’ views, their non-adherence to doctors’ instructions, and their preferences to ...

  1. Building America Expert Meeting. Combustion Safety

    Energy Technology Data Exchange (ETDEWEB)

    Brand, Larry [Partnership for Advanced Residential Retrofit (PARR), Des Plaines, IL (United States)

    2013-03-01

    This is an overview of "The Best Approach to Combustion Safety in a Direct Vent World," held June 28, 2012, in San Antonio, TX. The objective of this Expert Meeting was to identify gaps and barriers that need to be addressed by future research, and to develop data-driven technical recommendations for code updates so that a common approach for combustion safety can be adopted by all members of the building energy efficiency and code communities.

  2. Building America Expert Meeting: Combustion Safety

    Energy Technology Data Exchange (ETDEWEB)

    Brand, L.

    2013-03-01

    This is a meeting overview of 'The Best Approach to Combustion Safety in a Direct Vent World', held June 28, 2012, in San Antonio, Texas. The objective of this Expert Meeting was to identify gaps and barriers that need to be addressed by future research, and to develop data-driven technical recommendations for code updates so that a common approach for combustion safety can be adopted by all members of the building energy efficiency and code communities.

  3. An expert system for reward systems design.

    OpenAIRE

    Erturk, Alper

    2000-01-01

    Approved for public release; distribution is unlimited Today's business environment is a highly competitive marketplace. In this competition, organizations distribute numerous rewards to motivate, attract and retain employees, such as pay, fringe benefits and promotions. However, not all managers have the necessary knowledge and expertise to effectively decide and structure reward systems. This thesis presents an expert system to assist managers with designing the most appropriate reward s...

  4. 3D images and expert system

    International Nuclear Information System (INIS)

    Hasegawa, Jun-ichi

    1998-01-01

    This paper presents an expert system called 3D-IMPRESS for supporting applications of three dimensional (3D) image processing. This system can automatically construct a 3D image processing procedure based on a pictorial example of the goal given by a user. In the paper, to evaluate the performance of the system, it was applied to construction of procedures for extracting specific component figures from practical chest X-ray CT images. (author)

  5. Diagnostic expert system in the PF LINAC

    International Nuclear Information System (INIS)

    Abe, Isamu; Nakahara, Kazuo; Kitamura, Masaharu.

    1992-01-01

    A prototype diagnostic expert system (ES) was developed for the Photon Factory 2.5-GeV electron/positron LINAC injector system. The ES has been on-lined with the conventional linac computer network for receiving real data. This project was undertaken in an attempt to reduce the linac operator's mental workload, diagnosis duties, and to explore Artificial Intelligence (AI) technologies. The outlook for ES and its problems, and what has been achieved are outlined in this presentation. (author)

  6. Component aging evaluation with expert systems

    International Nuclear Information System (INIS)

    Wiesemann, J.S.; Maguire, H.T. Jr.

    1988-01-01

    The age degradation of components involves a complex relationship between a variety of variables. These relationships are typically modeled using probabilistic and deterministic analyses. These methods depend upon a formal understanding of the underlying degradation mechanisms and a database of experience which allows statistical analyses to extract numerical trends. At present, not all age degradation mechanisms are adequately modeled and available data for age degradation is in most cases insufficient. In addition, these methods tend to focus upon answers to isolated questions (e.g., What is the component failure rate?) rather than the more pertinent questions concerning operations and maintenance (e.g., should the component be replaced at the next outage). Fortunately, knowledge in the form of personal experience does exist which allows plant personnel to make decisions concerning operations and maintenance. This knowledge can be modeled using expert systems. This paper discusses CAGES (Component Aging Expert System). It combines expert rules (heuristics), probabilistic models, and deterministic models to make evaluations of component aging; predict the implications for component life extension, operational readiness, maintenance effectiveness, and safety, and make recommendations for maintenance and operation

  7. Fuzzy Expert System for Heart Attack Diagnosis

    Science.gov (United States)

    Hassan, Norlida; Arbaiy, Nureize; Shah, Noor Aziyan Ahmad; Afizah Afif@Afip, Zehan

    2017-08-01

    Heart attack is one of the serious illnesses and reported as the main killer disease. Early prevention is significant to reduce the risk of having the disease. The prevention efforts can be strengthen through awareness and education about risk factor and healthy lifestyle. Therefore the knowledge dissemination is needed to play role in order to distribute and educate public in health care management and disease prevention. Since the knowledge dissemination in medical is important, there is a need to develop a knowledge based system that can emulate human intelligence to assist decision making process. Thereby, this study utilized hybrid artificial intelligence (AI) techniques to develop a Fuzzy Expert System for Diagnosing Heart Attack Disease (HAD). This system integrates fuzzy logic with expert system, which helps the medical practitioner and people to predict the risk and as well as diagnosing heart attack based on given symptom. The development of HAD is expected not only providing expert knowledge but potentially become one of learning resources to help citizens to develop awareness about heart-healthy lifestyle.

  8. Expert systems for protective monitoring of facilities

    International Nuclear Information System (INIS)

    Carr, K.R.

    1987-01-01

    In complex plants, the possibility of serious operator error always exists to some extent, but, this can be especially true during an experiment or some other unusual exercise. Possible contributing factors to operational error include personnel fatigue, misunderstanding in communication, mistakes in executing orders, uncertainty about the delegated authority, pressure to meet a demanding schedule, and a lack of understanding of the possible consequences of deliberate violations of the facility's established operating procedures. Authoritative reports indicate that most of these factors were involved in the disastrous Russian Chernobyl-4 nuclear reactor accident in April 1986, which, ironically, occurred when a safety experiment was being conducted. Given the computer hardware and software now available for implementing expert systems together with integrated signal monitoring and communications, plant protection could be enhanced by an expert system with extended features to monitor the plant. The system could require information from the operators on a rigidly enforced schedule and automatically log in and report on a scheduled time basis to authorities at a central remote site during periods of safe operation. Additionally, the system could warn an operator or automatically shut down the plant in case of dangerous conditions, while simultaneously notifying independent, responsible, off-site personnel of the action taken. This approach would provide protection beyond that provided by typical facility scram circuits. This paper presents such an approach to implementing an expert system for plant protection, together with specific hardware and software configurations. The Chernobyl accident is used as the basis of discussion

  9. CHOOZ-A expert assessment program

    International Nuclear Information System (INIS)

    Bouat, M.; Godin, R.

    1993-01-01

    CHOOZ-A Nuclear Power Plant, the first French-Belgian PWR unit (300 MWe) was definitively shut down at the end of October 1991, after 24 years in operation. Since summer 1991, the steering committee of the French (EDF) Lifetime Project has initiated a large inquiry to the different technical specialists of EDF and external organizations, trying to define a wide expert assessment program on this plant. The aim is to improve the knowledge of aging mechanisms such as those observed on the 52 PWR French nuclear power plants (900 and 1,300 MWe), and contribute to the validation of non-destructive in-service testing methods. This paper presents the retained CHOOZ-A expert assessment program and technical lines followed during its set up. First major project stages are described, then technical choices are explained, and at last the final program is presented with the specific content of each expert assessment. The definitive program is scheduled for a three year period starting at the moment of final shutdown license acquisition, with a provisional total budget of more than US $10 million

  10. Expert communication link management: overview and progress

    Science.gov (United States)

    Dunkelberger, Kirk A.

    1998-08-01

    Consider the downsizing of our forces, the increasing complexity of our tactical platforms, and the ever widening array of communication options and the conclusion is inevitable. The need for automated support to reduce communication-related workload is critical to continued task force effectiveness. In a previous era, communication management expertise resided solely in the form of human experts. These experts flew with the pilots, providing the most effective means of communication in real time; they have since been removed from a great number of platforms due to force downsizing and real estate value in the cockpit. This burden has typically been shifted to the pilot, providing another set of tasks in an environment which is already far too taxing. An Expert Communication Link Manger (ECLM) is required -- a trusted, reliable assistant which can determine optimal link, channel, and waveform data for the communication requirements at hand and translate those requirements transparently into communication device control. Technologies are at hand which make ECLM possible; the mixture of these elements in the correct proportions can provide a capable, deployable, and cost effective ECLM in the near term. This paper describes specific applied ECLM research work in progress funded by the USAF under a four year effort. Operational objectives, technical objectives, a reference design, and technical excursions within the broad ECLM scope will be discussed in detail. Results of prototypes built to date in the area of communication inference from speech understanding, dynamic adaptive routing, and packet switching networks in the tactical environment will be presented.

  11. WWW expert system on producer gas cleaning

    Energy Technology Data Exchange (ETDEWEB)

    Schouten, E.J.; Lammers, G.; Beenackers, A.A.C.M. [University of Groningen (Netherlands)

    1999-07-01

    The University of Groningen (RUG) has developed an expert system on cleaning of biomass producer gas. This work was carried out in close co-operation with the Biomass Technology Group B.V. (BTG) in Enschede, The Netherlands within the framework of the EC supported JOR3-CT95-0084 project. The expert system was developed as a tool for the designer-engineer of downstream gas cleaning equipment and consists of an information package and a flowsheet package. The packages are integrated in a client/server system. The flowsheeting package of the expert system has been designed for the evaluation of different gas cleaning methods. The system contains a number of possible gas cleaning devices such as: cyclone, fabric filter, ceramic filter, venturi scrubber and catalytic cracker. The user can select up to five cleaning steps in an arbitrary order for his specific gas cleaning problem. After specification of the required design parameters, the system calculates the main design characteristics of the cleaning device. The information package is a collection of HTML{sup TM} files. It contains a large amount of information, tips, experience data, literature references and hyperlinks to other interesting Internet sites. This information is arranged per cleaning device. (orig.)

  12. Expert judgement combination using moment methods

    International Nuclear Information System (INIS)

    Wisse, Bram; Bedford, Tim; Quigley, John

    2008-01-01

    Moment methods have been employed in decision analysis, partly to avoid the computational burden that decision models involving continuous probability distributions can suffer from. In the Bayes linear (BL) methodology prior judgements about uncertain quantities are specified using expectation (rather than probability) as the fundamental notion. BL provides a strong foundation for moment methods, rooted in work of De Finetti and Goldstein. The main objective of this paper is to discuss in what way expert assessments of moments can be combined, in a non-Bayesian way, to construct a prior assessment. We show that the linear pool can be justified in an analogous but technically different way to linear pools for probability assessments, and that this linear pool has a very convenient property: a linear pool of experts' assessments of moments is coherent if each of the experts has given coherent assessments. To determine the weights of the linear pool we give a method of performance based weighting analogous to Cooke's classical model and explore its properties. Finally, we compare its performance with the classical model on data gathered in applications of the classical model

  13. Expert system application for prioritizing preventive actions for shift work: shift expert.

    Science.gov (United States)

    Esen, Hatice; Hatipoğlu, Tuğçen; Cihan, Ahmet; Fiğlali, Nilgün

    2017-09-19

    Shift patterns, work hours, work arrangements and worker motivations have increasingly become key factors for job performance. The main objective of this article is to design an expert system that identifies the negative effects of shift work and prioritizes mitigation efforts according to their importance in preventing these negative effects. The proposed expert system will be referred to as the shift expert. A thorough literature review is conducted to determine the effects of shift work on workers. Our work indicates that shift work is linked to demographic variables, sleepiness and fatigue, health and well-being, and social and domestic conditions. These parameters constitute the sections of a questionnaire designed to focus on 26 important issues related to shift work. The shift expert is then constructed to provide prevention advice at the individual and organizational levels, and it prioritizes this advice using a fuzzy analytic hierarchy process model, which considers comparison matrices provided by users during the prioritization process. An empirical study of 61 workers working on three rotating shifts is performed. After administering the questionnaires, the collected data are analyzed statistically, and then the shift expert produces individual and organizational recommendations for these workers.

  14. PSG-EXPERT. An expert system for the diagnosis of sleep disorders.

    Science.gov (United States)

    Fred, A; Filipe, J; Partinen, M; Paiva, T

    2000-01-01

    This paper describes PSG-EXPERT, an expert system in the domain of sleep disorders exploring polysomnographic data. The developed software tool is addressed from two points of view: (1)--as an integrated environment for the development of diagnosis-oriented expert systems; (2)--as an auxiliary diagnosis tool in the particular domain of sleep disorders. Developed over a Windows platform, this software tool extends one of the most popular shells--CLIPS (C Language Integrated Production System) with the following features: backward chaining engine; graph-based explanation facilities; knowledge editor including a fuzzy fact editor and a rules editor, with facts-rules integrity checking; belief revision mechanism; built-in case generator and validation module. It therefore provides graphical support for knowledge acquisition, edition, explanation and validation. From an application domain point of view, PSG-Expert is an auxiliary diagnosis system for sleep disorders based on polysomnographic data, that aims at assisting the medical expert in his diagnosis task by providing automatic analysis of polysomnographic data, summarising the results of this analysis in terms of a report of major findings and possible diagnosis consistent with the polysomnographic data. Sleep disorders classification follows the International Classification of Sleep Disorders. Major features of the system include: browsing on patients data records; structured navigation on Sleep Disorders descriptions according to ASDA definitions; internet links to related pages; diagnosis consistent with polysomnographic data; graphical user-interface including graph-based explanatory facilities; uncertainty modelling and belief revision; production of reports; connection to remote databases.

  15. Expert Oracle Application Express Plug-Ins

    CERN Document Server

    D'Souza, Martin Giffy

    2011-01-01

    Expert Oracle Application Express Plugins is your "go to" book on the groundbreaking plugin architecture introduced in Oracle Application Express 4.0. Using the new APEX functionality, you can create well-packaged, documented, reusable components and reliably leverage your coding investments across many applications. Components you create can define new item and region types, specify validation processes, and present dynamic actions to client applications. You can design innovative and colorful ways to display information, such as displaying the temperature using an image of a thermometer, or

  16. Risk perception: expert opinion versus public understanding

    International Nuclear Information System (INIS)

    Brown, Jennifer

    1987-01-01

    A research project looking at the public's attitudes towards the siting of radioactive waste depositories is reported. The risk perception studies seek to compare expert and lay understanding of risk. Adverse public reactions to risk can only be understood if it is known how people relate to risks in their everyday or working lives. Social trends and experiences are important, for example, the adverse public opinion on the siting of nuclear waste facilities. A number of elements have been identified as common to different risk areas such as chemicals, drugs, food or radioactive waste. These are the clashing of values, polarization of beliefs or clashes of interest. (UK)

  17. Experts' discussion on reactor safety research

    International Nuclear Information System (INIS)

    1980-01-01

    The experts' discussion on reactor safety research deals with risk analysis, political realization, man and technics, as well as with the international state of affairs. Inspite of a controversy on individual issues and on the proportion of governmental and industrial involvment in reactor safety research, the continuation and intensification of corresponding research work is said to be necessary. Several participants demanded to consider possible 'conventional accidents' as well as a stronger financial commitment by the industry in this sector. The ratio 'man and technics' being an interface decisive for the proper functioning or failure of complex technical systems requires even more research work to be done. (GL) [de

  18. Nuclear expert web search and crawler algorithm

    International Nuclear Information System (INIS)

    Reis, Thiago; Barroso, Antonio C.O.; Baptista, Benedito Filho D.

    2013-01-01

    In this paper we present preliminary research on web search and crawling algorithm applied specifically to nuclear-related web information. We designed a web-based nuclear-oriented expert system guided by a web crawler algorithm and a neural network able to search and retrieve nuclear-related hyper textual web information in autonomous and massive fashion. Preliminary experimental results shows a retrieval precision of 80% for web pages related to any nuclear theme and a retrieval precision of 72% for web pages related only to nuclear power theme. (author)

  19. SEPI an expert system for plant design

    International Nuclear Information System (INIS)

    Carotenuto, M.; Corleto, P.; Landeyro, P.

    1988-01-01

    The availability and suitability of technological information is of great importance in every kind of design task, especially when safety and reliability considerations are involved. In this paper an ''expert system for plant design'' (SEPI), is presented, together with its first application to nuclear back-end plants. This system is available on ENEA computer network. It is thought to be used both to collect know-how developed in the field and to assist unskilled designers during selection, evaluation and dimensioning tasks. It attemps to reproduce the normal way of ''reasoning'' and acting, and provides some graphic facilities

  20. Interactions of experts and the public

    International Nuclear Information System (INIS)

    Young, P.

    1986-01-01

    When a radiation emergency occurs media people will respond. The people in the press are the conduit to the public; they provide information. When there is a major tragedy, people instantly turn to the press. However, reporters are not experts in the field of radiation and they are going to bring a great diversity of backgrounds, technical understanding, perception, and their own fears to any story involving a radiation release. Therefore, when any organization has to deal with the media, an informational structure staffed by knowledgeable people is needed in advance to provide timely and accurate information

  1. Nuclear expert web search and crawler algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Thiago; Barroso, Antonio C.O.; Baptista, Benedito Filho D., E-mail: thiagoreis@usp.br, E-mail: barroso@ipen.br, E-mail: bdbfilho@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    In this paper we present preliminary research on web search and crawling algorithm applied specifically to nuclear-related web information. We designed a web-based nuclear-oriented expert system guided by a web crawler algorithm and a neural network able to search and retrieve nuclear-related hyper textual web information in autonomous and massive fashion. Preliminary experimental results shows a retrieval precision of 80% for web pages related to any nuclear theme and a retrieval precision of 72% for web pages related only to nuclear power theme. (author)

  2. WES: A well test analysis expert system

    International Nuclear Information System (INIS)

    Mensch, A.

    1988-06-01

    This report describes part of the development of an expert system in the domain of well-test analysis. This work has been done during my final internship, completed at the Lawrence Berkeley Laboratory. The report is divided in three parts: the first one gives a description of the state of the project at the time I first began to work on it, and raises some problems that have to be solved. The second section shows the results that have been reached, and the last one draws conclusions from these results and proposes extensions that would be useful in the future

  3. Steam Generator Inspection Planning Expert System

    International Nuclear Information System (INIS)

    Rzasa, P.

    1987-01-01

    Applying Artificial Intelligence technology to steam generator non-destructive examination (NDE) can help identify high risk locations in steam generators and can aid in preparing technical specification compliant eddy current test (ECT) programs. A steam Generator Inspection Planning Expert System has been developed which can assist NDE or utility personnel in planning ECT programs. This system represents and processes its information using an object oriented declarative knowledge base, heuristic rules, and symbolic information processing, three artificial intelligence based techniques incorporated in the design. The output of the system is an automated generation of ECT programs. Used in an outage inspection, this system significantly reduced planning time

  4. The Study of Expert System Utilization for the Accelerator Operation

    International Nuclear Information System (INIS)

    Budi-Santosa; Slamet-Santosa; Subari-Santosa

    2000-01-01

    The utilization of expert system in the accelerator laboratory has been studied. The study covers the utilization of expert system in the setting up experiment (tuning parameter), controlling system, safety or warning system. The results study shows, that using the expert system in the accelerator would be easy to operate the accelerator for user and operator. Increasing the skill of expert system could be updated without logical mechanism modification. (author)

  5. Expert Graphics System Research in the Department of the Navy.

    Science.gov (United States)

    Duff, Jon M.

    1987-01-01

    Presents current trends in the development of expert systems within the Department of the Navy, particularly research into expert graphics systems intended to support the Authoring Instructional Methods (AIM) research project. Defines artificial intelligence and expert systems. Discusses the operations and functions of the Navy's intelligent…

  6. 21 CFR 516.141 - Qualified expert panels.

    Science.gov (United States)

    2010-04-01

    ... choose members for the qualified expert panel in accordance with selection criteria listed in paragraph... whether the proposed qualified expert panel meets the selection criteria prior to the panel beginning its... Committee Act, as amended, 5 U.S.C. App. (b) Criteria for the selection of a qualified expert panel. (1) A...

  7. Criteria for the CAREM reactor's expert system design conduction

    International Nuclear Information System (INIS)

    Furman, A.; Delgado, R.

    1990-01-01

    The present work describes the analysis made to start with the development of an Expert System for the CAREM (SE) reactor's conduction. The following tasks are presented: a) purpose of the Expert System; b) Decision Making structure; c) Architecture of the Expert System; d) Description of Subsystems and e) Licensing. (Author) [es

  8. Expert Systems: A Challenge for the Reading Profession.

    Science.gov (United States)

    Balajthy, Ernest

    The expert systems are designed to imitate the reasoning of a human expert in a content area field. Designed to be advisors, these software systems combine the content area knowledge and decision-making ability of an expert with the user's understanding and knowledge of particular circumstances. The reading diagnosis system, the RD2P System…

  9. The Most Quoted Danish Economic Expert and the Welfare State

    DEFF Research Database (Denmark)

    Madsen, Poul Thøis

    It is well-known that economic experts (as well as other experts) are biased. However, it is not normally demonstrated systematically. By identifying and analyzing the viewpoints of the most quoted Danish expert on five characteristic debates bias is demonstrated. The character of the bias...

  10. Information Retrieval Diary of an Expert Technical Translator.

    Science.gov (United States)

    Cremmins, Edward T.

    1984-01-01

    Recommends use of entries from the information retrieval diary of Ted Crump, expert technical translator at the National Institute of Health, in the construction of computer models showing how expert translators solve problems of ambiguity in language. Expert and inexpert translation systems, eponyms, abbreviations, and alphabetic solutions are…

  11. An Analysis of the Working Memories of Expert Sport Instructors

    Science.gov (United States)

    McCullick, Bryan; Schempp, Paul; Hsu, Shan-Hui; Jung, Jin Hong; Vickers, Brad; Schuknecht, Greg

    2006-01-01

    A distinguishing characteristic of expert teachers appears to be an excellent memory (Berliner, 1986; Tan, 1997). Possessing an excellent memory aids experts in building a substantial knowledge base relative to teaching and learning. Despite its importance, the memory skills of expert teachers have yet to be investigated. Therefore, the purpose of…

  12. Expert Review of Pedagogical Activities at Therapeutic Recreation Camps

    Science.gov (United States)

    Kiselev, N. N.; Kiseleva, E. V.

    2015-01-01

    An analysis of pedagogical expert reviews at children's therapeutic recreation camps in Novosibirsk Region shows that it is necessary to implement an expert review system that plays a supporting and developmental role. Such a system should allow teams of teachers to submit their work to expert review and to move forward by reflecting on their…

  13. System control module diagnostic Expert Assistant

    Science.gov (United States)

    Flores, Luis M.; Hansen, Roger F.

    1990-01-01

    The Orbiter EXperiments (OEX) Program was established by NASA's Office of Aeronautics and Space Technology (OAST) to accomplish the precise data collection necessary to support a complete and accurate assessment of Space Transportation System (STS) Orbiter performance during all phases of a mission. During a mission, data generated by the various experiments are conveyed to the OEX System Control Module (SCM) which arranges for and monitors storage of the data on the OEX tape recorder. The SCM Diagnostic Expert Assistant (DEA) is an expert system which provides on demand advice to technicians performing repairs of a malfunctioning SCM. The DEA is a self-contained, data-driven knowledge-based system written in the 'C' Language Production System (CLIPS) for a portable micro-computer of the IBM PC/XT class. The DEA reasons about SCM hardware faults at multiple levels; the most detailed layer of encoded knowledge of the SCM is a representation of individual components and layouts of the custom-designed component boards.

  14. Network approaches for expert decisions in sports.

    Science.gov (United States)

    Glöckner, Andreas; Heinen, Thomas; Johnson, Joseph G; Raab, Markus

    2012-04-01

    This paper focuses on a model comparison to explain choices based on gaze behavior via simulation procedures. We tested two classes of models, a parallel constraint satisfaction (PCS) artificial neuronal network model and an accumulator model in a handball decision-making task from a lab experiment. Both models predict action in an option-generation task in which options can be chosen from the perspective of a playmaker in handball (i.e., passing to another player or shooting at the goal). Model simulations are based on a dataset of generated options together with gaze behavior measurements from 74 expert handball players for 22 pieces of video footage. We implemented both classes of models as deterministic vs. probabilistic models including and excluding fitted parameters. Results indicated that both classes of models can fit and predict participants' initially generated options based on gaze behavior data, and that overall, the classes of models performed about equally well. Early fixations were thereby particularly predictive for choices. We conclude that the analyses of complex environments via network approaches can be successfully applied to the field of experts' decision making in sports and provide perspectives for further theoretical developments. Copyright © 2011 Elsevier B.V. All rights reserved.

  15. Rotating Machinery Predictive Maintenance Through Expert System

    Directory of Open Access Journals (Sweden)

    M. Sarath Kumar

    2000-01-01

    Full Text Available Modern rotating machines such as turbomachines, either produce or absorb huge amount of power. Some of the common applications are: steam turbine-generator and gas turbine-compressor-generator trains produce power and machines, such as pumps, centrifugal compressors, motors, generators, machine tool spindles, etc., are being used in industrial applications. Condition-based maintenance of rotating machinery is a common practice where the machine's condition is monitored constantly, so that timely maintenance can be done. Since modern machines are complex and the amount of data to be interpreted is huge, we need precise and fast methods in order to arrive at the best recommendations to prevent catastrophic failure and to prolong the life of the equipment. In the present work using vibration characteristics of a rotor-bearing system, the condition of a rotating machinery (electrical rotor is predicted using an off-line expert system. The analysis of the problem is carried out in an Object Oriented Programming (OOP framework using the finite element method. The expert system which is also developed in an OOP paradigm gives the type of the malfunctions, suggestions and recommendations. The system is implemented in C++.

  16. A demonstration of expert systems applications in transportation engineering : volume III, evaluation of the prototype expert system TRANZ.

    Science.gov (United States)

    1990-01-01

    The validation and evaluation of an expert system for traffic control in highway work zones (TRANZ) is described. The stages in the evaluation process consisted of the following: revisit the experts, selectively distribute copies of TRANZ with docume...

  17. Concept of expert system for modal split in transportation planning

    Directory of Open Access Journals (Sweden)

    Popović Maja M.

    2006-01-01

    Full Text Available The objective of this paper is to develop a concept of expert system based on the survey of experts' opinions and their experience concerning relations in modal split, on the basis of parameters of transport system demand and transport supply, defined through PT travel time and city size, i.e. mean trip length. This expert system could be of use both to experts and less experienced planners who could apply the knowledge contained in this expert system for further improvement, on operational as well as on strategic level.

  18. A study on expert system applications for nuclear power plant

    International Nuclear Information System (INIS)

    Huh, Young Hwan; Kim, Yeong Jin; Park, Nam Seog; Dong, In Sook; Choi, In Seon

    1987-12-01

    The application of artificial intelligence techniques to nuclear power plants such as expert systems is rapidly emerging. expert systems can contribute significantly to the availability and the improved operation and safety of nuclear power plants. The objective of the project is to develop an expert system in a selected application area in the nuclear power plants. This project will last for 3 years. The first year's tasks are: - Information collection and literature survey on expert systems. - Analysis of several applicable areas for applying AI technologies to the nuclear power plants. - Conceptual design of a few selected domains. - Selection of hardware and software tools for the development of the expert system

  19. Preparing Principals as Instructional Leaders: Perceptions of University Faculty, Expert Principals, and Expert Teacher Leaders

    Science.gov (United States)

    Taylor Backor, Karen; Gordon, Stephen P.

    2015-01-01

    Although research has established links between the principal's instructional leadership and student achievement, there is considerable concern in the literature concerning the capacity of principal preparation programs to prepare instructional leaders. This study interviewed educational leadership faculty as well as expert principals and teacher…

  20. From expert witness to defendant: abolition of expert witness protection and its implications.

    Science.gov (United States)

    Mendelson, Danuta

    2012-12-01

    In Jones v Kaney [2011] 2 AC 398, the United Kingdom Supreme Court held that in England and Wales (but not in Scotland), clients can sue expert witnesses in negligence and/or contract for work performed under their retainer, whether in civil or criminal trials. The duties of expert witnesses in England are regulated by the Civil Procedure Rules and Protocols; the former also regulate the conduct of cases involving expert opinions. The legal context that led to the litigation is examined in the light of these rules, in particular, the nature of the allegations against Dr Kaney, a psychologist retained to provide psychiatric opinion. Jones v Kaney, as a decision of the United Kingdom Supreme Court, is not a binding precedent in Australia. However, unlike statutory enactments, common law judgments are retrospective in their operation, which means that health care practitioners who follow a generally accepted practice today may still be sued for damages by their patients or clients in the future. By definition, the future, including the refusal by the Australian High Court to follow Kaney's abolition of expert witnesses' immunity from suit for breach of duty to their clients, cannot be predicted with certainty. Consequently, health care practitioners in Australia and other countries should be aware of the case, its jurisprudential and practical ramifications.

  1. Mind the Gaps: Expert and Non-Expert Differences in Conceptualising the Geological Subsurface.

    Science.gov (United States)

    Gibson, H.; Stewart, I. S.; Stokes, A.; Pahl, S.

    2017-12-01

    In communicating geoscience topics, emphasis is often given to approaches such as the use of narrative to make a message engaging and reducing the use of jargon to ensure that it is understood by as wide a group of people as possible. Whilst these are undeniably important techniques to promote effective communication, an aspect of geoscience communication that is often overlooked is the publics' conceptual frameworks about core geoscience concepts. The consideration of different conceptual frameworks fits with the need to ensure that the framing is appropriate for the message, but it extends beyond simple framing into more complicated issues of addressing and incorporating pre- and mis-conceptions in geoscience. In a study examining expert and non-expert cognitive (mental) models of the geological subsurface in south-west England, several gaps were found between the fundamental ways that experts and non-experts conceptualise this invisible realm. Of these, three gaps were considered to be particularly important and common to many participants: the use of spatial reasoning; the application of surface experiences to subsurface processes; and the connection between the surface and subsurface. This paper will examine the evidence for these three important conceptual gaps between specialists and non-specialists and will address how this type of cognitive study can help improve effective geoscience communication.

  2. ART-Ada: An Ada-based expert system tool

    Science.gov (United States)

    Lee, S. Daniel; Allen, Bradley P.

    1991-01-01

    The Department of Defense mandate to standardize on Ada as the language for software systems development has resulted in increased interest in making expert systems technology readily available in Ada environments. NASA's Space Station Freedom is an example of the large Ada software development projects that will require expert systems in the 1990's. Another large scale application that can benefit from Ada based expert system tool technology is the Pilot's Associate (PA) expert system project for military combat aircraft. Automated Reasoning Tool (ART) Ada, an Ada Expert system tool is described. ART-Ada allow applications of a C-based expert system tool called ART-IM to be deployed in various Ada environments. ART-Ada is being used to implement several prototype expert systems for NASA's Space Station Freedom Program and the U.S. Air Force.

  3. Accuracy and interobserver agreement between MR-non-expert radiologists and MR-experts in reading MRI for suspected appendicitis

    Energy Technology Data Exchange (ETDEWEB)

    Leeuwenburgh, Marjolein M.N., E-mail: m.m.leeuwenburgh@amc.uva.nl [Department of Surgery, Academic Medical Center, University of Amsterdam (Netherlands); Department of Radiology, Academic Medical Center, University of Amsterdam (Netherlands); Wiarda, Bart M. [Department of Radiology, Alkmaar Medical Center, Alkmaar (Netherlands); Jensch, Sebastiaan [Department of Radiology, Sint Lucas Andreas Hospital, Amsterdam (Netherlands); Wouter van Es, H. [Department of Radiology, Sint Antonius Hospital, Nieuwegein (Netherlands); Stockmann, Hein B.A.C. [Department of Surgery, Kennemer Gasthuis, Haarlem (Netherlands); Gratama, Jan Willem C. [Department of Radiology, Gelre Hospitals, Apeldoorn (Netherlands); Cobben, Lodewijk P.J. [Department of Radiology, Haaglanden Medical Center, Leidschendam (Netherlands); Bossuyt, Patrick M.M. [Department of Clinical Epidemiology, Academic Medical Center, University of Amsterdam (Netherlands); Boermeester, Marja A. [Department of Surgery, Academic Medical Center, University of Amsterdam (Netherlands); Stoker, Jaap [Department of Radiology, Academic Medical Center, University of Amsterdam (Netherlands)

    2014-01-15

    Objective: To compare accuracy and interobserver agreement between radiologists with limited experience in the evaluation of abdominal MRI (non-experts), and radiologists with longer MR reading experience (experts), in reading MRI in patients with suspected appendicitis. Methods: MR imaging was performed in 223 adult patients with suspected appendicitis and read independently by two members of a team of eight MR-inexperienced radiologists, who were trained with 100 MR examinations previous to this study (non-expert reading). Expert reading was performed by two radiologists with a larger abdominal MR experience (>500 examinations) in consensus. A final diagnosis was assigned after three months based on all available information, except MRI findings. We estimated MRI sensitivity and specificity for appendicitis and for all urgent diagnoses separately. Interobserver agreement was evaluated using kappa statistics. Results: Urgent diagnoses were assigned to 147 of 223 patients; 117 had appendicitis. Sensitivity for appendicitis was 0.89 by MR-non-expert radiologists and 0.97 in MR-expert reading (p = 0.01). Specificity was 0.83 for MR-non-experts versus 0.93 for MR-expert reading (p = 0.002). MR-experts and MR-non-experts agreed on appendicitis in 89% of cases (kappa 0.78). Accuracy in detecting urgent diagnoses was significantly lower in MR-non-experts compared to MR-expert reading: sensitivity 0.84 versus 0.95 (p < 0.001) and specificity 0.71 versus 0.82 (p = 0.03), respectively. Agreement on urgent diagnoses was 83% (kappa 0.63). Conclusion: MR-non-experts have sufficient sensitivity in reading MRI in patients with suspected appendicitis, with good agreement with MR-expert reading, but accuracy of MR-expert reading was higher.

  4. Accuracy and interobserver agreement between MR-non-expert radiologists and MR-experts in reading MRI for suspected appendicitis

    International Nuclear Information System (INIS)

    Leeuwenburgh, Marjolein M.N.; Wiarda, Bart M.; Jensch, Sebastiaan; Wouter van Es, H.; Stockmann, Hein B.A.C.; Gratama, Jan Willem C.; Cobben, Lodewijk P.J.; Bossuyt, Patrick M.M.; Boermeester, Marja A.; Stoker, Jaap

    2014-01-01

    Objective: To compare accuracy and interobserver agreement between radiologists with limited experience in the evaluation of abdominal MRI (non-experts), and radiologists with longer MR reading experience (experts), in reading MRI in patients with suspected appendicitis. Methods: MR imaging was performed in 223 adult patients with suspected appendicitis and read independently by two members of a team of eight MR-inexperienced radiologists, who were trained with 100 MR examinations previous to this study (non-expert reading). Expert reading was performed by two radiologists with a larger abdominal MR experience (>500 examinations) in consensus. A final diagnosis was assigned after three months based on all available information, except MRI findings. We estimated MRI sensitivity and specificity for appendicitis and for all urgent diagnoses separately. Interobserver agreement was evaluated using kappa statistics. Results: Urgent diagnoses were assigned to 147 of 223 patients; 117 had appendicitis. Sensitivity for appendicitis was 0.89 by MR-non-expert radiologists and 0.97 in MR-expert reading (p = 0.01). Specificity was 0.83 for MR-non-experts versus 0.93 for MR-expert reading (p = 0.002). MR-experts and MR-non-experts agreed on appendicitis in 89% of cases (kappa 0.78). Accuracy in detecting urgent diagnoses was significantly lower in MR-non-experts compared to MR-expert reading: sensitivity 0.84 versus 0.95 (p < 0.001) and specificity 0.71 versus 0.82 (p = 0.03), respectively. Agreement on urgent diagnoses was 83% (kappa 0.63). Conclusion: MR-non-experts have sufficient sensitivity in reading MRI in patients with suspected appendicitis, with good agreement with MR-expert reading, but accuracy of MR-expert reading was higher

  5. An expert system for automated robotic grasping

    International Nuclear Information System (INIS)

    Stansfield, S.A.

    1990-01-01

    Many US Department of Energy sites and facilities will be environmentally remediated during the next several decades. A number of the restoration activities (e.g., decontamination and decommissioning of inactive nuclear facilities) can only be carried out by remote means and will be manipulation-intensive tasks. Experience has shown that manipulation tasks are especially slow and fatiguing for the human operator of a remote manipulator. In this paper, the authors present a rule-based expert system for automated, dextrous robotic grasping. This system interprets the features of an object to generate hand shaping and wrist orientation for a robot hand and arm. The system can be used in several different ways to lessen the demands on the human operator of a remote manipulation system - either as a fully autonomous grasping system or one that generates grasping options for a human operator and then automatically carries out the selected option

  6. Lay and Expert Perceptions of Planetary Protection

    Science.gov (United States)

    Race, Margaret S.; MacGregor, Donald G.; Slovic, Paul

    2000-01-01

    As space scientists and engineers plan new missions to Mars and other planets in our solar system, they will face critical questions about the potential for biological contamination of planetary surfaces. In a society that places ever-increasing importance on the role of public involvement in science and technology policy, questions about risks of biological contamination will be examined and debated in the media, and will lead to the formation of public perceptions of planetary-contamination risks. These perceptions will, over time, form an important input to the development of space policy. Previous research in public and expert perceptions of technological risks and hazards has shown that many of the problems faced by risk-management organizations are the result of differing perceptions of risk (and risk management) between the general public and scientific and technical experts. These differences manifest themselves both as disagreements about the definition (and level) of risk associated with a scientific, technological or industrial enterprise, and as distrust about the ability of risk-management organizations (both public and private) to adequately protect people's health and safety. This report presents the results of a set of survey studies designed to reveal perceptions of planetary exploration and protection from a wide range of respondents, including both members of the general public and experts in the life sciences. The potential value of this research lies in what it reveals about perceptions of risk and benefit that could improve risk-management policies and practices. For example, efforts to communicate with the public about Mars sample return missions could benefit from an understanding of the specific concerns that nonscientists have about such a mission by suggesting areas of potential improvement in public education and information. Assessment of both public and expert perceptions of risk can also be used to provide an advanced signal of

  7. How patent experts create patent breadth

    DEFF Research Database (Denmark)

    Beukel, Karin

    2014-01-01

    Science as an input to patented inventions is a fundamental of economic growth. However, our understanding of how science is transformed into patents is limited. In the present paper I seek to fill this gap by examining the micro-foundations of science-patent transformations. Using an inductive......, grounded theory approach to study the transformation of 12 scientific discoveries into patents I recast the relationship between science and patents: I show it as a particular process that affects patent breadth. Exploiting surplus patent breadth depends on the processes of abstraction and cognitive...... variety, which can be mobilized by patenting experts. The theory is tested using a recently published algebraic interpretive method for examining causal relationships in small-N studies....

  8. How patent experts create patent breadth

    DEFF Research Database (Denmark)

    Beukel, Karin

    2018-01-01

    Science as an input to patented inventions is a fundamental of economic growth. However, our understanding of how science is transformed into patents is limited. In the present paper I seek to fill this gap by examining the micro-foundations of science-patent transformations. Using an inductive......, grounded theory approach to study the transformation of 12 scientific discoveries into patents I recast the relationship between science and patents: I show it as a particular process that affects patent breadth. Exploiting surplus patent breadth depends on the processes of abstraction and cognitive...... variety, which can be mobilized by patenting experts. The theory is tested using a recently published algebraic interpretive method for examining causal relationships in small-N studies....

  9. An Expert System for Concrete Bridge Management

    DEFF Research Database (Denmark)

    Brito, J. de; Branco, F. A.; Thoft-Christensen, Palle

    1997-01-01

    The importance of bridge repair versus new bridge construction has risen in recent decades due to high deterioration rates that have been observed in these structures. Budgets both for building new bridges and keeping the existing ones are always limited. To help rational decision-making, bridge...... management systems are presently being implemented by bridge authorities in several countries. The prototype of an expert system for concrete bridge management is presented in this paper, with its functionality relying on two modules. The inspection module relies on a periodic acquisition of field...... information complemented by a knowledge-based interactive system, BRIDGE-1. To optimize management strategies at the headquarters, the BRIDGE-2 module was implemented, including three submodules: inspection strategy, maintenance and repair....

  10. An expert system for microbiologically influenced corrosion

    International Nuclear Information System (INIS)

    Carney, C.E.; Licina, G.J.

    1991-01-01

    Microbiologically Influenced Corrosion (MIC) is a damage mechanism that can cause serious degradation of service water system components. MIC can be particularly insidious since damage can occur very quickly, even in environments otherwise resistant to corrosion. Plant operations or maintenance personnel or system engineers typically do not have sufficient expertise to predict when and where MIC may occur or what methods of treatment are effective. An expert system (MICPro) has been devised which provides a tool for utilities to predict where MIC will occur, which systems or components are most susceptible, how operating parameters may affect vulnerability, and how to implement corrective and preventative measures. The system is designed to be simple to use: required inputs are common system parameters and results are presented as numbers from 1 to 10 indicating the likelihood of damage due to the given input. In this paper the structure and operation of the system is described, and future refinements are discussed

  11. IAEA Expert Team Returns from Iran

    International Nuclear Information System (INIS)

    2012-01-01

    Full text: A senior IAEA expert team is returning from Iran after two days of discussions with Iranian officials held on 20 and 21 February 2012. The meeting followed previous discussions held on 29 to 31 January 2012. During both the first and second round of discussions, the Agency team requested access to the military site at Parchin. Iran did not grant permission for this visit to take place. Intensive efforts were made to reach agreement on a document facilitating the clarification of unresolved issues in connection with Iran's nuclear programme, particularly those relating to possible military dimensions. Unfortunately, agreement was not reached on this document. 'It is disappointing that Iran did not accept our request to visit Parchin during the first or second meetings', IAEA Director General Yukiya Amano said. 'We engaged in a constructive spirit, but no agreement was reached'. (IAEA)

  12. An on-line diagnostic expert system

    International Nuclear Information System (INIS)

    Felkel, L.

    1987-01-01

    As experience with on-line information systems, experts systems and artificial intelligence tools grows, the authors retreat from the first euphoria that AI could help them solve the problem they were unable to solve with conventional programming. The major effort of the development time goes into building the knowledge-base. There is no such thing as a generic knowledge-base for nuclear power plants as there is, for example, for the diagnosis of a Boeing 747 aircraft. AI-methods, tools and hardware are still in a state which does not optimally lend itself to real-time application. The ability of developing prototype systems to investigate variants otherwise too costly to justify is one advantage that the authors gladly accept. Last, but no least the tools provide a flexible and adaptable user interface (desktop window systems) etc. The development of such tools in a project would be prohibitive and room for experimentation would be limited

  13. Expert systems and optimisation in process control

    International Nuclear Information System (INIS)

    Mamdani, A.; Efstathiou, J.

    1986-01-01

    This report brings together recent developments both in expert systems and in optimisation, and deals with current applications in industry. Part One is concerned with Artificial Intellegence in planning and scheduling and with rule-based control implementation. The tasks of control maintenance, rescheduling and planning are each discussed in relation to new theoretical developments, techniques available, and sample applications. Part Two covers model based control techniques in which the control decisions are used in a computer model of the process. Fault diagnosis, maintenance and trouble-shooting are just some of the activities covered. Part Three contains case studies of projects currently in progress, giving details of the software available and the likely future trends. One of these, on qualitative plant modelling as a basis for knowledge-based operator aids in nuclear power stations is indexed separately. (author)

  14. The plant expert system (PLEXSYS) development environment

    International Nuclear Information System (INIS)

    Hashemi, S.; Patterson, L.; Jeffery, M.; Delashmutt, L.

    1989-06-01

    The PLEXSYS software engineering tool provides an environment with which utility engineers can build and use expert systems for power plant applications. PLEXSYS provides the engineer with access to many powerful Artificial Intelligence methodologies, while retaining an engineering frame of reference and minimizing the need for a formal background in computer science. The principle concept is that the description and understanding of power plant systems centers on graphical forms such as piping and instrumentation diagrams and electrical line diagrams, which define a graphics-based model of plant knowledge that is common to many applications. PLEXSYS provides a model editor that allows the user to construct and modify models of hydraulic, electrical, and information systems in terms of elementary components and their interconnections. Analysis of the resulting schematic models is provided by several functions that perform network analysis, schematic browsing, mathematical modeling and customization of the user interface. 41 figs., 1 tab

  15. Spatial xenon oscillation control with expert systems

    International Nuclear Information System (INIS)

    Alten, S.; Danofsky, R.A.

    1993-01-01

    Spatial power oscillations were attributed to the xenon transients in a reactor core in 1958 by Randall and St. John. These transients are usually initiated by a local reactivity insertion and lead to divergent axial flux oscillations in the core at constant power. Several heuristic manual control strategies and automatic control methods were developed to damp the xenon oscillations at constant power operations. However, after the load-follow operation of the reactors became a necessity of life, a need for better control strategies arose. Even though various advanced control strategies were applied to solve the xenon oscillation control problem for the load-follow operation, the complexity of the system created difficulties in modeling. The strong nonlinearity of the problem requires highly sophisticated analytical approaches that are quite inept for numerical solutions. On the other hand, the complexity of a system and heuristic nature of the solutions are the basic reasons for using artificial intelligence techniques such as expert systems

  16. A framework expert system for pressure vessels

    International Nuclear Information System (INIS)

    Wang, Y.C.; Qin, S.J.

    1989-01-01

    Expert systems, known as a powerful tool to those numerical problems accompanied with logical argumentation, are facing the era of extended application into the engineering fields beyond the classical scopes of diagnosis and consultation. With regard to pressure vessels design it seems that the most important task is to establish a general purpose frame based on a microcomputer skeleton system to meet the various requirements of different vessels. The authors have made an attempt to perform such a skeleton designated file, ESTOOL, in order to achieve the objectives of executing numerical calculation combined with logical reasoning, and attaining higher efficiency of rules searching process. It has been successfully patched to the design software package for jacketed vessel with stirring shaft. This paper presents the guiding concepts and basic structure of ESTOOL via knowledge acquisition subsystem and inference engine

  17. Role of dental expert in forensic odontology

    Science.gov (United States)

    Verma, Anoop K.; Kumar, Sachil; Rathore, Shiuli; Pandey, Abhishek

    2014-01-01

    Forensic dentistry has become an integral part of forensic science over the past 100 years that utilizes dental or oro-facial findings to serve the judicial system. This has been due to the dedication of people like Gustafson's, Keiser-Nielson, and Suzuki for this field. They established the essential role which forensic dentistry plays mainly in the identification of human remains. The tooth has been used as weapons and under certain circumstances, may leave information about the identity of the biter. Dental professionals have a major role to play in keeping accurate dental records and providing all necessary information so that legal authorities may recognize mal practice, negligence, fraud or abuse, and identity of unknown individuals. This paper will try to summarize the various roles of dental experts in forensic medicine. PMID:25298709

  18. CIVA : expert post in non destructive testing

    International Nuclear Information System (INIS)

    Benoist, P.; Besnard, R.; Bayon, G.; Boutaine, J.L.

    1994-01-01

    C.E.A. has developed an original tool, a N.D.E software running on a workstation, able to handle different types of files: ultrasonics, eddy current, radiography, neutronography. The system is based on the experience of different SACLAY's laboratories and the different experts have brought their competence and knowledge in order to build this new software. Following the SPARTACUS approach, this tool allows to superpose images issued from various N.D.E. acquisitions. Modeling is directly integrated to the system, which permits to combine simulation and processing displays. 3 D imaging, signal processing and direct convolution of the data are also available. This software, named CIVA, improves the capacities of the N.D.E.; different examples of applications are shown, either for industrial or industrial applications. (authors) 6 refs., 14 figs

  19. TOXPERT: An Expert System for Risk Assessment

    Science.gov (United States)

    Soto, R. J.; Osimitz, T. G.; Oleson, A.

    1988-01-01

    TOXPERT is an artificial intelligence based system used to model product safety, toxicology (TOX) and regulatory (REG) decision processes. An expert system shell uses backward chaining rule control to link “marketing approval” goals to the type of product, REG agency, exposure conditions and TOX. Marketing risks are primarily a function of the TOX, hazards and exposure potential. The method employed differentiates between REG requirements in goal seeking control for various types of products. This is accomplished by controlling rule execution by defining frames for each REG agency. In addition, TOXPERT produces classifications of TOX ratings and suggested product labeling. This production rule system uses principles of TOX, REGs, corporate guidelines and internal “rules of thumb.” TOXPERT acts as an advisor for this narrow domain. Advantages are that it can make routine decisions freeing professional's time for more complex problem solving, provide backup and training.

  20. A survey of Framatome's expert systems activity

    International Nuclear Information System (INIS)

    Delaigue, D.; Grundstein, M.

    1987-01-01

    The French multinational nuclear energy world leader, Framatome, has designed and installed more than 40000 MWe of power in both France and abroad using Pressurized Water Reactor (PWR) technology. The French nuclear program ranks as one of the most successful in the world. In 1983, Framatome entered the Applied Artificial Intelligence (A.I.) field by setting up FRAMENTEC S.A., a joint venture with TEKNOWLEDGE Inc. Today, Framentec is a wholly-owned subsidiary of Framatome and is among the leading European companies specializing in Applied Artificial Intelligence. Framatome now has a 7.5% stake in Teknowledge Inc. The main applications in the nuclear industry can be summarized as follows: quality assurance; design of systems subject to extreme operating conditions; maintenance of complex systems; control of complex phenomenon producing high velocity transients; expert advice in multiple fields; compliance with complex regulations; high-skill personnel requirements; heavy financial investments

  1. Osteoporosis in Latin America: panel expert review

    Directory of Open Access Journals (Sweden)

    Patricia Clark

    2013-09-01

    Full Text Available Background. The Latin American region is undergoing a demographic and epidemiological transition, which is leading to an increase in chronic and degenerative diseases. Osteoporosis (OP and fragility fractures (FF are emerging as main causes of disease burden with great impact on health institutions. Purpose. This review article provides an updated overview of trends in the epidemiology and economic impact of OP and FF, as well as in diagnosis and available treatments in Latin America, including calcium, vitamin D and prevention programs. Methods. Expert panel. Conclusions. According to this review, there is a lack of epidemiological and economic information in the region. It is desirable to obtain information regarding quality of life in OP and FF as well as to highlight prevention as a tool to reduce FF.

  2. SIDES - Segment Interconnect Diagnostic Expert System

    International Nuclear Information System (INIS)

    Booth, A.W.; Forster, R.; Gustafsson, L.; Ho, N.

    1989-01-01

    It is well known that the FASTBUS Segment Interconnect (SI) provides a communication path between two otherwise independent, asynchronous bus segments. The SI is probably the most important module in any FASTBUS data acquisition network since it's failure to function can cause whole segments of the network to be inaccessible and sometimes inoperable. This paper describes SIDES, an intelligent program designed to diagnose SI's both in situ as they operate in a data acquisition network, and in the laboratory in an acceptance/repair environment. The paper discusses important issues such as knowledge acquisition; extracting knowledge from human experts and other knowledge sources. SIDES can benefit high energy physics experiments, where SI problems can be diagnosed and solved more quickly. Equipment pool technicians can also benefit from SIDES, first by decreasing the number of SI's erroneously turned in for repair, and secondly as SIDES acts as an intelligent assistant to the technician in the diagnosis and repair process

  3. Glyphosate rodent carcinogenicity bioassay expert panel review.

    Science.gov (United States)

    Williams, Gary M; Berry, Colin; Burns, Michele; de Camargo, Joao Lauro Viana; Greim, Helmut

    2016-09-01

    Glyphosate has been rigorously and extensively tested for carcinogenicity by administration to mice (five studies) and to rats (nine studies). Most authorities have concluded that the evidence does not indicate a cancer risk to humans. The International Agency for Research on Cancer (IARC), however, evaluated some of the available data and concluded that glyphosate probably is carcinogenic to humans. The expert panel convened by Intertek assessed the findings used by IARC, as well as the full body of evidence and found the following: (1) the renal neoplastic effects in males of one mouse study are not associated with glyphosate exposure, because they lack statistical significance, strength, consistency, specificity, lack a dose-response pattern, plausibility, and coherence; (2) the strength of association of liver hemangiosarcomas in a different mouse study is absent, lacking consistency, and a dose-response effect and having in high dose males only a significant incidence increase which is within the historical control range; (3) pancreatic islet-cell adenomas (non-significant incidence increase), in two studies of male SD rats did not progress to carcinomas and lacked a dose-response pattern (the highest incidence is in the low dose followed by the high dose); (4) in one of two studies, a non-significant positive trend in the incidence of hepatocellular adenomas in male rats did not lead to progression to carcinomas; (5) in one of two studies, the non-significant positive trend in the incidence of thyroid C-cell adenomas in female rats was not present and there was no progression of adenomas to carcinomas at the end of the study. Application of criteria for causality considerations to the above mentioned tumor types and given the overall weight-of-evidence (WoE), the expert panel concluded that glyphosate is not a carcinogen in laboratory animals.

  4. USING EXPERT OPINION IN HEALTH TECHNOLOGY ASSESSMENT: A GUIDELINE REVIEW.

    Science.gov (United States)

    Hunger, Theresa; Schnell-Inderst, Petra; Sahakyan, Narine; Siebert, Uwe

    2016-01-01

    External experts can be consulted at different stages of an HTA. When using vague information sources, it is particularly important to plan, analyze, and report the information processing in a standardized and transparent way. Our objective was to search and analyze recommendations regarding where and how to include expert data in HTA. We performed a systematic database search and screened the Internet pages of seventy-seven HTA organizations for guidelines, recommendations, and methods papers that address the inclusion of experts in HTA. Relevant documents were downloaded, and information was extracted in a standard form. Results were merged in tables and narrative evidence synthesis. From twenty-two HTA organizations, we included forty-two documents that consider the use of expert opinion in HTA. Nearly all documents mention experts in the step of preparation of the evidence report. Six documents address their role for priority setting of topics, fifteen for scoping, twelve for the appraisal of evidence and results, another twelve documents mention experts when considering the dissemination of HTA results. During the assessment step, experts are most often asked to amend the literature search or to provide expertise for special data analyses. Another issue for external experts is to appraise the HTA results and refer them back to a clinical and social context. Little is reported on methods of expert elicitation when their input substitutes study data. Despite existing recommendations on the use of expert opinion in HTA, common standards for elicitation are scarce in HTA guidelines.

  5. Expert system for liquid low-level waste management

    International Nuclear Information System (INIS)

    Ferrada, J.J.

    1992-01-01

    An expert system prototype has been developed to support system analysis activities at the Oak Ridge National Laboratory (ORNL) for waste management tasks. This expert system will aid in prioritizing radioactive waste streams for treatment and disposal by evaluating the severity and treatability of the problem as well as the final waste form. The objectives of the expert system development included: (1) collecting information on process treatment technologies for liquid low-level waste (LLLW) that can be incorporated in the knowledge base of the expert system, and (2) producing a prototype that suggests processes and disposal technologies for the ORNL LLLW system. The concept under which the expert system has been designed is integration of knowledge. There are many sources of knowledge (data bases, text files, simulation programs, etc.) that an expert would regularly consult in order to solve a problem of liquid waste management. The expert would normally know how to extract the information from these different sources of knowledge. The general scope of this project would be to include as much pertinent information as possible within the boundaries of the expert system. As a result, the user, who may not be an expert in every aspect of liquid waste management, may be able to apply the content of the information to a specific waste problem. This paper gives the methodological steps to develop the expert system under this general framework

  6. [Telemedicine correlation in retinopathy of prematurity between experts and non-expert observers].

    Science.gov (United States)

    Ossandón, D; Zanolli, M; López, J P; Stevenson, R; Agurto, R; Cartes, C

    2015-01-01

    To study the correlation between expert and non-expert observers in the reporting images for the diagnosis of retinopathy of prematurity (ROP) in a telemedicine setting. A cross-sectional, multicenter study, consisting of 25 sets of images of patients screened for ROP. They were evaluated by two experts in ROP and 1 non-expert and classified according to telemedicine classification, zone, stage, plus disease and Ells referral criteria. The telemedicine classification was: no ROP, mild ROP, type 2 ROP, or ROP that requires treatment. Ells referral criteria is defined as the presence at least one of the following: ROP in zone I, Stage 3 in zone I or II, or plus+ For statistical analysis, SPSS 16.0 was used. For correlation, Kappa value was performed. There was a high correlation between observers for the assessment of ROP stage (0.75; 0.54-0.88) plus disease (0.85; 0.71-0.92), and Ells criteria (0.89; 0.83-1.0). However, inter-observer values were low for zone (0.41; 0.27-0.54) and telemedicine classification (0.43; 0.33-0.6). When evaluating telemedicine images by examiners with different levels of expertise in ROP, the Ells criteria gave the best correlation. In addition, stage of disease and plus disease have good correlation among observers. In contrast, the correlation between observers was low for zone and telemedicine classification. Copyright © 2014 Sociedad Española de Oftalmología. Published by Elsevier España, S.L.U. All rights reserved.

  7. Ask-the-expert: Active Learning Based Knowledge Discovery Using the Expert

    Science.gov (United States)

    Das, Kamalika; Avrekh, Ilya; Matthews, Bryan; Sharma, Manali; Oza, Nikunj

    2017-01-01

    Often the manual review of large data sets, either for purposes of labeling unlabeled instances or for classifying meaningful results from uninteresting (but statistically significant) ones is extremely resource intensive, especially in terms of subject matter expert (SME) time. Use of active learning has been shown to diminish this review time significantly. However, since active learning is an iterative process of learning a classifier based on a small number of SME-provided labels at each iteration, the lack of an enabling tool can hinder the process of adoption of these technologies in real-life, in spite of their labor-saving potential. In this demo we present ASK-the-Expert, an interactive tool that allows SMEs to review instances from a data set and provide labels within a single framework. ASK-the-Expert is powered by an active learning algorithm for training a classifier in the backend. We demonstrate this system in the context of an aviation safety application, but the tool can be adopted to work as a simple review and labeling tool as well, without the use of active learning.

  8. Expert systems - basic principles and possible applications in nuclear energy

    International Nuclear Information System (INIS)

    Cain, D.G.; Schmidt, F.

    1987-01-01

    One of the primary goals of the application of mathematical methods and computational techniques in reactor physics is the effective and accurate solution of the neutron diffusion equation under various conditions. To reach this goal still requires much skill, experience, knowledge and imagination as can be seen from various contributions at this and other conferences. Experts are necessary. Will expert systems replace them. We shall discuss this question by describing the basic principles of problem solving by expert systems as compared to problem solving by mathematical and computational methods. From this we shall identify areas of possible applications of the new techniques in nuclear energy and develop some thoughts on present limitations. As a result we conclude that expert systems will not be able to replace experts as long as the experts use the systems to improve their own expertise

  9. The recourse to experts. Political reasons and uses

    International Nuclear Information System (INIS)

    Dumoulin, L.; La Branche, St.; Robert, C.; Warin, Ph.

    2005-01-01

    The need of reliable knowledge is necessary to draw adequate public policies. The role of experts is more and more important in any field, the expert brings his own specialized knowledge to the political world, he can define looming threads, can predict catastrophes, can highlight the long-term responsibility of particular choices but he can also contribute to the drawing of adequate solutions. The limit of expert's power lays in his ability to make a synthesis of plural knowledge. This book presents the role and weight of experts in our society from justice to economics via natural risks. A lot of examples of public policies based on expert valuation is given, in particular the recourse to experts of the European Union when it was to deal with the upgrading of nuclear safety standard in eastern countries. (A.C.)

  10. Expert system characteristics and potential applications in safeguards

    International Nuclear Information System (INIS)

    Chapman, L.D.

    1986-01-01

    The general growth of expert, knowledge-based (KB) or rule based systems will significantly increase in the next three to five years. Improvements in computer hardware (speed, reduced size, power) and software (rule based, data based, user interfaces) in recent years are providing the foundations for the growth of expert systems. A byproduct of this growth will undoubtedly be the application of expert systems to various safeguards problems. Characteristics of these expert systems will involve 1) multiple rules governing an outcome, 2) confidence factors on individual variables and rule sets, 3) priority, cost, and risk based rule sets, and 4) the reasoning behind the advice or decision given by the expert system. This paper presents characteristics, structures, and examples of simple rule based systems. Potential application areas for these expert systems may include training, operations, management, designs, evaluations, and specific hardware operation

  11. Model of critical diagnostic reasoning: achieving expert clinician performance.

    Science.gov (United States)

    Harjai, Prashant Kumar; Tiwari, Ruby

    2009-01-01

    Diagnostic reasoning refers to the analytical processes used to determine patient health problems. While the education curriculum and health care system focus on training nurse clinicians to accurately recognize and rescue clinical situations, assessments of non-expert nurses have yielded less than satisfactory data on diagnostic competency. The contrast between the expert and non-expert nurse clinician raises the important question of how differences in thinking may contribute to a large divergence in accurate diagnostic reasoning. This article recognizes superior organization of one's knowledge base, using prototypes, and quick retrieval of pertinent information, using similarity recognition as two reasons for the expert's superior diagnostic performance. A model of critical diagnostic reasoning, using prototypes and similarity recognition, is proposed and elucidated using case studies. This model serves as a starting point toward bridging the gap between clinical data and accurate problem identification, verification, and management while providing a structure for a knowledge exchange between expert and non-expert clinicians.

  12. Diagnosis - Using automatic test equipment and artificial intelligence expert systems

    Science.gov (United States)

    Ramsey, J. E., Jr.

    Three expert systems (ATEOPS, ATEFEXPERS, and ATEFATLAS), which were created to direct automatic test equipment (ATE), are reviewed. The purpose of the project was to develop an expert system to troubleshoot the converter-programmer power supply card for the F-15 aircraft and have that expert system direct the automatic test equipment. Each expert system uses a different knowledge base or inference engine, basing the testing on the circuit schematic, test requirements document, or ATLAS code. Implementing generalized modules allows the expert systems to be used for any different unit under test. Using converted ATLAS to LISP code allows the expert system to direct any ATE using ATLAS. The constraint propagated frame system allows for the expansion of control by creating the ATLAS code, checking the code for good software engineering techniques, directing the ATE, and changing the test sequence as needed (planning).

  13. The rational thinking of expert opinion and communicating in courtroom

    Directory of Open Access Journals (Sweden)

    Bing Li

    2017-01-01

    Full Text Available Since the past half century, expert testimony has played an increasingly important role in Chinese litigation. As the amount of expert testimony has grown, the issues about its admissibility and scientific foundation related to evidence are becoming to be questioned commonly. Since eighteenth central committee (China adopted the decision of the Central Committee of China on several important issues in promoting the legal system, the evidence was redefined to become the predominance in the whole proceeding. This article reviews the expert knowledge implicit in the opinions. It argues that the expert opinions ask judges to be aware of the role of communicationg between participants. Expert opinion is not only gained from laboratory, but also socially constructed in the rational expression and communication, which requir us think logically in terms of legal perceptions of science and expert knowledge in the empirical world.

  14. Expert system to control a fusion energy experiment

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, R.R.; Canales, T.; Lager, D.

    1986-01-01

    This paper describes a system that automates neutral beam source conditioning. The system achieves this with artificial intelligence techniques by encoding the behavior of several experts as a set of if-then rules in an expert system. One of the functions of the expert system is to control an adaptive controller that, in turn, controls the neutral beam source. The architecture of the system is presented followed by a description of its performance.

  15. Expert system for accelerator single-freedom nonlinear components

    International Nuclear Information System (INIS)

    Wang Sheng; Xie Xi; Liu Chunliang

    1995-01-01

    An expert system by Arity Prolog is developed for accelerator single-freedom nonlinear components. It automatically yields any order approximate analytical solutions for various accelerator single-freedom nonlinear components. As an example, the eighth order approximate analytical solution is derived by this expert system for a general accelerator single-freedom nonlinear component, showing that the design of the expert system is successful

  16. The Effect of Customer Empowerment on Adherence to Expert Advice

    OpenAIRE

    Camacho, Nuno; Jong, Martijn; Stremersch, Stefan

    2014-01-01

    textabstractCustomers often receive expert advice related to their health, finances, taxes or legal procedures, to name just a few. A noble stance taken by some is that experts should empower customers to make their own decisions. In this article, we distinguish informational from decisional empowerment and study whether empowerment leads customers to adhere more or less to expert advice. We empirically test our model using a unique dataset involving 11,735 respondents in 17 countries on four...

  17. Expert system to control a fusion energy experiment

    International Nuclear Information System (INIS)

    Johnson, R.R.; Canales, T.; Lager, D.

    1986-01-01

    This paper describes a system that automates neutral beam source conditioning. The system achieves this with artificial intelligence techniques by encoding the behavior of several experts as a set of if-then rules in an expert system. One of the functions of the expert system is to control an adaptive controller that, in turn, controls the neutral beam source. The architecture of the system is presented followed by a description of its performance

  18. Person expert in radiation protection: changing profiles

    International Nuclear Information System (INIS)

    Anon.

    2015-01-01

    In all French enterprises producing or using ionizing radiations, a person is in charge of the protection of workers against radiations: the expert in radiation protection (PCR). The education and training of this profession has been recently reformed, and its status will evolve by 2018 with a transposition of a European directive. While indicating the six main missions of PCRs (risk assessment, definition of protection measures, zoning optimisation, training of exposed workers, dosimetry follow-up, periodic controls), this article comments the current professional profile of PCRs who can be technicians, engineers as well as researchers. It also outlines aspects of the reform which do not satisfy PCRs' needs. A second article reports how PCRs perceive their mission on a daily basis, which obstacles they face, how they are organised to communicate between them and not to be isolated (a map of PCR regional networks is provided with indications of the number of members and of the main actions), and how the IRSN helps them. A third article evokes the content of a new standard (NF C 15-160) which defines the requirements for X ray generating installations, and the related theoretical and practical training proposed by the IRSN

  19. SAMEX: A severe accident management support expert

    International Nuclear Information System (INIS)

    Park, Soo-Yong; Ahn, Kwang-Il

    2010-01-01

    A decision support system for use in a severe accident management following an incident at a nuclear power plant is being developed which is aided by a severe accident risk database module and a severe accident management simulation module. The severe accident management support expert (SAMEX) system can provide the various types of diagnostic and predictive assistance based on the real-time plant specific safety parameters. It consists of four major modules as sub-systems: (a) severe accident risk data base module (SARDB), (b) risk-informed severe accident risk data base management module (RI-SARD), (c) severe accident management simulation module (SAMS), and (d) on-line severe accident management guidance module (on-line SAMG). The modules are integrated into a code package that executes within a WINDOWS XP operating environment, using extensive user friendly graphics control. In Korea, the integrated approach of the decision support system is being carried out under the nuclear R and D program planned by the Korean Ministry of Education, Science and Technology (MEST). An objective of the project is to develop the support system which can show a theoretical possibility. If the system is feasible, the project team will recommend the radiation protection technical support center of a national regulatory body to implement a plant specific system, which is applicable to a real accident, for the purpose of immediate and various diagnosis based on the given plant status information and of prediction of an expected accident progression under a severe accident situation.

  20. An Outsourcing Expert System for Governing Organizations

    Directory of Open Access Journals (Sweden)

    Meisam Shahbazi

    2016-10-01

    Full Text Available Making the right decision about doing activities in-house vs. outsourcing is one of the important management decisions. The considerable effect of this decision on organizational performance and responsiveness is supported by theoretical and empirical evidence. In this study, using the experts’ knowledge extraction and modeling, we have designed a logical framework for deciding about outsourcing in governing organizations and accordingly an expert system has been developed. As an applied research a descriptive approach and case study method have been used. Objectives, inevitable circumstances, requirements, background conditions and facilitators have been identified as the underlying components of the system. The system provides a recommendation for each activity and prioritizes them based on readiness for outsourcing. An implementation in IT department of a sample organization is provided and the results are analyzed.  In the end, the proposed system for activities of IT Management was carried out in one of the organizations and consequently the obtained outputs and results were analyzed.

  1. An expert system for emergency response

    International Nuclear Information System (INIS)

    Sebo, D.

    1989-01-01

    An expert system, the Reactor Safety Assessment System (RSAS), is being developed by the Idaho National Engineering Laboratory and the US Nuclear Regulatory Commission (NRC) for the NRC Operations Center. The RSAS is intended to aid the reactor safety team (RST) at the operations center in monitoring and projecting core and containment status during an emergency at a licensed nuclear power plant. The RSAS system development has two major aspects. The first is the compilation and storage of knowledge required for RST assessment tasks. The knowledge structure used by RSAS is a goal tree-success tree (GTST) model. The upper level structure of the GTST model is generic in nature. This allows development of models for generic plant-specific GTST models. The second aspect of the RSAS is the development of inferencing techniques for the access, display, and manipulation of the knowledge to meet RST requirements in a real-time manner during the activation of the operations center. This objective is achieved by critical safety function and success path monitoring. This basic strategy is used to determine the current status and estimate future challenges to the status of the reactor, identify procedures and equipment required to maintain or regain the critical safety functions, identify critical equipment, determine information requirements, and display pertinent information concerning current reactor status

  2. Coal Quality Expert: Status and software specifications

    International Nuclear Information System (INIS)

    Harrison, C.D.

    1992-01-01

    Under the Clean Coal Technology Program (Clean Coal Round 1), the US Department of Energy (DOE) and the Electric Power Research Institute (EPRI) are funding the development and demonstration of a computer program called the Coal Quality Expert (CQE trademark). When finished, the CQE will be a comprehensive PC-based program which can be used to evaluate several potential coal cleaning, blending, and switching options to reduce power plant emissions while minimizing generation costs. The CQE will be flxible in nature and capable of evaluating various qualities of coal, available transportation options, performance issues, and alternative emissions control strategies. This allows the CQE to determine the most cost-effective coal and the least expensive emissions control strategy for a given plant. To accomplish this, the CQE will be composed of technical models to evaluate performance issues; environmental models to evaluate environmental and regulatory issues; and cost estimating models to predict costs for installations of new and retrofit coal cleaning processes, power production equipment, and emissions control systems as well as other production costs such as consumables (fuel, scrubber additive, etc.), waste disposal, operating and maintenance, and replacement energy costs. These technical, environmental, and economic models as well as a graphical user interface will be developed for the CQE. And, in addition, to take advantage of already existing capability, the CQE will rely on seamless integration of already proven and extensively used computer programs such as the EPRI Coal Quality Information Systems, Coal Quality Impact Model (CQIM trademark), and NO x Pert. 2 figs

  3. CERN safety expert receives international award

    CERN Multimedia

    2005-01-01

    On 18 December 2004, the President of the Swiss Electro-technical Committee, Martin Reichle (left), presented the award to Helmut Schönbacher. Helmut Schönbacher, of the Safety Commission at CERN, has received, the "1906 Award" of the International Electrotechnical Commission (IEC) for his standardisation work on the influence of ionizing radiation on insulating materials. From 1986 until 2004, Schönbacher was leader of a working group on radiation composed of internationally recognised experts. It edited standards of the IEC 60544 series on the determination of the effects of ionizing radiation on electrical insulating materials. The working group also edited three IEC Technical Reports on the determination of long-term radiation ageing in polymers. This standardisation work and long-term experience from CERN on the radiation ageing of materials also contributed to research coordination programmes of the International Atomic Energy Agency (IAEA). From 1968 until 1988, Schönbacher was a member of the Rad...

  4. An expert system for steam generator maintenance

    International Nuclear Information System (INIS)

    Remond, A.

    1988-01-01

    The tube bundles in PWR steam generators are, by far, the major source of problems whether they are due to primary and secondary side corrosion mechanisms or to tube vibration-induced wear at tube support locations. Because of differences in SG operating, materials, and fabrication processes, the damage may differ from steam generator to steam generator. MPGV, an expert system for steam generator maintenance uses all steam generator data containing data on materials, fabrication processes, inservice inspection, and water chemistry. It has access to operational data for individual steam generators and contains models of possible degradation mechanisms. The objectives of the system are: · Diagnosing the most probable degradation mechanism or mechanisms by reviewing the entire steam generator history. · Identifying the tubes most exposed to future damage and evaluating the urgency of repair by simulating the probable development of the problem in time. · Establishing the appropriate preventive actions such as repair, inspection or other measures and establishing an action schedule. The system is intended for utilities either for individual plants before each inspection outage or any time an incident occurs or for a set of plants through a central MPGV center. (author)

  5. An hierarchical approach to performance evaluation of expert systems

    Science.gov (United States)

    Dominick, Wayne D. (Editor); Kavi, Srinu

    1985-01-01

    The number and size of expert systems is growing rapidly. Formal evaluation of these systems - which is not performed for many systems - increases the acceptability by the user community and hence their success. Hierarchical evaluation that had been conducted for computer systems is applied for expert system performance evaluation. Expert systems are also evaluated by treating them as software systems (or programs). This paper reports many of the basic concepts and ideas in the Performance Evaluation of Expert Systems Study being conducted at the University of Southwestern Louisiana.

  6. Handbook of VLSI chip design and expert systems

    CERN Document Server

    Schwarz, A F

    1993-01-01

    Handbook of VLSI Chip Design and Expert Systems provides information pertinent to the fundamental aspects of expert systems, which provides a knowledge-based approach to problem solving. This book discusses the use of expert systems in every possible subtask of VLSI chip design as well as in the interrelations between the subtasks.Organized into nine chapters, this book begins with an overview of design automation, which can be identified as Computer-Aided Design of Circuits and Systems (CADCAS). This text then presents the progress in artificial intelligence, with emphasis on expert systems.

  7. EPRI expert system activities for nuclear utility industry application

    International Nuclear Information System (INIS)

    Naser, J.A.

    1990-01-01

    This paper reports on expert systems which have reached a level of maturity where they offer considerable benefits for the nuclear utility industry. The ability of expert systems to enhance expertise makes them an important tool for the nuclear utility industry in the areas of engineering, operations and maintenance. Benefits of expert system applications include comprehensive and consistent reasoning, reduction of time required for activities, retention of human expertise and ability to utilize multiple experts knowledge for an activity. The Electric Power Research Institute (EPRI) has been performing four basic activities to help the nuclear industry take advantage of this expert system technology. The first is the development of expert system building tools which are tailored to nuclear utility industry applications. The second is the development of expert system applications. The third is work in developing a methodology for verification and validation of expert systems. The last is technology transfer activities to help the nuclear utility industry benefit from expert systems. The purpose of this paper is to describe the EPRI activities

  8. A Reasoning Architecture for Expert Troubleshooting of Complex Processes

    Data.gov (United States)

    National Aeronautics and Space Administration — This paper introduces a novel reasoning methodology, in combination with appropriate models and measurements (data) to perform accurately and expeditiously expert...

  9. Expert knowledge as defined by the X-Ray Ordinance

    International Nuclear Information System (INIS)

    1987-01-01

    The radiation protection officer or any person responsible for radiation safety have to give proof of their expert knowledge in accordance with sections 3, 4 of the X-Ray Ordinance. Proof of expert knowledge has to be furnished within the procedure of appointment (sec. 13, sub-sec. (3) X-Ray Ordinance). The directive defines the scope of the expert knowledge required, and the scope of expert knowledge persons must have, or acquire, who are responsible for radiation protection within the preview of sec. 23, no. 2, 4 and sec. 29, sub-sec. 1, no. 3 of the X-Ray Ordinance. (orig./HP) [de

  10. AN EXPERT SYSTEM FOR SUPPORTING THE PRODUCTION OF PLEASURE BOATS

    Directory of Open Access Journals (Sweden)

    Tomasz GONCIARZ

    2013-07-01

    Full Text Available Expert systems can be defined as computer programs, whose main task is to simulate a human expert, usually in a narrow field of expertise. Possible applications of modern information technology are very extensive, ranging from medicine, geology and technology to applications in the field of economic and financial decision support. The purpose of this paper is to present the practical application of an expert system that supports the process of managing the production of yachts and has a high suitability for use in this application. Using the expert system described in the paper reduces the time during the design and production preparation process.

  11. Expert systems for plant operations training and assistance

    International Nuclear Information System (INIS)

    Pack, R.W.; Lazar, P.M.; Schmidt, R.V.; Gaddy, C.D.

    1988-01-01

    The project described in this paper explored the use of expert systems for plant operations training and assistance. Three computer technologies were reviewed: computer-aided instruction, expert systems, and expert training systems (ETS). The technology of CAI has been developed since the early 1960s, and a wide range of applications are available commercially today. Expert systems have been developed primarily as job performance aids, and the number of commercial applications is increasing. A fully developed ETS has models of the trainer and trainee, in addition to a knowledge base

  12. Expert Panel Elicitation of Seismicity Following Glaciation in Sweden

    International Nuclear Information System (INIS)

    Hora, Stephen; Jensen, Mikael

    2005-12-01

    The Swedish Radiation Protection Authority, the Swedish Nuclear Power Inspectorate and the Swedish Nuclear Fuel and Waste Management Company have jointly carried out a project on expert panel elicitation on the issue of glacial induced Swedish earthquakes. Following a broad nomination procedure, 5 experts were chosen by a selection committee of 4 professors within Earth sciences disciplines. The 5 experts presented judgments about the frequency of earthquakes greater the magnitude 6 within 10 km for two Swedish sites, Oskarshamn and Forsmark, in connection with a glaciation cycle. The experts' median value vas 0,1 earthquakes for one glaciation cycle

  13. Expert systems for real-time monitoring and fault diagnosis

    Science.gov (United States)

    Edwards, S. J.; Caglayan, A. K.

    1989-01-01

    Methods for building real-time onboard expert systems were investigated, and the use of expert systems technology was demonstrated in improving the performance of current real-time onboard monitoring and fault diagnosis applications. The potential applications of the proposed research include an expert system environment allowing the integration of expert systems into conventional time-critical application solutions, a grammar for describing the discrete event behavior of monitoring and fault diagnosis systems, and their applications to new real-time hardware fault diagnosis and monitoring systems for aircraft.

  14. An examination of expert systems activities within the nuclear industry

    International Nuclear Information System (INIS)

    Bernard, J.A.; Washio, Takashi.

    1988-01-01

    This paper provides an overview of a detailed evaluation that the authors recently completed on expert systems applications within the nuclear industry. That evaluation examined the motivation for utilizing expert systems, identified the areas to which they were being applied, and provided an assessment of their utility. Listed here are some of the salient findings of that report. (1) Utilities are developing their own artificial intelligence tools rather than using commercial products. (2) Few expert systems are being developed for the express purpose of capturing human expertise. (3) A number of successful expert systems have been developed to assist in plant design, management, and maintenance scheduling. (4) Interactive diagnostic systems are being developed for the analysis of physical processes that vary slowly. (5) Real-time diagnostic expert systems are currently at the cutting edge of the technology. (6) Operator adviser and emergency response expert systems constitute ∼25% of the total. (7) Research on the use of expert systems for reactor control is quite active. (8) Too few quantitative evaluations of the benefits of expert systems to reactor operators have been performed. The operator's need is for timely, factual information on plant status. Hence, the true challenge to expert systems is real-time diagnostics

  15. Expert System Applications for the Electric Power Industry: Proceedings

    International Nuclear Information System (INIS)

    1992-06-01

    A conference on Expert System Applications for the Electric Power Industry was held in Boston on September 8--11, 1991 to provide a forum for technology transfer, technical information exchange, and education. The conference was attended by more than 150 representatives of electric utilities, equipment manufacturers, engineering consulting organizations, universities, national laboratories, and government agencies. The meeting included a keynote address, 70 papers, and 18 expert system demonstrations. Sessions covered expert systems in power system planning operations, fossil power plant applications, nuclear power plant applications, and intelligent user interfaces. The presentations showed how expert systems can provide immediate benefits to the electric power industry in many applications. Individual papers are indexed separately

  16. Estimating Production Potentials: Expert Bias in Applied Decision Making

    International Nuclear Information System (INIS)

    Matthews, L.J.; Burggraf, L.K.; Reece, W.J.

    1998-01-01

    A study was conducted to evaluate how workers predict manufacturing production potentials given positively and negatively framed information. Findings indicate the existence of a bias toward positive information and suggest that this bias may be reduced with experience but is never the less maintained. Experts err in the same way non experts do in differentially processing negative and positive information. Additionally, both experts and non experts tend to overestimate production potentials in a positive direction. The authors propose that these biases should be addressed with further research including cross domain analyses and consideration in training, workplace design, and human performance modeling

  17. Expert Panel Elicitation of Seismicity Following Glaciation in Sweden

    Energy Technology Data Exchange (ETDEWEB)

    Hora, Stephen; Jensen, Mikael (eds.)

    2005-12-15

    The Swedish Radiation Protection Authority, the Swedish Nuclear Power Inspectorate and the Swedish Nuclear Fuel and Waste Management Company have jointly carried out a project on expert panel elicitation on the issue of glacial induced Swedish earthquakes. Following a broad nomination procedure, 5 experts were chosen by a selection committee of 4 professors within Earth sciences disciplines. The 5 experts presented judgments about the frequency of earthquakes greater the magnitude 6 within 10 km for two Swedish sites, Oskarshamn and Forsmark, in connection with a glaciation cycle. The experts' median value vas 0,1 earthquakes for one glaciation cycle.

  18. The expert assistant in accident management

    International Nuclear Information System (INIS)

    Goddard, A.J.H.; Cannell, R.J.

    1990-01-01

    In the event of a nuclear accident in proximity to an urban area, the consequences resulting from the complex processes of environmental transport of radioactivity would require complex countermeasures. Emphasis has been placed on either modelling the potential effects of such an event on the population, or on attempting to predict the geographical evolution of the release. Less emphasis has been placed on the development of accident management aids with a in-built data acquisition capability. Given the problems of predicting the evolution of an accidental release of activity, more emphasis should be placed on the development of small regional systems specifically engineered to acquire and display environmental data in the most efficaceous form possible. A wealth of information can be obtained from appropriately-sited outstations which can aid those responsible for countermeasures in their decision making processes. The substantial volume of data which would arrive within the duration and during the aftermath of an accident requires skilled interpretation under conditions of considerable stress. It is necessary that a management aid notonly presents these data in a rapidly assimilable form, but is capable of making intelligent decisions of its own, on such matters as information display priority and the polling frequency of outstations. The requirement is for an expert assistant. The XERSES accident management aid has been designed with the foregoing features in mind. Intended for covering regions up to approximately 100 kms square, it links with between 1 and 64 outstations supplying a variety of environmental data. Under quiescent conditions the system will operate unattended, raising alarms remotely only when detecting abnormal conditions. Under emergency conditions, the system automatically adjusts such operating parameters as data acquisition rate

  19. Expert analogy use in a naturalistic setting

    Science.gov (United States)

    Kretz, Donald R.; Krawczyk, Daniel C.

    2014-01-01

    The use of analogy is an important component of human cognition. The type of analogy we produce and communicate depends heavily on a number of factors, such as the setting, the level of domain expertise present, and the speaker's goal or intent. In this observational study, we recorded economics experts during scientific discussion and examined the categorical distance and structural depth of the analogies they produced. We also sought to characterize the purpose of the analogies that were generated. Our results supported previous conclusions about the infrequency of superficial similarity in subject-generated analogs, but also showed that distance and depth characteristics were more evenly balanced than in previous observational studies. This finding was likely due to the nature of the goals of the participants, as well as the broader nature of their expertise. An analysis of analogical purpose indicated that the generation of concrete source examples of more general target concepts was most prevalent. We also noted frequent instances of analogies intended to form visual images of source concepts. Other common purposes for analogies were the addition of colorful speech, inclusion (i.e., subsumption) of a target into a source concept, or differentiation between source and target concepts. We found no association between depth and either of the other two characteristics, but our findings suggest a relationship between purpose and distance; i.e., that visual imagery typically entailed an outside-domain source whereas exemplification was most frequently accomplished using within-domain analogies. Overall, we observed a rich and diverse set of spontaneously produced analogical comparisons. The high degree of expertise within the observed group along with the richly comparative nature of the economics discipline likely contributed to this analogical abundance. PMID:25505437

  20. Expert Analogy Use in a Naturalistic Setting

    Directory of Open Access Journals (Sweden)

    Donald R Kretz

    2014-11-01

    Full Text Available The use of analogy is an important component of human cognition. The type of analogy we produce and communicate depends heavily on a number of factors, such as the setting, the level of domain expertise present, and the speaker’s goal or intent. In this observational study, we recorded economics experts during scientific discussion and examined the categorical distance and structural depth of the analogies they produced. We also sought to characterize the purpose of the analogies that were generated. Our results supported previous conclusions about the infrequency of superficial similarity in subject-generated analogs, but also showed that distance and depth characteristics were more evenly balanced than in previous observational studies. This finding was likely due to the nature of the goals of the participants, as well as the broader nature of their expertise. An analysis of analogical purpose indicated that the generation of concrete source examples of more general target concepts was most prevalent. We also noted frequent instances of analogies intended to form visual images of source concepts. Other common purposes for analogies were the addition of colorful speech, inclusion (i.e., subsumption of a target into a source concept, or differentiation between source and target concepts. We found no association between depth and either of the other two characteristics, but our findings suggest a relationship between purpose and distance; i.e., that visual imagery typically entailed an outside-domain source whereas exemplification was most frequently accomplished using within-domain analogies. Overall, we observed a rich and diverse set of spontaneously produced analogical comparisons. The high degree of expertise within the observed group along with the richly comparative nature of the economics discipline likely contributed to this analogical abundance.

  1. Expert views from Poland and Estonia

    Directory of Open Access Journals (Sweden)

    Kaja Põlluste

    2016-12-01

    Full Text Available Background . Home care (HC is placed between the health and social welfare systems, and the clients of HC mostly need health services. Along with other providers, family doctors (FDs are usually involved in the provision of care. Objectives. This paper aims to describe and compare the involvement of HC providers to elderly and disabled persons in Poland and Estonia. Material and methods . This study is part of the international project EURHOMA P (Mapping Professional Home Care in Europe. Data was collected in 2008–2010. Experts from different areas of health and social care were queried by using a questionnaire containing structured case narratives, which were hypothetical descriptions of the situations of elderly or disabled persons living at home and in need of care. Results. There are a number of HC services, e.g. nursing, medical and social, available in both countries. The application for HC is mostly made by the patient or a close family member; the point of entry to HC can differ and depends on the client’s primary problem. FDs, together with social workers, play an important role in the provision of HC services in both countries. However, due to a shortage of round-the-clock professional services at a client’s home, families are also expected to play a large role in providing HC . Conclusions . Health care professionals, mainly those working in primary health care, play a remarkable role in access to and provision of HC services. Nevertheless, responsibility for 24-hour care lies, to a large extent, with the client’s immediate family. This situation seems to be typical in Eastern European countries.

  2. Detecting malingering: a survey of experts' practices.

    Science.gov (United States)

    Slick, Daniel J; Tan, Jing E; Strauss, Esther H; Hultsch, David F

    2004-06-01

    A survey addressing practices of 'expert' neuropsychologists in handling financial compensation claim or personal injury litigation cases was carried out. Potential participants were identified by publication history. Responses were obtained from 24 out of the 39 neuropsychologists who were surveyed. Approximately 79% of the respondents reported using at least one specialized technique for detecting malingering in every litigant assessment. Half stated that they always give specialized tests at the beginning of the assessment. The Rey 15-Item test and the Test of Memory Malingering were the most frequently reported measures. Respondents also reported frequent use of 'malingering' indexes from standard neuropsychological tests. Reported base-rates varied, but the majority of respondents indicated that at least 10% of the litigants they assessed in the last year were definitely malingering. Respondents were split on the practice of routinely giving warnings at the outset of assessments that suboptimal performance may be detected. However, when the client's motivational status was suspect, more than half (58.3%) altered their assessment routine at least on some occasions, by encouraging good effort (70.8%) or administering additional SVTs. A minority directly confronted or warned clients (25%), terminated the examination earlier than planned (16.6%), or contacted the referring attorney immediately (29.2%). Respondents almost always stated some opinion regarding indicators of invalidity in written reports (95%). However, 41.7% rarely used the term 'malingering' and 12.5% never used the term. Most respondents (>80%) instead stated that the test results are invalid, inconsistent with the severity of the injury or indicative of exaggeration. Copyright 2003 National Academy of Neuropsychology

  3. Artificial Experts: The Computer as Diagnostician Has Definite Limits.

    Science.gov (United States)

    Pournelle, Jerry

    1984-01-01

    Argues that, although expert systems--which are supposed to give users all the advantages of consulting with human experts--can be useful for medical diagnosis, where tests tend to be reliable, they can be hazardous in such areas as psychological testing, where test reliability is difficult to measure. (MBR)

  4. Toward the efficient implementation of expert systems in Ada

    Science.gov (United States)

    Lee, S. Daniel

    1990-01-01

    Here, the authors describe Ada language issues encountered during the development of ART-Ada, an expert system tool for Ada deployment. ART-Ada is being used to implement several expert system applications for the Space Station Freedom and the U.S. Air Force. Additional information is given on dynamic memory allocation.

  5. Group prioritisation with unknown expert weights in incomplete linguistic context

    Science.gov (United States)

    Cheng, Dong; Cheng, Faxin; Zhou, Zhili; Wang, Juan

    2017-09-01

    In this paper, we study a group prioritisation problem in situations when the expert weights are completely unknown and their judgement preferences are linguistic and incomplete. Starting from the theory of relative entropy (RE) and multiplicative consistency, an optimisation model is provided for deriving an individual priority vector without estimating the missing value(s) of an incomplete linguistic preference relation. In order to address the unknown expert weights in the group aggregating process, we define two new kinds of expert weight indicators based on RE: proximity entropy weight and similarity entropy weight. Furthermore, a dynamic-adjusting algorithm (DAA) is proposed to obtain an objective expert weight vector and capture the dynamic properties involved in it. Unlike the extant literature of group prioritisation, the proposed RE approach does not require pre-allocation of expert weights and can solve incomplete preference relations. An interesting finding is that once all the experts express their preference relations, the final expert weight vector derived from the DAA is fixed irrespective of the initial settings of expert weights. Finally, an application example is conducted to validate the effectiveness and robustness of the RE approach.

  6. A new Expert Finding model based on Term Correlation Matrix

    Directory of Open Access Journals (Sweden)

    Ehsan Pornour

    2015-09-01

    Full Text Available Due to the enormous volume of unstructured information available on the Web and inside organization, finding an answer to the knowledge need in a short time is difficult. For this reason, beside Search Engines which don’t consider users individual characteristics, Recommender systems were created which use user’s previous activities and other individual characteristics to help users find needed knowledge. Recommender systems usage is increasing every day. Expert finder systems also by introducing expert people instead of recommending information to users have provided this facility for users to ask their questions form experts. Having relation with experts not only causes information transition, but also with transferring experiences and inception causes knowledge transition. In this paper we used university professors academic resume as expert people profile and then proposed a new expert finding model that recommends experts to users query. We used Term Correlation Matrix, Vector Space Model and PageRank algorithm and proposed a new hybrid model which outperforms conventional methods. This model can be used in internet environment, organizations and universities that experts have resume dataset.

  7. Solving Accounting Problems: Differences between Accounting Experts and Novices.

    Science.gov (United States)

    Marshall, P. Douglas

    2002-01-01

    Performance of 90 accounting experts (faculty and practitioners) and 60 novices (senior accounting majors) was compared. Experts applied more accounting principles to solving problems. There were no differences in types of principles applied and no correlation between (1) principles applied and number of breadth comments or (2) importance placed…

  8. Sources of correlation between experts: Empirical results from two extremes

    International Nuclear Information System (INIS)

    Meyer, M.A.; Booker, J.M.

    1987-04-01

    Through two studies, this report seeks to identify the sources of correlation, or dependence, between experts' estimates. Expert estimates are relied upon as sources of data whenever experimental data is lacking, such as in risk analyses and reliability assessments. Correlation between experts is a problem in the elicitation and subsequent use of subjective estimates. Until now, there have been no data confirming sources of correlation, although the experts' background is commonly speculated to be one. Two different populations of experts were administered questions in their areas of expertise. Data on their professional backgrounds and means of solving the questions were elicited using techniques from educational psychology and ethnography. The results from both studies indicate that the way in which an expert solves the problem is the major source of correlation. The experts' background can not be shown to be an important source of correlation nor to influence his choice of method for problem solution. From these results, some recommendations are given for the elicitation and use of expert opinion

  9. Anticipation and visual search behaviour in expert soccer goalkeepers

    NARCIS (Netherlands)

    Savelsbergh, G.J.P.; van der Kamp, J.; Williams, A.M.; Ward, P.

    2005-01-01

    A novel methodological approach is presented to examine the visual search behaviours employed by expert goalkeepers during simulated penalty kick situations in soccer. Expert soccer goalkeepers were classified as successful or unsuccessful based on their performance on a film-based test of

  10. Domestic violence: the role of the mental health expert.

    Science.gov (United States)

    Packer, I K

    1990-01-01

    Mental health experts are often called upon to testify in trials of battered woman who have killed their husbands. Such experts have an important role to play in educating both the public and the legal profession about the Battered Woman Syndrome.

  11. Combining SKU-level sales forecasts from models and experts

    NARCIS (Netherlands)

    Ph.H.B.F. Franses (Philip Hans); R. Legerstee (Rianne)

    2009-01-01

    textabstractWe study the performance of SKU-level sales forecasts which linearly combine statistical model forecasts and expert forecasts. Using a large and unique database containing model forecasts for monthly sales of various pharmaceutical products and forecasts given by about fifty experts, we

  12. Expert systems as applied to bridges and pavements : an overview.

    Science.gov (United States)

    1986-01-01

    Expert systems is a rapidly emerging new application of computers to aid decision makers in solving problems. This report gives an overview of what expert systems are and of what use they may be to a transportation department. The focus of the applic...

  13. Supporting experts to handle tweet collections about significant events

    NARCIS (Netherlands)

    Hürriyetoglu, Ali; Oostdijk, Nelleke; Basar, Erkan; van den Bosch, A.; Frasincar, F.; Ittoo, A.; Nguyen, L.; Metais, E.

    2017-01-01

    We introduce Relevancer that processes a tweet set and enables generating an automatic classifier from it. Relevancer satisfies information needs of experts during significant events. Enabling experts to combine automatic procedures with expertise is the main contribution of our approach and the

  14. Expert System Techniques and Applications in AEC-Design

    DEFF Research Database (Denmark)

    Andersen, Tom

    This part of a book presents expert system techniques applicable to building design and construction, and it reports and evaluates on systems developed in thar domain.......This part of a book presents expert system techniques applicable to building design and construction, and it reports and evaluates on systems developed in thar domain....

  15. The Principles of Designing an Expert System in Teaching Mathematics

    Science.gov (United States)

    Salekhova, Lailya; Nurgaliev, Albert; Zaripova, Rinata; Khakimullina, Nailya

    2013-01-01

    This study reveals general didactic concepts of the Expert Systems (ES) development process in the educational area. The proof of concept is based on the example of teaching the 8th grade Algebra subject. The main contribution in this work is the implementation of innovative approaches in analysis and processing of data by expert system as well as…

  16. Distributed Cognition in Sports Teams: Explaining Successful and Expert Performance

    Science.gov (United States)

    Williamson, Kellie; Cox, Rochelle

    2014-01-01

    In this article we use a hybrid methodology to better understand the skilful performance of sports teams as an exemplar of distributed cognition. We highlight key differences between a team of individual experts (an aggregate system) and an expert team (an emergent system), and outline the kinds of shared characteristics likely to be found in an…

  17. Realization of economic evaluation expert system for uranium mine project

    International Nuclear Information System (INIS)

    Wang Haifeng

    1993-01-01

    By studying the EVALUATOR, economic evaluation expert system of uranium mine project, the theoretical fundamentals of expert system, principle of inference mechanism, implementation of knowledge base, realization of explanation mechanism, acquisition of domain knowledge and representation of knowledge were described, especially the subjective Bayes approach for inexact reasoning problem used in EVALUATOR was discussed in detail

  18. Expert and Naive Raters Using the PAG: Does it Matter?

    Science.gov (United States)

    Cornelius, Edwin T.; And Others

    1984-01-01

    Questions the observed correlation between job experts and naive raters using the Position Analysis Questionnaire (PAQ); and conducts a replication of the Smith and Hakel study (1979) with college students (N=39). Concluded that PAQ ratings from job experts and college students are not equivalent and therefore are not interchangeable. (LLL)

  19. The Finishing Touch: Anatomy of Expert Lesson Closures

    Science.gov (United States)

    Webster, Collin A.; Connolly, Graeme; Schempp, Paul G.

    2009-01-01

    Background: Based on the idea that students remember best what is presented last, the lesson closure is commonly identified as an important component of effective teaching and has recently surfaced as a routine practice of expert teachers in sport. Despite its link to both effective and expert instruction, the lesson closure has seen scarce…

  20. The development of an expert system for arid rangeland ...

    African Journals Online (AJOL)

    Currently, the expert system uses wiki technology, as this allows a high level of interaction between user and administrator. The expert system includes embedded links to photographs and additional information. It allows easy updating of the knowledge base. An additional booklet was also developed, since access to ...

  1. Curricula for Media Literacy Education According to International Experts

    Science.gov (United States)

    Fedorov, Alexander; Levitskaya, Anastasia; Camarero, Emma

    2016-01-01

    The article analyzes the results of the international experts' survey regarding the curriculum of media literacy education, which was administrated by the authors in September-October 2015. The expert panel includes specialists actively involved in the real process of media literacy education in schools, universities and other educational…

  2. Expert Systems the Old Fashioned Way: Person to Person.

    Science.gov (United States)

    McCleary, Hunter; Mayer, William J.

    1988-01-01

    Describes the services of Teltech, Inc., which mimic the desirable attributes of artificial intelligence and expert systems via a "database" of 5,000 experts in technical areas and interactive literature searches executed by staff. Advantages and shortcomings of the network are exemplified by sample searches. Several sample menus and…

  3. Winter Reads: Your expert guide to the best history books

    DEFF Research Database (Denmark)

    Newby, Andrew

    2013-01-01

    Review of K. Barclay, 'Love, Intimacy and Power' as part of a feature in which experts on Scottish History were asked to choose their book of the year.......Review of K. Barclay, 'Love, Intimacy and Power' as part of a feature in which experts on Scottish History were asked to choose their book of the year....

  4. The Effect of Customer Empowerment on Adherence to Expert Advice

    NARCIS (Netherlands)

    N.M.A. Camacho (Nuno); M.G. de Jong (Martijn); S. Stremersch (Stefan)

    2014-01-01

    textabstractCustomers often receive expert advice related to their health, finances, taxes or legal procedures, to name just a few. A noble stance taken by some is that experts should empower customers to make their own decisions. In this article, we distinguish informational from decisional

  5. Supplement to a Methodology for Succession Planning for Technical Experts

    Energy Technology Data Exchange (ETDEWEB)

    Kirk, Bernadette Lugue [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Cain, Ronald A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Agreda, Carla L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-11-01

    This report complements A Methodology for Succession Planning for Technical Experts (Ron Cain, Shaheen Dewji, Carla Agreda, Bernadette Kirk, July 2017), which describes a draft methodology for identifying and evaluating the loss of key technical skills at nuclear operations facilities. This report targets the methodology for identifying critical skills, and the methodology is tested through interviews with selected subject matter experts.

  6. Reflection group on 'Expert Culture'

    Energy Technology Data Exchange (ETDEWEB)

    Eggermont, G

    2000-07-01

    As part of SCK-CEN's social sciences and humanities programme, a reflection group on 'Expert Culture' was established. The objectives of the reflection group are: (1) to clarify the role of SCK-CEN experts; (2) to clarify the new role of expertise in the evolving context of risk society; (3) to confront external views and internal SCK-CEN experiences on expert culture; (4) to improve trust building of experts and credibility of SCK-CEN as a nuclear actor in society; (5) to develop a draft for a deontological code; (6) to integrate the approach in training on assertivity and communication; (7) to create an output for a topical day on the subject of expert culture. The programme, achievements and perspectives of the refection group are summarised.

  7. GOTRES: an expert system for fault detection and analysis

    International Nuclear Information System (INIS)

    Chung, D.T.; Modarres, M.

    1989-01-01

    This paper describes a deep-knowledge expert system shell for diagnosing faults in process operations. The expert program shell is called GOTRES (GOal TRee Expert System) and uses a goal tree-success tree deep-knowledge structure to model its knowledge-base. To demonstrate GOTRES, we have built an on-line fault diagnosis expert system for an experimental nuclear reactor facility using this shell. The expert system is capable of diagnosing fault conditions using system goal tree as well as utilizing accumulated operating knowledge to predict plant causal and temporal behaviours. The GOTRES shell has also been used for root-cause detection and analysis in a nuclear plant. (author)

  8. Environmental policy. 2000 environmental expert opinion of the Council of Experimental Experts

    International Nuclear Information System (INIS)

    2000-05-01

    The reorientation of energy policy is a key issue. The Council of Environmental Experts considers the further use of atomic energy to be irresponsible and recommends a new orientation. Recommendations are made on ecology-centered taxation. Critical comments are made in the context of conservation of nature, where many species of plants and animals still continue to be endangered. The conservation programme of the Federal government, which also comprises a system of large, interconnected biotopes on 10% of Germany's total surface, is approved, and the potential contribution of sustainable agricultural and forestry policy is discussed in a separate chapter. Further subjects discussed are recycling and waste management, protection of water and soil, air pollution abatement, health protection and genetic engineering. The environmental aspects of Eastern European states becoming EC members are gone into in particular. The network of Europen Environmental Councils, for which the German Council of Environmental Experts currently acts as a coordinator, makes intensive efforts to improve environmental counselling in these states [de

  9. Expert and non-expert groups perception of LILW repository site selection procedure

    International Nuclear Information System (INIS)

    Zeleznik, N.; Polic, M.

    2001-01-01

    Slovenia is now in the process of the site selection for a low and intermediate level radioactive waste (LILW) repository. Earlier searches for the LILW repository site confronted the Agency for radwaste management (ARAO) with a number of problems, mainly concerning the contacts with the local communities and their willingness to accept the repository. Therefore the Agency started with a new, so-called mixed mode approach to the site selection, where the special role of a mediator is introduced. The mediator represents the link between the investor and the local community, and facilitates the communication and negotiations between both. In this study we try to find out how people perceive the mediating process and conditions under which the LILW repository would be accepted in the local community. Therefore a special survey was conducted. The results showed some of the conditions under which participants would possibly accept the LILW repository. Differences in the perception between non-expert and expert groups were demonstrated and analysed, especially in the assessment of the consequences of LILW repository construction on the environment. Also the socio-psychological influences of the LILW repository were noted and examined. Consequences and recommendations for future work on the site selection procedure were prepared on the basis of the research results.(author)

  10. Medical Physics expert and competence in radiation protection

    International Nuclear Information System (INIS)

    Vano, E.; Lamn, I. N.; Guerra, A. del; Van Kleffens, H. J.

    2003-01-01

    The Council Directive 97/43/EURATOM on health protection of individuals against the dangers of ionizing radiation in relation to medical exposure, defines the Medical Physical Expert as an expert in radiation physics or radiation technology applied to exposure, within the scope of the Directive, whose training and competence to act is recognized by the competent authorities; and who, as appropriate, acts or gives advice on patient dosimetry, on the development and use of complex techniques and equipment, on optimization, on quality assurance, including quality control, and on other matters relating to radiation protection, concerning exposure within the scope of this Directive. As a consequence, it might be implied that his competence in radiation protection should also cover the staff and the public. In fact, the training programmes of medical physics experts include all the aspects concerning these topics. Some confusion could arise in the medical area when the Qualified Expert defined in the Council Directive 96/29/Euratom laying down basic safety standards for the protection of the health of workers and the general public against the dangers arising from ionizing radiation is considered. The Qualified Expert is defined as a person having the knowledge and training needed to carry out physical, technical or radiochemical tests enabling doses to be assessed, and to give advice in order to ensure effective protection of individuals and the correct operation of protective equipment, whose capacity to act a qualified expert is recognized by the competent authorities. A qualified expert may be assigned the technical responsibility for the tasks of radiation protection of workers and members of the public. In Europe, the Qualified Expert is acting at present in the Medical Area in countries where there are not enough Medical Physics Experts or in countries where this role was established before the publication of the Council Directive 97/43/EURATOM. Now, the coherent

  11. An inter-observer agreement study of autofluorescence endoscopy in Barrett's esophagus among expert and non-expert endoscopists.

    Science.gov (United States)

    Mannath, J; Subramanian, V; Telakis, E; Lau, K; Ramappa, V; Wireko, M; Kaye, P V; Ragunath, K

    2013-02-01

    Autofluorescence imaging (AFI), which is a "red flag" technique during Barrett's surveillance, is associated with significant false positive results. The aim of this study was to assess the inter-observer agreement (IOA) in identifying AFI-positive lesions and to assess the overall accuracy of AFI. Anonymized AFI and high resolution white light (HRE) images were prospectively collected. The AFI images were presented in random order, followed by corresponding AFI + HRE images. Three AFI experts and 3 AFI non-experts scored images after a training presentation. The IOA was calculated using kappa and accuracy was calculated with histology as gold standard. Seventy-four sets of images were prospectively collected from 63 patients (48 males, mean age 69 years). The IOA for number of AF positive lesions was fair when AFI images were presented. This improved to moderate with corresponding AFI and HRE images [experts 0.57 (0.44-0.70), non-experts 0.47 (0.35-0.62)]. The IOA for the site of AF lesion was moderate for experts and fair for non-experts using AF images, which improved to substantial for experts [κ = 0.62 (0.50-0.72)] but remained at fair for non-experts [κ = 0.28 (0.18-0.37)] with AFI + HRE. Among experts, the accuracy of identifying dysplasia was 0.76 (0.7-0.81) using AFI images and 0.85 (0.79-0.89) using AFI + HRE images. The accuracy was 0.69 (0.62-0.74) with AFI images alone and 0.75 (0.70-0.80) using AFI + HRE among non-experts. The IOA for AF positive lesions is fair to moderate using AFI images which improved with addition of HRE. The overall accuracy of identifying dysplasia was modest, and was better when AFI and HRE images were combined.

  12. Expert Group Meeting on Population and Women.

    Science.gov (United States)

    1993-01-01

    As part of the preparation for the up-coming International Conference on Population and Development sponsored by the UN, an expert group met in June 1992 in Botswana to consider issues related to population and women. Particular attention was devoted to gender equality, population, and development; reproductive health and the health of families; adolescent fertility, marriage, and reproductive health; family planning (FP) and FP programs; education of girls and women and the relationship of education to fertility, health, and welfare; women's economic activity and its relationship to demographic factors; and the relationship between women, population, and the environment. While both developed and developing countries were considered, the emphasis was on the latter. 32 recommendations for action were addressed primarily to governments and other social institutions and also to funding agencies. The recommendations call for a recognization that health and education are particularly critical for women. They ask for the development of gender-based analysis and assessment of development policies to discover their impact on women. Service delivery to women should be culturally appropriate, and women should be integrated into development initiatives and into management and policy-making levels of social institutions. Responsible parenthood should be promoted as should the assumption of familiar responsibilities by men. Women should have access to safe abortion services. Adolescents should receive the education necessary to protect their reproductive health, and a minimum marriage age should be adopted. FP programs should be appropriate to their clients and should provide safe methods of fertility regulation. Improved and safe contraceptives and pharmaceuticals which will protect against sexually transmitted diseases should be developed, with renewed emphasis placed on new contraceptives for men. Safe sex measures should be promoted. The health of girls and women should

  13. Development of a Coal Quality Expert

    Energy Technology Data Exchange (ETDEWEB)

    None

    1998-06-20

    ABB Power Plant Laboratories Combustion Engineering, Inc., (ABB CE) and CQ Inc. completed a broad, comprehensive program to demonstrate the economic and environmental benefits of using higher quality U.S. coals for electrical power generation and developed state-of-the-art user-friendly software--Coal Quality Expert (CQE)-to reliably predict/estimate these benefits in a consistent manner. The program was an essential extension and integration of R and D projects performed in the past under U.S. DOE and EPRI sponsorship and it expanded the available database of coal quality and power plant performance information. This software will permit utilities to purchase the lowest cost clean coals tailored to their specific requirements. Based on common interest and mutual benefit, the subject program was cosponsored by the U.S. DOE, EPRI, and eight U.S. coal-burning utilities. In addition to cosponsoring this program, EPN contributed its background research, data, and computer models, and managed some other supporting contracts under the terms of a project agreement established between CQ Inc. and EPRI. The essential work of the proposed project was performed under separate contracts to CQ Inc. by Electric Power Technologies (El?'T), Black and Veatch (B and V), ABB Combustion Engineering, Babcock and Wilcox (B and W), and Decision Focus, Inc. Although a significant quantity of the coals tied in the United States are now cleaned to some degree before firing, for many of these coals the residual sulfur content requires users to install expensive sulfur removal systems and the residual ash causes boilers to operate inefficiently and to require frequent maintenance. Disposal of the large quantities of slag and ash at utility plant sites can also be problematic and expensive. Improved and advanced coal cleaning processes can reduce the sulfur content of many coals to levels conforming to environmental standards without requiring post-combustion desulfurization systems. Also

  14. Requirements to obtain the recognition of radiological protection experts

    International Nuclear Information System (INIS)

    Arguelles, R.; Villarroel, R.; Senderos, V.; Campos, R.; Pinos, M.; Ponjuan, G.; Franco, P.; Rueda, D.

    2003-01-01

    The scope of this paper is to summarize the general requirements related to education, training and skill of the individual to obtain the recognition of radiological protection experts on ionizing radiation (experts on radiological protection- RP). There has been established two levels according to the grade of responsibility: Qualified expert provided with a diploma given by de Nuclear Safety Council. Technician expert on radiological protection whose certification is made by the Qualified expert that supervise their work. To obtain the diploma of qualified expert is required an official degree, a title of Architecture, Engineering or equivalent in case of no national degrees; specific training on radiological protection (300 hours) and the knowledge on safety and radiological protection of the facilities to be supervised. Three years of experience on radiological protection must be proved. To get the recognition of technician expert on radiological protection is required Formacion Profesional de Grado Superior or equivalent and specific training on safety and radiological protection. Knowledge on basis and principles of radiological protection are required. According to the type of the facilities to be supervised there are two models: A model: to deal with facilities included in RD 1836/1999 (nuclear and radioactive facilities). B model: to deal with medical X rays facilities approved under RD 1891/1991 three months of experience on the selected model must be proved. (Author)

  15. MARBLE: A system for executing expert systems in parallel

    Science.gov (United States)

    Myers, Leonard; Johnson, Coe; Johnson, Dean

    1990-01-01

    This paper details the MARBLE 2.0 system which provides a parallel environment for cooperating expert systems. The work has been done in conjunction with the development of an intelligent computer-aided design system, ICADS, by the CAD Research Unit of the Design Institute at California Polytechnic State University. MARBLE (Multiple Accessed Rete Blackboard Linked Experts) is a system of C Language Production Systems (CLIPS) expert system tool. A copied blackboard is used for communication between the shells to establish an architecture which supports cooperating expert systems that execute in parallel. The design of MARBLE is simple, but it provides support for a rich variety of configurations, while making it relatively easy to demonstrate the correctness of its parallel execution features. In its most elementary configuration, individual CLIPS expert systems execute on their own processors and communicate with each other through a modified blackboard. Control of the system as a whole, and specifically of writing to the blackboard is provided by one of the CLIPS expert systems, an expert control system.

  16. A method for using expert judgement in PSA

    International Nuclear Information System (INIS)

    Pulkkinen, U.; Holmberg, J.

    1997-03-01

    The report discusses an expert judgement methodology development for applications at all levels of probabilistic safety assessment (PSA). The main applications are expected to be at PSA-levels 1 and 2. The method consists of several phases, including the selection and training of the experts, elicitation of experts' judgements, probabilistic modeling and combination of experts' judgements and documentation of the judgement process. The expert training and elicitation process is rather similar to that applied in the NUREG-1150 study. The combination of experts judgements is based on a Bayesian framework utilizing hierarchic models. The posterior distributions of the variables under analysis can be interpreted as a Bayesian counterpart of the combined or aggregated (consensus) distributions, and they are determined by applying Markov chain Monte-Carlo methods. The properties of the method are illustrated by some simple examples. The method is tested in a case study belonging to the benchmark exercise on the use of expert judgement in level 2 PSA, organized as a concerted action of European Commission Fourth Framework Programme on Nuclear Fission Safety. (14 refs.)

  17. Tools and technologies for expert systems: A human factors perspective

    Science.gov (United States)

    Rajaram, Navaratna S.

    1987-01-01

    It is widely recognized that technologies based on artificial intelligence (AI), especially expert systems, can make significant contributions to the productivity and effectiveness of operations of information and knowledge intensive organizations such as NASA. At the same time, these being relatively new technologies, there is the problem of transfering technology to key personnel of such organizations. The problems of examining the potential of expert systems and of technology transfer is addressed in the context of human factors applications. One of the topics of interest was the investigation of the potential use of expert system building tools, particularly NEXPERT as a technology transfer medium. Two basic conclusions were reached in this regard. First, NEXPERT is an excellent tool for rapid prototyping of experimental expert systems, but not ideal as a delivery vehicle. Therefore, it is not a substitute for general purpose system implementation languages such a LISP or C. This assertion probably holds for nearly all such tools on the market today. Second, an effective technology transfer mechanism is to formulate and implement expert systems for problems which members of the organization in question can relate to. For this purpose, the LIghting EnGineering Expert (LIEGE) was implemented using NEXPERT as the tool for technology transfer and to illustrate the value of expert systems to the activities of the Man-System Division.

  18. Water Sensation During Passive Propulsion for Expert and Nonexpert Swimmers.

    Science.gov (United States)

    Kusanagi, Kenta; Sato, Daisuke; Hashimoto, Yasuhiro; Yamada, Norimasa

    2017-06-01

    This study determined whether expert swimmers, compared with nonexperts, have superior movement perception and physical sensations of propulsion in water. Expert (national level competitors, n = 10) and nonexpert (able to swim 50 m in > 3 styles, n = 10) swimmers estimated distance traveled in water with their eyes closed. Both groups indicated their subjective physical sensations in the water. For each of two trials, two-dimensional coordinates were obtained from video recordings using the two-dimensional direct linear transformation method for calculating changes in speed. The mean absolute error of the difference between the actual and estimated distance traveled in the water was significantly lower for expert swimmers (0.90 ± 0.71 meters) compared with nonexpert swimmers (3.85 ± 0.84 m). Expert swimmers described the sensation of propulsion in water in cutaneous terms as the "sense of flow" and sensation of "skin resistance." Therefore, expert swimmers appear to have a superior sense of distance during their movement in the water compared with that of nonexpert swimmers. In addition, expert swimmers may have a better perception of movement in water. We propose that expert swimmers integrate sensations and proprioceptive senses, enabling them to better perceive and estimate distance moved through water.

  19. Expert music performance: cognitive, neural, and developmental bases.

    Science.gov (United States)

    Brown, Rachel M; Zatorre, Robert J; Penhune, Virginia B

    2015-01-01

    In this chapter, we explore what happens in the brain of an expert musician during performance. Understanding expert music performance is interesting to cognitive neuroscientists not only because it tests the limits of human memory and movement, but also because studying expert musicianship can help us understand skilled human behavior in general. In this chapter, we outline important facets of our current understanding of the cognitive and neural basis for music performance, and developmental factors that may underlie musical ability. We address three main questions. (1) What is expert performance? (2) How do musicians achieve expert-level performance? (3) How does expert performance come about? We address the first question by describing musicians' ability to remember, plan, execute, and monitor their performances in order to perform music accurately and expressively. We address the second question by reviewing evidence for possible cognitive and neural mechanisms that may underlie or contribute to expert music performance, including the integration of sound and movement, feedforward and feedback motor control processes, expectancy, and imagery. We further discuss how neural circuits in auditory, motor, parietal, subcortical, and frontal cortex all contribute to different facets of musical expertise. Finally, we address the third question by reviewing evidence for the heritability of musical expertise and for how expertise develops through training and practice. We end by discussing outlooks for future work. © 2015 Elsevier B.V. All rights reserved.

  20. A Belief Rule-Based Expert System to Diagnose Influenza

    DEFF Research Database (Denmark)

    Hossain, Mohammad Shahadat; Khalid, Md. Saifuddin; Akter, Shamima

    2014-01-01

    , development and application of an expert system to diagnose influenza under uncertainty. The recently developed generic belief rule-based inference methodology by using the evidential reasoning (RIMER) approach is employed to develop this expert system, termed as Belief Rule Based Expert System (BRBES......). The RIMER approach can handle different types of uncertainties, both in knowledge representation, and in inference procedures. The knowledge-base of this system was constructed by using records of the real patient data along with in consultation with the Influenza specialists of Bangladesh. Practical case...

  1. Expert system for nuclear power plant feedwater system diagnosis

    International Nuclear Information System (INIS)

    Meguro, R.; Kinoshita, Y.; Sato, T.; Yokota, Y.; Yokota, M.

    1987-01-01

    The Expert System for Nuclear Power Plant Feedwater System Diagnosis has been developed to assist maintenance engineers in nuclear power plants. This system adopts the latest process computer TOSBAC G8050 and the expert system developing tool TDES2, and has a large scale knowledge base which consists of the expert knowledge and experience of engineers in many fields. The man-machine system, which has been developed exclusively for diagnosis, improves the man-machine interface and realizes the graphic displays of diagnostic process and path, stores diagnostic results and searches past reference

  2. Knowledge Representation Using Multilevel Flow Model in Expert System

    International Nuclear Information System (INIS)

    Wang, Wenlin; Yang, Ming

    2015-01-01

    As for the knowledge representation, of course, there are a great many methods available for knowledge representation. These include frames, causal models, and many others. This paper presents a novel method called Multilevel Flow Model (MFM), which is used for knowledge representation in G2 expert system. Knowledge representation plays a vital role in constructing knowledge bases. Moreover, it also has impact on building of generic fault model as well as knowledge bases. The MFM is particularly useful to describe system knowledge concisely as domain map in expert system when domain experts are not available

  3. Expert system for quality control in the INIS database

    International Nuclear Information System (INIS)

    Todeschini, C.; Tolstenkov, A.

    1990-05-01

    An expert system developed to identify input items to INIS database with a high probability of containing errors is described. The system employs a Knowledge Base constructed by the interpretation of a large number of intellectual choices or expert decisions made by human indexers and incorporated in the INIS database. On the basis of the descriptor indexing, the system checks the correctness of the categorization. A notable feature of the system is its capability of self improvement by the continuous updating of the Knowledge Base. The expert system has also been found to be extremely useful in identifying documents with poor indexing. 3 refs, 9 figs

  4. A study on expert system applications for nuclear power plant

    International Nuclear Information System (INIS)

    Huh, Young Hwan; Kim, Kil Yoo; Kang, Soon Ju; Park, Nam Seok; Ryu, Chan Ho; Choi, In Seon; Chung, Young Moo; Chung, Tae Eon; Yim, Chang Jae; Lee, Yoon Sang.

    1990-01-01

    The objectives of this research are 1) to develop an expert system which can automatically evaluate eddy current (EC) signal during an eddy current test (ECT) of SG U tube inspection, 2) to build an effective data base management system for ECT data. By this expert system the reliability in EC signal evaluation can be improved, and the required man-power can be reduced. And this expert system can supply a stable ECT and contribute to a safe operation of the nuclear power plant. (author)

  5. Expert systems for assisting the analysis of hazards

    International Nuclear Information System (INIS)

    Evrard, J.M.; Martinez, J.M.; Souchet, Y.

    1990-01-01

    The advantage of applying expert systems in the analysis of safety in the operation of nuclear power plants is discussed. Expert systems apply a method based on a common representation of nuclear power plants. The main steps of the method are summarized. The applications given concern in the following fields: the analysis of hazards in the electric power supplies of a gas-graphite power plant; the evaluation of the availability of safety procedures in a PWR power plant; the search for the sources of leakage in a PWR power plant. The analysis shows that expert systems are a powerful tool in the study of safety of nuclear power plants [fr

  6. An Expert System for the Development of Efficient Parallel Code

    Science.gov (United States)

    Jost, Gabriele; Chun, Robert; Jin, Hao-Qiang; Labarta, Jesus; Gimenez, Judit

    2004-01-01

    We have built the prototype of an expert system to assist the user in the development of efficient parallel code. The system was integrated into the parallel programming environment that is currently being developed at NASA Ames. The expert system interfaces to tools for automatic parallelization and performance analysis. It uses static program structure information and performance data in order to automatically determine causes of poor performance and to make suggestions for improvements. In this paper we give an overview of our programming environment, describe the prototype implementation of our expert system, and demonstrate its usefulness with several case studies.

  7. Knowledge Representation Using Multilevel Flow Model in Expert System

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Wenlin; Yang, Ming [Harbin Engineering University, Harbin (China)

    2015-05-15

    As for the knowledge representation, of course, there are a great many methods available for knowledge representation. These include frames, causal models, and many others. This paper presents a novel method called Multilevel Flow Model (MFM), which is used for knowledge representation in G2 expert system. Knowledge representation plays a vital role in constructing knowledge bases. Moreover, it also has impact on building of generic fault model as well as knowledge bases. The MFM is particularly useful to describe system knowledge concisely as domain map in expert system when domain experts are not available.

  8. The digital storytelling process: A comparative analysis from various experts

    Science.gov (United States)

    Hussain, Hashiroh; Shiratuddin, Norshuhada

    2016-08-01

    Digital Storytelling (DST) is a method of delivering information to the audience. It combines narrative and digital media content infused with the multimedia elements. In order for the educators (i.e the designers) to create a compelling digital story, there are sets of processes introduced by experts. Nevertheless, the experts suggest varieties of processes to guide them; of which some are redundant. The main aim of this study is to propose a single guide process for the creation of DST. A comparative analysis is employed where ten DST models from various experts are analysed. The process can also be implemented in other multimedia materials that used the concept of DST.

  9. Expert System For Diagnosis Pest And Disease In Fruit Plants

    Science.gov (United States)

    Dewanto, Satrio; Lukas, Jonathan

    2014-03-01

    This paper discussed the development of an expert system to diagnose pests and diseases on fruit plants. Rule base method was used to store the knowledge from experts and literatures. Control technique using backward chain and started from the symptoms to get conclusions about the pests and diseases that occur. Development of the system has been performed using software Corvid Exsys developed by Exsys company. Results showed that the development of this expert system can be used to assist users in identifying the type of pests and diseases on fruit plants. Further development and possibility of using internet for this system are proposed.

  10. USING OF SOFTWARE FOR ESTIMATION OF EXPERT COMPETENCE

    Directory of Open Access Journals (Sweden)

    Oleg N. Velichko

    2015-01-01

    Full Text Available The features of estimation of expert’s competence in the field of higher education are considered, got with a help, both universal statistical software and special software. The comparative analysis of quantitative estimation of expert’s competence is conducted, that showed possibility of forming of the most competent group of experts for realization of necessary group expert estimation in the field of higher education. An analysis showed the high degree of coincidence of results that allow declining less competent experts

  11. PERFORMANCE EVALUATION OF PENSION FUNDS WITH FUZZY EXPERT SYSTEM

    Directory of Open Access Journals (Sweden)

    SERDAR KORUKOĞLU

    2013-06-01

    Full Text Available Financial rating and ranking firms often use linguistic instead of numerical values. When input data are mostly qualitative and are based on subjective knowledge of experts, the Fuzzy Set Theory provides a solid mathematical model to represent and handle these data. The aim of this study is developing a fuzzy expert model to evaluate the performance of the pension funds by using their risk and return values. The method is used for evaluating the performance of the randomly selected of twenty seven Turkish pension funds. The obtained results proved that the fuzzy expert system is appropriate and consistent for performance evaluation.

  12. Topics in expert system design methodologies and tools

    CERN Document Server

    Tasso, C

    1989-01-01

    Expert Systems are so far the most promising achievement of artificial intelligence research. Decision making, planning, design, control, supervision and diagnosis are areas where they are showing great potential. However, the establishment of expert system technology and its actual industrial impact are still limited by the lack of a sound, general and reliable design and construction methodology.This book has a dual purpose: to offer concrete guidelines and tools to the designers of expert systems, and to promote basic and applied research on methodologies and tools. It is a coordinated coll

  13. Use of expert systems in nuclear power plants

    International Nuclear Information System (INIS)

    Uhrig, R.E.

    1989-01-01

    The application of technologies, particularly expert systems, to the control room activities in a nuclear power plant has the potential to reduce operator error and increase plant safety, reliability, and efficiency. Furthermore, there are a large number of nonoperating activities (testing, routine maintenance, outage planning, equipment diagnostics, and fuel management) in which expert systems can increase the efficiency and effectiveness of overall plant and corporate operations. This document presents a number of potential applications of expert systems in the nuclear power field. 36 refs., 2 tabs

  14. Expert system for quality control in the INIS database

    Energy Technology Data Exchange (ETDEWEB)

    Todeschini, C; Tolstenkov, A [International Atomic Energy Agency, Vienna (Austria)

    1990-05-01

    An expert system developed to identify input items to INIS database with a high probability of containing errors is described. The system employs a Knowledge Base constructed by the interpretation of a large number of intellectual choices or expert decisions made by human indexers and incorporated in the INIS database. On the basis of the descriptor indexing, the system checks the correctness of the categorization. A notable feature of the system is its capability of self improvement by the continuous updating of the Knowledge Base. The expert system has also been found to be extremely useful in identifying documents with poor indexing. 3 refs, 9 figs.

  15. An expert system for spare parts inventory control

    International Nuclear Information System (INIS)

    Kim, K.Y.; Chen, P.Y.C.; Okrent, D.

    1987-01-01

    This paper describes an expert system which can handle spare part requirements not only in corrective maintenance (CM) or preventive maintenance (PM), but also when failure rates of components or parts are updated by new data or by predictive maintenance (PDM), and which can also decide optimum stocking level of each spare part. This expert system provides a maintenance (or inventory) manager with an improved basis for decision making in the maintenance related to spare parts. The definitions of PM and PDM from NUREG-1212 (USNRC 1986) are used herein. This expert system used Intellignece/Compiler (Intelligence Ware, 1986) as a language/tool in the IBM-PC

  16. An expert system for the esthetic rating of bridges.

    Science.gov (United States)

    1990-01-01

    The expert system presented should facilitate the in-depth analysis of bridge esthetics and encourage high standards for the appearance of bridges. The procedure described systematically evaluates features of a target bridge in relation to a similar ...

  17. Review of The Rise of the Expert Company

    OpenAIRE

    Chalmers, Robert A.

    1989-01-01

    The authors of this book, Edward A. Feigenbaum, Pamela McCorduck, and H. Penny Nii, have given us an absorbing collection of tales about the successful integration of expert systems into mainstream industry.

  18. An expert system technology for work authorization information systems

    International Nuclear Information System (INIS)

    Munchausen, J.H.; Glazer, K.A.

    1988-01-01

    This paper describes the effort by Southern California Edison Company (SCE) and the Electric Power Research Institute (EPRI) to develop an expert systems work station designed to support the San Onofre Nuclear Generating Station (SONGS). The expert systems work station utilizes IntelliCorp KEE (Knowledge Engineering Environment) and EPRI-IntelliCorp PLEXSYS (PLant EXpert SYStem) technology, and SCE Piping and Instrumentation Diagrams (P and ID's) and host-based computer applications to assist plant operations and maintenance personnel in the development of safety tagout boundaries. Of significance in this venture is the merging of conventional computer applications technology with expert systems technology. The EPRI PLEXSYS work station will act as a front-end for the SONGS Tagout Administration and Generation System (TAGS), a conventional CICS/COBOL mainframe computer application

  19. Telecontrol - Expert systems. Real-time monitoring and remote diagnostic

    Energy Technology Data Exchange (ETDEWEB)

    Lam, A.

    1996-09-01

    The role of expert systems in programming simple and complex tasks in utilities companies was discussed with examples from B.C. Hydro, where expert systems have been used in such diverse applications as an in-house programmable logic controller (PLC) training course, and a machine audit on a 150 MW steam turbine generating unit at their Burrard Thermal Generating Plant. The PLC tutoring program uses expert system technology for the air blast circuit breakers` air drier system, for individualized on-site training. The steam turbine audits (an eight-month long project) were performed remotely by dialing an on-site computer configured with customized expert software. Details of these, and other potential applications, such as transformer monitoring and diagnostics, circuit breaker performance analysis, and information management, were described.

  20. The importance of expert feedback during endovascular simulator training.

    LENUS (Irish Health Repository)

    Boyle, Emily

    2011-07-01

    Complex endovascular skills are difficult to obtain in the clinical environment. Virtual reality (VR) simulator training is a valuable addition to current training curricula, but is there a benefit in the absence of expert trainers?

  1. Critical review of expert system validation in transportation

    Science.gov (United States)

    1997-01-01

    Expert system validationthat is, testing systems to ascertain whether they achieve acceptable performance levelshas with few exceptions been ad hoc, informal, and of dubious value. Very few efforts have been made in this regard in the transport...

  2. Experiment with expert system guidance of an engineering analysis task

    International Nuclear Information System (INIS)

    Ransom, V.H.; Fink, R.K.; Callow, R.A.

    1986-01-01

    An experiment is being conducted in which expert systems are used to guide the performance of an engineering analysis task. The task chosen for experimentation is the application of a large thermal hydraulic transient simulation computer code. The expectation from this work is that the expert system will result in an improved analytical result with a reduction in the amount of human labor and expertise required. The code associated functions of model formulation, data input, code execution, and analysis of the computed output have all been identified as candidate tasks that could benefit from the use of expert systems. Expert system modules have been built for the model building and data input task. Initial results include the observation that human expectations of an intelligent environment rapidly escalate and structured or stylized tasks that are tolerated in the unaided system are frustrating within the intelligent environment

  3. The commission of independent experts has labeled Mochovce as safe

    International Nuclear Information System (INIS)

    Grujbar, V.

    1998-01-01

    An independent commission of experts, appointed by IAEA, said that it did not find any faults concerning the integrity of the pressure vessel of the reactor in first block of the NPP Mochovce. The commission, comprising experts from the U.S.A., Belgium, Finland, Germany and Russia, was given the same documents as the Austrian mission, appointed by the office of the Austrian Chancellor, in May. The Austrian experts then expressed two serious concerns about the security of the first block in Mochovce.The experts of the IAEA agreed that the real condition of Mochovce is a lot better that shown in the technical documentation and they did not find any faults. IAEA was in this case, for the first time, an arbiter solving an international dispute about security of a NPP

  4. Team of experts concludes review of safety issues at Temelin

    International Nuclear Information System (INIS)

    2001-01-01

    Full text: At the request of the Czech Government, the International Atomic Energy Agency (IAEA) assembled a team of national experts from Bulgaria, France, Germany, Spain, and the United Kingdom, with an observer from Austria, to review safety issues at the Temelin power plant that were identified in 1996 as relevant to reactors of the generic Temelin design (WWER-1000/320 type). Following a detailed on-site review from 18 to 23 November 2001, the experts concluded that most identified issues had been addressed and resolved. Work is continuing on the few remaining issues. These issues, however, are not judged by them to be significant and would not from the experts' standpoint preclude the safe operation of the Temelin nuclear power plant. The final report of the team of experts will be available to the Czech Government in one month's time. (author)

  5. Expert system for controlling plant growth in a contained environment

    Science.gov (United States)

    May, George A. (Inventor); Lanoue, Mark Allen (Inventor); Bethel, Matthew (Inventor); Ryan, Robert E. (Inventor)

    2011-01-01

    In a system for optimizing crop growth, vegetation is cultivated in a contained environment, such as a greenhouse, an underground cavern or other enclosed space. Imaging equipment is positioned within or about the contained environment, to acquire spatially distributed crop growth information, and environmental sensors are provided to acquire data regarding multiple environmental conditions that can affect crop development. Illumination within the contained environment, and the addition of essential nutrients and chemicals are in turn controlled in response to data acquired by the imaging apparatus and environmental sensors, by an "expert system" which is trained to analyze and evaluate crop conditions. The expert system controls the spatial and temporal lighting pattern within the contained area, and the timing and allocation of nutrients and chemicals to achieve optimized crop development. A user can access the "expert system" remotely, to assess activity within the growth chamber, and can override the "expert system".

  6. Problematic Aspects of the Use of Expert Systems in Law

    Directory of Open Access Journals (Sweden)

    Marius Kalinauskas

    2011-08-01

    Full Text Available Summary. The usage of expert systems in law brings many problematic questions. Complexity and intricacy of law, combined with limited possibilities of information technologies makes it difficult to create flawlessly working expert systems. In this article the author analyses problematic aspects related to expert system usage in law. Comparisons of various research are made according to analysis of scientific articles. The author analyses practical difficulties of legal norm representation, creation of expert knowledge ontology, expert systems liability issues. Legal responsibility of expert system developers, users, and owners are also covered in this paper. Creation of legal ontologies is a complicated process because of the nature of the subject itself and the complexity and quantity of knowledge which must be represented in order to have fully functional legal expert system. Legal information basically consists of legal norms, doctrine, precedents and expert knowledge. All of these areas have specific representation issues, but the most difficult part is to make ontology and representation of expert knowledge. Different experts may have distinct points of view in some similar cases. Human decisions are made not only by applying certain rules to the problem decision pattern. Providence, analytical skills and critical thinking is required in legal professional work. Human reasoning and decision-making is not only based on symbolic values, it also consists of intermediate symbolic assumptions. So the question is: is it possible to give a clear structure to something which has no permanent state? The other problem which is analyzed in this article is artificial reasoning methods, which are basically different forms of pattern recognition with some specific methods applied to them. The second part of the paper analyses the liability of expert systems. Nowadays expert systems can’t be legally responsible for their decisions. They lack

  7. Problematic Aspects of the Use of Expert Systems in Law

    Directory of Open Access Journals (Sweden)

    Marius Kalinauskas

    2013-08-01

    Full Text Available The usage of expert systems in law brings many problematic questions. Complexity and intricacy of law, combined with limited possibilities of information technologies makes it difficult to create flawlessly working expert systems. In this article the author analyses problematic aspects related to expert system usage in law. Comparisons of various research are made according to analysis of scientific articles. The author analyses practical difficulties of legal norm representation, creation of expert knowledge ontology, expert systems liability issues. Legal responsibility of expert system developers, users, and owners are also covered in this paper. Creation of legal ontologies is a complicated process because of the nature of the subject itself and the complexity and quantity of knowledge which must be represented in order to have fully functional legal expert system. Legal information basically consists of legal norms, doctrine, precedents and expert knowledge. All of these areas have specific representation issues, but the most difficult part is to make ontology and representation of expert knowledge. Different experts may have distinct points of view in some similar cases. Human decisions are made not only by applying certain rules to the problem decision pattern. Providence, analytical skills and critical thinking is required in legal professional work. Human reasoning and decision-making is not only based on symbolic values, it also consists of intermediate symbolic assumptions. So the question is: is it possible to give a clear structure to something which has no permanent state? The other problem which is analyzed in this article is artificial reasoning methods, which are basically different forms of pattern recognition with some specific methods applied to them. The second part of the paper analyses the liability of expert systems. Nowadays expert systems can’t be legally responsible for their decisions. They lack intellectual

  8. Risk communication between Experts and the Public: Perceptions and Intentions

    International Nuclear Information System (INIS)

    Sjoeberg, Lennart; Verhost, Philippe; Bouzon, Arlette

    2002-01-01

    This paper develops a conceptual and theoretical analysis of risk communication in cases where experts and the public have widely divergent views about the size of a risk: experts find it very small but some members of the public have an opposite view. Other members of the public agree with the experts. Applications are chosen from the risk management problems inhere in the handling of spent nuclear fuel. It is pointed out that the conflicting views have very different bases.The role of trust is analyzed and while it is a crucial issue, it is much broader than what has usually been assumed. Trust refers not only to social trust (i.e. trust in experts or authorities/corporation) but also to basic notions regarding knowledge and science. In a communication situation, the communicated position with regard to risk seems may not be perceived correctly by any of the parties, and positions tend to be entrenched

  9. Was the Conconi test validated by sporting success, expert opinion ...

    African Journals Online (AJOL)

    Was the Conconi test validated by sporting success, expert opinion or good science? ... Open Access DOWNLOAD FULL TEXT ... Despite scientific evidence to the contrary, a popular incremental field test for endurance athletes (Conconi Test) ...

  10. An Expert support model for ex situ soil remediation

    NARCIS (Netherlands)

    Okx, J.P.; Frankhuizen, E.M.; Wit, de J.C.; Pijls, C.G.J.M.; Stein, A.

    2000-01-01

    This paper presents an expert support model recombining knowledge and experience obtained during ex situ soil remediation. To solve soil remediation problems, an inter-disciplinary approach is required. Responsibilities during the soil remediation process, however, are increasingly decentralised,

  11. [Development of expert diagnostic system for common respiratory diseases].

    Science.gov (United States)

    Xu, Wei-hua; Chen, You-ling; Yan, Zheng

    2014-03-01

    To develop an internet-based expert diagnostic system for common respiratory diseases. SaaS system was used to build architecture; pattern of forward reasoning was applied for inference engine design; ASP.NET with C# from the tool pack of Microsoft Visual Studio 2005 was used for website-interview medical expert system.The database of the system was constructed with Microsoft SQL Server 2005. The developed expert system contained large data memory and high efficient function of data interview and data analysis for diagnosis of various diseases.The users were able to perform this system to obtain diagnosis for common respiratory diseases via internet. The developed expert system may be used for internet-based diagnosis of various respiratory diseases,particularly in telemedicine setting.

  12. Experts discuss unconventional conflicts in the Americas | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2015-07-10

    Jul 10, 2015 ... Experts discuss unconventional conflicts in the Americas ... in illicit activities — like drug smuggling and illegal mining — that destabilize societies and ruin lives. ... Social exclusion and "violences" in Central American cities.

  13. Quality dependent fusion of intramodal and multimodal biometric experts

    Science.gov (United States)

    Kittler, J.; Poh, N.; Fatukasi, O.; Messer, K.; Kryszczuk, K.; Richiardi, J.; Drygajlo, A.

    2007-04-01

    We address the problem of score level fusion of intramodal and multimodal experts in the context of biometric identity verification. We investigate the merits of confidence based weighting of component experts. In contrast to the conventional approach where confidence values are derived from scores, we use instead raw measures of biometric data quality to control the influence of each expert on the final fused score. We show that quality based fusion gives better performance than quality free fusion. The use of quality weighted scores as features in the definition of the fusion functions leads to further improvements. We demonstrate that the achievable performance gain is also affected by the choice of fusion architecture. The evaluation of the proposed methodology involves 6 face and one speech verification experts. It is carried out on the XM2VTS data base.

  14. Expert systems for space power supply: design, analysis, and evaluation

    International Nuclear Information System (INIS)

    Cooper, R.S.; Thomson, M.K.; Hoshor, A.

    1987-01-01

    The authors evaluated the feasibility of applying expert systems to the conceptual design, analysis, and evaluation of space power supplies in particular, and complex systems in general. To do this, they analyzed the space power supply design process and in associated knowledge base, and characterized them in a form suitable for computer emulation of a human expert. The existing expert system tools and the results achieved with them were evaluated to assess their applicability to power system design. They applied some new concepts for combining program architectures (modular expert systems and algorithms) with information about the domain to create a deep system for handling the complex design problem. They authors developed, programmed and tested NOVICE, a code to solve a simplified version of a scoping study of a wide variety of power supply types for a broad range of missions, as a concrete feasibility demonstration

  15. How clear is transparent? Reporting expert reasoning in legal cases

    NARCIS (Netherlands)

    Sjerps, M.J.; Berger, C.E.H.

    2012-01-01

    Experts providing evidence in legal cases are universally recommended to be transparent, particularly in their reasoning, so that legal practitioners can critically check whether the conclusions are adequately supported by the results. However, when exploring the practical meaning of this

  16. The Standards in Admitting Expert Evidence in Ethiopia

    African Journals Online (AJOL)

    Abreha Mesele Zinabu

    ... that might have been of greater assistance to a jury was excluded.13 This approach puts limits on .... expert evidence because the laws are not adequately comprehensive. In effect, .... its relevancy, materiality and validity. In criminal cases ...

  17. Slechtnieuwsbrieven als genre: leren via observaties van experts

    NARCIS (Netherlands)

    Leijten, Marielle; De Smet, Milou; Van Waes, Luuk

    2011-01-01

    Leijten, M., De Smet, M. J. R., & Van Waes, L. (2011, June). Slechtnieuwsbrieven als genre: leren via observaties van experts. Presentation at the Onderwijs Research Dagen (ORD), Maastricht, The Netherlands.

  18. Instructional Design Thought Processes of Expert Nurse Educators

    OpenAIRE

    Gross, Monty Dale

    2006-01-01

    This study explores how expert nurse educators design instruction. Six female expert nurse educators volunteered to participate. Each participant had over ten years experience teaching, and all were recognized for their teaching excellence. They also had master's or doctoral degrees. Participants worked in small private schools, community colleges, or large public universities. The methodology was based in developmental research. Qualitative data sources included interviews, think-aloud proto...

  19. An Embedded Rule-Based Diagnostic Expert System in Ada

    Science.gov (United States)

    Jones, Robert E.; Liberman, Eugene M.

    1992-01-01

    Ada is becoming an increasingly popular programming language for large Government-funded software projects. Ada with it portability, transportability, and maintainability lends itself well to today's complex programming environment. In addition, expert systems have also assumed a growing role in providing human-like reasoning capability expertise for computer systems. The integration is discussed of expert system technology with Ada programming language, especially a rule-based expert system using an ART-Ada (Automated Reasoning Tool for Ada) system shell. NASA Lewis was chosen as a beta test site for ART-Ada. The test was conducted by implementing the existing Autonomous Power EXpert System (APEX), a Lisp-based power expert system, in ART-Ada. Three components, the rule-based expert systems, a graphics user interface, and communications software make up SMART-Ada (Systems fault Management with ART-Ada). The rules were written in the ART-Ada development environment and converted to Ada source code. The graphics interface was developed with the Transportable Application Environment (TAE) Plus, which generates Ada source code to control graphics images. SMART-Ada communicates with a remote host to obtain either simulated or real data. The Ada source code generated with ART-Ada, TAE Plus, and communications code was incorporated into an Ada expert system that reads the data from a power distribution test bed, applies the rule to determine a fault, if one exists, and graphically displays it on the screen. The main objective, to conduct a beta test on the ART-Ada rule-based expert system shell, was achieved. The system is operational. New Ada tools will assist in future successful projects. ART-Ada is one such tool and is a viable alternative to the straight Ada code when an application requires a rule-based or knowledge-based approach.

  20. ASSESSMENT OF POWER QUALITY DISTURBANCE USING EXPERT SYSTEM

    OpenAIRE

    A.N.MALLESWARA RAO,; Dr. K.RAMESH REDDY,; Dr. B.V.SANKER RAM

    2011-01-01

    This paper describes a fuzzy expert system in order to understand and deal with power quality problems encountered in distribution systems in a better way. Because of the technology and software now available this monitoring is highly effective, the fuzzy expert system not only can provide information about the quality of the power and the causes of power system disturbances, but it can identify problem conditions throughout the system before they cause widespread customer complains and equip...

  1. Information encryption in the expert management of strategic uncertainty

    OpenAIRE

    Frey, Seth; Williams, Paul L.; Albino, Dominic K.

    2016-01-01

    Strategic agents in incomplete-information environments have a conflicted relationship with uncertainty: it can keep them unpredictable to their opponents, but it must also be overcome to predict the actions of those opponents. We use a multivariate generalization of information theory to characterize the information processing behavior of strategic reasoning experts. We compare expert and novice poker players --- "sharks" and "fish" --- over 1.75 million hands of online two-player No-Limit T...

  2. Estimating unknown parameters in haemophilia using expert judgement elicitation.

    Science.gov (United States)

    Fischer, K; Lewandowski, D; Janssen, M P

    2013-09-01

    The increasing attention to healthcare costs and treatment efficiency has led to an increasing demand for quantitative data concerning patient and treatment characteristics in haemophilia. However, most of these data are difficult to obtain. The aim of this study was to use expert judgement elicitation (EJE) to estimate currently unavailable key parameters for treatment models in severe haemophilia A. Using a formal expert elicitation procedure, 19 international experts provided information on (i) natural bleeding frequency according to age and onset of bleeding, (ii) treatment of bleeds, (iii) time needed to control bleeding after starting secondary prophylaxis, (iv) dose requirements for secondary prophylaxis according to onset of bleeding, and (v) life-expectancy. For each parameter experts provided their quantitative estimates (median, P10, P90), which were combined using a graphical method. In addition, information was obtained concerning key decision parameters of haemophilia treatment. There was most agreement between experts regarding bleeding frequencies for patients treated on demand with an average onset of joint bleeding (1.7 years): median 12 joint bleeds per year (95% confidence interval 0.9-36) for patients ≤ 18, and 11 (0.8-61) for adult patients. Less agreement was observed concerning estimated effective dose for secondary prophylaxis in adults: median 2000 IU every other day The majority (63%) of experts expected that a single minor joint bleed could cause irreversible damage, and would accept up to three minor joint bleeds or one trauma related joint bleed annually on prophylaxis. Expert judgement elicitation allowed structured capturing of quantitative expert estimates. It generated novel data to be used in computer modelling, clinical care, and trial design. © 2013 John Wiley & Sons Ltd.

  3. Topics for application of expert systems for nuclear power plants

    International Nuclear Information System (INIS)

    Trovato, S.A.; Aydin, F.

    1992-01-01

    Expert systems are an innovative form of computer software which offer to enhance productivity and improve operations of nuclear power plants. A survey and assessment of opportunities for application of this technology at Consolidated Edison Company of New York, Inc.'s (Con Edison) Indian Point 2 nuclear power plant was conducted. Eleven topics for expert systems are discussed in this paper. 1 ref., 2 figs., 2 tabs

  4. Processing Expert Judgements in Accident Consequence Modelling (invited paper)

    International Nuclear Information System (INIS)

    Kraan, B.C.P.; Cooke, R.M.

    2000-01-01

    In performing uncertainty analysis a distribution on the code input parameters is required. The construction of the distribution on the code input parameters for the joint CEC/USNRC Accident Consequence Code Uncertainty Analysis using Expert Judgement is discussed. An example from the food chain module is used to illustrate the construction. Different mathematical techniques have been developed to transform the expert judgements into the required format. Finally, the effect of taking account of correlations in performing uncertainty analysis is investigated. (author)

  5. Computer-assisted expert case definition in electronic health records.

    Science.gov (United States)

    Walker, Alexander M; Zhou, Xiaofeng; Ananthakrishnan, Ashwin N; Weiss, Lisa S; Shen, Rongjun; Sobel, Rachel E; Bate, Andrew; Reynolds, Robert F

    2016-02-01

    To describe how computer-assisted presentation of case data can lead experts to infer machine-implementable rules for case definition in electronic health records. As an illustration the technique has been applied to obtain a definition of acute liver dysfunction (ALD) in persons with inflammatory bowel disease (IBD). The technique consists of repeatedly sampling new batches of case candidates from an enriched pool of persons meeting presumed minimal inclusion criteria, classifying the candidates by a machine-implementable candidate rule and by a human expert, and then updating the rule so that it captures new distinctions introduced by the expert. Iteration continues until an update results in an acceptably small number of changes to form a final case definition. The technique was applied to structured data and terms derived by natural language processing from text records in 29,336 adults with IBD. Over three rounds the technique led to rules with increasing predictive value, as the experts identified exceptions, and increasing sensitivity, as the experts identified missing inclusion criteria. In the final rule inclusion and exclusion terms were often keyed to an ALD onset date. When compared against clinical review in an independent test round, the derived final case definition had a sensitivity of 92% and a positive predictive value of 79%. An iterative technique of machine-supported expert review can yield a case definition that accommodates available data, incorporates pre-existing medical knowledge, is transparent and is open to continuous improvement. The expert updates to rules may be informative in themselves. In this limited setting, the final case definition for ALD performed better than previous, published attempts using expert definitions. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  6. Aerodynamics of the EXPERT Re-Entry Ballistic Vehicle

    Science.gov (United States)

    Kharitonov, A. M.; Adamov, N. P.; Mazhul, I. I.; Vasenyov, L. G.; Zvegintsev, V. I.; Muylaert, J. M.

    2009-01-01

    Since 2002 till now, experimental studies of the EXPERT reentry capsule have been performed in ITAM SB RAS wind tunnels. These studies have been performed in consecutive ISTC project No. 2109, 3151, and currently ongoing project No. 3550. The results of earlier studies in ITAM wind tunnels can be found in [1-4]. The present paper describes new data obtained for the EXPERT model.

  7. Characterizing Health-Related Information Needs of Domain Experts

    OpenAIRE

    Znaidi , Eya; Tamine , Lynda; Chouquet , Cécile; Latiri , Chira

    2013-01-01

    International audience; In information retrieval literature, understanding the users’ intents behind the queries is critically important to gain a better insight of how to select relevant results. While many studies investigated how users in general carry out exploratory health searches in digital environments, a few focused on how are the queries formulated, specifically by domain expert users. This study intends to fill this gap by studying 173 health expert queries issued from 3 medical in...

  8. A prototype nuclear emergency response decision making expert system

    International Nuclear Information System (INIS)

    Chang, C.; Shih, C.; Hong, M.; Yu, W.; Su, M.; Wang, S.

    1990-01-01

    A prototype of emergency response expert system developed for nuclear power plants, has been fulfilled by Institute of Nuclear Energy Research. Key elements that have been implemented for emergency response include radioactive material dispersion assessment, dynamic transportation evacuation assessment, and meteorological parametric forecasting. A network system consists of five 80386 Personal Computers (PCs) has been installed to perform the system functions above. A further project is still continuing to achieve a more complicated and fanciful computer aid integral emergency response expert system

  9. A literature review of expert problem solving using analogy

    OpenAIRE

    Mair, C; Martincova, M; Shepperd, MJ

    2009-01-01

    We consider software project cost estimation from a problem solving perspective. Taking a cognitive psychological approach, we argue that the algorithmic basis for CBR tools is not representative of human problem solving and this mismatch could account for inconsistent results. We describe the fundamentals of problem solving, focusing on experts solving ill-defined problems. This is supplemented by a systematic literature review of empirical studies of expert problem solving of non-trivial pr...

  10. A living PSA based on use of expert systems

    International Nuclear Information System (INIS)

    Ancelin, C.; Bouissou, M.; Le, P.; De Saint-Quentin, S.; Villatte, N.

    1989-01-01

    This paper presents the expert systems that are developed by EDF in the framework of the French PSA. Aimed at automatically generating reliability models (fault trees, state graphs....), these expert systems are used for the reliability studies of safety systems in the Paluel nuclear power plant. Beyond the description of the implemented method, this paper insists on the new approach proposed to the reliability engineer, when using artificial intelligence techniques

  11. An expert system to estimate SNM production at LWR systems

    International Nuclear Information System (INIS)

    Sandquist, G.M.; Allison, J.L.; Rogers, V.C.

    1988-01-01

    An artificial intelligence expert system, analysis of proliferation by expert system (APES), has been developed and tested to permit a nonexpert to quickly evaluate the capabilities and capacities of a reactor and reprocessing system for producing and separating plutonium [special nuclear material (SNM)] even when system information may be limited and uncertain. The present analysis domain of APES is directed at light water reactors and Purex reprocessing, but extension of the domain is planned

  12. A brief history and technical review of the expert system research

    Science.gov (United States)

    Tan, Haocheng

    2017-09-01

    The expert system is a computer system that emulates the decision-making ability of a human expert, which aims to solve complex problems by reasoning knowledge. It is an important branch of artificial intelligence. In this paper, firstly, we briefly introduce the development and basic structure of the expert system. Then, from the perspective of the enabling technology, we classify the current expert systems and elaborate four expert systems: The Rule-Based Expert System, the Framework-Based Expert System, the Fuzzy Logic-Based Expert System and the Expert System Based on Neural Network.

  13. The technical qualified expert on radiation protection in Spain

    International Nuclear Information System (INIS)

    Marco Arboli, M.; Rodriguez Suarez, M.

    2002-01-01

    Education and training is considered an important tool for promoting safety culture and improving the level of competence of workers. In the different disciplines involved in Radiation Protection (PR), training programmes are being revised to ensure effective protection of individuals. In the European Union framework, the new normative and its adaptation in the Member States, as well as the past actions in each country, make the community to conclude that harmonization of educational programmes and European recognition of the qualification must be reached. An important point of these actions is the definition of the European Qualified Expert. Article 38 of the EURATOM Basic Safety Standards imposes requirements on training and education of the qualified experts and their exchange within the European Union. Since then, there has been many initiatives to seek to harmonization of the qualified expert requirements. In the Spanish education system, there has been a standard training and competent authority recognition of the high level qualified experts on radiation protection since 1986, whose programme is continuously being updating and improving. Taking into account the European actions to define the qualified expert training requirements, it has been designed an educational course for the Technical Qualified Expert on Radiation Protection. This pilot course has being carried out during May, 2002. The results of this project is shown in this paper. (Author)

  14. Adaptability of expert visual anticipation in baseball batting.

    Science.gov (United States)

    Müller, Sean; Fadde, Peter J; Harbaugh, Allen G

    2017-09-01

    By manipulating stimulus variation in terms of opponent pitcher actions, this study investigated the capability of expert (n = 30) and near-expert (n = 95) professional baseball batters to adapt anticipation skill when using the video simulation temporal occlusion paradigm. Participants watched in-game footage of two pitchers, one after the other, that was temporally occluded at ball release and various points during ball flight. They were required to make a written prediction of pitch types and locations. Per cent accuracy was calculated for pitch type, for pitch location, and for type and location combined. Results indicated that experts and near-experts could adapt their anticipation to predict above guessing level across both pitchers, but adaptation to the left-handed pitcher was poorer than the right-handed pitcher. Small-to-moderate effect sizes were found in terms of superior adaptation by experts over near-experts at the ball release and early ball flight occlusion conditions. The findings of this study extend theoretical and applied knowledge of expertise in striking sports. Practical application of the instruments and findings are discussed in terms of applied researchers, practitioners and high-performance staff in professional sporting organisations.

  15. A theory of expert leadership (TEL) in psychiatry.

    Science.gov (United States)

    Goodall, Amanda H

    2016-06-01

    Leaders' technical competence - 'expert knowledge' - has been shown in many settings to be associated with better organizational performance. In universities, for example, there is longitudinal evidence that research-focused scholars make the best leaders; results from a hospital study show that doctors instead of professional managers are most closely associated with the best performing institutions. To explain these patterns, and raise hypotheses, a theory of expert leadership (TEL) has been developed that might explain these patterns. In this paper the framework for expert leadership is applied to psychiatry. The TEL proposes that psychiatric leaders, as opposed to non-expert managers, improve organizational performance through several channels. First, experts' knowledge influences organizational strategy. Second, having been 'one of them', a psychiatrist understands how to create the optimal work environment for psychiatric teams, through appropriate goal-setting, evaluation and support. These factors are positively associated with workers' wellbeing and performance. Third, exceptional psychiatrist-leaders are likely to set high standards for hiring. Fourth, leaders' credibility extends their influence among core workers, and also signals organizational priorities to stakeholders. Finally, a necessary prerequisite of TEL is that expert leaders have direct executive power inclusive of budgetary and strategic oversight. © The Royal Australian and New Zealand College of Psychiatrists 2015.

  16. Expert systems applied to two problems in nuclear power plants

    International Nuclear Information System (INIS)

    Kim, K.Y.

    1988-01-01

    This dissertation describes two prototype expert systems applied to two problems in nuclear power plants. One problem is spare parts inventory control, and the other one is radionuclide release from containment during severe accident. The expert system for spare parts inventory control can handle spare parts requirements not only in corrective, preventive, or predictive maintenance, but also when failure rates of components or parts are updated by new data. Costs and benefits of spare parts inventory acquisition are evaluated with qualitative attributes such as spare part availability to provide the inventory manager with an improved basis for decision making. The expert system is implemented with Intelligence/Compiler on an IBM-AT. The other expert system for radionuclide release from containment can estimate magnitude, type, location, and time of release of radioactive materials from containment during a severe accident nearly on line, based on the actual measured physical parameters such as temperature and pressure inside the containment. The expert system has a function to check the validation of sensor data. The expert system is implemented with KEE on a Symbolics LISP machine

  17. Expert elicitation and the problem of detecting undeclared activities

    International Nuclear Information System (INIS)

    Pilat, Joseph F.; Sylvester, Kori Budlong; Stanbro, William D.

    2002-01-01

    Measures applicable to the detection of undeclared activities are not well established, and their effectiveness is uncertain. To detect clandestine paths, the IAEA is still developing processes and procedures. As the Agency gains experience with new measures and with integrated safeguards, dealing with such problems may become more experience-based and perhaps more closely parallel the process with current safeguards where detection probabilities for the measures to be utilized on declared paths are well characterized. Whether or not this point will be reached for undeclared and mixed paths, the only tool that appears suitable at present for the purpose of generating a reasonable detection probability that can over time be tested against reality and, if necessary, adjusted is formal expert judgment, or expert elicitation. Formal expert elicitation is a structured process that makes use of people knowledgeable in certain areas to make assessments. To provide a 'proof of principle' of this methodology for presentation to the Agency, experts in nuclear technology, nonproliferation, safeguards and open source information, as well as in formal expert elicitation processes, engaged in three illustrative expert elicitations on assessing information analysis as a means to detect undeclared activities. These elicitations were successful. This paper will discuss the process of and issues raised by the elicitations.

  18. Cooperating expert systems for space station power distribution management

    International Nuclear Information System (INIS)

    Nguyen, T.A.; Chiou, W.C.

    1986-01-01

    In a complex system such as the manned Space Station, it is deemed necessary that many expert systems must perform tasks in a concurrent and cooperative manner. An important question to arise is: what cooperative-task-performing models are appropriate for multiple expert systems to jointly perform tasks. The solution to this question will provide a crucial automation design criteria for the Space Station complex systems architecture. Based on a client/server model for performing tasks, the authors have developed a system that acts as a front-end to support loosely-coupled communications between expert systems running on multiple Symbolics machines. As an example, they use the two ART*-based expert systems to demonstrate the concept of parallel symbolic manipulation for power distribution management and dynamic load planner/scheduler in the simulated Space Station environment. This on-going work will also explore other cooperative-task-performing models as alternatives which can evaluate inter and intra expert system communication mechanisms. It will serve as a testbed and a bench-marking tool for other Space Station expert subsystem communication and information exchange

  19. Cooperating Expert Systems For Space Station Power Distribution Management

    Science.gov (United States)

    Nguyen, T. A.; Chiou, W. C.

    1987-02-01

    In a complex system such as the manned Space Station, it is deem necessary that many expert systems must perform tasks in a concurrent and cooperative manner. An important question arise is: what cooperative-task-performing models are appropriate for multiple expert systems to jointly perform tasks. The solution to this question will provide a crucial automation design criteria for the Space Station complex systems architecture. Based on a client/server model for performing tasks, we have developed a system that acts as a front-end to support loosely-coupled communications between expert systems running on multiple Symbolics machines. As an example, we use two ART*-based expert systems to demonstrate the concept of parallel symbolic manipulation for power distribution management and dynamic load planner/scheduler in the simulated Space Station environment. This on-going work will also explore other cooperative-task-performing models as alternatives which can evaluate inter and intra expert system communication mechanisms. It will be served as a testbed and a bench-marking tool for other Space Station expert subsystem communication and information exchange.

  20. Classification of health webpages as expert and non expert with a reduced set of cross-language features.

    Science.gov (United States)

    Grabar, Natalia; Krivine, Sonia; Jaulent, Marie-Christine

    2007-10-11

    Making the distinction between expert and non expert health documents can help users to select the information which is more suitable for them, according to whether they are familiar or not with medical terminology. This issue is particularly important for the information retrieval area. In our work we address this purpose through stylistic corpus analysis and the application of machine learning algorithms. Our hypothesis is that this distinction can be performed on the basis of a small number of features and that such features can be language and domain independent. The used features were acquired in source corpus (Russian language, diabetes topic) and then tested on target (French language, pneumology topic) and source corpora. These cross-language features show 90% precision and 93% recall with non expert documents in source language; and 85% precision and 74% recall with expert documents in target language.