Geophysical analysis for the Ada Tepe region (Bulgaria) - case study
Trifonova, Petya; Metodiev, Metodi; Solakov, Dimcho; Simeonova, Stela; Vatseva, Rumiana
2013-04-01
According to the current archeological investigations Ada Tepe is the oldest gold mine in Europe with Late Bronze and Early Iron age. It is a typical low-sulfidation epithermal gold deposit and is hosted in Maastrichtian-Paleocene sedimentary rocks above a detachment fault contact with underlying Paleozoic metamorphic rocks. Ada Tepe (25o.39'E; 41o.25'N) is located in the Eastern Rhodope unit. The region is highly segmented despite the low altitude (470-750 m) due to widespread volcanic and sediment rocks susceptible to torrential erosion during the cold season. Besides the thorough geological exploration focused on identifying cost-effective stocks of mineral resources, a detailed geophysical analysis concernig diferent stages of the gold extraction project was accomplished. We present the main results from the geophysical investigation aimed to clarify the complex seismotectonic setting of the Ada Tepe site region. The overall study methodology consists of collecting, reviewing and estimating geophysical and seismological information to constrain the model used for seismic hazard assessment of the area. Geophysical information used in the present work consists of gravity, geomagnetic and seismological data. Interpretation of gravity data is applied to outline the axes of steep gravity transitions marked as potential axes of faults, flexures and other structures of dislocation. Direct inverse techniques are also utilized to estimate the form and depth of anomalous sources. For the purposes of seismological investigation of the Ada Tepe site region an earthquake catalogue is compiled for the time period 510BC - 2011AD. Statistical parameters of seismicity - annual seismic rate parameter, ?, and the b-value of the Gutenberg-Richter exponential relation for Ada Tepe site region, are estimated. All geophysical datasets and derived results are integrated using GIS techniques ensuring interoperability of data when combining, processing and visualizing obtained
GÖBEKLI TEPE: AN OUTSTANDING PRE-POTTERY NEOLITHIC SITE IN THE GERMUŞ MOUNTAINS
DEFF Research Database (Denmark)
Kinzel, Moritz
as previously thought). Since the first excavations, starting in the mid-1990s, Göbekli Tepe has repeatedly been referred to as a mountain sanctuary and pilgrimage site. However, more recent fieldwork is now beginning to reveal a more complex story. New archaeological results and the re-appraisal of existing...
A technological study of Hassuna culture ceramics (Yarim Tepe I settlement
Directory of Open Access Journals (Sweden)
Natalia Yu. Petrova
2012-12-01
Full Text Available The article presents the results of a comparative technological analysis of Hassuna culture pottery from Yarim Tepe I (6th millennium BC from the lower and middle horizons. The technological stages of selecting the clay and organic materials, the composition of the clay paste and the surface treatment, but also certain issues related to the ornamentation and firing of the pottery are presented in the article.
Lifescience Database Archive (English)
Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...
OPHRYS GENERA IN THE TERRITORY OF THE TEPE-OBA BOTANICAL RESERVE. POPULATION'S ANALYSIS
Directory of Open Access Journals (Sweden)
Viktoria Ju. Letukhova
2017-01-01
Full Text Available Abstract. Aim. To determine the amount and age structure of Ophrys oestrifera and O. apifera populations on the territory of the Tepe-Oba botanical reserve (South-East Crimea, study the morphological features of plants. To evaluate the current populations' state and identify factors of threats. Material. Three populations of Ophrys oestrifera and one population of O. apifera were found and studied on the territory of Tepe-Oba, their quantitative and age composition (structure were determined, vitality of individuals for O. oestrifera populations was defined. Results. O. oestrifera grows in three localities on the areas of 10 to 400 m2 and in the numbers of 28 to 342 individuals. The population of O. apifera has its area of 10 m2 and its size is 15 generative specimens. Populations O. oestrifera No. 1, 2 are young, normal and stable. Populations of O. oestrifera No. 3 and O. apifera have not yet reached their dynamic equilibrium (balance. O. oestrifera index of vitality doesn't significantly different in three populations (IVC=1,00– 1,09, that indicates approximately the same kind of growing conditions in the studying territory. However, growing in the same conditions O. apifera has some biometric differences from the O. oestrifera. For example, O. oestrifera plants are 1.5 times higher, inflorescence length is on average 2.5–3 times longer, and number of flowers in the inflorescence is 1,5 times more than those O. apifera. Main conclusions. The condition of O. oestrifera population in the territory of Tepe-Oba is satisfactory. Insignificant differences diversity in their vital structure can be associated with a e condition of O. apifera population is threatening because of its low size, small area and the lack of pregenerative plants in the age spectrum.
JB*-Algebras of Topological Stable Rank 1
Directory of Open Access Journals (Sweden)
Akhlaq A. Siddiqui
2007-01-01
Full Text Available In 1976, Kaplansky introduced the class JB*-algebras which includes all C*-algebras as a proper subclass. The notion of topological stable rank 1 for C*-algebras was originally introduced by M. A. Rieffel and was extensively studied by various authors. In this paper, we extend this notion to general JB*-algebras. We show that the complex spin factors are of tsr 1 providing an example of special JBW*-algebras for which the enveloping von Neumann algebras may not be of tsr 1. In the sequel, we prove that every invertible element of a JB*-algebra is positive in certain isotope of ; if the algebra is finite-dimensional, then it is of tsr 1 and every element of is positive in some unitary isotope of . Further, it is established that extreme points of the unit ball sufficiently close to invertible elements in a JB*-algebra must be unitaries and that in any JB*-algebras of tsr 1, all extreme points of the unit ball are unitaries. In the end, we prove the coincidence between the λ-function and λu-function on invertibles in a JB*-algebra.
Akimova, S.; Gallet, Y.; Amirov, S.; Petrova, N.
2016-12-01
The main objective of this study is to recover the geomagnetic field intensity variations in the Middle East during the 7th and 6th millennia BC, with a particular focus on rapid fluctuations. We will report on new archeointensity data obtained from two ancient Late Neolithic settlements called Yarim Tepe I and II, located today in Northern Iraq, which were excavated by Soviet archeologists in the seventies. Yarim Tepe II, comprising a 7-m thick sequence of cultural deposits divided into nine successive levels, is dated from the Halaf period ( 5950-5300 BC). Yarim Tepe I is dated from the Pre-Halaf period ( 6300-5950 BC), with three recognized cultural phases referred to as Hassuna I, II and III. There, the deposits form a sequence of 6.5 m, which were divided into 12 archeological levels. Most of the archeological artifacts discovered during the excavations, in particular thousands of potsherds, are stored at the repository of Archeological Institute in Moscow, where our sampling was undertaken. We collected 29 groups of potsherds from Yarim Tepe II and 22 groups from Yarim Tepe I from superimposed stratigraphic layers having on average a thickness of about 20 cm. Each group consists of at least 3 (up to 10) fragments. All analyses were carried out using the three-axis vibrating sample magnetometer Triaxe, which allows magnetization measurements of a small sample (developed for the Triaxe magnetometer takes into account both the anisotropy and cooling rate effects on thermoremanent magnetization acquisition. Together with other data previously obtained from Syria and Bulgaria, the new archeointensity results show the occurrence of rapid geomagnetic field fluctuations in the Middle East during the Late Neolithic period, in particular during the 6th millennium BC. The data from Yarim Tepe II indeed confirm the occurrence of a short-lasting intensity peak around 5500 BC, with intensity variation rates as high as 0.35 - 0.15 µT/year over a few decades. We will also
ERZURUM ŞARTLARINDA DİKİM ZAMANI VE TEPE ALMANIN PATATESTE VERİM VE ÇEŞİTLİ ÖZELLİKLERİNE ETKİSİ /
Şenol, Sabahattin
2010-01-01
ÖZETErzurum Ekolojik şartlarında dikim ve tepe alma zamanmm patatesteverime ve diğer bazı agronomik karekterlere etkisini tesbitetmek için bu çalışma yapılmış, erkenci ve geç olgunlaşan 34/962 ve49/962 çeşitler bu denemeye alınmıştır. Neticede, en fazıa verim enerken dikim zamanı olarak tayin ediıen 13 Mayıs tarihinde a.ltlnmış,tepe aımanm· veya sürgün öıdürmenin önemli etkisi g&ou...
Genetic Characterization of Bacillus anthracis 17 JB strain.
Seyed-Mohamadi, Sakineh; Moradi Bidhendi, Soheila; Tadayon, Keyvan; Ghaderi, Rainak
2015-06-01
Bacillus anthracis is one of the most homogenous bacteria ever described. Some level of diversity. Bacillus anthracis 17JB is a laboratory strain It is broadly used as a challenge strain in guinea pigs for potency test of anthrax vaccine. This work describes genetic characterization of B. anthracis 17 JB strain using the SNPs and MLVA genotyping. In SNPs typing, the originally French 17JB strain represented the A.Br. 008/009 subgroup. In Levy's genotyping method, 843, 451 and 864 bp long fragments were identified at AA03, AJ03 and AA07 loci, respectively. In the vaccine manufacturer perspective these findings are much valuable on their own account, but similar research is required to extend molecular knowledge of B. anthracis epidemiology in Persia.
Required characteristics of Paenibacillus polymyxa JB-0501 as potential probiotic.
Naghmouchi, Karim; Baah, John; Cudennec, Benoit; Drider, Djamel
2013-08-01
The ability of Paenibacillus polymyxa to inhibit the growth of Escherichia coli generic ATCC 25922 (Escherichia coli ATCC 25922) and to adhere to monolayers of the enterocyte-like human cell line Caco-2 was evaluated. P. polymyxa JB-0501 (P. polymyxa JB-0501), found in a livestock feed probiotic supplement, was compared to P. polymyxa reference strain ATCC 43685 and ATCC 7070 (P. polymyxa ATCC) in terms of carbohydrate utilization and resistance to lysozyme, acid, bile salts, and hydrogen peroxide. JB-0501 grew at pH 4.5 and at H2O2 concentrations less than 7.3 μg/ml and presented a higher affinity to hexadecane and decane. Bile salts at 0.2 % inhibited the growth of all three strains. P. polymyxa JB-0501 and P. polymyxa ATCC 43865 adhered to Caco-2 cell monolayers. The percentage of cells that adhered ranged from about 0.35 to 6.5 % and was partially proportional to the number applied. Contact time (from 15 min to 1 h) had little impact on adhesion. P. polymyxa JB-0501 inhibited the growth of E. coli ATCC 25922, as proven by the diffusion tests in agar. Taken together, these results suggested that P. polymyxa JB-0501 has the potential probiotic properties to justify its consideration as a livestock feed supplement.
Pharmacology of JB-9315, a new selective histamine H2-receptor antagonist.
Palacios, B; Montero, M J; Sevilla, M A; San Román, L
1998-02-01
1. The histamine H2-receptor antagonistic activity and antisecretory and antiulcer effects of JB-9315 were studied in comparison with the standard H2 blocker ranitidine. 2. In vitro, JB-9315 is a competitive antagonist of histamine H2 receptors in the isolated, spontaneously beating guinea-pig right atrium, with a pA2 value of 7.30 relative to a value of 7.36 for ranitidine. JB-9315 was specific for the histamine H2 receptor because, at high concentration, it did not affect histamine- or acetylcholine-induced contractions in guinea-pig isolated ileum or rat isolated duodenum, respectively. 3. JB-9315 dose dependently inhibited histamine-, pentagastrin- or carbachol-stimulated acid secretion and basal secretion in the perfused stomach preparation of the anesthetized rat. In the pylorus-ligated rat after intraperitoneal administration, total acid output over 4 h was inhibited by JB-9315 with an ID50 of 32.8 mg/kg, confirming its H2-receptor antagonist properties. 4. JB-9315 showed antiulcer activity against cold stress plus indomethacin-induced lesions with an ID50 of 6.8 mg/kg. 5. JB-9315, 50 and 100 mg/kg, inhibited macroscopic gastric hemorrhagic lesions induced by ethanol. In contrast, ranitidine (50 mg/kg) failed to reduce these lesions. 6. These results indicate that JB-9315 is a new antiulcer drug that exerts a cytoprotective effect in addition to its gastric antisecretory activity.
JB-300: An advanced medium size transport for 2005
Debrouwer, Giles; Graham, Katherine; Ison, Jim; Juarez, Vince; Moskalik, Steve; Pankonin, Jon; Weinstein, Arnold
1993-01-01
In the fall of 1992, the TAC Team was presented with a Request for Proposal (PFP) for a mid-size (250-350 passenger) commercial transport. The aircraft was to be extremely competitive in the areas of passenger comfort, performance, and economic aspects. Through the use of supercritical airfoils, a technologically advanced Very High By-pass Ratio (VHBR) turbofan engine, a low overall drag configuration, a comparable interior layout, and mild use of composites, the JB-300 offers an economically viable choice to the airlines. The cents per passenger mile of the JB-300 is 1.76, which is considerably lower than current aircraft in the same range. Overall, the JB-300 is a technologically advanced aircraft, which will meet the demands of the 21st century.
Pharmacological, neurochemical, and behavioral profile of JB-788, a new 5-HT1A agonist.
Picard, M; Morisset, S; Cloix, J F; Bizot, J C; Guerin, M; Beneteau, V; Guillaumet, G; Hevor, T K
2010-09-01
A novel pyridine derivative, 8-{4-[(6-methoxy-2,3-dihydro-[1,4]dioxino[2,3-b]pyridine-3-ylmethyl)-amino]-butyl}-8-aza-spiro[4.5]decane-7,9-dione hydrochloride, termed JB-788, was designed to selectively target 5-HT(1A) receptors. In the present study, the pharmacological profile of JB-788 was characterized in vitro using radioligands binding tests and in vivo using neurochemical and behavioural experiments. JB-788 bound tightly to human 5-HT(1A) receptor expressed in human embryonic kidney 293 (HEK-293) cells with a K(i) value of 0.8 nM. Its binding affinity is in the same range as that observed for the (+/-)8-OH-DPAT, a reference 5HT(1A) agonist compound. Notably, JB-788 only bound weakly to 5-HT(1B) or 5-HT(2A) receptors and moreover the drug displayed only weak or indetectable binding to muscarinic, alpha(2), beta(1) and beta(2) adrenergic receptors, or dopaminergic D(1) receptors. JB-788 was found to display substantial binding affinity for dopaminergic D(2) receptors and, to a lesser extend to alpha(1) adrenoreceptors. JB-788 dose-dependently decreased forskolin-induced cAMP accumulation in HEK cells expressing human 5-HT(1A), thus acting as a potent 5-HT(1A) receptor agonist (E(max.) 75%, EC(50) 3.5 nM). JB-788 did not exhibit any D(2) receptor agonism but progressively inhibited the effects of quinpirole, a D(2) receptor agonist, in the cAMP accumulation test with a K(i) value of 250 nM. JB-788 induced a weak change in cAMP levels in mouse brain but, like some antipsychotics, transiently increased glycogen contents in various brain regions. Behavioral effects were investigated in mice using the elevated plus-maze. JB-788 was found to increase the time duration spent by animals in anxiogenic situations. Locomotor hyperactivity induced by methamphetamine in mouse, a model of antipsychotic activity, was dose-dependently inhibited by JB-788. Altogether, these results suggest that JB-788 displays pharmacological properties, which could be of interest in the area
Palacios, B; Montero, M J; Sevilla, M A; Román, L S
1995-05-01
1. JB-9322 is a selective histamine H2-receptor antagonist with gastric antisecretory activity and mucosal protective properties. 2. The affinity of JB-9322 for the guinea-pig atria histamine H2-receptor was approximately 2 times greater than that of ranitidine. 3. In vivo, the ID50 value for the inhibition of gastric acid secretion in pylorus-ligated rats was 5.28 mg kg-1 intraperitoneally. JB-9322 also dose-dependently inhibited gastric juice volume and pepsin secretion. In gastric lumen-perfused rats, intravenous injection of JB-9322 dose-dependently reduced histamine-, pentagastrin- and carbachol-stimulated gastric acid secretion. 4. JB-9322 showed antiulcer activity against aspirin and indomethacin-induced gastric lesions and was more potent than ranitidine. 5. JB-9322 effectively inhibited macroscopic gastric haemorrhagic lesions induced by ethanol. Intraperitoneal injection was effective in preventing the lesions as well as oral treatment. The oral ID50 value for these lesions was 1.33 mg kg-1. By contrast, ranitidine (50 mg kg-1) failed to reduce these lesions. In addition, the protective effect of JB-9322 was independent of prostaglandin synthesis. 6. These results indicate that JB-9322 is a new antiulcer drug that exerts a potent cytoprotective effect in addition to its gastric antisecretory activity.
TEPE/GReAT (General Relativity Accuracy Test in an Einstein Elevator): ready to start
International Nuclear Information System (INIS)
Iafolla, V.; Fiorenza, E.; Lefevre, C.
2008-01-01
TEPEE/GReAT is an experiment aimed at testing the principle of equivalence at a level of accuracy equal to 5 parts in 10 15 by means of a differential acceleration detector free falling inside a co-moving, endogenic, evacuated capsule, released from a stratospheric balloon. The detector is spun about a horizontal axis during the fall in order to modulate the equivalence principle violation signal at the spin frequency. Thanks to the recent funding of the Italian side, the project is ready- to enter its second phase. The main activities related to detector prototype (both non-cryogenic and cryogenic versions) development and testing, free-fall tests, signal extraction from noise (in particular related to the common-mode rejection factor) and flight model requirements are discussed.
Ji, Xiangyu; Xu, Jing; Ning, Shuxiang; Li, Nan; Tan, Liang; Shi, Shengnan
2017-12-01
Comamonas sp. JB was used to investigate the cometabolic degradation of dibenzofuran (DBF) and dibenzothiophene (DBT) with naphthalene as the primary substrate. Dehydrogenase and ATPase activity of the growing system with the presence of DBF and DBT were decreased when compared to only naphthalene in the growing system, indicating that the presence of DBF and DBT inhibited the metabolic activity of strain JB. The pathways and enzymes involved in the cometabolic degradation were tested. Examination of metabolites elucidated that strain JB cometabolically degraded DBF to 1,2-dihydroxydibenzofuran, subsequently to 2-hydroxy-4-(3'-oxo-3'H-benzofuran-2'-yliden)but-2-enoic acid, and finally to catechol. Meanwhile, strain JB cometabolically degraded DBT to 1,2-dihydroxydibenzothiophene and subsequently to the ring cleavage product. A series of naphthalene-degrading enzymes including naphthalene dioxygenase, 1,2-dihydroxynaphthalene dioxygenase, salicylaldehyde dehydrogenase, salicylate hydroxylase, and catechol 2,3-oxygenase have been detected, confirming that naphthalene was the real inducer of expression the degradation enzymes and metabolic pathways were controlled by naphthalene-degrading enzymes.
Perez-Burgos, Azucena; Wang, Bingxian; Mao, Yu-Kang; Mistry, Bhavik; McVey Neufeld, Karen-Anne; Bienenstock, John; Kunze, Wolfgang
2013-01-15
Mounting evidence supports the influence of the gut microbiome on the local enteric nervous system and its effects on brain chemistry and relevant behavior. Vagal afferents are involved in some of these effects. We previously showed that ingestion of the probiotic bacterium Lactobacillus rhamnosus (JB-1) caused extensive neurochemical changes in the brain and behavior that were abrogated by prior vagotomy. Because information can be transmitted to the brain via primary afferents encoded as neuronal spike trains, our goal was to record those induced by JB-1 in vagal afferents in the mesenteric nerve bundle and thus determine the nature of the signals sent to the brain. Male Swiss Webster mice jejunal segments were cannulated ex vivo, and serosal and luminal compartments were perfused separately. Bacteria were added intraluminally. We found no evidence for translocation of labeled bacteria across the epithelium during the experiment. We recorded extracellular multi- and single-unit neuronal activity with glass suction pipettes. Within minutes of application, JB-1 increased the constitutive single- and multiunit firing rate of the mesenteric nerve bundle, but Lactobacillus salivarius (a negative control) or media alone were ineffective. JB-1 significantly augmented multiunit discharge responses to an intraluminal distension pressure of 31 hPa. Prior subdiaphragmatic vagotomy abolished all of the JB-1-evoked effects. This detailed exploration of the neuronal spike firing that encodes behavioral signaling to the brain may be useful to identify effective psychoactive bacteria and thereby offer an alternative new perspective in the field of psychiatry and comorbid conditions.
Yutsis-Akimova, Stanislava; Gallet, Yves; Amirov, Shahmardan
2018-01-01
We present new archeointensity results from a series of groups of pottery fragments that were collected from the multi-layered archeological site Yarim Tepe II in Northern Iraq (Northern Mesopotamia) dated to the 6th millennium BC. This site comprises a 7-m-thick sequence of archeological deposits encompassing the Middle Halaf, Late Halaf and the Halaf-Ubaid Transitional (HUT), between ∼5750 and ∼5000 BC according to the chronology currently considered for the Halafian archeological period. Three new radiocarbon dates obtained from bone fragments confirm that Yarim Tepe II was likely not occupied before the Middle Halaf, as was independently established from archeological constraints. Archeointensity determinations were carried out using the protocol developed for the Triaxe magnetometer. This procedure takes into account thermoremanent magnetization anisotropy and cooling rate effects. 114 fragments fulfilled our set of archeointensity selection criteria, with intensity data obtained from at least two but most often three specimens per fragment. Mean archeointensity values were estimated for 23 groups of fragments well distributed across the entire stratigraphic sequence from the averaging of the data obtained from a minimum of three fragments per group. These values were dated using a bootstrap procedure relying on the stratigraphic position of the different groups of fragments and on the different age constraints available inside the Yarim Tepe II sequence. The new data show a significant decrease in geomagnetic field intensity by ∼12 μT between the Middle Halaf and the Late Halaf-HUT time interval. This decrease was accompanied by a short intensity peak, which may have lasted only a few decades, around the Middle Halaf-Late Halaf boundary, at ∼5500 BC. This evolution is quite similar to that observed from Syrian and Bulgarian archeointensity data, even though the precise duration of the intensity peak is presently questionable. The Bulgarian data set
Jin, Zhong Min; Sha, Wei; Zhang, Yan Fu; Zhao, Jing; Ji, Hongyang
2013-07-01
Phytoremediation combined with suitable microorganisms and biodegradable chelating agents can be a means of reclaiming lands contaminated by toxic heavy metals. We investigated the ability of a lead- and cadmium-resistant bacterial strain (JB12) and the biodegradable chelator ethylenediamine-N,N'-disuccinic acid (EDDS) to improve absorption of these metals from soil by tall fescue and red clover. Strain JB12 was isolated from contaminated soil samples, analysed for lead and cadmium resistance, and identified as Burkholderia cepacia. Tall fescue and red clover were grown in pots to which we added JB12, (S,S)-EDDS, combined JB12 and EDDS, or water only. Compared with untreated plants, the biomass of plants treated with JB12 was significantly increased. Concentrations of lead and cadmium in JB12-treated plants increased significantly, with few exceptions. Plants treated with EDDS responded variably, but in those treated with combined EDDS and JB12, heavy metal concentrations increased significantly in tall fescue and in the aboveground parts of red clover. We conclude that JB12 is resistant to lead and cadmium. Its application to the soil improved the net uptake of these heavy metals by experimental plants. The potential for viable phytoremediation of lead- and cadmium-polluted soils with tall fescue and red clover combined with JB12 was further enhanced by the addition of EDDS.
Ohtsuka, Hiromichi; Kitagawa, Madoka; Kohiruimaki, Masayuki; Tanami, Erika; Masui, Machiko; Hayashi, Tomohito; Ando, Takaaki; Watanabe, Daisaku; Koiwa, Masateru; Sato, Shigeru; Kawamura, Seiichi
2006-11-01
To compare the changes in the insulin reaction of Holstein dairy cows and Japanese Black cows (JB) during the periparturient period, the insulin resistance test in vivo and lymphocytes proliferation with insulin in vitro were performed. Ten healthy Holstein dairy cows (Holstein group) and 10 healthy JB cows (JB group) used in this study were observed on days 60, 40, and 20 before calving and days 7 and 20 after calving. In insulin resistance reaction in vivo and in vitro, a low insulin-stimulated glucose disposal rate and lymphocyte proliferation with insulin were observed in the Holstein group compared with the JB group during the experimental period. An analysis of the lymphocytes cultured with insulin showed that the percentage of CD4+CD45R- T cells in the Holstein group was significantly lower than that of the JB group before day 20. These findings indicate that T cells reaction to insulin in healthy periparturient Holstein cows is lower than that in Japanese Black.
Directory of Open Access Journals (Sweden)
Klaus Schmidt
2010-12-01
Full Text Available The transition from non-food producing to farming societies first took place during the Pre-Pottery Neolithic (PPN of the Near East. It happened immediately after the end of the Pleistocene, between the 10th to the 8th millennium BC. One of the main questions that have exercised the minds of generations of archaeologists is why people first gave up a hunting and gathering way of life and start to domesticate plants and animals. In other words, why did the Neolithic Revolution take place? The new discoveries at Göbekli Tepe have turned up evidence for explanations that differ from the generally accepted wisdom on this issue.
Directory of Open Access Journals (Sweden)
Saikali Melody
2012-07-01
Full Text Available Abstract Background Sesquiterpene lactones (SL are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan isolated from Achillea falcata and salograviolide A (Sal A isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. Methods The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. Results β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. Conclusions These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to
Saikali, Melody; Ghantous, Akram; Halawi, Racha; Talhouk, Salma N; Saliba, Najat A; Darwiche, Nadine
2012-07-09
Sesquiterpene lactones (SL) are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan) isolated from Achillea falcata and salograviolide A (Sal A) isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to the Middle East may provide opportunities for complementary
Loss of retrovirus production in JB/RH melanoma cells transfected with H-2Kb and TAP-1 genes.
Li, M; Xu, F; Muller, J; Huang, X; Hearing, V J; Gorelik, E
1999-01-20
JB/RH1 melanoma cells, as well as other melanomas of C57BL/6 mice (B16 and JB/MS), express a common melanoma-associated antigen (MAA) encoded by an ecotropic melanoma-associated retrovirus (MelARV). JB/RH1 cells do not express the H-2Kb molecules due to down-regulation of the H-2Kb and TAP-1 genes. When JB/RH1 cells were transfected with the H-2Kb and cotransfected with the TAP-1 gene, it resulted in the appearance of H-2Kb molecules and an increase in their immunogenicity, albeit they lost expression of retrovirus-encoded MAA recognized by MM2-9B6 mAb. Loss of MAA was found to result from a complete and stable elimination of ecotropic MelARV production in the H-2Kb/TAP-1-transfected JB/RH1 cells. Northern blot analysis showed no differences in ecotropic retroviral messages in MelARV-producing and -nonproducing melanoma cells, suggesting that loss of MelARV production was not due to down-regulation of MelARV transcription. Southern blot analysis revealed several rearrangements in the proviral DNA of H-2Kb-positive JB/RH1 melanoma cells. Sequence analysis of the ecotropic proviral DNA from these cells showed numerous nucleotide substitutions, some of which resulted in the appearance of a novel intraviral PstI restriction site and the loss of a HindIII restriction site in the pol region. PCR amplification of the proviral DNAs indicates that an ecotropic provirus found in the H-2Kb-positive cells is novel and does not preexist in the parental H-2Kb-negative melanoma cells. Conversely, the ecotropic provirus of the parental JB/RH1 cells was not amplifable from the H-2Kb-positive cells. Our data indicate that stable loss of retroviral production in the H-2Kb/TAP-1-transfected melanoma cells is probably due to the induction of recombination between a productive ecotropic MelARV and a defective nonecotropic provirus leading to the generation of a defective ecotropic provirus and the loss of MelARV production and expression of the retrovirus-encoded MAA. Copyright 1999
Embedding, serial sectioning and staining of zebrafish embryos using JB-4 resin.
Sullivan-Brown, Jessica; Bisher, Margaret E; Burdine, Rebecca D
2011-01-01
Histological techniques are critical for observing tissue and cellular morphology. In this paper, we outline our protocol for embedding, serial sectioning, staining and visualizing zebrafish embryos embedded in JB-4 plastic resin-a glycol methacrylate-based medium that results in excellent preservation of tissue morphology. In addition, we describe our procedures for staining plastic sections with toluidine blue or hematoxylin and eosin, and show how to couple these stains with whole-mount RNA in situ hybridization. We also describe how to maintain and visualize immunofluorescence and EGFP signals in JB-4 resin. The protocol we outline-from embryo preparation, embedding, sectioning and staining to visualization-can be accomplished in 3 d. Overall, we reinforce that plastic embedding can provide higher resolution of cellular details and is a valuable tool for cellular and morphological studies in zebrafish.
A novel chimeric prophage vB_LdeS-phiJB from commercial Lactobacillus delbrueckii subsp. bulgaricus.
Guo, Tingting; Zhang, Chenchen; Xin, Yongping; Xin, Min; Kong, Jian
2016-05-01
Prophage vB_LdeS-phiJB (phiJB) was induced by mitomycin C and UV radiation from the Lactobacillus delbrueckii subsp. bulgaricus SDMCC050201 isolated from a Chinese yoghurt sample. It has an isometric head and a non-contractile tail with 36,969 bp linear double-stranded DNA genome, which is classified into the group a of Lb. delbrueckii phages. The genome of phiJB is highly modular with functionally related genes clustered together. Unexpectedly, there is no similarity of its DNA replication module to any phages that have been reported, while it consists of open-reading frames homologous to the proteins of Lactobacillus strains. Comparative genomic analysis indicated that its late gene clusters, integration/lysogeny modules and DNA replication module derived from different evolutionary ancestors and integrated into a chimera. Our results revealed a novel chimeric phage of commercial Lb. delbrueckii and will broaden the knowledge of phage diversity in the dairy industry.
Directory of Open Access Journals (Sweden)
Patrycja Konieczna
Full Text Available The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1. Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.
Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O’Mahony, Liam
2015-01-01
The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses. PMID:25816321
Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O'Mahony, Liam
2015-01-01
The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.
Reactive flow modeling of initial density effect on divergence JB-9014 detonation driving
Yu, Xin; Huang, Kuibang; Zheng, Miao
2016-06-01
A serious of experiments were designed and the results were represented in this paper, in which 2mm thickness cooper shells were impacted by explosives named JB-9014 with different densities, and the surface velocities of the OFHC shells were measured. The comparison of experimental data shows the free surface velocity of the OFHC shell increase with the IHE density. Numerical modeling, which occupied phenomenological reactive flow rate model using the two-dimensional Lagrange hydrodynamic code, were carried out to simulate the above experiments, and empirical adjustments on detonation velocity and pressure and Pier Tang's adjustments on EOS of detonation products were both introduced in our numerical simulation work. The computational results agree well with that of experiments, and the numerical results with original parameters of products and the adjusted ones of JB-9014 could describe the density effect distinctly.
Kim, Su Young; Jin, Mi Ra; Chung, Chang Ho; Yun, Yeoung-Sang; Jahng, Kwang Yeop; Yu, Kang-Yeol
2015-04-01
Biosorption of heavy metals and dyes is a promising technology that involves the removal of toxic metals from industrial wastes. The present study aims to screen the bacterial strains isolated from soils and polluted pond for their potential biosorption of both cationic dye and cadmium. Bacillus catenulatus JB-022 strain removed 58% and 66% of cationic basic blue 3 (BB3) and cadmium (Cd(II)) at the respective concentrations of 2000 mg/L and 150 mg/L. The biosorption equilibrium data were well fitted by the Langmuir adsorption isotherm, and the kinetic studies indicated that the biosorption followed the pseudo-second-order model. The biosorption kinetics showed that the equilibrium was reached within 10 min and 5 min for BB3 and Cd(II), respectively. According to the Langmuir model, the maximum uptakes of BB3 and Cd(II) by the JB-022 biomass were estimated to be 139.74 and 64.28 mg/g, respectively. To confirm the surface morphology and functional groups, field emission scanning electron microscope, energy-dispersive X-ray spectrometer, X-ray diffraction, and Fourier transform infrared spectroscopy analyses were carried out, and the results revealed that the biomass of JB-022 has carboxyl and phosphonate groups as potential surface functional groups capable of binding to cationic pollutants. In conclusion, B. catenulatus JB-022 is proposed as an excellent biosorbent with potentially important applications in removal of cationic pollutants from wastewaters. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Jiang, Bei; Zhou, Zunchun; Dong, Ying; Tao, Wei; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan
2015-07-01
A bacterium designated strain JB, able to degrade six benzene, toluene, ethylbenzene, and o-, m-, and p-xylene (BTEX) compounds, was isolated from petroleum-contaminated soil. Taxonomic analyses showed that the isolate belonged to Comamonas, and until now, the genus Comamonas has not included any known BTEX degraders. The BTEX biodegradation rate was slightly low on the mineral salt medium (MSM), but adding a small amount of yeast extract greatly enhanced the biodegradation. The relationship between specific degradation rate and individual BTEX was described well by Michaelis-Menten kinetics. The treatment of petrochemical wastewater containing BTEX mixture and phenol was shown to be highly efficient by BTEX-grown JB. In addition, toxicity assessment indicated the treatment of the petrochemical wastewater by BTEX-grown JB led to less toxicity than untreated wastewater.
Draft genome sequences of Streptococcus bovis strains ATCC 33317 and JB1
We report the draft genome sequences of Streptococcus bovis type strain ATTC 33317 (CVM42251) isolated from cow dung and strain JB1 (CVM42252) isolated from a cow rumen in 1977. Strains were subjected to Next Generation sequencing and the genome sizes are approximately 2 MB and 2.2 MB, respectively....
Copper and dyes enhance laccase production in gamma-proteobacterium JB.
Malhotra, Kanam; Sharma, Prince; Capalash, Neena
2004-07-01
Laccase production in gamma-proteobacterium JB was enhanced 13-fold by adding 0.1 mM CuSO(4) 24 h after the onset of growth. Ethidium bromide (2.5 microM), Malachite Green, Phenol Red and Thymol Blue (10 microM each) enhanced laccase production 17-, 19-, 4- and 2-fold, respectively. Among the fourteen aromatic/organic compounds tried, p-aminobenzoic acid and an industrial effluent, from where the organism was isolated, showed 1.2- and 1.26-fold increases in production.
Isolation of perchlorate-reducing Azospira suillum strain JB524 from tidal flats of the Yellow Sea
Directory of Open Access Journals (Sweden)
Nirmala Bardiya
2016-11-01
Full Text Available Objective: To isolate and identify perchlorate-reducing bacterium from an enriched consortium from tidal flats of the Yellow Sea. Methods: A perchlorate-enriched consortium from tidal flats of the Yellow Sea was used to isolate Azospira suillum (A. suillum strain JB524. The strain was identified based on partial 16S rDNA sequencing. Perchlorate reduction by the strain was tested with acetate as the e - donor in the presence of NaCl, nitrate and at different growth temperatures using standard anaerobic techniques. The complete enzymatic destruction of perchlorate was confirmed as evolution of O2 by chlorite dismutase in the absence of acetate. Results: Strain JB524 shared 100% 16S rDNA sequence similarity with the type strain A. suillum PST isolated from a swine waste treatment lagoon. Perchlorate reduction coincided with concomitant increase in cell density. Although, acclimatization of the strain PST at suboptimal temperature for perchlorate reduction is not reported, the newly isolated strain could rapidly reduce perchlorate at 22 °C after brief acclimatization. Conclusions: Reduction of perchlorate by A. suillum strain JB524 was negatively affected in the presence of NaCl, suboptimal temperature, presence of nitrate, and limiting amount of acetate as the e-donor.
Lactobacillus rhamnosus strain JB-1 reverses restraint stress-induced gut dysmotility.
West, C; Wu, R Y; Wong, A; Stanisz, A M; Yan, R; Min, K K; Pasyk, M; McVey Neufeld, K-A; Karamat, M I; Foster, J A; Bienenstock, J; Forsythe, P; Kunze, W A
2017-01-01
Environmental stress affects the gut with dysmotility being a common consequence. Although a variety of microbes or molecules may prevent the dysmotility, none reverse the dysmotility. We have used a 1 hour restraint stress mouse model to test for treatment effects of the neuroactive microbe, L. rhamnosus JB-1 ™ . Motility of fluid-filled ex vivo gut segments in a perfusion organ bath was recorded by video and migrating motor complexes measured using spatiotemporal maps of diameter changes. Stress reduced jejunal and increased colonic propagating contractile cluster velocities and frequencies, while increasing contraction amplitudes for both. Luminal application of 10E8 cfu/mL JB-1 restored motor complex variables to unstressed levels within minutes of application. L. salivarius or Na.acetate had no treatment effects, while Na.butyrate partially reversed stress effects on colonic frequency and amplitude. Na.propionate reversed the stress effects for jejunum and colon except on jejunal amplitude. Our findings demonstrate, for the first time, a potential for certain beneficial microbes as treatment of stress-induced intestinal dysmotility and that the mechanism for restoration of function occurs within the intestine via a rapid drug-like action on the enteric nervous system. © 2016 John Wiley & Sons Ltd.
Xenobiotics enhance laccase activity in alkali-tolerant γ-proteobacterium JB.
Singh, Gursharan; Batish, Mona; Sharma, Prince; Capalash, Neena
2009-01-01
Various genotoxic textile dyes, xenobiotics, substrates (10 µM) and agrochemicals (100 µg/ml) were tested for enhancement of alkalophilic laccase activity in γ-proteobacterium JB. Neutral Red, Indigo Carmine, Naphthol Base Bordears and Sulphast Ruby dyes increased the activity by 3.7, 2.7, 2.6 and 2.3 fold respectively. Xenobiotics/substrates like p-toluidine, 8-hydroxyquinoline and anthracine increased it by 3.4, 2.8 and 2.3 fold respectively. Atrazine and trycyclozole pesticides enhanced the activity by 1.95 and 1.5 fold respectively.
Jiang, Bei; Zhou, Zunchun; Dong, Ying; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan; Gao, Shan; Yang, Aifu; Chen, Zhong; Sun, Hongjuan
2015-05-01
In this study, we investigated the bioremediation of petrochemical wastewater containing BTEX compounds by immobilized Comamonas sp. JB cells. Three kinds of magnetic nanoparticles were evaluated as immobilization supports for strain JB. After comparison with Fe3O4 and a-Fe2O3 nanoparticles, r-Fe2O3 nanoparticle was selected as the optimal immobilization support. The highest biodegradation activity of r-Fe2O3-magnetically immobilized cells was obtained when the concentration of r-Fe2O3 nanoparticle was 120 mg L(-1). Additionally, the recycling experiments demonstrated that the degradation activity of r-Fe2O3-magnetically immobilized cells was still high and led to less toxicity than untreated wastewater during the eight recycles. qPCR suggested the concentration of strain JB in r-Fe2O3-magnetically immobilized cells was evidently increased after eight cycles of degradation experiments. These results supported developing efficient biocatalysts using r-Fe2O3-magnetically immobilized cells and provided a promising technique for improving biocatalysts used in the bioremediation of not only petrochemical wastewater but also other hazardous wastewater.
Han, Sang-Min; Lee, Jong-Soo
2017-09-01
This study was done to produce γ-aminobutyric acid (GABA) from wild yeast as well as investigate its anti-hyperglycemic effects. Among ten GABA-producing yeast strains, Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1 produced high GABA concentration of 134.4 µg/mL and 179.2 µg/mL, respectively. P. silvicola UL6-1 showed a maximum GABA yield of 136.5 µg/mL and 200.8 µg/mL from S. carnicolor 402-JB-1 when they were cultured for 30 hr at 30℃ in yeast extract-peptone-dextrose medium. The cell-free extract from P. silvicola UL6-1 and S. carnicolor 402-JB-1 showed very high anti-hyperglycemic α-glucosidase inhibitory activity of 72.3% and 69.9%, respectively. Additionally, their cell-free extract-containing GABA showed the anti-hyperglycemic effect in streptozotocin-induced diabetic Sprague-Dawley rats.
McVey Neufeld, Karen-Anne; Kay, Sebastian; Bienenstock, John
2018-01-01
Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST) and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair-BALB/c and Swiss Webster-with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.
International Nuclear Information System (INIS)
Zhang Dongyun; Li Jingxia; Gao Jimin; Huang Chuanshu
2009-01-01
Arsenic is a well-documented human carcinogen associated with skin carcinogenesis. Our previous work reveals that arsenite exposure is able to induce cell transformation in mouse epidermal cell JB6 Cl41 through the activation of ERK, rather than JNK pathway. Our current studies further evaluate downstream pathway in low dose arsenite-induced cell transformation in JB6 Cl41 cells. Our results showed that treatment of cells with low dose arsenite induced activation of c-Jun/AP-1 pathway, and ectopic expression of dominant negative mutant of c-Jun (TAM67) blocked arsenite-induced transformation. Furthermore, our data indicated that cyclin D1 was an important downstream molecule involved in c-Jun/AP-1-mediated cell transformation upon low dose arsenite exposure, because inhibition of cyclin D1 expression by its specific siRNA in the JB6 Cl41 cells resulted in impairment of anchorage-independent growth of cells induced by low dose arsenite. Collectively, our results demonstrate that c-Jun/AP-1-mediated cyclin D1 expression is at least one of the key events implicated in cell transformation upon low dose arsenite exposure
Directory of Open Access Journals (Sweden)
Castranova Vincent
2009-04-01
Full Text Available Abstract Background Carcinogenicity of nickel compounds has been well documented. However, the carcinogenic effect of metallic nickel is still unclear. The present study investigates metallic nickel nano- and fine particle-induced apoptosis and the signal pathways involved in this process in JB6 cells. The data obtained from this study will be of benefit for elucidating the pathological and carcinogenic potential of metallic nickel particles. Results Using 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, we found that metallic nickel nanoparticles exhibited higher cytotoxicity than fine particles. Both metallic nickel nano- and fine particles induced JB6 cell apoptosis. Metallic nickel nanoparticles produced higher apoptotic induction than fine particles. Western-blot analysis showed an activation of proapoptotic factors including Fas (CD95, Fas-associated protein with death domain (FADD, caspase-8, death receptor 3 (DR3 and BID in apoptotic cells induced by metallic nickel particles. Immunoprecipitation (IP western blot analysis demonstrated the formation of the Fas-related death-inducing signaling complex (DISC in the apoptotic process. Furthermore, lamin A and beta-actin were cleaved. Moreover, we found that apoptosis-inducing factor (AIF was up-regulated and released from mitochondria to cytoplasm. Interestingly, although an up-regulation of cytochrome c was detected in the mitochondria of metallic nickel particle-treated cells, no cytochrome c release from mitochondria to cytoplasm was found. In addition, activation of antiapoptotic factors including phospho-Akt (protein kinase B and Bcl-2 was detected. Further studies demonstrated that metallic nickel particles caused no significant changes in the mitochondrial membrane permeability after 24 h treatment. Conclusion In this study, metallic nickel nanoparticles caused higher cytotoxicity and apoptotic induction than fine particles in JB6 cells. Apoptotic cell death
Directory of Open Access Journals (Sweden)
Karen-Anne McVey Neufeld
2018-05-01
Full Text Available Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair—BALB/c and Swiss Webster—with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.
SN 2008jb: A 'LOST' CORE-COLLAPSE SUPERNOVA IN A STAR-FORMING DWARF GALAXY AT ∼10 Mpc
International Nuclear Information System (INIS)
Prieto, J. L.; Lee, J. C.; Drake, A. J.; Djorgovski, S. G.; McNaught, R.; Garradd, G.; Beacom, J. F.; Beshore, E.; Catelan, M.; Pojmanski, G.; Stanek, K. Z.; Szczygieł, D. M.
2012-01-01
We present the discovery and follow-up observations of SN 2008jb, a core-collapse supernova in the southern dwarf irregular galaxy ESO 302–14 (M B = –15.3 mag) at 9.6 Mpc. This nearby transient was missed by galaxy-targeted surveys and was only found in archival optical images obtained by the Catalina Real-time Transient Survey and the All-Sky Automated Survey. The well-sampled archival photometry shows that SN 2008jb was detected shortly after explosion and reached a bright optical maximum, V max ≅ 13.6 mag (M V,max ≅ –16.5). The shape of the light curve shows a plateau of ∼100 days, followed by a drop of ∼1.4 mag in the V band to a slow decline with an approximate 56 Co decay slope. The late-time light curve is consistent with 0.04 ± 0.01 M ☉ of 56 Ni synthesized in the explosion. A spectrum of the supernova obtained two years after explosion shows a broad, boxy Hα emission line, which is unusual for normal Type II-Plateau supernovae at late times. We detect the supernova in archival Spitzer and WISE images obtained 8-14 months after explosion, which show clear signs of warm (600-700 K) dust emission. The dwarf irregular host galaxy, ESO 302–14, has a low gas-phase oxygen abundance, 12 + log(O/H) = 8.2 (∼1/5 Z ☉ ), similar to those of the Small Magellanic Cloud and the hosts of long gamma-ray bursts and luminous core-collapse supernovae. This metallicity is one of the lowest among local (∼ 5 M ☉ for the star formation complex, assuming a single-age starburst. These properties are consistent with the expanding Hα supershells observed in many well-studied nearby dwarf galaxies, which are tell-tale signs of feedback from the cumulative effect of massive star winds and supernovae. The age estimated for the star-forming region where SN 2008jb exploded suggests a relatively high-mass progenitor star with an initial mass M ∼ 20 M ☉ and warrants further study. We discuss the implications of these findings in the study of core
Energy Technology Data Exchange (ETDEWEB)
Weber, Thomas J.; Shankaran, Harish; Wiley, H. S.; Opresko, Lee K.; Chrisler, William B.; Quesenberry, Ryan D.
2010-05-02
basic fibroblast growth factor (bFGF or FGF2) plays an important role in epidermal wound healing in vivo and is associated with a persistent increased in the extracellular signal-regulated kinase (ERK) pathway in vitro. Here we have examined whether bFGF induces the closure of an experimental scratch wound in JB6 mouse epidermal cells and have explored the regulation of the ERK pathway by bFGF in the context of kinase oscillations. bFGF stimulation is associated with increases in cellular phospho-ERK and phospho-c-Jun levels. In addition, bFGF increases cell proliferation and a change in cell morphology (stellate appearance) in a dose-dependent fashion (0.1 – 100 ng/ml). bFGF treatment also promoted the closure of an experimental scratch wound in vitro. JB6 cells were stably transfected with an ERK1-GFP chimera to follow temporal ERK subcellular distribution patterns. We observe a persistent upregulation of the ERK pathway, as evidenced by a significant increase in nuclear ERK1-GFP levels at time points up to 24 hr after bFGF treatment. Interestingly, at the single cell level, ERK is observed to oscillate between nuclear and cytosolic compartments in response to bFGF treatment. Because this oscillatory behavior is asynchronous in the cell population, it is only clearly resolved at the single cell level. Collectively, data presented here are consistent with an important role for bFGF in wound healing and suggest a more complex regulation of the ERK pathway by bFGF than has previously been appreciated.
Expert Systems: What Is an Expert System?
Duval, Beverly K.; Main, Linda
1994-01-01
Describes expert systems and discusses their use in libraries. Highlights include parts of an expert system; expert system shells; an example of how to build an expert system; a bibliography of 34 sources of information on expert systems in libraries; and a list of 10 expert system shells used in libraries. (Contains five references.) (LRW)
Shrinivas, Dengeti; Savitha, Gunashekaran; Raviranjan, Kumar; Naik, Gajanan Ramchandra
2010-11-01
A highly thermostable alkaline xylanase was purified to homogeneity from culture supernatant of Bacillus sp. JB 99 using DEAE-Sepharose and Sephadex G-100 gel filtration with 25.7-fold increase in activity and 43.5% recovery. The molecular weight of the purified xylanase was found to be 20 kDA by SDS-PAGE and zymogram analysis. The enzyme was optimally active at 70 °C, pH 8.0 and stable over pH range of 6.0-10.0.The relative activity at 9.0 and 10.0 were 90% and 85% of that of pH 8.0, respectively. The enzyme showed high thermal stability at 60 °C with 95% of its activity after 5 h. The K (m) and V (max) of enzyme for oat spelt xylan were 4.8 mg/ml and 218.6 µM min(-1) mg(-1), respectively. Analysis of N-terminal amino acid sequence revealed that the xylanase belongs to glycosyl hydrolase family 11 from thermoalkalophilic Bacillus sp. with basic pI. Substrate specificity showed a high activity on xylan-containing substrate and cellulase-free nature. The hydrolyzed product pattern of oat spelt xylan on thin-layer chromatography suggested xylanase as an endoxylanase. Due to these properties, xylanase from Bacillus sp. JB 99 was found to be highly compatible for paper and pulp industry.
Price competition between an expert and a non-expert
Bouckaert, J.M.C.; Degryse, H.A.
1998-01-01
This paper characterizes price competition between an expert and a non-expert. In contrast with the expert, the non-expert’s repair technology is not always successful. Consumers visit the expert after experiencing an unsuccessful match at the non-expert. This re-entry affects the behaviour of both sellers. For low enough probability of successful repair at the non-expert, all consumers first visit the non-expert, and a ‘timid-pricing’ equilibrium results. If the non-expert’s repair technolog...
NESSUS/EXPERT - An expert system for probabilistic structural analysis methods
Millwater, H.; Palmer, K.; Fink, P.
1988-01-01
An expert system (NESSUS/EXPERT) is presented which provides assistance in using probabilistic structural analysis methods. NESSUS/EXPERT is an interactive menu-driven expert system that provides information to assist in the use of the probabilistic finite element code NESSUS/FEM and the fast probability integrator. NESSUS/EXPERT was developed with a combination of FORTRAN and CLIPS, a C language expert system tool, to exploit the strengths of each language.
International Nuclear Information System (INIS)
Haldy, P.A.
1988-01-01
The definitions of the terms 'artificial intelligence' and 'expert systems', the methodology, areas of employment and limits of expert systems are discussed. The operation of an expert system is described, especially the presentation and organization of knowledge as well as interference and control. Methods and tools for expert system development are presented and their application in nuclear energy are briefly addressed. 7 figs., 2 tabs., 6 refs
Johnvesly, B; Manjunath, B R; Naik, G R
2002-03-01
Thermoalkaliphilic Bacillus sp. JB-99 was grown in a 250 ml Erlenmeyer flask containing 50 ml medium containing (g/l) Pigeon pea waste 10; NaNO3, 5.0; K2HPO4, 5.0; MgSO4 x 2H2O, 0.2 and Na2CO3, 10.0. Incubations were carried out at 50 degrees C on a rotary incubator shaker for 15 h. A high level of extra cellular thermostable protease activity was observed after 24 h incubation. The optimum temperature and pH for activity were 70 degrees C and 11, respectively, so this enzyme showed stable activity at high temperature and under alkaline conditions.
Lucas, P.J.F.
2005-01-01
Expert systems mimic the problem-solving activity of human experts in specialized domains by capturing and representing expert knowledge. Expert systems include a knowledge base, an inference engine that derives conclusions from the knowledge, and a user interface. Knowledge may be stored as if-then rules, orusing other formalisms such as frames and predicate logic. Uncertain knowledge may be represented using certainty factors, Bayesian networks, Dempster-Shafer belief functions, or fuzzy se...
Expert - Non-expert differences in visual behaviour during alpine slalom skiing.
Decroix, Marjolein; Wazir, Mohd Rozilee Wazir Norjali; Zeuwts, Linus; Deconinck, Frederik F J A; Lenoir, Matthieu; Vansteenkiste, Pieter
2017-10-01
The aim of this study was to investigate visual behaviour of expert and non-expert ski athletes during an alpine slalom. Fourteen non-experts and five expert slalom skiers completed an alpine slalom course in an indoor ski slope while wearing a head-mounted eye tracking device. Experts completed the slalom clearly faster than non-experts, but no significant difference was found in timing and position of the turn initiation. Although both groups already looked at future obstacles approximately 0,5s before passing the upcoming pole, the higher speed of experts implied that they shifted gaze spatially earlier in the bend than non-experts. Furthermore, experts focussed more on the second next pole while non-expert slalom skiers looked more to the snow surface immediately in front of their body. No difference was found in the fixation frequency, average fixation duration, and quiet eye duration between both groups. These results suggest that experts focus on the timing of their actions while non-experts still need to pay attention to the execution of these actions. These results also might suggest that ski trainers should instruct non-experts and experts to focus on the next pole and, shift their gaze to the second next pole shortly before reaching it. Based on the current study it seems unadvisable to instruct slalom skiers to look several poles ahead during the actual slalom. However, future research should test if these results still hold on a real outdoor slope, including multiple vertical gates. Copyright © 2017 Elsevier B.V. All rights reserved.
Sedov, S. N.; Aleksandrovskii, A. L.; Benz, M.; Balabina, V. I.; Mishina, T. N.; Shishkov, V. A.; Şahin, F.; Özkaya, V.
2017-04-01
Soils and sediments composing Tell Körtik Tepe (Epipaleolithic, Turkey) and Tell Yunatsite (Chalcolithic (Eneolithic), Bulgaria) have been studied with the aim to gain a better insight into their microfabrics, determine the composition of anthropogenic artifacts, and, on this basis, to analyze similarities and distinctions between these objects and the modern soils of urban areas. The methods of micromorphology, scanning electron microscopy with an energy dispersive X-ray microanalyzer, X-ray fluorometry, and other techniques to determine the chemical and physical properties of the soils and sediments have been applied. Two paleosols have been identified in Tell Yunatsite with a total thickness of 9 m: the paleosol buried under the tell and the paleosol in its middle part. Sediments of Tell Körtik Tepe have a total thickness of up to 5 m; their accumulation began at the end of Pleistocene over the surface of buried paleosol. The cultural layer of the tells consists of construction debris mainly represented by a mixture of clay and sand and of domestic wastes with the high content of phosphorus. The major source of phosphorus is calcium phosphate (apatite) of bone tissues. The abundance of various anthropogenic materials in the sediments is clearly seen in thin sections. Even in the paleosols developed within the cultural layer (the mid-profile paleosol in Tell Yunatsite), the amount of microinclusions of bone fragments, charcoal, and burnt clay (ceramics) is very high. Micromorphological data indicate that up to 50% of the layered material filling an Epipaleolithic construction in Tell Körtik Tepe consists of the anthropogenic inclusions: bone fragments, charcoal, etc. The features of pedogenic transformation are present in the sediments. Such sediments can be classified as synlithogenic soils similar to the modern Urbic Technosols. It is shown that the formation of paleosols and sediments of Tell Körtik Tepe took place under extreme environmental conditions
Energy Technology Data Exchange (ETDEWEB)
1984-04-01
Expert-ease allows the most inexperienced of computer users to build an expert system in a matter of hours. It is nothing more or less than a computer based problem-solving system. It allows the expert to preserve his or her knowledge in the form of rules, which can be applied to problems put to the system by the non-expert. The crucial piece of software at the heart of Expert-Ease extracts rules from data, and is called the analogue concept learning system. It was developed by Intelligent Terminals Ltd. and supplied to Export Software International to be incorporated into a commercially attractive package for business users. The resulting product runs on the Act Sirius and the IBM PC and compatibles. It is a well conceived and polished product with a popular appeal that should ensure widespread acceptance even at a cost of >1500 plus vat.
DEFF Research Database (Denmark)
Hildebrandt, Thomas Troels; Cattani, Gian Luca
2016-01-01
An expert system is a computer system for inferring knowledge from a knowledge base, typically by using a set of inference rules. When the concept of expert systems was introduced at Stanford University in the early 1970s, the knowledge base was an unstructured set of facts. Today the knowledge b...... for the application of expert systems, but also raises issues regarding privacy and legal liability....
Georgiana Marin; Mihai Catalin Andrei
2011-01-01
In recent decades IT and computer systems have evolved rapidly in economic informatics field. The goal is to create user friendly information systems that respond promptly and accurately to requests. Informatics systems evolved into decision assisted systems, and such systems are converted, based on gained experience, in expert systems for creative problem solving that an organization is facing. Expert systems are aimed at rebuilding human reasoning on the expertise obtained from experts, sto...
Expert and competent non-expert visual cues during simulated diagnosis in intensive care.
McCormack, Clare; Wiggins, Mark W; Loveday, Thomas; Festa, Marino
2014-01-01
The aim of this study was to examine the information acquisition strategies of expert and competent non-expert intensive care physicians during two simulated diagnostic scenarios involving respiratory distress in an infant. Specifically, the information acquisition performance of six experts and 12 competent non-experts was examined using an eye-tracker during the initial 90 s of the assessment of the patient. The results indicated that, in comparison to competent non-experts, experts recorded longer mean fixations, irrespective of the scenario. When the dwell times were examined against specific areas of interest, the results revealed that competent non-experts recorded greater overall dwell times on the nurse, where experts recorded relatively greater dwell times on the head and face of the manikin. In the context of the scenarios, experts recorded differential dwell times, spending relatively more time on the head and face during the seizure scenario than during the coughing scenario. The differences evident between experts and competent non-experts were interpreted as evidence of the relative availability of task-specific cues or heuristics in memory that might direct the process of information acquisition amongst expert physicians. The implications are discussed for the training and assessment of diagnostic skills.
Expert and Competent Non-Expert Visual Cues during Simulated Diagnosis in Intensive Care
Directory of Open Access Journals (Sweden)
Clare eMcCormack
2014-08-01
Full Text Available The aim of this study was to examine the information acquisition strategies of expert and competent non-expert intensive care physicians during two simulated diagnostic scenarios involving respiratory distress in an infant. Specifically, the information acquisition performance of six experts and 12 competent non-experts was examined using an eye tracker during the initial 90 seconds of the assessment of the patient. The results indicated that, in comparison to competent non-experts, experts recorded longer mean fixations, irrespective of the scenario. When the dwell times were examined against specific areas of interest, the results revealed that competent non-experts recorded greater overall dwell times on the nurse, where experts recorded relatively greater dwell times on the head and face of the manikin. In the context of the scenarios, experts recorded differential dwell times, spending relatively more time on the head and face during the seizure scenario than during the coughing scenario. The differences evident between experts and competent non-experts were interpreted as evidence of the relative availability of task-specific cues or heuristics in memory that might direct the process of information acquisition amongst expert physicians. The implications are discussed for the training and assessment of diagnostic skills.
Plutonium - the ultrapoison? An expert's opinion about an expert opinion
International Nuclear Information System (INIS)
Stoll, W.; Becker, K.
1989-01-01
In an expert opinion written by Professor H. Kuni, Marburg, for the North Rhine-Westphalian state government, plutonium is called by far the most dangerous element in the Periodic Table. The Marburg medical expert holds that even improved legal instruments are unable to warrant effective protection of the workers handling this material, in the light of the present standards of industrial safety, because of radiological conditions and measuring problems with plutonium isotopes. In this article by an internationally renowned expert in the field, the ideas expressed in the expert opinion about the toxicity of plutonium, the cause-and-effect relationship in radiation damage by plutonium, and recent findings about the toxicity are subjected to a critical review. On the basis of results of radiation protection and of case studies, the statements in the expert opinion are contrasted with facts which make them appear in a very different light. (orig./RB) [de
Expert status and performance.
Directory of Open Access Journals (Sweden)
Mark A Burgman
Full Text Available Expert judgements are essential when time and resources are stretched or we face novel dilemmas requiring fast solutions. Good advice can save lives and large sums of money. Typically, experts are defined by their qualifications, track record and experience. The social expectation hypothesis argues that more highly regarded and more experienced experts will give better advice. We asked experts to predict how they will perform, and how their peers will perform, on sets of questions. The results indicate that the way experts regard each other is consistent, but unfortunately, ranks are a poor guide to actual performance. Expert advice will be more accurate if technical decisions routinely use broadly-defined expert groups, structured question protocols and feedback.
Abu-Nasser, Bassem S.
2017-01-01
International audience; There is an increased interest in the area of Artificial Intelligence in general and expert systems in particular. Expert systems are rapidly growing technology. Expert systems are a branch of Artificial Intelligence which is having a great impact on many fields of human life. Expert systems use human expert knowledge to solve complex problems in many fields such as Health, science, engineering, business, and weather forecasting. Organizations employing the technology ...
Inter-expert and intra-expert reliability in sleep spindle scoring
DEFF Research Database (Denmark)
Wendt, Sabrina Lyngbye; Welinder, Peter; Sørensen, Helge Bjarup Dissing
2015-01-01
Objectives To measure the inter-expert and intra-expert agreement in sleep spindle scoring, and to quantify how many experts are needed to build a reliable dataset of sleep spindle scorings. Methods The EEG dataset was comprised of 400 randomly selected 115 s segments of stage 2 sleep from 110...... with higher reliability than the estimation of spindle duration. Reliability of sleep spindle scoring can be improved by using qualitative confidence scores, rather than a dichotomous yes/no scoring system. Conclusions We estimate that 2–3 experts are needed to build a spindle scoring dataset...... with ‘substantial’ reliability (κ: 0.61–0.8), and 4 or more experts are needed to build a dataset with ‘almost perfect’ reliability (κ: 0.81–1). Significance Spindle scoring is a critical part of sleep staging, and spindles are believed to play an important role in development, aging, and diseases of the nervous...
International Nuclear Information System (INIS)
Asami, Tohru; Hashimoto, Kazuo; Yamamoto, Seiichi
1992-01-01
Recently, aiming at the application to the plant control for nuclear reactors and traffic and communication control, the research and the practical use of the expert system suitable to real time processing have become conspicuous. In this report, the condition for the required function to control the object that dynamically changes within a limited time is presented, and the technical difference between the real time expert system developed so as to satisfy it and the expert system of conventional type is explained with the actual examples and from theoretical aspect. The expert system of conventional type has the technical base in the problem-solving equipment originating in STRIPS. The real time expert system is applied to the fields accompanied by surveillance and control, to which conventional expert system is hard to be applied. The requirement for the real time expert system, the example of the real time expert system, and as the techniques of realizing real time processing, the realization of interruption processing, dispersion processing, and the mechanism of maintaining the consistency of knowledge are explained. (K.I.)
Singh, Gursharan; Sharma, Prince; Capalash, Neena
2009-08-01
An alkalophilic and halotolerant laccase from gamma-proteobacterium JB catalyzed in high concentrations of organic solvents and various salts. The enzyme retained 80-100% activity in 10% concentration of dimethylsulfoxide (DMSO), ethanol, acetone or methanol; 100, 85 and 50% activity in 20 mM MgCl(2), 5.0 mM MnCl(2) and 0.1 mM CuCl(2); 140, 120 and 110% activity in 5.0 mM MnSO(4), 10 mM MgSO(4) and 1mM CaSO(4), respectively. Sodium halides inhibited the enzyme in the order: F(-)> Br(-)> I(-)> Cl(-). In 0.5 M NaCl, pH 6.0, laccase was approximately 60% active. Decolorization of indigo carmine by laccase at pH 9.0 was not inhibited even in the presence of 0.5 M NaCl. Release of chromophoric, reducing and hydrophobic compounds during biobleaching of straw rich-soda pulp by laccase was not inhibited when the enzyme was applied in the presence of 1 M NaCl at pH 8.0. Laccase retained 50% residual activity even when incubated with 5% calcium hypochlorite for 30 min.
Online-Expert: An Expert System for Online Database Selection.
Zahir, Sajjad; Chang, Chew Lik
1992-01-01
Describes the design and development of a prototype expert system called ONLINE-EXPERT that helps users select online databases and vendors that meet users' needs. Search strategies are discussed; knowledge acquisition and knowledge bases are described; and the Analytic Hierarchy Process (AHP), a decision analysis technique that ranks databases,…
International Nuclear Information System (INIS)
Brechet, Y.; Musseau, O.; Bruna, G.; Sperandio, M.; Roulleaux-Dugage, M.; Andrieux, S.; Metteau, L.
2014-01-01
This series of short articles are dedicated to the role of the expert in the enterprise. There is an important difference between a scientific counsellor and an expert, the expert, recognized by his peers, can speak publicly in his field of expertise but has a duty of transparency while the job of a scientific counsellor requires confidentiality. The making and the use of an expert in an enterprise requires a dedicated organization. The organization of the expertise in 5 enterprises in nuclear industry are considered: CEA (French Alternative Energies and Atomic Energy Commission), IRSN (Institute of Radioprotection and Nuclear Safety), AREVA, ANDRA (National Radioactive Waste Management Agency) and EDF (Electricity of France)
System Experts and Decision Making Experts in Transdisciplinary Projects
Mieg, Harald A.
2006-01-01
Purpose: This paper aims at a better understanding of expert roles in transdisciplinary projects. Thus, the main purpose is the analysis of the roles of experts in transdisciplinary projects. Design/methodology/approach: The analysis of the ETH-UNS case studies from the point of view of the psychology of expertise and the sociology of professions…
Expert auditors’ services classification
Jolanta Wisniewska
2013-01-01
The profession of an expert auditor is a public trust occupation with a distinctive feature of taking responsibility for actions in the public interest. The main responsibility of expert auditors is performing financial auditing; however, expert auditors are prepared to carry out different tasks which encompass a wide plethora of financial and auditing services for different kinds of institutions and companies. The aim of the article is first of all the description of expert auditors’ service...
Delegating Decisions to Experts
Li, Hao; Suen, Wing
2004-01-01
We present a model of delegation with self-interested and privately informed experts. A team of experts with extreme but opposite biases is acceptable to a wide range of decision makers with diverse preferences, but the value of expertise from such a team is low. A decision maker wants to appoint experts who are less partisan than he is in order…
Shrinivas, Dengeti; Kumar, Raghwendra; Naik, G R
2012-01-01
The thermoalkalophilic Bacillus halodurans JB 99 cells known for production of novel thermostable alkaline keratinolytic protease were immobilized in calcium alginate matrix. Batch and repeated batch cultivation using calcium alginate immobilized cells were studied for alkaline protease production in submerged fermentation. Immobilized cells with 2.5% alginate and 350 beads/flask of initial cell loading showed enhanced production of alkaline protease by 23.2% (5,275 ± 39.4 U/ml) as compared to free cells (4,280 ± 35.4 U/ml) after 24 h. In the semicontinuous mode of cultivation, immobilized cells under optimized conditions produced an appreciable level of alkaline protease in up to nine cycles and reached a maximal value of 5,975 U/ml after the seventh cycle. The enzyme produced from immobilized cells efficiently degraded chicken feathers in the presence of a reducing agent which can help the poultry industry in the management of keratin-rich waste and obtaining value-added products.
Energy Technology Data Exchange (ETDEWEB)
Basden, A
1983-11-01
This article seeks to bring together a number of issues relevant to the application of expert systems by discussing their advantages and limitations, their roles and benefits, and the influence that real-life applications might have on the design of expert systems software. Part of the expert systems strategy of one major chemical company is outlined. Because it was in constructing one particular expert system that many of these issues became important this system is described briefly at the start of the paper and used to illustrate much of the later discussion. It is of the plausible-inference type and has application in the field of materials engineering. 22 references.
Counselor Expert System | Debretsion | Zede Journal
African Journals Online (AJOL)
An expert system plays an important role on alleviating primarily shortage of experts in a specific area of interest. With the help of an expert system, personnel with little expertise can solve problems that require expert knowledge. In this paper all major aspects of an expert system development have been presented.
Energy Technology Data Exchange (ETDEWEB)
Jensen, M. [Swedish Radiation Protection Authority, Stockholm (Sweden). Dept. of Waste Management and Environmental Protection; Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)
2005-09-15
Scientists are now frequently in a situation where data cannot be easily assessed, since they may have conflicting or uncertain sources. While expert judgment reflects private choices, it is possible both reduce the personal aspect as well as in crease confidence in the judgments by using formal protocols for choice and elicitation of experts. A full-scale elicitation made on seismicity following glaciation, now in its late phase and presented here in a preliminary form, illustrates the value of the technique and some essential issues in connection with the decision to launch such a project. The results show an unusual low variation between the experts.
DEFF Research Database (Denmark)
Warby, Simon C.; Wendt, Sabrina Lyngbye; Welinder, Peter
2014-01-01
to crowdsource spindle identification by human experts and non-experts, and we compared their performance with that of automated detection algorithms in data from middle- to older-aged subjects from the general population. We also refined methods for forming group consensus and evaluating the performance...... of event detectors in physiological data such as electroencephalographic recordings from polysomnography. Compared to the expert group consensus gold standard, the highest performance was by individual experts and the non-expert group consensus, followed by automated spindle detectors. This analysis showed...... that crowdsourcing the scoring of sleep data is an efficient method to collect large data sets, even for difficult tasks such as spindle identification. Further refinements to spindle detection algorithms are needed for middle- to older-aged subjects....
Surgical experts: born or made?
Sadideen, Hazim; Alvand, Abtin; Saadeddin, Munir; Kneebone, Roger
2013-01-01
The concept of surgical expertise and the processes involved in its development are topical, and there is a constant drive to identify reliable measures of expert performance in surgery. This review explores the notion of whether surgical experts are "born" or "made", with reference to educational theory and pertinent literature. Peer-reviewed publications, books, and online resources on surgical education, expertise and training were reviewed. Important themes and aspects of expertise acquisition were identified in order to better understand the concept of a surgical expert. The definition of surgical expertise and several important aspects of its development are highlighted. Innate talent plays an important role, but is insufficient on its own to produce a surgical expert. Multiple theories that explore motor skill acquisition and memory are relevant, and Ericsson's theory of the development of competence followed by deliberate self-practice has been especially influential. Psychomotor and non-technical skills are necessary for progression in the current climate in light of our training curricula; surgical experts are adaptive experts who excel in these. The literature suggests that surgical expertise is reached through practice; surgical experts are made, not born. A deeper understanding of the nature of expert performance and its development will ensure that surgical education training programmes are of the highest possible quality. Surgical educators should aim to develop an expertise-based approach, with expert performance as the benchmark. Copyright © 2013 Surgical Associates Ltd. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Wagner, H [Kernforschungszentrum Karlsruhe G.m.b.H. (Germany, F.R.)
1980-02-01
The Federal Ministry of the Interior is preparing an ordinance on expert consultants under the Atomic Energy Act which, among other topics, is to include legal norms for the criteria to be met by experts in terms of non-partisanship, training, capabilities, technical equipment and cooperation in expert organizations of members of various scientific and technical disciplines. A summary of general criteria relating to the qualification, selection and status of experts called in by the legislative and executive branches and by courts of law, which could be organized as a series of guidelines without any original qualities of legal norms, could be recommended in view of the increasing quantitative and qualitative importance of experts. However, passing an ordinance merely fixing and putting into concrete terms the image of an 'expert under the Atomic Energy Act' is intolerable, because the status of scientific and technical experts by far extends beyond the field of nuclear law in our industrial society characterized by a far reaching division of labor. Weak points in the organization of expert services are not confined to technology or nuclear power. Separate rules establishing legal norms are not convincing also for reasons of technology policy and legal policy as well as for those of social psychology and practice.
Expert Systems for the Analytical Laboratory.
de Monchy, Allan R.; And Others
1988-01-01
Discusses two computer problem solving programs: rule-based expert systems and decision analysis expert systems. Explores the application of expert systems to automated chemical analyses. Presents six factors to consider before using expert systems. (MVL)
Expert system application for prioritizing preventive actions for shift work: shift expert.
Esen, Hatice; Hatipoğlu, Tuğçen; Cihan, Ahmet; Fiğlali, Nilgün
2017-09-19
Shift patterns, work hours, work arrangements and worker motivations have increasingly become key factors for job performance. The main objective of this article is to design an expert system that identifies the negative effects of shift work and prioritizes mitigation efforts according to their importance in preventing these negative effects. The proposed expert system will be referred to as the shift expert. A thorough literature review is conducted to determine the effects of shift work on workers. Our work indicates that shift work is linked to demographic variables, sleepiness and fatigue, health and well-being, and social and domestic conditions. These parameters constitute the sections of a questionnaire designed to focus on 26 important issues related to shift work. The shift expert is then constructed to provide prevention advice at the individual and organizational levels, and it prioritizes this advice using a fuzzy analytic hierarchy process model, which considers comparison matrices provided by users during the prioritization process. An empirical study of 61 workers working on three rotating shifts is performed. After administering the questionnaires, the collected data are analyzed statistically, and then the shift expert produces individual and organizational recommendations for these workers.
Experts in science and society
Gigerenzer, Gerd
2004-01-01
In today's complex world, we have come to rely increasingly on those who have expertise in specific areas and can bring their knowledge to bear on crucial social, political and scientific questions. Taking the viewpoint that experts are consulted when there is something important at stake for an individual, a group, or society at large, Experts in Science and Society explores expertise as a relational concept. How do experts balance their commitment to science with that to society? How does a society actually determine that a person has expertise? What personal traits are valued in an expert? From where does the expert derive authority? What makes new forms of expertise emerge? These and related questions are addressed from a wide range of areas in order to be inclusive, as well as to demonstrate similarities across areas. Likewise, in order to be culturally comparative, this volume includes examples and discussions of experts in different countries and even in different time periods. The topics include the r...
International Nuclear Information System (INIS)
Tobita, Yoshimasa; Yamaguchi, Takashi; Matsumoto, Mitsuo; Ono, Kiyoshi.
1990-01-01
The computer code system which can evaluate the mass balance and cycle cost in nuclear fuel cycle has been developing a PNC using an artificial intelligence technique. This system is composed of the expert system, data base and analysis codes. The expert system is the most important one in the system and the content of the expert system is explained in this paper. The expert system has the three functions. The first is the function of understanding the meaning of user's questions by natural language, the second is the function of selecting the best way to solve the problem given by the user using the knowledge which is already installed in the system, and the last is the function of answering the questions. The knowledge of the experts installed in the expert system is represented by the frame-type rules. Therefore, the knowledge will be simply added to the system, and consequently the system will be easily extended. (author)
DEFF Research Database (Denmark)
Blok, Anders
2007-01-01
a case study of the May 2003 Danish consensus conference on environmental economics as a policy tool, the article reflects on the politics of expert authority permeating practices of public participation. Adopting concepts from the sociology of scientific knowledge (SSK), the conference is seen......-than-successful defense in the citizen perspective. Further, consensus conferences are viewed alternatively as "expert dissent conferences," serving to disclose a multiplicity of expert commitments. From this perspective, some challenges for democratizing expertise through future exercises in public participation...
Reflection group on 'Expert Culture'
International Nuclear Information System (INIS)
Eggermont, G.
2000-01-01
As part of SCK-CEN's social sciences and humanities programme, a reflection group on 'Expert Culture' was established. The objectives of the reflection group are: (1) to clarify the role of SCK-CEN experts; (2) to clarify the new role of expertise in the evolving context of risk society; (3) to confront external views and internal SCK-CEN experiences on expert culture; (4) to improve trust building of experts and credibility of SCK-CEN as a nuclear actor in society; (5) to develop a draft for a deontological code; (6) to integrate the approach in training on assertivity and communication; (7) to create an output for a topical day on the subject of expert culture. The programme, achievements and perspectives of the refection group are summarised
PSG-EXPERT. An expert system for the diagnosis of sleep disorders.
Fred, A; Filipe, J; Partinen, M; Paiva, T
2000-01-01
This paper describes PSG-EXPERT, an expert system in the domain of sleep disorders exploring polysomnographic data. The developed software tool is addressed from two points of view: (1)--as an integrated environment for the development of diagnosis-oriented expert systems; (2)--as an auxiliary diagnosis tool in the particular domain of sleep disorders. Developed over a Windows platform, this software tool extends one of the most popular shells--CLIPS (C Language Integrated Production System) with the following features: backward chaining engine; graph-based explanation facilities; knowledge editor including a fuzzy fact editor and a rules editor, with facts-rules integrity checking; belief revision mechanism; built-in case generator and validation module. It therefore provides graphical support for knowledge acquisition, edition, explanation and validation. From an application domain point of view, PSG-Expert is an auxiliary diagnosis system for sleep disorders based on polysomnographic data, that aims at assisting the medical expert in his diagnosis task by providing automatic analysis of polysomnographic data, summarising the results of this analysis in terms of a report of major findings and possible diagnosis consistent with the polysomnographic data. Sleep disorders classification follows the International Classification of Sleep Disorders. Major features of the system include: browsing on patients data records; structured navigation on Sleep Disorders descriptions according to ASDA definitions; internet links to related pages; diagnosis consistent with polysomnographic data; graphical user-interface including graph-based explanatory facilities; uncertainty modelling and belief revision; production of reports; connection to remote databases.
Expert Systems: An Overview for Teacher-Librarians.
Orwig, Gary; Barron, Ann
1992-01-01
Provides an overview of expert systems for teacher librarians. Highlights include artificial intelligence and expert systems; the development of the MYCIN medical expert system; rule-based expert systems; the use of expert system shells to develop a specific system; and how to select an appropriate application for an expert system. (11 references)…
Energy Technology Data Exchange (ETDEWEB)
Leeuwenburgh, Marjolein M.N., E-mail: m.m.leeuwenburgh@amc.uva.nl [Department of Surgery, Academic Medical Center, University of Amsterdam (Netherlands); Department of Radiology, Academic Medical Center, University of Amsterdam (Netherlands); Wiarda, Bart M. [Department of Radiology, Alkmaar Medical Center, Alkmaar (Netherlands); Jensch, Sebastiaan [Department of Radiology, Sint Lucas Andreas Hospital, Amsterdam (Netherlands); Wouter van Es, H. [Department of Radiology, Sint Antonius Hospital, Nieuwegein (Netherlands); Stockmann, Hein B.A.C. [Department of Surgery, Kennemer Gasthuis, Haarlem (Netherlands); Gratama, Jan Willem C. [Department of Radiology, Gelre Hospitals, Apeldoorn (Netherlands); Cobben, Lodewijk P.J. [Department of Radiology, Haaglanden Medical Center, Leidschendam (Netherlands); Bossuyt, Patrick M.M. [Department of Clinical Epidemiology, Academic Medical Center, University of Amsterdam (Netherlands); Boermeester, Marja A. [Department of Surgery, Academic Medical Center, University of Amsterdam (Netherlands); Stoker, Jaap [Department of Radiology, Academic Medical Center, University of Amsterdam (Netherlands)
2014-01-15
Objective: To compare accuracy and interobserver agreement between radiologists with limited experience in the evaluation of abdominal MRI (non-experts), and radiologists with longer MR reading experience (experts), in reading MRI in patients with suspected appendicitis. Methods: MR imaging was performed in 223 adult patients with suspected appendicitis and read independently by two members of a team of eight MR-inexperienced radiologists, who were trained with 100 MR examinations previous to this study (non-expert reading). Expert reading was performed by two radiologists with a larger abdominal MR experience (>500 examinations) in consensus. A final diagnosis was assigned after three months based on all available information, except MRI findings. We estimated MRI sensitivity and specificity for appendicitis and for all urgent diagnoses separately. Interobserver agreement was evaluated using kappa statistics. Results: Urgent diagnoses were assigned to 147 of 223 patients; 117 had appendicitis. Sensitivity for appendicitis was 0.89 by MR-non-expert radiologists and 0.97 in MR-expert reading (p = 0.01). Specificity was 0.83 for MR-non-experts versus 0.93 for MR-expert reading (p = 0.002). MR-experts and MR-non-experts agreed on appendicitis in 89% of cases (kappa 0.78). Accuracy in detecting urgent diagnoses was significantly lower in MR-non-experts compared to MR-expert reading: sensitivity 0.84 versus 0.95 (p < 0.001) and specificity 0.71 versus 0.82 (p = 0.03), respectively. Agreement on urgent diagnoses was 83% (kappa 0.63). Conclusion: MR-non-experts have sufficient sensitivity in reading MRI in patients with suspected appendicitis, with good agreement with MR-expert reading, but accuracy of MR-expert reading was higher.
International Nuclear Information System (INIS)
Leeuwenburgh, Marjolein M.N.; Wiarda, Bart M.; Jensch, Sebastiaan; Wouter van Es, H.; Stockmann, Hein B.A.C.; Gratama, Jan Willem C.; Cobben, Lodewijk P.J.; Bossuyt, Patrick M.M.; Boermeester, Marja A.; Stoker, Jaap
2014-01-01
Objective: To compare accuracy and interobserver agreement between radiologists with limited experience in the evaluation of abdominal MRI (non-experts), and radiologists with longer MR reading experience (experts), in reading MRI in patients with suspected appendicitis. Methods: MR imaging was performed in 223 adult patients with suspected appendicitis and read independently by two members of a team of eight MR-inexperienced radiologists, who were trained with 100 MR examinations previous to this study (non-expert reading). Expert reading was performed by two radiologists with a larger abdominal MR experience (>500 examinations) in consensus. A final diagnosis was assigned after three months based on all available information, except MRI findings. We estimated MRI sensitivity and specificity for appendicitis and for all urgent diagnoses separately. Interobserver agreement was evaluated using kappa statistics. Results: Urgent diagnoses were assigned to 147 of 223 patients; 117 had appendicitis. Sensitivity for appendicitis was 0.89 by MR-non-expert radiologists and 0.97 in MR-expert reading (p = 0.01). Specificity was 0.83 for MR-non-experts versus 0.93 for MR-expert reading (p = 0.002). MR-experts and MR-non-experts agreed on appendicitis in 89% of cases (kappa 0.78). Accuracy in detecting urgent diagnoses was significantly lower in MR-non-experts compared to MR-expert reading: sensitivity 0.84 versus 0.95 (p < 0.001) and specificity 0.71 versus 0.82 (p = 0.03), respectively. Agreement on urgent diagnoses was 83% (kappa 0.63). Conclusion: MR-non-experts have sufficient sensitivity in reading MRI in patients with suspected appendicitis, with good agreement with MR-expert reading, but accuracy of MR-expert reading was higher
Intelligent programs-expert systems
Energy Technology Data Exchange (ETDEWEB)
Gledhill, V X
1982-01-01
In recent years, computer scientists have developed what are called expert systems. These programs have three fundamental components: a knowledge base, which changes with experience; an inference engine which enables the program to make decisions; and an interface that allows the program to communicate with the person using the system. Expert systems have been developed successfully in areas such as medical diagnosis, geology, and computer maintenance. This paper describes the evolution and basic principles of expert systems and give some examples of their use.
1987-01-01
Expert systems, a branch of artificial-intelligence studies, is introduced with a view to its relevance in transportation engineering. Knowledge engineering, the process of building expert systems or transferring knowledge from human experts to compu...
TU Delft expert judgment data base
International Nuclear Information System (INIS)
Cooke, Roger M.; Goossens, Louis L.H.J.
2008-01-01
We review the applications of structured expert judgment uncertainty quantification using the 'classical model' developed at the Delft University of Technology over the last 17 years [Cooke RM. Experts in uncertainty. Oxford: Oxford University Press; 1991; Expert judgment study on atmospheric dispersion and deposition. Report Faculty of Technical Mathematics and Informatics No.01-81, Delft University of Technology; 1991]. These involve 45 expert panels, performed under contract with problem owners who reviewed and approved the results. With a few exceptions, all these applications involved the use of seed variables; that is, variables from the experts' area of expertise for which the true values are available post hoc. Seed variables are used to (1) measure expert performance, (2) enable performance-based weighted combination of experts' distributions, and (3) evaluate and hopefully validate the resulting combination or 'decision maker'. This article reviews the classical model for structured expert judgment and the performance measures, reviews applications, comparing performance-based decision makers with 'equal weight' decision makers, and collects some lessons learned
Expert system technology for the military
International Nuclear Information System (INIS)
Franklin, J.E.; Carmody, C.L.; Buteau, B.L.; Keller, K.; Levitt, T.S.
1988-01-01
This paper is concerned with the applications of expert systems to complex military problems. A brief description of needs for expert systems in the military arena is given. A short tutorial on some of the elements of an expert system is found in Appendix I. An important aspect of expert systems concerns using uncertain information and ill-defined procedures. Many of the general techniques of dealing with uncertainty are described in Appendix II. These techniques include Bayesian certainty factors, Dempster-Shafer theory of uncertainty, and Zadeh's fuzzy set theory. The major portion of the paper addresses specific expert system examples such as resource allocation, identification of radar images, maintenance and troubleshooting of electronic equipment, and the interpretation and understanding of radar images. Extensions of expert systems to incorporate learning are examined in the context of military intelligence to determine the disposition, location, and intention of the adversary. The final application involves the use of distributed communicating cooperating expert systems for battle management. Finally, the future of expert systems and their evolving capabilities are discussed
Expert systems: A 5-year perspective
International Nuclear Information System (INIS)
MacAllister, D.J.; Day, R.; McCormack, M.D.
1996-01-01
This paper gives an overview of a major integrated oil company's experience with artificial intelligence (AI) over the last 5 years, with an emphasis on expert systems. The authors chronicle the development of an AI group, including details on development tool selection, project selection strategies, potential pitfalls, and descriptions of several completed expert systems. Small expert systems produced by teams of petroleum technology experts and experienced expert system developers that are focused in well-defined technical areas have produced substantial benefits and accelerated petroleum technology transfer
Computer Based Expert Systems.
Parry, James D.; Ferrara, Joseph M.
1985-01-01
Claims knowledge-based expert computer systems can meet needs of rural schools for affordable expert advice and support and will play an important role in the future of rural education. Describes potential applications in prediction, interpretation, diagnosis, remediation, planning, monitoring, and instruction. (NEC)
[Deontology of the medical expert].
Raszeja, S
1995-09-01
The authority of prosecuting organ to choose the expert, set his task and verify the following opinion is defined. The qualities of the medical expert and his duties are described, referring to: -his expertise; -his morality; -his ability to issue an independent (objective) opinion. Detailed rules, which can be ascribed to a specific medical expert's deontological code, are listed and explained.
International Nuclear Information System (INIS)
Verdejo, F.
1985-01-01
The purpose of this article is to introduce readers to the basic principles of rule-based expert systems. Four topics are discussed in subsequent sections: (1) Definition; (2) Structure of an expert system; (3) State of the art and (4) Impact and future research. (orig.)
Preserving experience through expert systems
International Nuclear Information System (INIS)
Jelinek, J.B.; Weidman, S.H.
1989-01-01
Expert systems technology, one of the branches in the field of computerized artificial intelligence, has existed for >30 yr but only recently has been made available on commercially standard hardware and software platforms. An expert system can be defined as any method of encoding knowledge by representing that knowledge as a collection of facts or objects. Decisions are made by the expert program by obtaining data about the problem or situation and correlating encoded facts (knowledge) to the data until a conclusion can be reached. Such conclusions can be relayed to the end user as expert advice. Realizing the potential of this technology, General Electric (GE) Nuclear Energy (GENE) has initiated a development program in expert systems applications; this technology offers the potential for packaging, distributing, and preserving nuclear experience in a software form. The paper discusses application fields, effective applications, and knowledge acquisition and knowledge verification
Operational expert system applications in Canada
Suen, Ching Y
1992-01-01
This book is part of a new series on operational expert systems worldwide. Expert systems are now widely used in different parts of the world for various applications. The past four years have witnessed a steady growth in the development and deployment of expert systems in Canada. Research in this field has also gained considerable momentum during the past few years. However, the field of expert systems is still young in Canada. This book contains 13 chapters contributed by 31 experts from both universities and industries across Canada covering a wide range of applications related to electric
Expert Systems as Tools for Technical Communicators.
Grider, Daryl A.
1994-01-01
Discusses expertise, what an expert system is, what an expert system shell is, what expert systems can and cannot do, knowledge engineering and technical communicators, and planning and managing expert system projects. (SR)
An expert system for uranium exploration
International Nuclear Information System (INIS)
Chhipa, V.K.; Sengupta, M.
1989-01-01
Artificial intelligence is an emerging technology in the field of computer application. Expert systems have been developed to imitate human intelligence and reasoning process. Expert systems have much scope of application in the decision making process in mineral exploration as such decisions are highly subjective and expert opinions are very helpful. This paper presents a small expert system to analyze the reasoning process in exploring for uranium deposits in sandstone
Expert software for accident identification
International Nuclear Information System (INIS)
Dobnikar, M.; Nemec, T.; Muehleisen, A.
2003-01-01
Each type of an accident in a Nuclear Power Plant (NPP) causes immediately after the start of the accident variations of physical parameters that are typical for that type of the accident thus enabling its identification. Examples of these parameter are: decrease of reactor coolant system pressure, increase of radiation level in the containment, increase of pressure in the containment. An expert software enabling a fast preliminary identification of the type of the accident in Krsko NPP has been developed. As input data selected typical parameters from Emergency Response Data System (ERDS) of the Krsko NPP are used. Based on these parameters the expert software identifies the type of the accident and also provides the user with appropriate references (past analyses and other documentation of such an accident). The expert software is to be used as a support tool by an expert team that forms in case of an emergency at Slovenian Nuclear Safety Administration (SNSA) with the task to determine the cause of the accident, its most probable scenario and the source term. The expert software should provide initial identification of the event, while the final one is still to be made after appropriate assessment of the event by the expert group considering possibility of non-typical events, multiple causes, initial conditions, influences of operators' actions etc. The expert software can be also used as an educational/training tool and even as a simple database of available accident analyses. (author)
BWR recirculation pump diagnostic expert system
International Nuclear Information System (INIS)
Chiang, S.C.; Morimoto, C.N.; Torres, M.R.
2004-01-01
At General Electric (GE), an on-line expert system to support maintenance decisions for BWR recirculation pumps for nuclear power plants has been developed. This diagnostic expert system is an interactive on-line system that furnishes diagnostic information concerning BWR recirculation pump operational problems. It effectively provides the recirculation pump diagnostic expertise in the plant control room continuously 24 hours a day. The expert system is interfaced to an on-line monitoring system, which uses existing plant sensors to acquire non-safety related data in real time. The expert system correlates and evaluates process data and vibration data by applying expert rules to determine the condition of a BWR recirculation pump system by applying knowledge based rules. Any diagnosis will be automatically displayed, indicating which pump may have a problem, the category of the problem, and the degree of concern expressed by the validity index and color hierarchy. The rules incorporate the expert knowledge from various technical sources such as plant experience, engineering principles, and published reports. These rules are installed in IF-THEN formats and the resulting truth values are also expressed in fuzzy terms and a certainty factor called a validity index. This GE Recirculation Pump Expert System uses industry-standard software, hardware, and network access to provide flexible interfaces with other possible data acquisition systems. Gensym G2 Real-Time Expert System is used for the expert shell and provides the graphical user interface, knowledge base, and inference engine capabilities. (author)
Trendwatch combining expert opinion
Hendrix, E.M.T.; Kornelis, M.; Pegge, S.M.; Galen, van M.A.
2006-01-01
In this study, focus is on a systematic way to detect future changes in trends that may effect the dynamics in the agro-food sector, and on the combination of opinions of experts. For the combination of expert opinions, the usefulness of multilevel models is investigated. Bayesian data analysis is
Mapping on complex neutrosophic soft expert sets
Al-Quran, Ashraf; Hassan, Nasruddin
2018-04-01
We introduce the mapping on complex neutrosophic soft expert sets. Further, we investigated the basic operations and other related properties of complex neutrosophic soft expert image and complex neutrosophic soft expert inverse image of complex neutrosophic soft expert sets.
Expert Judgement Assessment & SCENT Ontological Analysis
Directory of Open Access Journals (Sweden)
NICHERSU Iulian
2018-05-01
Full Text Available This study aims to provide insights in the starting point of the Horizon 2020 ECfunded project SCENT (Smart Toolbox for Εngaging Citizens into a People-Centric Observation Web Citizen Observatory (CO in terms of existing infrastructure, existing monitoring systems and some discussion on the existing legal and administrative framework that relate to flood monitoring and management in the area of Danube Delta. The methodology used in this approach is based on expert judgement and ontological analysis, using the information collected from the identified end-users of the SCENT toolbox. In this type of analysis the stages of flood monitoring and management that the experts are involved in are detailed. This is done through an Expert Judgement Assessment analysis. The latter is complemented by a set of Key Performance Indicators that the stakeholders have assessed and/or proposed for the evaluation of the SCENT demonstrations, for the impact of the project and finally for SCENT toolbox performance and usefulness. The second part of the study presents an analysis that attempts to map the interactions between different organizations and components of the existing monitoring systems in the Danube Delta case study. Expert Judgement (EJ allows to gain information from specialists in a specific field through a consultation process with one or more experts that have experience in similar and complementary topics. Expert judgment, expert estimates, or expert opinion are all terms that refer to the contents of the problem; estimates, outcomes, predictions, uncertainties, and their corresponding assumptions and conditions are all examples of expert judgment. Expert Judgement is affected by the process used to gather it. On the other hand, the ontological analysis comes to complete this study, by organizing and presenting the connections behind the flood management and land use systems in the three phases of the flood event.
A law for nuclear experts only
International Nuclear Information System (INIS)
Wagner, H.
1980-01-01
The Federal Ministry of the Interior is preparing an ordinance on expert consultants under the Atomic Energy Act which, among other topics, is to include legal norms for the criteria to be met by experts in terms of non-partisanship, training, capabilities, technical equipment and cooperation in expert organizations of members of various scientific and technical disciplines. A summary of general criteria relating to the qualification, selection and status of experts called in by the legislative and executive branches and by courts of law, which could be organized as a series of guidelines without any original qualities of legal norms, could be recommended in view of the increasing quantitative and qualitative importance of experts. However, passing an ordinance merely fixing and putting into concrete terms the image of an 'expert under the Atomic Energy Act' is intolerable, because the status of scientific and technical experts by far extends beyond the field of nuclear law in our industrial society characterized by a far reaching division of labor. Weak points in the organization of expert services are not confined to technology or nuclear power. Separate rules establishing legal norms are not convincing also for reasons of technology policy and legal policy as well as for those of social psychology and practice. (orig.) 891 HP/orig. 892 MKO [de
Operational expert system applications in Europe
Zarri, Gian Piero
1992-01-01
Operational Expert System Applications in Europe describes the representative case studies of the operational expert systems (ESs) that are used in Europe.This compilation provides examples of operational ES that are realized in 10 different European countries, including countries not usually examined in the standard reviews of the field.This book discusses the decision support system using several artificial intelligence tools; expert systems for fault diagnosis on computerized numerical control (CNC) machines; and expert consultation system for personal portfolio management. The failure prob
Mannath, J; Subramanian, V; Telakis, E; Lau, K; Ramappa, V; Wireko, M; Kaye, P V; Ragunath, K
2013-02-01
Autofluorescence imaging (AFI), which is a "red flag" technique during Barrett's surveillance, is associated with significant false positive results. The aim of this study was to assess the inter-observer agreement (IOA) in identifying AFI-positive lesions and to assess the overall accuracy of AFI. Anonymized AFI and high resolution white light (HRE) images were prospectively collected. The AFI images were presented in random order, followed by corresponding AFI + HRE images. Three AFI experts and 3 AFI non-experts scored images after a training presentation. The IOA was calculated using kappa and accuracy was calculated with histology as gold standard. Seventy-four sets of images were prospectively collected from 63 patients (48 males, mean age 69 years). The IOA for number of AF positive lesions was fair when AFI images were presented. This improved to moderate with corresponding AFI and HRE images [experts 0.57 (0.44-0.70), non-experts 0.47 (0.35-0.62)]. The IOA for the site of AF lesion was moderate for experts and fair for non-experts using AF images, which improved to substantial for experts [κ = 0.62 (0.50-0.72)] but remained at fair for non-experts [κ = 0.28 (0.18-0.37)] with AFI + HRE. Among experts, the accuracy of identifying dysplasia was 0.76 (0.7-0.81) using AFI images and 0.85 (0.79-0.89) using AFI + HRE images. The accuracy was 0.69 (0.62-0.74) with AFI images alone and 0.75 (0.70-0.80) using AFI + HRE among non-experts. The IOA for AF positive lesions is fair to moderate using AFI images which improved with addition of HRE. The overall accuracy of identifying dysplasia was modest, and was better when AFI and HRE images were combined.
Expert system application education project
Gonzelez, Avelino J.; Ragusa, James M.
1988-01-01
Artificial intelligence (AI) technology, and in particular expert systems, has shown potential applicability in many areas of operation at the Kennedy Space Center (KSC). In an era of limited resources, the early identification of good expert system applications, and their segregation from inappropriate ones can result in a more efficient use of available NASA resources. On the other hand, the education of students in a highly technical area such as AI requires an extensive hands-on effort. The nature of expert systems is such that proper sample applications for the educational process are difficult to find. A pilot project between NASA-KSC and the University of Central Florida which was designed to simultaneously address the needs of both institutions at a minimum cost. This project, referred to as Expert Systems Prototype Training Project (ESPTP), provided NASA with relatively inexpensive development of initial prototype versions of certain applications. University students likewise benefit by having expertise on a non-trivial problem accessible to them at no cost. Such expertise is indispensible in a hands-on training approach to developing expert systems.
Feurzeig, Wallace
1984-01-01
The first expert instructional system, the Socratic System, was developed in 1964. One of the earliest applications of this system was in the area of differential diagnosis in clinical medicine. The power of the underlying instructional paradigm was demonstrated and the potential of the approach for valuably supplementing medical instruction was recognized. Twenty years later, despite further educationally significant advances in expert systems technology and enormous reductions in the cost of computers, expert instructional methods have found very little application in medical schools.
Expert robots in nuclear plants
International Nuclear Information System (INIS)
Byrd, J.S.; Fisher, J.J.; DeVries, K.R.; Martin, T.P.
1987-01-01
Expert robots enhance a safety and operations in nuclear plants. E.I. du Pont de Nemours and Company, Savannah River Laboratory, is developing expert mobile robots for deployment in nuclear applications at the Savannah River Plant. Knowledge-based expert systems are being evaluated to simplify operator control, to assist in navigation and manipulation functions, and to analyze sensory information. Development work using two research vehicles is underway to demonstrate semiautonomous, intelligence, expert robot system operation in process areas. A description of the mechanical equipment, control systems, and operating modes is presented, including the integration of onboard sensors. A control hierarchy that uses modest computational methods is being used to allow mobile robots to autonomously navigate and perform tasks in known environments without the need for large computer systems
Expert robots in nuclear plants
International Nuclear Information System (INIS)
Byrd, J.S.; Fisher, J.J.; DeVries, K.R.; Martin, T.P.
1987-01-01
Expert robots will enhance safety and operations in nuclear plants. E. I. du Pont de Nemours and Company, Savannah River Laboratory, is developing expert mobile robots for deployment in nuclear applications at the Savannah River Plant. Knowledge-based expert systems are being evaluated to simplify operator control, to assist in navigation and manipulation functions, and to analyze sensory information. Development work using two research vehicles is underway to demonstrate semiautonomous, intelligent, expert robot system operation in process areas. A description of the mechanical equipment, control systems, and operating modes is presented, including the integration of onboard sensors. A control hierarchy that uses modest computational methods is being used to allow mobile robots to autonomously navigate and perform tasks in known environments without the need for large computer systems
Expert database system for quality control
Wang, Anne J.; Li, Zhi-Cheng
1993-09-01
There are more competitors today. Markets are not homogeneous they are fragmented into increasingly focused niches requiring greater flexibility in the product mix shorter manufacturing production runs and above allhigher quality. In this paper the author identified a real-time expert system as a way to improve plantwide quality management. The quality control expert database system (QCEDS) by integrating knowledge of experts in operations quality management and computer systems use all information relevant to quality managementfacts as well as rulesto determine if a product meets quality standards. Keywords: expert system quality control data base
Expert systems in process control systems
International Nuclear Information System (INIS)
Wittig, T.
1987-01-01
To illustrate where the fundamental difference between expert systems in classical diagnosis and in industrial control lie, the work of process control instrumentation is used as an example for the job of expert systems. Starting from the general process of problem-solving, two classes of expert systems can be defined accordingly. (orig.) [de
Use of expert judgement in NUREG-1150
International Nuclear Information System (INIS)
Ortiz, N.R.; Wheeler, T.A.; Breeding, R.J.; Hora, S.; Meyer, M.A.; Kenney, R.L.
1991-01-01
The explicit expert judgment process used in NUREG-1150, 'Severe Accident Risks: An Assessment for Five US Nuclear Plants', is discussed in this paper. The main steps of the process are described, including selection of issues and experts, elicitation training, presentation of issues to the experts, preparation of issue analyses by the experts, discussion of issue analyses and elicitation, and recomposition and aggregation of results. To demonstrate the application of the expert judgment process to NUREG-1150, two issues are summarized: one from the accident frequency analysis, and one from the accident progression analysis. Recommendations and insights are provided to improve the use of explicit expert judgment in complex technical issues. (orig.)
Expert Evidence and International Criminal Justice
DEFF Research Database (Denmark)
Appazov, Artur
The book is a comprehensive narration of the use of expertise in international criminal trials offering reflection on standards concerning the quality and presentation of expert evidence. It analyzes and critiques the rules governing expert evidence in international criminal trials...... and the strategies employed by counsel and courts relying upon expert evidence and challenges that courts face determining its reliability. In particular, the author considers how the procedural and evidentiary architecture of international criminal courts and tribunals influences the courts' ability to meaningfully...... incorporate expert evidence into the rational fact-finding process. The book provides analysis of the unique properties of expert evidence as compared with other forms of evidence and the challenges that these properties present for fact-finding in international criminal trials. It draws conclusions about...
Inductive acquisition of expert knowledge
Energy Technology Data Exchange (ETDEWEB)
Muggleton, S.H.
1986-01-01
Expert systems divide neatly into two categories: those in which (1) the expert decisions result in changes to some external environment (control systems), and (2) the expert decisions merely seek to describe the environment (classification systems). Both the explanation of computer-based reasoning and the bottleneck (Feigenbaum, 1979) of knowledge acquisition are major issues in expert-systems research. The author contributed to these areas of research in two ways: 1. He implemented an expert-system shell, the Mugol environment, which facilitates knowledge acquisition by inductive inference and provides automatic explanation of run-time reasoning on demand. RuleMaster, a commercial version of this environment, was used to advantage industrially in the construction and testing of two large classification systems. 2. He investigated a new techniques called 'sequence induction' that can be used in construction of control systems. Sequence induction is based on theoretical work in grammatical learning. He improved existing grammatical learning algorithms as well as suggesting and theoretically characterizing new ones. These algorithms were successfully applied to acquisition of knowledge for a diverse set of control systems, including inductive construction of robot plans and chess end-gam strategies.
Ionita, C
2014-01-01
The ALICE experiment at CERN employs a number of human operators (shifters), who have to make sure that the experiment is always in a state compatible with taking Physics data. Given the complexity of the system and the myriad of errors that can arise, this is not always a trivial task. The aim of this paper is to describe an expert system that is capable of assisting human shifters in the ALICE control room. The system diagnoses potential issues and attempts to make smart recommendations for troubleshooting. At its core, a Prolog engine infers whether a Physics or a technical run can be started based on the current state of the underlying sub-systems. A separate C++ component queries certain SMI objects and stores their state as facts in a Prolog knowledge base. By mining the data stored in dierent system logs, the expert system can also diagnose errors arising during a run. Currently the system is used by the on-call experts for faster response times, but we expect it to be adopted as a standard tool by reg...
International Nuclear Information System (INIS)
Tsubota, Koji
1990-01-01
The application of Artificial Intelligence (AI) as a tool for mineral exploration started only a decade ago. The systems that have been reported are in the most cases the expert systems that can simulate the decision of the experts or help numerical calculation for more reasonable and/or fast decision making. PNC started the development of the expert system for uranium exploration in 1983. Since then, KOGITO, a expert system to find the favorability of the target area, has been developed. Two years ago, the second generation development, Intelligent Research Environment and Support System, IRESS was initiated aiming at the establishment of a total support system for a project evaluation. We will review our effort for development of our system and introduce the application of the Data directed Numerical method as a new tool to Ahnemland area in Australia. (author)
Partners for development: Expert assistant in Malaysia
International Nuclear Information System (INIS)
Daud, A.H.
1996-01-01
This report reviews the expert assignments received by Malaysia under the TC programme over the 1980-95 time period. It provides data about the type of assignments and expert services, the institutions receiving the experts, and duration of the assignment. Also reviewed is the process of requesting and implementing an expert assignment in Malaysia, as well as the country's related objectives and plans
Expert system technology for nondestructive waste assay
International Nuclear Information System (INIS)
Becker, G.K.; Determan, J.C.
1998-01-01
Nondestructive assay waste characterization data generated for use in the National TRU Program must be of known and demonstrable quality. Each measurement is required to receive an independent technical review by a qualified expert. An expert system prototype has been developed to automate waste NDA data review of a passive/active neutron drum counter system. The expert system is designed to yield a confidence rating regarding measurement validity. Expert system rules are derived from data in a process involving data clustering, fuzzy logic, and genetic algorithms. Expert system performance is assessed against confidence assignments elicited from waste NDA domain experts. Performance levels varied for the active, passive shielded, and passive system assay modes of the drum counter system, ranging from 78% to 94% correct classifications
Contextual Factors for Finding Similar Experts
DEFF Research Database (Denmark)
Hofmann, Katja; Balog, Krisztian; Bogers, Toine
2010-01-01
-seeking models, are rarely taken into account. In this article, we extend content-based expert-finding approaches with contextual factors that have been found to influence human expert finding. We focus on a task of science communicators in a knowledge-intensive environment, the task of finding similar experts......, given an example expert. Our approach combines expertise-seeking and retrieval research. First, we conduct a user study to identify contextual factors that may play a role in the studied task and environment. Then, we design expert retrieval models to capture these factors. We combine these with content......-based retrieval models and evaluate them in a retrieval experiment. Our main finding is that while content-based features are the most important, human participants also take contextual factors into account, such as media experience and organizational structure. We develop two principled ways of modeling...
Expert system aids transport regulation users
International Nuclear Information System (INIS)
Cheshire, R.D.; Straw, R.J.
1990-01-01
During late 1984 the IAEA Regulations were identified as an area of application for an expert system adviser which could offer many advantages. Over the following year some simple tests were carried out to examine its feasibility, but TRANAID did not get underway until 1986 when British Nuclear Fuels (BNFL) Corporate Management services were engaged on the product. By this time a greater choice of suitable software, in the form of expert system shells, had become available. After a number of trial systems the shell Leonardo was finally adopted for the final system. In order for TRANAID to emulate the expert it was necessary to spend time extracting and documenting the expert knowledge. This was a matter of investigating how the regulations are used and was achieved by a series of meetings including opportunity for the computer specialists to interview the regulations experts. There are several benefits in having an expert system advisor in this area. It is useful to both experienced and inexperienced users of regulations. For those who are learning to use the regulations it is an excellent training aid. For those who know the regulations but use them infrequently it can save time and provide a valuable reassurance. The adviser has enabled the expert user's know how to be captured and to be made widely available to those with less experience. (author)
Cooperative expert system reasoning for waste remediations
International Nuclear Information System (INIS)
Bohn, S.J.; Pennock, K.A.; Franklin, A.L.
1991-12-01
The United States Department of Energy (DOE) is facing a large task in completing Remedial Investigations and Feasibility Studies (RI/FS) for hazardous waste sites across the nation. One of the primary objectives of an RI/FS is the specification of viable sequences of technology treatment trains which can provide implementable site solutions. We present a methodology which integrates expert system technology within an object-oriented framework to create a cooperative reasoning system designed to provide a comprehensive list of these implementable solutions. The system accomplishes its goal of specifying technology trains by utilizing a ''team'' of expert system objects. The system distributes the problem solving among the individual expert objects, and then coordinates the combination of individual decisions into a joint solution. Each expert object possesses the knowledge of an expert in a particular technology. An expert object can examine the parameters and characteristics of the waste site, seek information and support from other expert objects, and then make decisions concerning its own applicability. This methodology has at least two primary benefits. First, the creation of multiple expert objects provides a more direct mapping from the actual process to a software system, making the system easier to build. Second, the distribution of the inferencing among a number of loosely connected expert objects allows for a more robust and maintainable final product
Fire Effects, Education, and Expert Systems
Robert E. Martin
1987-01-01
Predicting the effects of fires in the year 2000 and beyond will be enhanced by the use of expert systems. Although our predictions may have broad confidence limits, expert systems should help us to improve the predictions and to focus on the areas where improved knowledge is most needed. The knowledge of experts can be incorporated into previously existing knowledge...
Hierarchical Model of Assessing and Selecting Experts
Chernysheva, Tatiana Yurievna; Korchuganova, Mariya Anatolievna; Borisov, V. V.; Minkov, S. L.
2016-01-01
Revealing experts' competences is a multi-objective issue. Authors of the paper deal with competence assessing methods of experts seen as objects, and criteria of qualities. An analytic hierarchy process of assessing and ranking experts is offered, which is based on paired comparison matrices and scores, quality parameters are taken into account as well. Calculation and assessment of experts is given as an example.
Ask-the-expert: Active Learning Based Knowledge Discovery Using the Expert
Das, Kamalika; Avrekh, Ilya; Matthews, Bryan; Sharma, Manali; Oza, Nikunj
2017-01-01
Often the manual review of large data sets, either for purposes of labeling unlabeled instances or for classifying meaningful results from uninteresting (but statistically significant) ones is extremely resource intensive, especially in terms of subject matter expert (SME) time. Use of active learning has been shown to diminish this review time significantly. However, since active learning is an iterative process of learning a classifier based on a small number of SME-provided labels at each iteration, the lack of an enabling tool can hinder the process of adoption of these technologies in real-life, in spite of their labor-saving potential. In this demo we present ASK-the-Expert, an interactive tool that allows SMEs to review instances from a data set and provide labels within a single framework. ASK-the-Expert is powered by an active learning algorithm for training a classifier in the backend. We demonstrate this system in the context of an aviation safety application, but the tool can be adopted to work as a simple review and labeling tool as well, without the use of active learning.
Experts' perceptions on the entrepreneurial framework conditions
Correia, Aldina; e Silva, Eliana Costa; Lopes, I. Cristina; Braga, Alexandra; Braga, Vitor
2017-11-01
The Global Entrepreneurship Monitor is a large scale database for internationally comparative entrepreneurship. This database includes information of more than 100 countries concerning several aspects of entrepreneurship activities, perceptions, conditions, national and regional policy, among others, in two main sources of primary data: the Adult Population Survey and the National Expert Survey. In the present work the National Expert Survey datasets for 2011, 2012 and 2013 are analyzed with the purpose of studying the effects of different type of entrepreneurship expert specialization on the perceptions about the Entrepreneurial Framework Conditions (EFCs). The results of the multivariate analysis of variance for the 2013 data show significant differences of the entrepreneurship experts when compared the 2011 and 2012 surveys. For the 2013 data entrepreneur experts are less favorable then most of the other experts to the EFCs.
Robust Trust in Expert Testimony
Directory of Open Access Journals (Sweden)
Christian Dahlman
2015-05-01
Full Text Available The standard of proof in criminal trials should require that the evidence presented by the prosecution is robust. This requirement of robustness says that it must be unlikely that additional information would change the probability that the defendant is guilty. Robustness is difficult for a judge to estimate, as it requires the judge to assess the possible effect of information that the he or she does not have. This article is concerned with expert witnesses and proposes a method for reviewing the robustness of expert testimony. According to the proposed method, the robustness of expert testimony is estimated with regard to competence, motivation, external strength, internal strength and relevance. The danger of trusting non-robust expert testimony is illustrated with an analysis of the Thomas Quick Case, a Swedish legal scandal where a patient at a mental institution was wrongfully convicted for eight murders.
Expert systems in clinical microbiology.
Winstanley, Trevor; Courvalin, Patrice
2011-07-01
This review aims to discuss expert systems in general and how they may be used in medicine as a whole and clinical microbiology in particular (with the aid of interpretive reading). It considers rule-based systems, pattern-based systems, and data mining and introduces neural nets. A variety of noncommercial systems is described, and the central role played by the EUCAST is stressed. The need for expert rules in the environment of reset EUCAST breakpoints is also questioned. Commercial automated systems with on-board expert systems are considered, with emphasis being placed on the "big three": Vitek 2, BD Phoenix, and MicroScan. By necessity and in places, the review becomes a general review of automated system performances for the detection of specific resistance mechanisms rather than focusing solely on expert systems. Published performance evaluations of each system are drawn together and commented on critically.
Expert opinion vs. empirical evidence
Herman, Rod A; Raybould, Alan
2014-01-01
Expert opinion is often sought by government regulatory agencies when there is insufficient empirical evidence to judge the safety implications of a course of action. However, it can be reckless to continue following expert opinion when a preponderance of evidence is amassed that conflicts with this opinion. Factual evidence should always trump opinion in prioritizing the information that is used to guide regulatory policy. Evidence-based medicine has seen a dramatic upturn in recent years spurred by examples where evidence indicated that certain treatments recommended by expert opinions increased death rates. We suggest that scientific evidence should also take priority over expert opinion in the regulation of genetically modified crops (GM). Examples of regulatory data requirements that are not justified based on the mass of evidence are described, and it is suggested that expertise in risk assessment should guide evidence-based regulation of GM crops. PMID:24637724
Expert systems in clinical practice
International Nuclear Information System (INIS)
Renaud-Salis, J.L.
1987-01-01
The first expert systems prototypes intended for advising physicians on diagnosis or therapy selection have been designed more than ten years ago. However, a few of them are already in use in clinical practice after years of research and development efforts. The capabilities of these systems to reason symbolically and to mimic the hypothetico-deductive processes used by physicians distinguishes them from conventional computer programs. Their power comes from their knowledge-base which embeds a large quantity of high-level, specialized knowledge captured from medical experts. Common methods for knowledge representation include production rules and frames. These methods also provide a mean for organizing and structuring the knowledge according to hierarchical or causal links. The best expert-systems perform at the level of the experts. They are easy to learn and use, and can communicate with the user in pseudo-natural language. Moreover they are able to explain their line of reasoning. These capabilities make them potentially useful, usable and acceptable by physicians. However if the problems related to difficulties and costs in building expert-systems are on the way to be solved within the next few years, forensic and ethical issues should have to be addressed before one can envisage their routine use in clinical practice [fr
African Journals Online (AJOL)
Adele
formal rules of evidence apply) to help it understand the issues of a case and ... statements on medical expert witness by professional representative bodies in .... determining the size of the financial settlement that may have to be made to the.
Expert system for estimating LWR plutonium production
International Nuclear Information System (INIS)
Sandquist, G.M.
1988-01-01
An Artificial Intelligence-Expert System called APES (Analysis of Proliferation by Expert System) has been developed and tested to permit a non proliferation expert to evaluate the capability and capacity of a specified LWR reactor and PUREX reprocessing system for producing and separating plutonium even when system information may be limited and uncertain. APES employs an expert system coded in LISP and based upon an HP-RL (Hewlett Packard-Representational Language) Expert System Shell. The user I/O interface communicates with a blackboard and the knowledge base which contains the quantitative models required to describe the reactor, selected fission product production and radioactive decay processes, Purex reprocessing and ancillary knowledge
Expert Systems in Reference Services.
Roysdon, Christine, Ed.; White, Howard D., Ed.
1989-01-01
Eleven articles introduce expert systems applications in library and information science, and present design and implementation issues of system development for reference services. Topics covered include knowledge based systems, prototype development, the use of artificial intelligence to remedy current system inadequacies, and an expert system to…
Quantitative and qualitative analysis of the expert and non-expert opinion in fire risk in buildings
International Nuclear Information System (INIS)
Hanea, D.M.; Jagtman, H.M.; Alphen, L.L.M.M. van; Ale, B.J.M.
2010-01-01
Expert judgment procedure is a method very often used in the area of risk assessments of complex systems or processes to fill in quantitative data. Although it has been proved to be a very reliable source of information when no other data are available, the choice of experts is always questioned. When the available data are limited, the seed questions cover only partially the domains of expertise, which may cause problems. Expertise is assessed not covering the full object of study but only those topics for which seed questions can be formulated. The commonly used quantitative analysis of an expert judgment exercise is combined with a qualitative analysis. The latter adds more insights to the relation between the assessor's field and statistical knowledge and their performance in an expert judgment. In addition the qualitative analysis identifies different types of seed questions. Three groups of assessors with different levels of statistical and domain knowledge are studied. The quantitative analysis shows no differences between field experts and non-experts and no differences between having advanced statistical knowledge or not. The qualitative analysis supports these findings. In addition it is found that especially technical questions are answered with larger intervals. Precaution is required when using seed questions for which the real value can be calculated, which was the case for one of the seed questions.
20 CFR 405.10 - Medical and Vocational Expert System.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Medical and Vocational Expert System. 405.10... Vocational Expert System. (a) General. The Medical and Vocational Expert System is comprised of the Medical... Vocational Expert System. (3) Experts who provide evidence at your request. Experts whom you ask to provide...
International Nuclear Information System (INIS)
Ionita, C; Carena, F
2014-01-01
The ALICE experiment at CERN employs a number of human operators (shifters), who have to make sure that the experiment is always in a state compatible with taking Physics data. Given the complexity of the system and the myriad of errors that can arise, this is not always a trivial task. The aim of this paper is to describe an expert system that is capable of assisting human shifters in the ALICE control room. The system diagnoses potential issues and attempts to make smart recommendations for troubleshooting. At its core, a Prolog engine infers whether a Physics or a technical run can be started based on the current state of the underlying sub-systems. A separate C++ component queries certain SMI objects and stores their state as facts in a Prolog knowledge base. By mining the data stored in different system logs, the expert system can also diagnose errors arising during a run. Currently the system is used by the on-call experts for faster response times, but we expect it to be adopted as a standard tool by regular shifters during the next data taking period
de Reuver, Philip R.; Dijkgraaf, Marcel G. W.; Gevers, Sjef K. M.; Gouma, Dirk J.
2008-01-01
Objective: To determine the inter-rater agreement of expert witness testimonies in bile duct injury malpractice litigation. Background Data: Malpractice litigation is an increasing concern in modem surgical practice. As most of the lawyers are not educated in medicine, expert witnesses are asked to
Reuver, P.R. de; Dijkgraaf, M.G.; Gevers, S.K.; Gouma, D.J.; Bleichrodt, R.P.; Cuesta, M.A.; Erp, W.F. van; Gerritsen, J.; Hesselink, E.J.; Laarhoven, C.J.H.M. van; Lange, J. de; Obertop, H.; Stassen, L.P.; Terpstra, O.T.; Tilanus, H.W.; Vroonhoven, T.J.; Wit, L. de
2008-01-01
OBJECTIVE: To determine the inter-rater agreement of expert witness testimonies in bile duct injury malpractice litigation. BACKGROUND DATA: Malpractice litigation is an increasing concern in modern surgical practice. As most of the lawyers are not educated in medicine, expert witnesses are asked to
An expert system for turbogenerator diagnostics
International Nuclear Information System (INIS)
Bessenyei, Z.; Tomcsanyi, T.; Toth, Z.; Laczay, I.
1992-01-01
In 1990, an expert system for turbo-generator diagnostics (EST-D) was installed at the 3rd and 4th units of the Paks NPP (Hungary). The expert system is strongly integrated to the ARGUS II vibration monitoring and diagnostics system. The system works on IBM PC AT. The VEIKI's and the NPP's human experts were interviewed to fill up the knowledgebase. The system is able to identify 13 different faults of the parts of a turbogenerator. The knowledgebase consists of ca 200 rules. The rules were built in and the system was verified and validated using a model of the turbines and using the experiences gathered with ARGUS II during the last 3 years. The maintenance personnel is authorized to modify and/or extend the knowledgebase. The input data for evaluation come from measured vibration patterns produced by the ARGUS II system, database of events, and maintenance data input by the maintenance personnel. The expert system is based on the modified GENESYS 2.1 shell (developed by SZAMALK, Hungary). Some limitations from PC application were eliminated, and a new, independent explanation module and man-machine interface were developed. Using this man-machine interface, one of the basic goals of the expert system developments was achieved: the human experts contribution is not necessary for diagnoses. The operator of the diagnostics system is able to produce the reports of diagnoses. Of course the interface allows the human experts to see the diagnoses through. It should be mentioned, at the beginning of 1991, we installed a similar expert system at the 1st 1000 MW WWER type unit of the Kalinin NPP (Soviet Union). In this paper, the operation of the EST-D, the man-machine interface and the operational experiences of the first 4 months work are explained. 2 refs., 14 figs
Artificial Intelligence: The Expert Way.
Bitter, Gary G.
1989-01-01
Discussion of artificial intelligence (AI) and expert systems focuses on their use in education. Characteristics of good expert systems are explained; computer software programs that contain applications of AI are described, highlighting one used to help educators identify learning-disabled students; and the future of AI is discussed. (LRW)
Mind the Gaps: Expert and Non-Expert Differences in Conceptualising the Geological Subsurface.
Gibson, H.; Stewart, I. S.; Stokes, A.; Pahl, S.
2017-12-01
In communicating geoscience topics, emphasis is often given to approaches such as the use of narrative to make a message engaging and reducing the use of jargon to ensure that it is understood by as wide a group of people as possible. Whilst these are undeniably important techniques to promote effective communication, an aspect of geoscience communication that is often overlooked is the publics' conceptual frameworks about core geoscience concepts. The consideration of different conceptual frameworks fits with the need to ensure that the framing is appropriate for the message, but it extends beyond simple framing into more complicated issues of addressing and incorporating pre- and mis-conceptions in geoscience. In a study examining expert and non-expert cognitive (mental) models of the geological subsurface in south-west England, several gaps were found between the fundamental ways that experts and non-experts conceptualise this invisible realm. Of these, three gaps were considered to be particularly important and common to many participants: the use of spatial reasoning; the application of surface experiences to subsurface processes; and the connection between the surface and subsurface. This paper will examine the evidence for these three important conceptual gaps between specialists and non-specialists and will address how this type of cognitive study can help improve effective geoscience communication.
Key attributes of expert NRL referees.
Morris, Gavin; O'Connor, Donna
2017-05-01
Experiential knowledge of elite National Rugby League (NRL) referees was investigated to determine the key attributes contributing to expert officiating performance. Fourteen current first-grade NRL referees were asked to identify the key attributes they believed contributed to their expert refereeing performance. The modified Delphi method involved a 3-round process of an initial semi-structured interview followed by 2 questionnaires to reach consensus of opinion. The data revealed 25 attributes that were rated as most important that underpin expert NRL refereeing performance. Results illustrate the significance of the cognitive category, with the top 6 ranked attributes all cognitive skills. Of these, the referees ranked decision-making accuracy as the most important attribute, followed by reading the game, communication, game understanding, game management and knowledge of the rules. Player rapport, positioning and teamwork were the top ranked game skill attributes underpinning performance excellence. Expert referees also highlighted a number of psychological attributes (e.g., concentration, composure and mental toughness) that were significant to performance. There were only 2 physiological attributes (fitness, aerobic endurance) that were identified as significant to elite officiating performance. In summary, expert consensus was attained which successfully provided a hierarchy of the most significant attributes of expert NRL refereeing performance.
Expert judgement models in quantitative risk assessment
Energy Technology Data Exchange (ETDEWEB)
Rosqvist, T. [VTT Automation, Helsinki (Finland); Tuominen, R. [VTT Automation, Tampere (Finland)
1999-12-01
Expert judgement is a valuable source of information in risk management. Especially, risk-based decision making relies significantly on quantitative risk assessment, which requires numerical data describing the initiator event frequencies and conditional probabilities in the risk model. This data is seldom found in databases and has to be elicited from qualified experts. In this report, we discuss some modelling approaches to expert judgement in risk modelling. A classical and a Bayesian expert model is presented and applied to real case expert judgement data. The cornerstone in the models is the log-normal distribution, which is argued to be a satisfactory choice for modelling degree-of-belief type probability distributions with respect to the unknown parameters in a risk model. Expert judgements are qualified according to bias, dispersion, and dependency, which are treated differently in the classical and Bayesian approaches. The differences are pointed out and related to the application task. Differences in the results obtained from the different approaches, as applied to real case expert judgement data, are discussed. Also, the role of a degree-of-belief type probability in risk decision making is discussed.
Expert judgement models in quantitative risk assessment
International Nuclear Information System (INIS)
Rosqvist, T.; Tuominen, R.
1999-01-01
Expert judgement is a valuable source of information in risk management. Especially, risk-based decision making relies significantly on quantitative risk assessment, which requires numerical data describing the initiator event frequencies and conditional probabilities in the risk model. This data is seldom found in databases and has to be elicited from qualified experts. In this report, we discuss some modelling approaches to expert judgement in risk modelling. A classical and a Bayesian expert model is presented and applied to real case expert judgement data. The cornerstone in the models is the log-normal distribution, which is argued to be a satisfactory choice for modelling degree-of-belief type probability distributions with respect to the unknown parameters in a risk model. Expert judgements are qualified according to bias, dispersion, and dependency, which are treated differently in the classical and Bayesian approaches. The differences are pointed out and related to the application task. Differences in the results obtained from the different approaches, as applied to real case expert judgement data, are discussed. Also, the role of a degree-of-belief type probability in risk decision making is discussed
Expert systems and nuclear safety
International Nuclear Information System (INIS)
Beltracchi, L.
1990-01-01
The US Nuclear Regulatory Commission (NRC) and the Electric Power Research Institute have initiated a broad-based exploration of means to evaluate the potential applications of expert systems in the nuclear industry. This exploratory effort will assess the use of expert systems to augment the diagnostic and decision-making capabilities of personnel with the goal of enhancing productivity, reliability, and performance. The initial research effort is the development and documentation of guidelines for verifying and validating (V and V) expert systems. An initial application of expert systems in the nuclear industry is to aid operations and maintenance personnel in decision-making tasks. The scope of the decision aiding covers all types of cognitive behavior consisting of skill, rule, and knowledge-based behavior. For example, procedure trackers were designed and tested to support rule-based behavior. Further, these systems automate many of the tedious, error-prone human monitoring tasks, thereby reducing the potential for human error. The paper version of the procedure contains the knowledge base and the rules and thus serves as the basis of the design verification of the procedure tracker. Person-in-the-loop tests serve as the basis for the validation of a procedure tracker. When conducting validation tests, it is important to ascertain that the human retains the locus of control in the use of the expert system
Expert systems: an alternative paradigm
Energy Technology Data Exchange (ETDEWEB)
Coombs, M.; Alty, J.
1984-01-01
There has recently been a significant effort by the AI community to interest industry in the potential of expert systems. However, this has resulted in far fewer substantial applications projects than might be expected. This article argues that this is because human experts are rarely required to perform the role that computer-based experts are programmed to adopt. Instead of being called in to answer well-defined problems, they are more often asked to assist other experts to extend and refine their understanding of a problem area at the junction of their two domains of knowledge. This more properly involves educational rather than problem-solving skills. An alternative approach to expert system design is proposed based upon guided discovery learning. The user is provided with a supportive environment for a particular class of problem, the system predominantly acting as an adviser rather than directing the interaction. The environment includes a database of domain knowledge, a set of procedures for its application to a concrete problem, and an intelligent machine-based adviser to judge the user's effectiveness and advise on strategy. The procedures focus upon the use of user generated explanations both to promote the application of domain knowledge and to expose understanding difficulties. Simple database PROLOG is being used as the subject material for the prototype system which is known as MINDPAD. 30 references.
Paradigms and building tools for real-time expert systems
International Nuclear Information System (INIS)
Behrens, U.; Flasinski, M.; Hagge, L.; Ohrenberg, K.
1994-01-01
An expert system is a software which can simulate the problem solving behavior of a human expert. The rule-based paradigm is chosen to describe the different aspects involved in expert system development. Differences between expert systems and common procedural or object-oriented programs are investigated. Expert system shells are introduced as a building tool for expert systems, together with some guidelines on the evaluation of such shells. A discussion of special needs for real-time expert system development concludes the paper
Main tasks of the Nuclear Research Institute in the period till the year 2000
International Nuclear Information System (INIS)
Podest, M.
1989-06-01
The main tasks of the Nuclear Research Institute will be oriented to: safety of nuclear power installations; expert and diagnostic systems for such installations; the effect of operating medium on the life of nuclear power plants; disposal of radioactive wastes; prospective nuclear sources; research into and development of radiopharmaceuticals; radiation technologies and methods. Specific tasks are itemized. The statute of the Institute is attached. (J.B.). 1 tab
ART-Ada: An Ada-based expert system tool
Lee, S. Daniel; Allen, Bradley P.
1991-01-01
The Department of Defense mandate to standardize on Ada as the language for software systems development has resulted in increased interest in making expert systems technology readily available in Ada environments. NASA's Space Station Freedom is an example of the large Ada software development projects that will require expert systems in the 1990's. Another large scale application that can benefit from Ada based expert system tool technology is the Pilot's Associate (PA) expert system project for military combat aircraft. Automated Reasoning Tool (ART) Ada, an Ada Expert system tool is described. ART-Ada allow applications of a C-based expert system tool called ART-IM to be deployed in various Ada environments. ART-Ada is being used to implement several prototype expert systems for NASA's Space Station Freedom Program and the U.S. Air Force.
Methodology toward second generation expert systems
International Nuclear Information System (INIS)
Dormoy, J.L.
1989-01-01
So-called First Generation Expert Systems were aimed at capturing the expert's know-how. Though providing remarkable achievements, this first wave did not give the expected outcome. A new generation is getting out from the laboratories. Instead of remaining at a shallow level of knowledge - that is the unmotivated reasoning processes expressed by an expert when he is forced to tell them - one attempts to re-build this level of knowledge from the first principles which constitute the basis of an expert's knowledge. These systems are called deep knowledge-based, or second generation expert systems. Discussion in the three first parts rests on two examples: A first generation and a half system for process control in nuclear powers plants, than the system EXTRA for alarm processing in nuclear plants, wherein fonctional knowledge is explicitely represented. We show how deep knowledge can be implemented, and the advantages that can be expected from this methodology. Qualitative Physics is discussed in the next part. Future research developments as well as potential payoffs are mentioned [fr
False confessions, expert testimony, and admissibility.
Watson, Clarence; Weiss, Kenneth J; Pouncey, Claire
2010-01-01
The confession of a criminal defendant serves as a prosecutor's most compelling piece of evidence during trial. Courts must preserve a defendant's constitutional right to a fair trial while upholding the judicial interests of presenting competent and reliable evidence to the jury. When a defendant seeks to challenge the validity of that confession through expert testimony, the prosecution often contests the admissibility of the expert's opinion. Depending on the content and methodology of the expert's opinion, testimony addressing the phenomenon of false confessions may or may not be admissible. This article outlines the scientific and epistemological bases of expert testimony on false confession, notes the obstacles facing its admissibility, and provides guidance to the expert in formulating opinions that will reach the judge or jury. We review the 2006 New Jersey Superior Court decision in State of New Jersey v. George King to illustrate what is involved in the admissibility of false-confession testimony and use the case as a starting point in developing a best-practice approach to working in this area.
Beresniewicz, John
2011-01-01
Expert PL/SQL Practices is a book of collected wisdom on PL/SQL programming from some of the best and the brightest in the field. Each chapter is a deep-dive into a specific problem, technology, or feature set that you'll face as a PL/SQL programmer. Each author has chosen their topic out of the strong belief that what they share can make a positive difference in the quality and scalability of code that you write. The path to mastery begins with syntax and the mechanics of writing statements to make things happen. If you've reached that point with PL/SQL, then let the authors of Expert PL/SQL
Expert systems for superalloy studies
Workman, Gary L.; Kaukler, William F.
1990-01-01
There are many areas in science and engineering which require knowledge of an extremely complex foundation of experimental results in order to design methodologies for developing new materials or products. Superalloys are an area which fit well into this discussion in the sense that they are complex combinations of elements which exhibit certain characteristics. Obviously the use of superalloys in high performance, high temperature systems such as the Space Shuttle Main Engine is of interest to NASA. The superalloy manufacturing process is complex and the implementation of an expert system within the design process requires some thought as to how and where it should be implemented. A major motivation is to develop a methodology to assist metallurgists in the design of superalloy materials using current expert systems technology. Hydrogen embrittlement is disasterous to rocket engines and the heuristics can be very complex. Attacking this problem as one module in the overall design process represents a significant step forward. In order to describe the objectives of the first phase implementation, the expert system was designated Hydrogen Environment Embrittlement Expert System (HEEES).
Expert systems as decision tools
International Nuclear Information System (INIS)
Scott, C.K.
1989-01-01
The feasibility of using expert systems as an aid in regulatory compliance functions has been investigated. A literature review was carried out to identify applications of expert systems to regulatory affairs. A bibliography of the small literature on such applications was prepared. A prototype system, ARIES, was developed to demonstrate the use of an expert system as an aid to a Project Officer in assuring compliance with licence requirements. The system runs on a personal computer with a graphical interface. Extensive use is made of hypertext to link interrelated rules and requirements as well as to provide an explanation facility. Based on the performance of ARIES the development of a field version is recommended
From expert witness to defendant: abolition of expert witness protection and its implications.
Mendelson, Danuta
2012-12-01
In Jones v Kaney [2011] 2 AC 398, the United Kingdom Supreme Court held that in England and Wales (but not in Scotland), clients can sue expert witnesses in negligence and/or contract for work performed under their retainer, whether in civil or criminal trials. The duties of expert witnesses in England are regulated by the Civil Procedure Rules and Protocols; the former also regulate the conduct of cases involving expert opinions. The legal context that led to the litigation is examined in the light of these rules, in particular, the nature of the allegations against Dr Kaney, a psychologist retained to provide psychiatric opinion. Jones v Kaney, as a decision of the United Kingdom Supreme Court, is not a binding precedent in Australia. However, unlike statutory enactments, common law judgments are retrospective in their operation, which means that health care practitioners who follow a generally accepted practice today may still be sued for damages by their patients or clients in the future. By definition, the future, including the refusal by the Australian High Court to follow Kaney's abolition of expert witnesses' immunity from suit for breach of duty to their clients, cannot be predicted with certainty. Consequently, health care practitioners in Australia and other countries should be aware of the case, its jurisprudential and practical ramifications.
Expert system for fast reactor diagnostic
International Nuclear Information System (INIS)
Parcy, J.P.
1982-09-01
A general description of expert systems is given. The operation of a fast reactor is reviewed. The expert system to the diagnosis of breakdowns limited to the reactor core. The structure of the system is described: specification of the diagnostics; structure of the data bank and evaluation of the rules; specification of the prediagnostics and evaluation; explanation of the diagnostics; time evolution of the system; comparison with other expert systems. Applications to some cases of faults are finally presented [fr
Sherlock Holmes: an expert's view of expertise.
André, Didierjean; Fernand, Gobet
2008-02-01
In recent years, there has been an intense research effort to understand the cognitive processes and structures underlying expert behaviour. Work in different fields, including scientific domains, sports, games and mnemonics, has shown that there are vast differences in perceptual abilities between experts and novices, and that these differences may underpin other cognitive differences in learning, memory and problem solving. In this article, we evaluate the progress made in the last years through the eyes of an outstanding, albeit fictional, expert: Sherlock Holmes. We first use the Sherlock Holmes character to illustrate expert processes as described by current research and theories. In particular, the role of perception, as well as the nature and influence of expert knowledge, are all present in the description of Conan Doyle's hero. In the second part of the article, we discuss a number of issues that current research on expertise has barely addressed. These gaps include, for example, several forms of reasoning, the influence of emotions on cognition, and the effect of age on experts' knowledge and cognitive processes. Thus, although nearly 120-year-old, Conan Doyle's books show remarkable illustrations of expert behaviour, including the coverage of themes that have mostly been overlooked by current research.
21 CFR 516.141 - Qualified expert panels.
2010-04-01
... choose members for the qualified expert panel in accordance with selection criteria listed in paragraph... whether the proposed qualified expert panel meets the selection criteria prior to the panel beginning its... Committee Act, as amended, 5 U.S.C. App. (b) Criteria for the selection of a qualified expert panel. (1) A...
Differentiating Experts' Anticipatory Skills in Beach Volleyball
Canal-Bruland, Rouwen; Mooren, Merel; Savelsbergh, Geert J. P.
2011-01-01
In this study, we examined how perceptual-motor expertise and watching experience contribute to anticipating the outcome of opponents' attacking actions in beach volleyball. To this end, we invited 8 expert beach volleyball players, 8 expert coaches, 8 expert referees, and 8 control participants with no beach volleyball experience to watch videos…
Measuring the Effectiveness of Gamesourcing Expert Oil Painting Annotations
M.C. Traub (Myriam); J.R. van Ossenbruggen (Jacco); J. He (Jiyin); L. Hardman (Lynda); M. de Rijke (Maarten); T Kentner; A.P. de Vries (Arjen); F.M.G. de Jong (Franciska); C. Zhai (ChengXiang ); K. Hofmann (Katja); K. Radinsky
2014-01-01
htmlabstractTasks that require users to have expert knowledge are diffi- cult to crowdsource. They are mostly too complex to be carried out by non-experts and the available experts in the crowd are difficult to target. Adapting an expert task into a non-expert user task, thereby enabling the
[Telemedicine correlation in retinopathy of prematurity between experts and non-expert observers].
Ossandón, D; Zanolli, M; López, J P; Stevenson, R; Agurto, R; Cartes, C
2015-01-01
To study the correlation between expert and non-expert observers in the reporting images for the diagnosis of retinopathy of prematurity (ROP) in a telemedicine setting. A cross-sectional, multicenter study, consisting of 25 sets of images of patients screened for ROP. They were evaluated by two experts in ROP and 1 non-expert and classified according to telemedicine classification, zone, stage, plus disease and Ells referral criteria. The telemedicine classification was: no ROP, mild ROP, type 2 ROP, or ROP that requires treatment. Ells referral criteria is defined as the presence at least one of the following: ROP in zone I, Stage 3 in zone I or II, or plus+ For statistical analysis, SPSS 16.0 was used. For correlation, Kappa value was performed. There was a high correlation between observers for the assessment of ROP stage (0.75; 0.54-0.88) plus disease (0.85; 0.71-0.92), and Ells criteria (0.89; 0.83-1.0). However, inter-observer values were low for zone (0.41; 0.27-0.54) and telemedicine classification (0.43; 0.33-0.6). When evaluating telemedicine images by examiners with different levels of expertise in ROP, the Ells criteria gave the best correlation. In addition, stage of disease and plus disease have good correlation among observers. In contrast, the correlation between observers was low for zone and telemedicine classification. Copyright © 2014 Sociedad Española de Oftalmología. Published by Elsevier España, S.L.U. All rights reserved.
Expert system for liquid low-level waste management
International Nuclear Information System (INIS)
Ferrada, J.J.
1992-01-01
An expert system prototype has been developed to support system analysis activities at the Oak Ridge National Laboratory (ORNL) for waste management tasks. This expert system will aid in prioritizing radioactive waste streams for treatment and disposal by evaluating the severity and treatability of the problem as well as the final waste form. The objectives of the expert system development included: (1) collecting information on process treatment technologies for liquid low-level waste (LLLW) that can be incorporated in the knowledge base of the expert system, and (2) producing a prototype that suggests processes and disposal technologies for the ORNL LLLW system. The concept under which the expert system has been designed is integration of knowledge. There are many sources of knowledge (data bases, text files, simulation programs, etc.) that an expert would regularly consult in order to solve a problem of liquid waste management. The expert would normally know how to extract the information from these different sources of knowledge. The general scope of this project would be to include as much pertinent information as possible within the boundaries of the expert system. As a result, the user, who may not be an expert in every aspect of liquid waste management, may be able to apply the content of the information to a specific waste problem. This paper gives the methodological steps to develop the expert system under this general framework
Reflection group on 'Expert Culture'
Energy Technology Data Exchange (ETDEWEB)
Eggermont, G
2000-07-01
As part of SCK-CEN's social sciences and humanities programme, a reflection group on 'Expert Culture' was established. The objectives of the reflection group are: (1) to clarify the role of SCK-CEN experts; (2) to clarify the new role of expertise in the evolving context of risk society; (3) to confront external views and internal SCK-CEN experiences on expert culture; (4) to improve trust building of experts and credibility of SCK-CEN as a nuclear actor in society; (5) to develop a draft for a deontological code; (6) to integrate the approach in training on assertivity and communication; (7) to create an output for a topical day on the subject of expert culture. The programme, achievements and perspectives of the refection group are summarised.
Expert Systems for auditing management information systems
Directory of Open Access Journals (Sweden)
Gheroghe Popescu
2007-05-01
Full Text Available Expert systems are built with the help of: specialised programming languages or expert system generators (shell. But this structure was reached after tens of years of work and research, because expert systems are nothing but pragmatic capitalisation of the results of research carried out in artificial intelligence and theory of knowledge.
Expert Cold Structure Development
Atkins, T.; Demuysere, P.
2011-05-01
The EXPERT Program is funded by ESA. The objective of the EXPERT mission is to perform a sub-orbital flight during which measurements of critical aero- thermodynamic phenomena will be obtained by using state-of-the-art instrumentation. As part of the EXPERT Flight Segment, the responsibility of the Cold Structure Development Design, Manufacturing and Validation was committed to the Belgian industrial team SONACA/SABCA. The EXPERT Cold Structure includes the Launcher Adapter, the Bottom Panel, the Upper Panel, two Cross Panels and the Parachute Bay. An additional Launcher Adapter was manufactured for the separation tests. The selected assembly definition and manufacturing technologies ( machined parts and sandwich panels) were dictated classically by the mass and stiffness, but also by the CoG location and the sensitive separation interface. Used as support for the various on-board equipment, the Cold Structure is fixed to but thermally uncoupled from the PM 1000 thermal shield. It is protect on its bottom panel by a thermal blanket. As it is a protoflight, analysis was the main tool for the verification. Low level stiffness and modal analysis tests have also been performed on the Cold Structure equipped with its ballast. It allowed to complete its qualification and to prepare SONACA/SABCA support for the system dynamic tests foreseen in 2011. The structure was finally coated with a thermal control black painting and delivered on time to Thales Alenia Space-Italy end of March 201.
Expert judgment for nuclear energy
International Nuclear Information System (INIS)
Choi, Young Sung; Lee, Sun Ho; Lee, Byong Whi
2000-01-01
Public perception on nuclear energy is much influenced by subjective impressions mostly formed through sensational and dramatic news of mass media or anti-nuclear groups. However, nuclear experts, those who have more relevant knowledge and information about nuclear energy, may have reasonable opinion based on scientific facts or inferences. Thus their opinion and consensus should be examined and taken into account during the process of nuclear energy policy formulation. For the purpose of eliciting experts' opinion, the web-based on-line survey system (eBOSS) was developed. Using the survey system, experts' views on nuclear energy were tallied, analyzed and compared with the public's. Based on the survey results, the paper suggests some recommendations about the future direction of the public information program in Korea
Energy Technology Data Exchange (ETDEWEB)
NONE
1959-01-15
Problems connected with the disposal into the sea of radioactive wastes from peaceful uses of atomic energy are being examined by a panel of experts, convened by the International Atomic Energy Agency. These experts from eight different countries held a first meeting at IAEA headquarters in Vienna from 4-9 December 1958, under the chairmanship of Dr. Harry Brynielsson, Director General of the Swedish Atomic Energy Company. The countries represented are: Canada, Czechoslovakia, France, Japan, Netherlands, United Kingdom and United States. The group will meet again in 1959. (author)
Enhancing Transparency in Multidisciplinary Expert Communication
International Nuclear Information System (INIS)
Hukki, Kristiina; Pulkkinen, Urho
2003-01-01
Faced with problems of public acceptance most nuclear waste management organisations now acknowledge the importance of transparency in their pursuit of solutions for high-level nuclear waste disposal. To make progress the implementing organizations need the trust of other stakeholders in the decision-making process. For such trust these outside stakeholders need knowledge on the grounds for the judgments and decisions made in different scientific and technical disciplines. Transparency is, however, at least as important for the multidisciplinary expert communication itself. As a matter of fact, the transparency of the internal expert interaction processes is a prerequisite for the true transparency of the communication between the implementer and the external stakeholder groups. The introduced conceptual framework has been developed for the identification of the requirements of safety-informed communication in multidisciplinary expert work in nuclear waste management. The framework offers a common thinking model and common concepts which can be utilized in the development of the communication practices. The basis of the framework is on the possibility to understand the safety-critical significance of one's work. The transparency of communication is, for its part, based on making explicit the relevant knowledge necessary for gaining the understanding. This supplementary knowledge, which is related to the substance issues but is not scientific-technical by nature, enhances the experts' awareness of the context of their own contribution and of the background of the other experts' contributions. The common conceptualization and modelling of the knowledge-related dependencies between the tasks make it possible to realize the significance of the supplementary knowledge for transparent communication in actual situations. They also facilitate the recognition of the need for different types of supplementary knowledge in the interfaces between the tasks. By enhancing mutual
Geology of the Menderes Massif and the Lycian Nappes South of Denizli, Western Taurides
Directory of Open Access Journals (Sweden)
Aral İ. OKAY
1989-06-01
Full Text Available Mount Honaz region in the Western Taurides is made up of superimposed several tectonic units. In the west, monotonous green metashales called the Honaz shale occur at the base of the tectonic stack. Honaz shale is tectonically overlain by weakly metamorphosed, massif white limestone, thinly bedded cherty limestone and shale which covers the Mendercs massif. Menderes massif is in turn tectonically overlain by the Sandak complex of the Lycian nappes made up of Mesozoic dolomites and limestones and ophiolite mainly of harzburgite lies oven the Sandak complex. All these tectonic units form an eastward overturned major anticline called the Honaz anticline; a pelagic sedimentary sequence of Late Cretaceous—Middle/Late Eocene age, called the Göbecik Tepe complex, occurs tectonically beneath the overturned limb of the Honaz anticline. The Göbecik Tepe complex constitutes the relative autochthonous in the region of the Mount Honaz. Different tectonic units in the Mount Honaz region show effects of Late Cretaceous, Middle Eocene and Late Eocene/Oligocene tectonics. Obduction of the ophiolite over the Sandak complex probably occurred during the Late Cretaceous, while the age of thrusting of the Sandak complex over the Menderes massif is probably Middle Eocene. Emplacement of these tectonic units over the Göbecik Tepe complex and the formation of the Honaz anticline is of Late Eocene/Oligocene age.
Grabar, Natalia; Krivine, Sonia; Jaulent, Marie-Christine
2007-10-11
Making the distinction between expert and non expert health documents can help users to select the information which is more suitable for them, according to whether they are familiar or not with medical terminology. This issue is particularly important for the information retrieval area. In our work we address this purpose through stylistic corpus analysis and the application of machine learning algorithms. Our hypothesis is that this distinction can be performed on the basis of a small number of features and that such features can be language and domain independent. The used features were acquired in source corpus (Russian language, diabetes topic) and then tested on target (French language, pneumology topic) and source corpora. These cross-language features show 90% precision and 93% recall with non expert documents in source language; and 85% precision and 74% recall with expert documents in target language.
Earthquakes and Tectonics Expert Judgment Elicitation Project
International Nuclear Information System (INIS)
Coppersmith, K.J.; Perman, R.C.; Youngs, R.R.
1993-02-01
This report summarizes the results of the Earthquakes and Tectonics Expert Judgement Excitation Project sponsored by the Electric Power Research Institute (EPRI). The objectives of this study were two-fold: (1) to demonstrate methods for the excitation of expert judgement, and (2) to quantify the uncertainties associated with earthquake and tectonics issues for use in the EPRI-HLW performance assessment. Specifically, the technical issue considered is the probability of differential fault displacement through the proposed repository at Yucca Mountain, Nevada. For this study, a strategy for quantifying uncertainties was developed that relies on the judgements of multiple experts. A panel of seven geologists and seismologists was assembled to quantify the uncertainties associated with earthquake and tectonics issues for the performance assessment model. A series of technical workshops focusing on these issues were conducted. Finally, each expert was individually interviewed in order to elicit his judgement regarding the technical issues and to provide the technical basis for his assessment. This report summarizes the methodologies used to elicit the judgements of the earthquakes and tectonics experts (termed ''specialists''), and summarizes the technical assessments made by the expert panel
Expert judgement in performance assessment
International Nuclear Information System (INIS)
Wilmot, R.D.; Galson, D.A.
2000-01-01
This report is a pilot study that systematically describes the various types of expert judgement that are made throughout the development of a PA, and summarizes existing tools and practices for dealing with expert judgements. The report also includes recommendations for further work in the area of expert judgement. Expert judgements can be classified in a number of ways, including classification according to why the judgements are made and according to how the judgements are made. In terms of why judgements are made, there is a broad distinction between: Judgements concerning data that are made because alternatives are not feasible; and Judgements about the conduct of a PA that are made because there are no alternative approaches for making the decision. In the case of how judgements are made, the report distinguishes between non-elicited judgements made by individuals, non-elicited judgements made by groups, and elicited judgements made by individuals or groups. These types of judgement can generally be distinguished by the extent of the associated documentation, and hence their traceability. Tools for assessing judgements vary depending on the type of judgements being examined. Key tools are peer review, an appropriate QA regime, documentation, and elicitation. Dialogue with stake holders is also identified as important in establishing whether judgements are justified in the context in which they are used. The PA process comprises a number of stages, from establishing the assessment context, through site selection and repository design, to scenario and model development and parametrisation. The report discusses how judgements are used in each of these stages, and identifies which of the tools and procedures for assessing judgements are most appropriate at each stage. Recommendations for further work include the conduct of a trial expert elicitation to gain experience in the advantages and disadvantages of this technique, the development of guidance for peer
Expert judgement in performance assessment
Energy Technology Data Exchange (ETDEWEB)
Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom)
2000-01-01
This report is a pilot study that systematically describes the various types of expert judgement that are made throughout the development of a PA, and summarizes existing tools and practices for dealing with expert judgements. The report also includes recommendations for further work in the area of expert judgement. Expert judgements can be classified in a number of ways, including classification according to why the judgements are made and according to how the judgements are made. In terms of why judgements are made, there is a broad distinction between: Judgements concerning data that are made because alternatives are not feasible; and Judgements about the conduct of a PA that are made because there are no alternative approaches for making the decision. In the case of how judgements are made, the report distinguishes between non-elicited judgements made by individuals, non-elicited judgements made by groups, and elicited judgements made by individuals or groups. These types of judgement can generally be distinguished by the extent of the associated documentation, and hence their traceability. Tools for assessing judgements vary depending on the type of judgements being examined. Key tools are peer review, an appropriate QA regime, documentation, and elicitation. Dialogue with stake holders is also identified as important in establishing whether judgements are justified in the context in which they are used. The PA process comprises a number of stages, from establishing the assessment context, through site selection and repository design, to scenario and model development and parametrisation. The report discusses how judgements are used in each of these stages, and identifies which of the tools and procedures for assessing judgements are most appropriate at each stage. Recommendations for further work include the conduct of a trial expert elicitation to gain experience in the advantages and disadvantages of this technique, the development of guidance for peer
Liquid low level waste management expert system
International Nuclear Information System (INIS)
Ferrada, J.J.; Abraham, T.J.; Jackson, J.R.
1991-01-01
An expert system has been developed as part of a new initiative for the Oak Ridge National Laboratory (ORNL) systems analysis program. This expert system will aid in prioritizing radioactive waste streams for treatment and disposal by evaluating the severity and treatability of the problem, as well as the final waste form. The objectives of the expert system development included: (1) collecting information on process treatment technologies for liquid low-level waste (LLLW) that can be incorporated in the knowledge base of the expert system, and (2) producing a prototype that suggests processes and disposal technologies for the ORNL LLLW system. 4 refs., 9 figs
40 CFR 194.26 - Expert judgment.
2010-07-01
... CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification General Requirements... experts (by name and employer) involved in any expert judgment elicitation processes used to support the... judgment elicitation processes and the reasoning behind those results. Documentation of interviews used to...
Building a new TSO organization and its competences in the Czech Republic
International Nuclear Information System (INIS)
Hrehor, Miroslav; Kynčl, Miloš; Mazzini, Guido; Ruščák, Marek; Musa, Alis
2017-01-01
This paper contains a proposal for establishing an independent technical and expert nuclear safety team within the National Radiation Protection Institute (SÚRO) in support of the State Office for Nuclear Safety (SÚJB). The team’s competences should be gradual improved so that starting 2021, SÚRO could perform as a fully functional TSO for SÚJB in all key areas of SÚJB’s responsibilities (as far as feasible), covering specifically nuclear safety, technical safety, radiation protection, emergency preparedness and security (physical protection). This objective requires, in addition to personal and material resources, gradual building of expertise as regards existing as well as future nuclear facilities. Preparing a team of TSO workers for future ''professional competences'' is already taking place by addressing research projects focusing on new generation reactors and innovative cooling media. Examples of current activities and applications in these areas are presented.
A method for using expert judgement in PSA
International Nuclear Information System (INIS)
Pulkkinen, U.; Holmberg, J.
1997-03-01
The report discusses an expert judgement methodology development for applications at all levels of probabilistic safety assessment (PSA). The main applications are expected to be at PSA-levels 1 and 2. The method consists of several phases, including the selection and training of the experts, elicitation of experts' judgements, probabilistic modeling and combination of experts' judgements and documentation of the judgement process. The expert training and elicitation process is rather similar to that applied in the NUREG-1150 study. The combination of experts judgements is based on a Bayesian framework utilizing hierarchic models. The posterior distributions of the variables under analysis can be interpreted as a Bayesian counterpart of the combined or aggregated (consensus) distributions, and they are determined by applying Markov chain Monte-Carlo methods. The properties of the method are illustrated by some simple examples. The method is tested in a case study belonging to the benchmark exercise on the use of expert judgement in level 2 PSA, organized as a concerted action of European Commission Fourth Framework Programme on Nuclear Fission Safety. (14 refs.)
In vitro antimicrobial and antioxidant activities of bark extracts of ...
African Journals Online (AJOL)
Jane
2011-07-01
Jul 1, 2011 ... Key words: Bauhinia purpurea, phytochemical analysis, antimicrobial activity, antioxidant property. INTRODUCTION. The use of ..... Supplement to glossary of ... Turkish flora Bektas Tepe and Atalay Sokmen, (2): 22-25. Cao G ...
The recourse to experts. Political reasons and uses
International Nuclear Information System (INIS)
Dumoulin, L.; La Branche, St.; Robert, C.; Warin, Ph.
2005-01-01
The need of reliable knowledge is necessary to draw adequate public policies. The role of experts is more and more important in any field, the expert brings his own specialized knowledge to the political world, he can define looming threads, can predict catastrophes, can highlight the long-term responsibility of particular choices but he can also contribute to the drawing of adequate solutions. The limit of expert's power lays in his ability to make a synthesis of plural knowledge. This book presents the role and weight of experts in our society from justice to economics via natural risks. A lot of examples of public policies based on expert valuation is given, in particular the recourse to experts of the European Union when it was to deal with the upgrading of nuclear safety standard in eastern countries. (A.C.)
Expert system characteristics and potential applications in safeguards
International Nuclear Information System (INIS)
Chapman, L.D.
1986-01-01
The general growth of expert, knowledge-based (KB) or rule based systems will significantly increase in the next three to five years. Improvements in computer hardware (speed, reduced size, power) and software (rule based, data based, user interfaces) in recent years are providing the foundations for the growth of expert systems. A byproduct of this growth will undoubtedly be the application of expert systems to various safeguards problems. Characteristics of these expert systems will involve 1) multiple rules governing an outcome, 2) confidence factors on individual variables and rule sets, 3) priority, cost, and risk based rule sets, and 4) the reasoning behind the advice or decision given by the expert system. This paper presents characteristics, structures, and examples of simple rule based systems. Potential application areas for these expert systems may include training, operations, management, designs, evaluations, and specific hardware operation
A Phenomenology of Expert Musicianship
DEFF Research Database (Denmark)
Høffding, Simon
This dissertation develops a phenomenology of expert musicianship through an interdisciplinary approach that integrates qualitative interviews with the Danish String Quartet with philosophical analyses drawing on ideas and theses found in phenomenology, philosophy of mind, cognitive science...... and psychology of music. The dissertation is structured through the asking, analyzing and answering of three primary questions, namely: 1) What is it like to be an expert? 2) What is the general phenomenology of expert musicianship? 3) What happens to the self in deep musical absorption? The first question...... targets a central debate in philosophy and psychology on whether reflection is conducive for, or detrimental to, skillful performance. My analyses show that the concepts assumed in the literature on this question are poorly defined and gloss over more important features of expertise. The second question...
EPRI expert system activities for nuclear utility industry application
International Nuclear Information System (INIS)
Naser, J.A.
1990-01-01
This paper reports on expert systems which have reached a level of maturity where they offer considerable benefits for the nuclear utility industry. The ability of expert systems to enhance expertise makes them an important tool for the nuclear utility industry in the areas of engineering, operations and maintenance. Benefits of expert system applications include comprehensive and consistent reasoning, reduction of time required for activities, retention of human expertise and ability to utilize multiple experts knowledge for an activity. The Electric Power Research Institute (EPRI) has been performing four basic activities to help the nuclear industry take advantage of this expert system technology. The first is the development of expert system building tools which are tailored to nuclear utility industry applications. The second is the development of expert system applications. The third is work in developing a methodology for verification and validation of expert systems. The last is technology transfer activities to help the nuclear utility industry benefit from expert systems. The purpose of this paper is to describe the EPRI activities
Hierarchical Model of Assessing and Selecting Experts
Chernysheva, T. Y.; Korchuganova, M. A.; Borisov, V. V.; Min'kov, S. L.
2016-04-01
Revealing experts’ competences is a multi-objective issue. Authors of the paper deal with competence assessing methods of experts seen as objects, and criteria of qualities. An analytic hierarchy process of assessing and ranking experts is offered, which is based on paired comparison matrices and scores, quality parameters are taken into account as well. Calculation and assessment of experts is given as an example.
AR42J-B-13 cell: An expandable progenitor to generate an unlimited supply of functional hepatocytes
International Nuclear Information System (INIS)
Wallace, Karen; Fairhall, Emma A.; Charlton, Keith A.; Wright, Matthew C.
2010-01-01
Hepatocytes are the preparation of choice for Toxicological research in vitro. However, despite the fact that hepatocytes proliferate in vivo during liver regeneration, they are resistant to proliferation in vitro, do not tolerate sub-culture and tend to enter a de-differentiation program that results in a loss of hepatic function. These limitations have resulted in the search for expandable rodent and human cells capable of being directed to differentiate into functional hepatocytes. Research with stem cells suggests that it may be possible to provide the research community with hepatocytes in vitro although to date, significant challenges remain, notably generating a sufficiently pure population of hepatocytes with a quantitative functionality comparable with hepatocytes. This paper reviews work with the AR42J-B-13 (B-13) cell line. The B-13 cell was cloned from the rodent AR42J pancreatic cell line, express genes associated with pancreatic acinar cells and readily proliferates in simple culture media. When exposed to glucocorticoid, 75-85% of the cells trans-differentiate into hepatocyte-like (B-13/H) cells functioning at a level quantitatively similar to freshly isolated rat hepatocytes (with the remaining cells retaining the B-13 phenotype). Trans-differentiation of pancreatic acinar cells also appears to occur in vivo in rats treated with glucocorticoid; in mice with elevated circulating glucocorticoid and in humans treated for long periods with glucocorticoid. The B-13 response to glucocorticoid therefore appears to be related to a real pathophysiological response of a pancreatic cell to glucocorticoid. An understanding of how this process occurs and if it can be generated or engineered in human cells would result in a cell line with the ability to generate an unlimited supply of functional human hepatocytes in a cost effective manner.
Counseling, Artificial Intelligence, and Expert Systems.
Illovsky, Michael E.
1994-01-01
Considers the use of artificial intelligence and expert systems in counseling. Limitations are explored; candidates for counseling versus those for expert systems are discussed; programming considerations are reviewed; and techniques for dealing with rational, nonrational, and irrational thoughts and feelings are described. (Contains 46…
Medical Physics expert and competence in radiation protection
International Nuclear Information System (INIS)
Vano, E.; Lamn, I. N.; Guerra, A. del; Van Kleffens, H. J.
2003-01-01
The Council Directive 97/43/EURATOM on health protection of individuals against the dangers of ionizing radiation in relation to medical exposure, defines the Medical Physical Expert as an expert in radiation physics or radiation technology applied to exposure, within the scope of the Directive, whose training and competence to act is recognized by the competent authorities; and who, as appropriate, acts or gives advice on patient dosimetry, on the development and use of complex techniques and equipment, on optimization, on quality assurance, including quality control, and on other matters relating to radiation protection, concerning exposure within the scope of this Directive. As a consequence, it might be implied that his competence in radiation protection should also cover the staff and the public. In fact, the training programmes of medical physics experts include all the aspects concerning these topics. Some confusion could arise in the medical area when the Qualified Expert defined in the Council Directive 96/29/Euratom laying down basic safety standards for the protection of the health of workers and the general public against the dangers arising from ionizing radiation is considered. The Qualified Expert is defined as a person having the knowledge and training needed to carry out physical, technical or radiochemical tests enabling doses to be assessed, and to give advice in order to ensure effective protection of individuals and the correct operation of protective equipment, whose capacity to act a qualified expert is recognized by the competent authorities. A qualified expert may be assigned the technical responsibility for the tasks of radiation protection of workers and members of the public. In Europe, the Qualified Expert is acting at present in the Medical Area in countries where there are not enough Medical Physics Experts or in countries where this role was established before the publication of the Council Directive 97/43/EURATOM. Now, the coherent
Nickel Hydrogen Battery Expert System
Johnson, Yvette B.; Mccall, Kurt E.
1992-01-01
The Nickel Cadmium Battery Expert System-2, or 'NICBES-2', which was used by the NASA HST six-battery testbed, was subsequently converted into the Nickel Hydrogen Battery Expert System, or 'NICHES'. Accounts are presently given of this conversion process and future uses being contemplated for NICHES. NICHES will calculate orbital summary data at the end of each orbit, and store these files for trend analyses and rules-generation.
Singh, Gursharan; Ahuja, Naveen; Batish, Mona; Capalash, Neena; Sharma, Prince
2008-11-01
An alkalophilic laccase from gamma-proteobacterium JB was applied to wheat straw-rich soda pulp to check its bleaching potential by using response surface methodology based on central composite design. The design was employed by selecting laccase units, ABTS (2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid)) concentration and pH as model factors. The results of second order factorial design experiments showed that all three independent variables had significant effect on brightness and kappa number of laccase-treated pulp. Optimum conditions for biobleaching of pulp with laccase preparation (specific activity, 65 nkat mg(-1) protein) were 20 nkat g(-1) of pulp, 2mM ABTS and pH 8.0 which enhanced brightness by 5.89% and reduced kappa number by 21.1% within 4h of incubation at 55 degrees C, without further alkaline extraction of pulp. Tear index (8%) and burst index (18%) also improved for laccase-treated pulp as compared to control raw pulp. Treatment of chemically (CEH1H2) bleached pulp with laccase showed significant effect on release of chromophores, hydrophobic and reducing compounds. Laccase-prebleaching of raw pulp reduced the use of hypochlorite by 10% to achieve brightness of resultant hand sheets similar to the fully chemically bleached pulp.
Safety Tips from the Expert Witness.
Gray, Gary R.
1995-01-01
Many physical educators and coaches use the potential for liability to guide their decisions about conducting activities. By understanding expert witnesses' roles in negligence actions, surer planning, teaching, and coaching are possible. The paper describes issues that expert witnesses examine in negligence actions against physical educators,…
Influence of Professional Affiliation on Expert's View on Welfare Measures
DEFF Research Database (Denmark)
Dam Otten, Nina; Rousing, Tine; Forkman, Björn
2017-01-01
are not balanced in numbers of experts. At two time points (2012 and 2016), dairy cattle and swine experts from four different stakeholder groups, namely researchers (RES), production advisors (CONS), practicing veterinarians (VET) and animal welfare control officers (AWC) were asked to weigh eight different...... between expert groups among swine experts. Inter-expert differences were more pronounced for both species. The results highlight the challenges of using expert weightings in aggregated welfare assessment models, as the choice of expert affiliation may play a confounding role in the final aggregation due...
DEFF Research Database (Denmark)
Thorndahl, Kathrine Liedtke; Ravn, Susanne
2017-01-01
on a case study of elite rope skipping, we argue that the phenomenological concept of incorporation does not suffice to adequately describe how expert tool users feel when interacting with their tools. By analyzing a combination of insights gained from participant observation of 11 elite rope skippers......According to some phenomenologists, a tool can be experienced as incorporated when, as a result of habitual use or deliberate practice, someone is able to manipulate it without conscious effort. In this article, we specifically focus on the experience of expertise tool use in elite sport. Based...... and autoethnographic material from one former elite skipper, we take some initial steps toward the development of a more nuanced understanding of the concept of incorporation; one that is able to accommodate the experiences of expert tool users. In sum, our analyses indicate that the possibility for experiencing...
Information Retrieval Diary of an Expert Technical Translator.
Cremmins, Edward T.
1984-01-01
Recommends use of entries from the information retrieval diary of Ted Crump, expert technical translator at the National Institute of Health, in the construction of computer models showing how expert translators solve problems of ambiguity in language. Expert and inexpert translation systems, eponyms, abbreviations, and alphabetic solutions are…
1990-01-01
The validation and evaluation of an expert system for traffic control in highway work zones (TRANZ) is described. The stages in the evaluation process consisted of the following: revisit the experts, selectively distribute copies of TRANZ with docume...
A brief history and technical review of the expert system research
Tan, Haocheng
2017-09-01
The expert system is a computer system that emulates the decision-making ability of a human expert, which aims to solve complex problems by reasoning knowledge. It is an important branch of artificial intelligence. In this paper, firstly, we briefly introduce the development and basic structure of the expert system. Then, from the perspective of the enabling technology, we classify the current expert systems and elaborate four expert systems: The Rule-Based Expert System, the Framework-Based Expert System, the Fuzzy Logic-Based Expert System and the Expert System Based on Neural Network.
Expert opinion vs. empirical evidence
Herman, Rod A; Raybould, Alan
2014-01-01
Expert opinion is often sought by government regulatory agencies when there is insufficient empirical evidence to judge the safety implications of a course of action. However, it can be reckless to continue following expert opinion when a preponderance of evidence is amassed that conflicts with this opinion. Factual evidence should always trump opinion in prioritizing the information that is used to guide regulatory policy. Evidence-based medicine has seen a dramatic upturn in recent years sp...
System and method for creating expert systems
Hughes, Peter M. (Inventor); Luczak, Edward C. (Inventor)
1998-01-01
A system and method provides for the creation of a highly graphical expert system without the need for programming in code. An expert system is created by initially building a data interface, defining appropriate Mission, User-Defined, Inferred, and externally-generated GenSAA (EGG) data variables whose data values will be updated and input into the expert system. Next, rules of the expert system are created by building appropriate conditions of the rules which must be satisfied and then by building appropriate actions of rules which are to be executed upon corresponding conditions being satisfied. Finally, an appropriate user interface is built which can be highly graphical in nature and which can include appropriate message display and/or modification of display characteristics of a graphical display object, to visually alert a user of the expert system of varying data values, upon conditions of a created rule being satisfied. The data interface building, rule building, and user interface building are done in an efficient manner and can be created without the need for programming in code.
Expert systems for plant operations training and assistance
International Nuclear Information System (INIS)
Pack, R.W.; Lazar, P.M.; Schmidt, R.V.; Gaddy, C.D.
1988-01-01
The project described in this paper explored the use of expert systems for plant operations training and assistance. Three computer technologies were reviewed: computer-aided instruction, expert systems, and expert training systems (ETS). The technology of CAI has been developed since the early 1960s, and a wide range of applications are available commercially today. Expert systems have been developed primarily as job performance aids, and the number of commercial applications is increasing. A fully developed ETS has models of the trainer and trainee, in addition to a knowledge base
Handbook of VLSI chip design and expert systems
Schwarz, A F
1993-01-01
Handbook of VLSI Chip Design and Expert Systems provides information pertinent to the fundamental aspects of expert systems, which provides a knowledge-based approach to problem solving. This book discusses the use of expert systems in every possible subtask of VLSI chip design as well as in the interrelations between the subtasks.Organized into nine chapters, this book begins with an overview of design automation, which can be identified as Computer-Aided Design of Circuits and Systems (CADCAS). This text then presents the progress in artificial intelligence, with emphasis on expert systems.
Use of expert systems in nuclear safety
International Nuclear Information System (INIS)
1990-02-01
One dominant aspect of improvement in safe nuclear power plant operation is the very high speed in the development and introduction of computer technologies. This development commenced recently when advanced control technology was incorporated into the nuclear industry. This led to an increasing implementation of information displays, annunciator windows and other devices inside the control room, eventually overburdening the control room operator with detailed information. Expert systems are a further step in this direction being designed to apply large knowledge bases to solve practical problems. These ''intelligent'' systems have to incorporate enough knowledge to reach expert levels of importance and represent a very advanced man-machine interface. The aims of the Technical Committee were addressed by the three Working Groups and summarized in Sections 2, 3 and 4 of this report. Section 2 summarizes the results and discussions on the current capabilities of expert systems and identifies features for the future development and use of Expert Systems in Nuclear Power Plants. Section 3 provides an overview of the discussions and investigations into the current status of Expert Systems in NPPs. This section develops a method for assessing the overall benefit of different applications and recommends a broad strategy for priority developments of Expert Systems in NPPs. Section 4 assesses the overall use of PSA type studies in Expert Systems in NPPs and identifies specific features to be adopted in the design of these systems in future applications. The conclusions of the three Working Groups are presented in Section 5. The 15 papers presented at the meeting formed the Annex of this document. A separate abstract was prepared for each of these papers. Refs, figs, tabs and pictures
WINE ADVISOR EXPERT SYSTEM USING DECISION RULES
Directory of Open Access Journals (Sweden)
Dinuca Elena Claudia
2013-07-01
Full Text Available In this article I focus on developing an expert system for advising the choice of wine that best matches a specific occasion. An expert system is a computer application that performs a task that would be performed by a human expert. The implementation is done using Delphi programming language. I used to represent the knowledge bases a set of rules. The rules are of type IF THEN ELSE rules, decision rules based on different important wine features.
Industrial disasters - the expert systems solution
International Nuclear Information System (INIS)
Sachs, P.
1986-01-01
Six mistakes by the operators led to the accident at the Cherobyl nuclear reactor. These have been studied. It is suggested that an expert systems approach could prevent similar accidents. The expert system is a new approach to software programming where programs are required to perform intelligent analyses of complex situations. It separates the knowledge of a problem from the procedural code that performs the decision. An expert system will evaluate data and indicate a priority on alarms in real time. Now software systems can detect the cause of a problem in a process plant and present their findings to the operators in the control room. This should enable operators to make the correct decisions as they will know which underlying process faults are causing the alarms to operate. The Chernobyl post-mortem meeting made 13 proposals for improving safety. Two in particular are noted as relevant to expert advice systems; international collaboration on man-reactor relationships and a conference to explore the balance of automation and human action to minimise operating errors. (U.K.)
Expert Systems: A Challenge for the Reading Profession.
Balajthy, Ernest
The expert systems are designed to imitate the reasoning of a human expert in a content area field. Designed to be advisors, these software systems combine the content area knowledge and decision-making ability of an expert with the user's understanding and knowledge of particular circumstances. The reading diagnosis system, the RD2P System…
Sakaguchi, Hideharu
Do you remember an expert system? I think there are various impressions about the system. For example, some might say “It reminds me of old days”. On the other hand, some might say “It was really troublesome”. About 25 years ago, from late 1980s to the middle of 1990s, when the Showa era was about to change into the Heisei Era, artificial intelligence boomed. Research and development for an expert system which was equipped with expertise and worked as smart as expert, was advanced in various fields. Our company also picked up the system as the new system which covered weak point of conventional computer technology. We started research and development in 1984, and installed an expert system in a SCADA system, which started operating in March 1990 in the Fukuoka Integrated Control Center. In this essay, as an electric power engineer who involved in development at that time, I introduce the situation and travail story about developing an expert system which support restorative actions from the outage and overload condition of power networks.
Duda, Richard O.; Shortliffe, Edward H.
1983-01-01
Discusses a class of artificial intelligence computer programs (often called "expert systems" because they address problems normally thought to require human specialists for their solution) intended to serve as consultants for decision making. Also discusses accomplishments (including information systematization in medical diagnosis and…
A fuzzy expert system based on relations
International Nuclear Information System (INIS)
Hall, L.O.; Kandel, A.
1986-01-01
The Fuzzy Expert System (FESS) is an expert system which makes use of the theory of fuzzy relations to perform inference. Relations are very general and can be used for any application, which only requires different types of relations be implemented and used. The incorporation of fuzzy reasoning techniques enables the expert system to deal with imprecision in a well-founded manner. The knowledge is represented in relational frames. FESS may operate in either a forward chaining or backward chaining manner. It uses primarily implication and factual relations. A unique methodology for combination of evidence has been developed. It makes uses of a blackboard for communication between the various knowledge sources which may operate in parallel. The expert system has been designed in such a manner that it may be used for diverse applications
Cataloging Expert Systems: Optimism and Frustrated Reality.
Olmstadt, William J.
2000-01-01
Discusses artificial intelligence and attempts to catalog expert systems. Topics include the nature of expertise; examples of cataloging expert systems; barriers to implementation; and problems, including total automation, cataloging expertise, priorities, and system design. (LRW)
Expert witness and Jungian archetypes.
Lallave, Juan Antonio; Gutheil, Thomas Gordon
2012-01-01
Jung's theories of archetype, shadow, and the personal and collective unconscious provide a postmodern framework in which to consider the role of the expert witness in judicial proceedings. Archetypal themes, motifs, and influences help to illuminate the shadow of the judicial system and projections and behaviors among the cast of the court in pursuing justice. This article speaks to archetypal influences and dialectical tensions encountered by the expert witness in this judicial drama. The archetype of Justice is born from the human need for order and relational fairness in a world of chaos. The persona of justice is the promise of truth in the drama. The shadow of justice is untruth, the need to win by any means. The dynamics of the trickster archetype serve and promote injustice. These influences are examined by means of a case example. This approach will deepen understanding of court proceedings and the role of the expert witness in the heroic quest for justice. Copyright © 2012 Elsevier Ltd. All rights reserved.
Expert music performance: cognitive, neural, and developmental bases.
Brown, Rachel M; Zatorre, Robert J; Penhune, Virginia B
2015-01-01
In this chapter, we explore what happens in the brain of an expert musician during performance. Understanding expert music performance is interesting to cognitive neuroscientists not only because it tests the limits of human memory and movement, but also because studying expert musicianship can help us understand skilled human behavior in general. In this chapter, we outline important facets of our current understanding of the cognitive and neural basis for music performance, and developmental factors that may underlie musical ability. We address three main questions. (1) What is expert performance? (2) How do musicians achieve expert-level performance? (3) How does expert performance come about? We address the first question by describing musicians' ability to remember, plan, execute, and monitor their performances in order to perform music accurately and expressively. We address the second question by reviewing evidence for possible cognitive and neural mechanisms that may underlie or contribute to expert music performance, including the integration of sound and movement, feedforward and feedback motor control processes, expectancy, and imagery. We further discuss how neural circuits in auditory, motor, parietal, subcortical, and frontal cortex all contribute to different facets of musical expertise. Finally, we address the third question by reviewing evidence for the heritability of musical expertise and for how expertise develops through training and practice. We end by discussing outlooks for future work. © 2015 Elsevier B.V. All rights reserved.
Expert system for accelerator single-freedom nonlinear components
International Nuclear Information System (INIS)
Wang Sheng; Xie Xi; Liu Chunliang
1995-01-01
An expert system by Arity Prolog is developed for accelerator single-freedom nonlinear components. It automatically yields any order approximate analytical solutions for various accelerator single-freedom nonlinear components. As an example, the eighth order approximate analytical solution is derived by this expert system for a general accelerator single-freedom nonlinear component, showing that the design of the expert system is successful
Expert systems for assisting in design reviews
International Nuclear Information System (INIS)
Brtis, J.S.; Johnson, W.J.; Weber, N.; Naser, J.
1990-01-01
This paper discusses Sargent and Lundy's (S and L's) use of expert system technologies to computerize the procedures used for engineering design reviews. This paper discusses expert systems and the advantages that result from using them to computerize the decision-making process. This paper also discusses the design review expert systems that S and L has developed to perform fire protection and ALARA (as low as reasonably achievable) design reviews, and is currently developing for the Electric Power Research Institute (EPRI) to perform 10 CFR 50.59 safety reviews
Expert systems and computer based industrial systems
International Nuclear Information System (INIS)
Dunand, R.
1989-01-01
Framentec is the artificial intelligence subsidiary of FRAMATOME. It is involved in expert-system activities of Shells, developments, methodology and software for maintenance (Maintex) and consulting and methodology. Specific applications in the nuclear field are presented. The first is an expert system to assist in the piping support design prototype, the second is an expert system that assists an ultrasonic testing operator in determining the nature of a welding defect and the third is a welding machine diagnosis advisor. Maintex is a software tool to provide assistance in the repair of complex industrial equipment. (author)
An expert system for dispersion model interpretation
International Nuclear Information System (INIS)
Skyllingstad, E.D.; Ramsdell, J.V.
1988-10-01
A prototype expert system designed to diagnose dispersion model uncertainty is described in this paper with application to a puff transport model. The system obtains qualitative information from the model user and through an expert-derived knowledge base, performs a rating of the current simulation. These results can then be used in combination with dispersion model output for deciding appropriate evacuation measures. Ultimately, the goal of this work is to develop an expert system that may be operated accurately by an individual uneducated in meteorology or dispersion modeling. 5 refs., 3 figs
MARBLE: A system for executing expert systems in parallel
Myers, Leonard; Johnson, Coe; Johnson, Dean
1990-01-01
This paper details the MARBLE 2.0 system which provides a parallel environment for cooperating expert systems. The work has been done in conjunction with the development of an intelligent computer-aided design system, ICADS, by the CAD Research Unit of the Design Institute at California Polytechnic State University. MARBLE (Multiple Accessed Rete Blackboard Linked Experts) is a system of C Language Production Systems (CLIPS) expert system tool. A copied blackboard is used for communication between the shells to establish an architecture which supports cooperating expert systems that execute in parallel. The design of MARBLE is simple, but it provides support for a rich variety of configurations, while making it relatively easy to demonstrate the correctness of its parallel execution features. In its most elementary configuration, individual CLIPS expert systems execute on their own processors and communicate with each other through a modified blackboard. Control of the system as a whole, and specifically of writing to the blackboard is provided by one of the CLIPS expert systems, an expert control system.
GOTRES: an expert system for fault detection and analysis
International Nuclear Information System (INIS)
Chung, D.T.; Modarres, M.
1989-01-01
This paper describes a deep-knowledge expert system shell for diagnosing faults in process operations. The expert program shell is called GOTRES (GOal TRee Expert System) and uses a goal tree-success tree deep-knowledge structure to model its knowledge-base. To demonstrate GOTRES, we have built an on-line fault diagnosis expert system for an experimental nuclear reactor facility using this shell. The expert system is capable of diagnosing fault conditions using system goal tree as well as utilizing accumulated operating knowledge to predict plant causal and temporal behaviours. The GOTRES shell has also been used for root-cause detection and analysis in a nuclear plant. (author)
Adaptability of expert visual anticipation in baseball batting.
Müller, Sean; Fadde, Peter J; Harbaugh, Allen G
2017-09-01
By manipulating stimulus variation in terms of opponent pitcher actions, this study investigated the capability of expert (n = 30) and near-expert (n = 95) professional baseball batters to adapt anticipation skill when using the video simulation temporal occlusion paradigm. Participants watched in-game footage of two pitchers, one after the other, that was temporally occluded at ball release and various points during ball flight. They were required to make a written prediction of pitch types and locations. Per cent accuracy was calculated for pitch type, for pitch location, and for type and location combined. Results indicated that experts and near-experts could adapt their anticipation to predict above guessing level across both pitchers, but adaptation to the left-handed pitcher was poorer than the right-handed pitcher. Small-to-moderate effect sizes were found in terms of superior adaptation by experts over near-experts at the ball release and early ball flight occlusion conditions. The findings of this study extend theoretical and applied knowledge of expertise in striking sports. Practical application of the instruments and findings are discussed in terms of applied researchers, practitioners and high-performance staff in professional sporting organisations.
Expert finding by the Dempster‐Shafer theory for evidence combination
Torkzadeh mahani, N.; Dehghani, M.; Mirian, M.S.; Shakery, A.; Taheri, K.
The expertise of human experts can be formally extracted from their written documents, research projects, and everyday activities. The process whereby experts are recognized according to their activities is called expert finding. In this paper, we propose an approach to identify the experts in a
Zazzi, M; Kaiser, R; Sönnerborg, A; Struck, D; Altmann, A; Prosperi, M; Rosen-Zvi, M; Petroczi, A; Peres, Y; Schülter, E; Boucher, C A; Brun-Vezinet, F; Harrigan, P R; Morris, L; Obermeier, M; Perno, C-F; Phanuphak, P; Pillay, D; Shafer, R W; Vandamme, A-M; van Laethem, K; Wensing, A M J; Lengauer, T; Incardona, F
2011-04-01
The EuResist expert system is a novel data-driven online system for computing the probability of 8-week success for any given pair of HIV-1 genotype and combination antiretroviral therapy regimen plus optional patient information. The objective of this study was to compare the EuResist system vs. human experts (EVE) for the ability to predict response to treatment. The EuResist system was compared with 10 HIV-1 drug resistance experts for the ability to predict 8-week response to 25 treatment cases derived from the EuResist database validation data set. All current and past patient data were made available to simulate clinical practice. The experts were asked to provide a qualitative and quantitative estimate of the probability of treatment success. There were 15 treatment successes and 10 treatment failures. In the classification task, the number of mislabelled cases was six for EuResist and 6-13 for the human experts [mean±standard deviation (SD) 9.1±1.9]. The accuracy of EuResist was higher than the average for the experts (0.76 vs. 0.64, respectively). The quantitative estimates computed by EuResist were significantly correlated (Pearson r=0.695, Pexperts. However, the agreement among experts was only moderate (for the classification task, inter-rater κ=0.355; for the quantitative estimation, mean±SD coefficient of variation=55.9±22.4%). With this limited data set, the EuResist engine performed comparably to or better than human experts. The system warrants further investigation as a treatment-decision support tool in clinical practice. © 2010 British HIV Association.
Expert Systems as a Mindtool To Facilitate Mental Model Learning.
Mason-Mason, Susan Dale; Tessmer, Martin A.
2000-01-01
This exploratory study investigated whether the process of constructing an expert system model promotes the formation of expert-like mental models. Discusses expert systems as mindtools, expert systems as learning tools, the assessment of mental models, results of pretests and posttests, and future research. (Contains 56 references.) (Author/LRW)
Risks, doubt, scientific and technical expert appraisement
International Nuclear Information System (INIS)
Decrop, G.
1993-01-01
In complex systems which compose modern societies, expert report is going to take an increasing place. In its usual definition, expert is justified by a superior authority, his knowledge comes from experience, he is present as a third party where he has to work. It is often forgotten two other important points, connected with the situation: it is a tangling of technical or natural systems with a social system and above all there is a risk of uncertainty. Then, the job of expert is different from scientific work done in laboratories and different from operational work done by engineers
Computers start to think with expert systems
Energy Technology Data Exchange (ETDEWEB)
1983-03-21
A growing number of professionals-notably in oil and mineral exploration, plasma research, medicine, VLSI circuit design, drug design and robotics-are beginning to use computerised expert systems. A computer program uses knowledge and inference procedures to solve problems which are sufficiently difficult to require significant human expertise for their solution. The facts constitute a body of information that is widely shared, publicly available and generally agreed upon by experts in the field. The heuristics are mostly private, and little discussed, rules of good judgement (rules of plausible reasoning, rules of good guessing, etc.) that characterise expert-level decision making in the field.
CHOOZ-A expert assessment program
International Nuclear Information System (INIS)
Bouat, M.; Godin, R.
1993-01-01
CHOOZ-A Nuclear Power Plant, the first French-Belgian PWR unit (300 MWe) was definitively shut down at the end of October 1991, after 24 years in operation. Since summer 1991, the steering committee of the French (EDF) Lifetime Project has initiated a large inquiry to the different technical specialists of EDF and external organizations, trying to define a wide expert assessment program on this plant. The aim is to improve the knowledge of aging mechanisms such as those observed on the 52 PWR French nuclear power plants (900 and 1,300 MWe), and contribute to the validation of non-destructive in-service testing methods. This paper presents the retained CHOOZ-A expert assessment program and technical lines followed during its set up. First major project stages are described, then technical choices are explained, and at last the final program is presented with the specific content of each expert assessment. The definitive program is scheduled for a three year period starting at the moment of final shutdown license acquisition, with a provisional total budget of more than US $10 million
A theory of expert leadership (TEL) in psychiatry.
Goodall, Amanda H
2016-06-01
Leaders' technical competence - 'expert knowledge' - has been shown in many settings to be associated with better organizational performance. In universities, for example, there is longitudinal evidence that research-focused scholars make the best leaders; results from a hospital study show that doctors instead of professional managers are most closely associated with the best performing institutions. To explain these patterns, and raise hypotheses, a theory of expert leadership (TEL) has been developed that might explain these patterns. In this paper the framework for expert leadership is applied to psychiatry. The TEL proposes that psychiatric leaders, as opposed to non-expert managers, improve organizational performance through several channels. First, experts' knowledge influences organizational strategy. Second, having been 'one of them', a psychiatrist understands how to create the optimal work environment for psychiatric teams, through appropriate goal-setting, evaluation and support. These factors are positively associated with workers' wellbeing and performance. Third, exceptional psychiatrist-leaders are likely to set high standards for hiring. Fourth, leaders' credibility extends their influence among core workers, and also signals organizational priorities to stakeholders. Finally, a necessary prerequisite of TEL is that expert leaders have direct executive power inclusive of budgetary and strategic oversight. © The Royal Australian and New Zealand College of Psychiatrists 2015.
Model of critical diagnostic reasoning: achieving expert clinician performance.
Harjai, Prashant Kumar; Tiwari, Ruby
2009-01-01
Diagnostic reasoning refers to the analytical processes used to determine patient health problems. While the education curriculum and health care system focus on training nurse clinicians to accurately recognize and rescue clinical situations, assessments of non-expert nurses have yielded less than satisfactory data on diagnostic competency. The contrast between the expert and non-expert nurse clinician raises the important question of how differences in thinking may contribute to a large divergence in accurate diagnostic reasoning. This article recognizes superior organization of one's knowledge base, using prototypes, and quick retrieval of pertinent information, using similarity recognition as two reasons for the expert's superior diagnostic performance. A model of critical diagnostic reasoning, using prototypes and similarity recognition, is proposed and elucidated using case studies. This model serves as a starting point toward bridging the gap between clinical data and accurate problem identification, verification, and management while providing a structure for a knowledge exchange between expert and non-expert clinicians.
Tropospheric ozone. Formation, properties, effects. Expert opinion
International Nuclear Information System (INIS)
Elstner, E.F.
1996-01-01
The formation and dispersion of tropospheric ozone are discussed only marginally in this expert opinion; the key interest is in the effects of ground level ozone on plants, animals, and humans. The expert opinion is based on an analysis of the available scientific publications. (orig./MG) [de
The assessment of argumentation from expert opinion
Wagemans, J.H.M.
2011-01-01
In this contribution, I will develop a comprehensive tool for the reconstruction and evaluation of argumentation from expert opinion. This is done by analyzing and then combining two dialectical accounts of this type of argumentation. Walton’s account of the ‘appeal to expert opinion’ provides a
Jess, the Java expert system shell
Energy Technology Data Exchange (ETDEWEB)
Friedman-Hill, E.J.
1997-11-01
This report describes Jess, a clone of the popular CLIPS expert system shell written entirely in Java. Jess supports the development of rule-based expert systems which can be tightly coupled to code written in the powerful, portable Java language. The syntax of the Jess language is discussed, and a comprehensive list of supported functions is presented. A guide to extending Jess by writing Java code is also included.
A new Expert Finding model based on Term Correlation Matrix
Directory of Open Access Journals (Sweden)
Ehsan Pornour
2015-09-01
Full Text Available Due to the enormous volume of unstructured information available on the Web and inside organization, finding an answer to the knowledge need in a short time is difficult. For this reason, beside Search Engines which don’t consider users individual characteristics, Recommender systems were created which use user’s previous activities and other individual characteristics to help users find needed knowledge. Recommender systems usage is increasing every day. Expert finder systems also by introducing expert people instead of recommending information to users have provided this facility for users to ask their questions form experts. Having relation with experts not only causes information transition, but also with transferring experiences and inception causes knowledge transition. In this paper we used university professors academic resume as expert people profile and then proposed a new expert finding model that recommends experts to users query. We used Term Correlation Matrix, Vector Space Model and PageRank algorithm and proposed a new hybrid model which outperforms conventional methods. This model can be used in internet environment, organizations and universities that experts have resume dataset.
Sources of correlation between experts: Empirical results from two extremes
International Nuclear Information System (INIS)
Meyer, M.A.; Booker, J.M.
1987-04-01
Through two studies, this report seeks to identify the sources of correlation, or dependence, between experts' estimates. Expert estimates are relied upon as sources of data whenever experimental data is lacking, such as in risk analyses and reliability assessments. Correlation between experts is a problem in the elicitation and subsequent use of subjective estimates. Until now, there have been no data confirming sources of correlation, although the experts' background is commonly speculated to be one. Two different populations of experts were administered questions in their areas of expertise. Data on their professional backgrounds and means of solving the questions were elicited using techniques from educational psychology and ethnography. The results from both studies indicate that the way in which an expert solves the problem is the major source of correlation. The experts' background can not be shown to be an important source of correlation nor to influence his choice of method for problem solution. From these results, some recommendations are given for the elicitation and use of expert opinion
Reeve, Charlie L.; Charles, Jennifer E.
2008-01-01
The current study examines the views of experts in the science of mental abilities about the primacy and uniqueness of "g" and the social implications of ability testing, and compares their responses to the views of a group of non-expert psychologists. Results indicate expert consensus that "g" is an important, non-trivial determinant (or at least…
Expert system to control a fusion energy experiment
Energy Technology Data Exchange (ETDEWEB)
Johnson, R.R.; Canales, T.; Lager, D.
1986-01-01
This paper describes a system that automates neutral beam source conditioning. The system achieves this with artificial intelligence techniques by encoding the behavior of several experts as a set of if-then rules in an expert system. One of the functions of the expert system is to control an adaptive controller that, in turn, controls the neutral beam source. The architecture of the system is presented followed by a description of its performance.
Expert system to control a fusion energy experiment
International Nuclear Information System (INIS)
Johnson, R.R.; Canales, T.; Lager, D.
1986-01-01
This paper describes a system that automates neutral beam source conditioning. The system achieves this with artificial intelligence techniques by encoding the behavior of several experts as a set of if-then rules in an expert system. One of the functions of the expert system is to control an adaptive controller that, in turn, controls the neutral beam source. The architecture of the system is presented followed by a description of its performance
Energy Technology Data Exchange (ETDEWEB)
Gupta, Nidhi, E-mail: guptanidhi12@gmail.com; Fischer, Arnout R. H., E-mail: arnout.fischer@wur.nl [Wageningen University, Marketing and Consumer Behaviour Group (Netherlands); George, Saji, E-mail: saji_george@nyp.gov.sg [Nanyang Polytechnic, Centre for Sustainable Nanotechnology, School of Chemical and Life Sciences (Singapore); Frewer, Lynn J., E-mail: lynn.frewer@newcastle.ac.uk [Newcastle University, School of Agriculture, Food and Rural Development (United Kingdom)
2013-08-15
The introduction of different applications of nanotechnology will be informed by expert views regarding which (types of) application will be most societally acceptable. Previous research in Northern Europe has indicated that experts believe that various factors will be influential, predominant among these being public perceptions of benefit, need and consumer concern about contact with nanomaterials. These factors are thought by experts to differentiate societal acceptance and rejection of nanotechnology applications. This research utilises a larger sample of experts (N = 67) drawn from Northern America, Europe, Australasia, India and Singapore to examine differences in expert opinion regarding societal acceptance of different applications of nanotechnology within different technological environments, consumer cultures and regulatory regimes. Perceived risk and consumer concerns regarding contact with nano-particles are thought by all experts to drive rejection, and perceived benefits to influence acceptance, independent of country. Encapsulation and delivery of nutrients in food was thought to be the most likely to raise societal concerns, while targeted drug delivery was thought most likely to be accepted. Lack of differentiation between countries suggests that expert views regarding social acceptance may be homogenous, independent of local contextual factors.
International Nuclear Information System (INIS)
Gupta, Nidhi; Fischer, Arnout R. H.; George, Saji; Frewer, Lynn J.
2013-01-01
The introduction of different applications of nanotechnology will be informed by expert views regarding which (types of) application will be most societally acceptable. Previous research in Northern Europe has indicated that experts believe that various factors will be influential, predominant among these being public perceptions of benefit, need and consumer concern about contact with nanomaterials. These factors are thought by experts to differentiate societal acceptance and rejection of nanotechnology applications. This research utilises a larger sample of experts (N = 67) drawn from Northern America, Europe, Australasia, India and Singapore to examine differences in expert opinion regarding societal acceptance of different applications of nanotechnology within different technological environments, consumer cultures and regulatory regimes. Perceived risk and consumer concerns regarding contact with nano-particles are thought by all experts to drive rejection, and perceived benefits to influence acceptance, independent of country. Encapsulation and delivery of nutrients in food was thought to be the most likely to raise societal concerns, while targeted drug delivery was thought most likely to be accepted. Lack of differentiation between countries suggests that expert views regarding social acceptance may be homogenous, independent of local contextual factors
The microcomputer-based expert system in CAD-PV
International Nuclear Information System (INIS)
Wang, Y.; Qin, S.
1987-01-01
As a branch of artificial intelligence, expert system has been revealed day after day in more and more engineering scopes since the successful applications of MYCIN in diagnosis and DENDRAL in the molecular structure of organic compounds etc.. But in the design scope of pressure vessel, as we know, only a few papers have so far been published with respect to the expert system. The necessity and feasibility of accompanying CAD-PV with expert system attracted more scholars to engage in. Although many countries, including China, have regularized the design standards or codes for pressure vessel, but of which no one can solve all of the problems concerning the various practical occasions and experiences. In general, the more domain knowledges a design engineer possesses of, the better decision will be made by him. By virtue of the expert system any less experienced engineer could make the optimum decision in design as well as a skilled senior engineer in addition to the application of design code. It is the due significance for developing high level expert system as an intelligence assistant in the plan option of CAD-PV. In this paper we attempt to introduce a specified software JACKPV used in the design procedure of jacketed pressure vessel as an intelligence front in CAD-PV. JACKPV consists of the function of expert system based on the personal computer IBM-PC/XT with the language PASCAL in its program. It was proved that an ordinary CAD software could be effectively improved while equipped with expert system. (orig.)
Expert systems for real-time monitoring and fault diagnosis
Edwards, S. J.; Caglayan, A. K.
1989-01-01
Methods for building real-time onboard expert systems were investigated, and the use of expert systems technology was demonstrated in improving the performance of current real-time onboard monitoring and fault diagnosis applications. The potential applications of the proposed research include an expert system environment allowing the integration of expert systems into conventional time-critical application solutions, a grammar for describing the discrete event behavior of monitoring and fault diagnosis systems, and their applications to new real-time hardware fault diagnosis and monitoring systems for aircraft.
An examination of expert systems activities within the nuclear industry
International Nuclear Information System (INIS)
Bernard, J.A.; Washio, Takashi.
1988-01-01
This paper provides an overview of a detailed evaluation that the authors recently completed on expert systems applications within the nuclear industry. That evaluation examined the motivation for utilizing expert systems, identified the areas to which they were being applied, and provided an assessment of their utility. Listed here are some of the salient findings of that report. (1) Utilities are developing their own artificial intelligence tools rather than using commercial products. (2) Few expert systems are being developed for the express purpose of capturing human expertise. (3) A number of successful expert systems have been developed to assist in plant design, management, and maintenance scheduling. (4) Interactive diagnostic systems are being developed for the analysis of physical processes that vary slowly. (5) Real-time diagnostic expert systems are currently at the cutting edge of the technology. (6) Operator adviser and emergency response expert systems constitute ∼25% of the total. (7) Research on the use of expert systems for reactor control is quite active. (8) Too few quantitative evaluations of the benefits of expert systems to reactor operators have been performed. The operator's need is for timely, factual information on plant status. Hence, the true challenge to expert systems is real-time diagnostics
USING EXPERT OPINION IN HEALTH TECHNOLOGY ASSESSMENT: A GUIDELINE REVIEW.
Hunger, Theresa; Schnell-Inderst, Petra; Sahakyan, Narine; Siebert, Uwe
2016-01-01
External experts can be consulted at different stages of an HTA. When using vague information sources, it is particularly important to plan, analyze, and report the information processing in a standardized and transparent way. Our objective was to search and analyze recommendations regarding where and how to include expert data in HTA. We performed a systematic database search and screened the Internet pages of seventy-seven HTA organizations for guidelines, recommendations, and methods papers that address the inclusion of experts in HTA. Relevant documents were downloaded, and information was extracted in a standard form. Results were merged in tables and narrative evidence synthesis. From twenty-two HTA organizations, we included forty-two documents that consider the use of expert opinion in HTA. Nearly all documents mention experts in the step of preparation of the evidence report. Six documents address their role for priority setting of topics, fifteen for scoping, twelve for the appraisal of evidence and results, another twelve documents mention experts when considering the dissemination of HTA results. During the assessment step, experts are most often asked to amend the literature search or to provide expertise for special data analyses. Another issue for external experts is to appraise the HTA results and refer them back to a clinical and social context. Little is reported on methods of expert elicitation when their input substitutes study data. Despite existing recommendations on the use of expert opinion in HTA, common standards for elicitation are scarce in HTA guidelines.
Concept of expert system for modal split in transportation planning
Directory of Open Access Journals (Sweden)
Popović Maja M.
2006-01-01
Full Text Available The objective of this paper is to develop a concept of expert system based on the survey of experts' opinions and their experience concerning relations in modal split, on the basis of parameters of transport system demand and transport supply, defined through PT travel time and city size, i.e. mean trip length. This expert system could be of use both to experts and less experienced planners who could apply the knowledge contained in this expert system for further improvement, on operational as well as on strategic level.
An hierarchical approach to performance evaluation of expert systems
Dominick, Wayne D. (Editor); Kavi, Srinu
1985-01-01
The number and size of expert systems is growing rapidly. Formal evaluation of these systems - which is not performed for many systems - increases the acceptability by the user community and hence their success. Hierarchical evaluation that had been conducted for computer systems is applied for expert system performance evaluation. Expert systems are also evaluated by treating them as software systems (or programs). This paper reports many of the basic concepts and ideas in the Performance Evaluation of Expert Systems Study being conducted at the University of Southwestern Louisiana.
Expert system aided operator's mental activities training
International Nuclear Information System (INIS)
Gieci, A.; Macko, J.; Mosny, J.; Gese, A.
1994-01-01
The operator's mental activity is the most important part of his work. A processing of a large amount of the information by the operator is possible only if he/she possesses appropriate cognitive skills. To facilitate the novice's acquisition of the experienced operator's cognitive skills of the decision-making process a special type of the expert system was developed. The cognitive engineering's models and problem-solving methodology constitutes the basis of this expert system. The article gives an account of the prototype of the mentioned expert system developed to aid the whole mental activity of the nuclear power plant operator during his decision-making process. (author). 6 refs, 6 figs
EXPERT SYSTEMS - DEVELOPMENT OF AGRICULTURAL INSURANCE TOOL
Directory of Open Access Journals (Sweden)
NAN Anca-Petruţa
2013-07-01
Full Text Available Because of the fact that specialty agricultural assistance is not always available when the farmers need it, we identified expert systems as a strong instrument with an extended potential in agriculture. This started to grow in scale recently, including all socially-economic activity fields, having the role of collecting data regarding different aspects from human experts with the purpose of assisting the user in the necessary steps for solving problems, at the performance level of the expert, making his acquired knowledge and experience available. We opted for a general presentation of the expert systems as well as their necessity, because, the solution to develop the agricultural system can come from artificial intelligence by implementing the expert systems in the field of agricultural insurance, promoting existing insurance products, farmers finding options in depending on their necessities and possibilities. The objective of this article consists of collecting data about different aspects about specific areas of interest of agricultural insurance, preparing the database, a conceptual presentation of a pilot version which will become constantly richer depending on the answers received from agricultural producers, with the clearest exposure of knowledgebase possible. We can justify picking this theme with the fact that even while agricultural insurance plays a very important role in agricultural development, the registered result got from them are modest, reason why solutions need to be found in the scope of developing the agricultural sector. The importance of this consists in the proposal of an immediate viable solution to correspond with the current necessities of agricultural producers and in the proposal of an innovative solution, namely the implementation of expert system in agricultural insurance as a way of promoting insurance products. Our research, even though it treats the subject at an conceptual level, it wants to undertake an
Toward the Development of Expert Assessment Systems.
Hasselbring, Ted S.
1986-01-01
The potential application of "expert systems" to the diagnosis and assessment of special-needs children is examined and existing prototype systems are reviewed. The future of this artificial intelligence technology is discussed in relation to emerging development tools designed for the creation of expert systems by the lay public. (Author)
Expert group formation using facility location analysis
Neshati, M.; Beigy, H.; Hiemstra, Djoerd
In this paper, we propose an optimization framework to retrieve an optimal group of experts to perform a multi-aspect task. While a diverse set of skills are needed to perform a multi-aspect task, the group of assigned experts should be able to collectively cover all these required skills. We
Expert group formation using facility location analysis
Neshati, Mahmood; Beigy, Hamid; Hiemstra, Djoerd
2014-01-01
In this paper, we propose an optimization framework to retrieve an optimal group of experts to perform a multi-aspect task. While a diverse set of skills are needed to perform a multi-aspect task, the group of assigned experts should be able to collectively cover all these required skills. We
Experts' meeting: Maintenance '83
International Nuclear Information System (INIS)
1983-01-01
The brochure presents, in full wording, 20 papers read at the experts' meeting ''Maintenance '83'' in Wiesbaden. Most of the papers discuss reliability data (acquisition, evaluation, processing) of nearly all fields of industry. (RW) [de
Criteria for the CAREM reactor's expert system design conduction
International Nuclear Information System (INIS)
Furman, A.; Delgado, R.
1990-01-01
The present work describes the analysis made to start with the development of an Expert System for the CAREM (SE) reactor's conduction. The following tasks are presented: a) purpose of the Expert System; b) Decision Making structure; c) Architecture of the Expert System; d) Description of Subsystems and e) Licensing. (Author) [es
Contemporary Expert Debates on the SCO-Related Issues
Directory of Open Access Journals (Sweden)
Igor Evgen'evich Denisov
2016-01-01
Full Text Available Since its establishment the SCO has always attracted a lot of expert attention. The SCO Forum was founded in 2006 to bring together for annual debates experts from all member-states. Within this format in-depth discussions took place in April 2016 in Dushanbe, which hosted this year conference of the SCO Forum. Participating experts and officials reviewed problems of security, economic cooperation (including transport and water-energy issues and SCO enlargement, the latter being one of the most debatable. Experts presented some new thesis on all these problems, in particular on the enlargement issue. These new thesis are summed up in this article. Besides, the SCO Forum this year had many statements on the organization approaching a sort of new phase in its development. This line of discussions may lead in the future to even more active debates on SCO's role in the world. This article puts emphasis on the new elements of these debates and reviews major experts' attitudes within this line of discussion on the SCO being in front of a new stage of development.
Functional magnetic resonance imaging (FMRI) and expert testimony.
Kulich, Ronald; Maciewicz, Raymond; Scrivani, Steven J
2009-03-01
Medical experts frequently use imaging studies to illustrate points in their court testimony. This article reviews how these studies impact the credibility of expert testimony with judges and juries. The apparent "objective" evidence provided by such imaging studies can lend strong credence to a judge's or jury's appraisal of medical expert's testimony. However, as the court usually has no specialized scientific expertise, the use of complex images as part of courtroom testimony also has the potential to mislead or at least inappropriately bias the weight given to expert evidence. Recent advances in brain imaging may profoundly impact forensic expert testimony. Functional magnetic resonance imaging and other physiologic imaging techniques currently allow visualization of the activation pattern of brain regions associated with a wide variety of cognitive and behavioral tasks, and more recently, pain. While functional imaging technology has a valuable role in brain research and clinical investigation, it is important to emphasize that the use of imaging studies in forensic matters requires a careful scientific foundation and a rigorous legal assessment.
Group prioritisation with unknown expert weights in incomplete linguistic context
Cheng, Dong; Cheng, Faxin; Zhou, Zhili; Wang, Juan
2017-09-01
In this paper, we study a group prioritisation problem in situations when the expert weights are completely unknown and their judgement preferences are linguistic and incomplete. Starting from the theory of relative entropy (RE) and multiplicative consistency, an optimisation model is provided for deriving an individual priority vector without estimating the missing value(s) of an incomplete linguistic preference relation. In order to address the unknown expert weights in the group aggregating process, we define two new kinds of expert weight indicators based on RE: proximity entropy weight and similarity entropy weight. Furthermore, a dynamic-adjusting algorithm (DAA) is proposed to obtain an objective expert weight vector and capture the dynamic properties involved in it. Unlike the extant literature of group prioritisation, the proposed RE approach does not require pre-allocation of expert weights and can solve incomplete preference relations. An interesting finding is that once all the experts express their preference relations, the final expert weight vector derived from the DAA is fixed irrespective of the initial settings of expert weights. Finally, an application example is conducted to validate the effectiveness and robustness of the RE approach.
Expert Review of Pedagogical Activities at Therapeutic Recreation Camps
Kiselev, N. N.; Kiseleva, E. V.
2015-01-01
An analysis of pedagogical expert reviews at children's therapeutic recreation camps in Novosibirsk Region shows that it is necessary to implement an expert review system that plays a supporting and developmental role. Such a system should allow teams of teachers to submit their work to expert review and to move forward by reflecting on their…
Cooperating expert systems for space station power distribution management
International Nuclear Information System (INIS)
Nguyen, T.A.; Chiou, W.C.
1986-01-01
In a complex system such as the manned Space Station, it is deemed necessary that many expert systems must perform tasks in a concurrent and cooperative manner. An important question to arise is: what cooperative-task-performing models are appropriate for multiple expert systems to jointly perform tasks. The solution to this question will provide a crucial automation design criteria for the Space Station complex systems architecture. Based on a client/server model for performing tasks, the authors have developed a system that acts as a front-end to support loosely-coupled communications between expert systems running on multiple Symbolics machines. As an example, they use the two ART*-based expert systems to demonstrate the concept of parallel symbolic manipulation for power distribution management and dynamic load planner/scheduler in the simulated Space Station environment. This on-going work will also explore other cooperative-task-performing models as alternatives which can evaluate inter and intra expert system communication mechanisms. It will serve as a testbed and a bench-marking tool for other Space Station expert subsystem communication and information exchange
Cooperating Expert Systems For Space Station Power Distribution Management
Nguyen, T. A.; Chiou, W. C.
1987-02-01
In a complex system such as the manned Space Station, it is deem necessary that many expert systems must perform tasks in a concurrent and cooperative manner. An important question arise is: what cooperative-task-performing models are appropriate for multiple expert systems to jointly perform tasks. The solution to this question will provide a crucial automation design criteria for the Space Station complex systems architecture. Based on a client/server model for performing tasks, we have developed a system that acts as a front-end to support loosely-coupled communications between expert systems running on multiple Symbolics machines. As an example, we use two ART*-based expert systems to demonstrate the concept of parallel symbolic manipulation for power distribution management and dynamic load planner/scheduler in the simulated Space Station environment. This on-going work will also explore other cooperative-task-performing models as alternatives which can evaluate inter and intra expert system communication mechanisms. It will be served as a testbed and a bench-marking tool for other Space Station expert subsystem communication and information exchange.
Expert systems to assist plant operation
International Nuclear Information System (INIS)
Matsumoto, Yoshihiro; Mori, Nobuyuki; Wada, Norio
1985-01-01
Large-scale real-time process control systems, such as those for electric power dispatching, large thermal and nuclear power stations, steel mill plants and manufacturing automation systems, need expert systems to assist operator's decision. The expert systems newly developed to fulfill the requirement are founded on OKBS (object oriented knowledge based system). OKBS provides various object types: fuzzy logic type, production rule type, frame type, state transition type, abstract data type and input/output transformation type. (author)
Recruiting experts for technical assistance rogramme
International Nuclear Information System (INIS)
1974-01-01
One of the objectives of the IAEA is the provision of technical assistance to its Member States to carry out their peaceful nuclear activities more efficiently and safely. This involves looking for and supplying experts, equipment and fellowships. Since 1958 the Agency has provided the services of more than 1800 experts valued at $11.5 million, 4300 fellowships valued at $14.3 million, and equipment worth $10.8 million. The efficiency of the programme can only be increased by a more prompt consideration of proposals forwarded by the Agency, and the continuing co-operation from national Governments and private institutions. The IAEA recruits an average of 200 experts a year to implement its Regular Technical Assistance Programme. These projects are financed by voluntary contributions from Member States, and by the United Nations Development Programme for those projects for which the IAEA is the executing agency
An Expert System for Designing Fire Prescriptions
Elizabeth Reinhardt
1987-01-01
Managers use prescribed fire to accomplish a variety of resource objectives. The knowledge needed to design successful prescriptions is both quantitative and qualitative. Some of it is available through publications and computer programs, but much of the knowledge of expert practitioners has never been collected or published. An expert system being developed at the,...
The vulcain N expert fire system
International Nuclear Information System (INIS)
Roche, A.
1989-03-01
The Institute for Nuclear Safety and Protection (IPSN) has begun work on an expert system to aid in the diagnosis of fire hazards in nuclear installations. This system is called Vulcain N and is designed as a support tool for the analyses carried out by the IPSN. Vulcain N, is based on the Vulcain expert system already developed by Bertin for its own needs and incorporates the specific rules and know-how of the IPSN experts. The development of Vulcain N began in October 1986 with the drawing up of the technical specifications, and should be completed by the end of 1988. Vulcain N brings together knowledge from a number of different domains: the locations of the combustible materials, the thermal characteristics of the combustible materials and of the walls of the room, the ventilation conditions and, finally, knowledge of fire experts concerning the development of fire. The latter covers four levels of expert knowledge: standards and their associated calculations, the simplified physics of the fire enabling more precise values to be obtained for the figures given by the standards, the rules and knowledge which enables a certain number of deductions to be made concerning the development of the fire, and a numerical simulation code which can be used to monitor the variation of certain characteristic parameters with time. For a given fire out-break scenario, Vulcain N performs diagnosis of different aspects: development of fire, effect of ventilation, emergency action possibilities, propagation hazards, etc. Owing to its flexibility, it can be used in the analysis of fire hazards to simulate a number of possible scenarios and to very rapidly deduce the essential, predominant factors. It will also be used to assist in drafting emergency procedures for application in facilities with nuclear hazards
Expert knowledge as defined by the X-Ray Ordinance
International Nuclear Information System (INIS)
1987-01-01
The radiation protection officer or any person responsible for radiation safety have to give proof of their expert knowledge in accordance with sections 3, 4 of the X-Ray Ordinance. Proof of expert knowledge has to be furnished within the procedure of appointment (sec. 13, sub-sec. (3) X-Ray Ordinance). The directive defines the scope of the expert knowledge required, and the scope of expert knowledge persons must have, or acquire, who are responsible for radiation protection within the preview of sec. 23, no. 2, 4 and sec. 29, sub-sec. 1, no. 3 of the X-Ray Ordinance. (orig./HP) [de
Expert Panel Elicitation of Seismicity Following Glaciation in Sweden
International Nuclear Information System (INIS)
Hora, Stephen; Jensen, Mikael
2005-12-01
The Swedish Radiation Protection Authority, the Swedish Nuclear Power Inspectorate and the Swedish Nuclear Fuel and Waste Management Company have jointly carried out a project on expert panel elicitation on the issue of glacial induced Swedish earthquakes. Following a broad nomination procedure, 5 experts were chosen by a selection committee of 4 professors within Earth sciences disciplines. The 5 experts presented judgments about the frequency of earthquakes greater the magnitude 6 within 10 km for two Swedish sites, Oskarshamn and Forsmark, in connection with a glaciation cycle. The experts' median value vas 0,1 earthquakes for one glaciation cycle
Expert Panel Elicitation of Seismicity Following Glaciation in Sweden
Energy Technology Data Exchange (ETDEWEB)
Hora, Stephen; Jensen, Mikael (eds.)
2005-12-15
The Swedish Radiation Protection Authority, the Swedish Nuclear Power Inspectorate and the Swedish Nuclear Fuel and Waste Management Company have jointly carried out a project on expert panel elicitation on the issue of glacial induced Swedish earthquakes. Following a broad nomination procedure, 5 experts were chosen by a selection committee of 4 professors within Earth sciences disciplines. The 5 experts presented judgments about the frequency of earthquakes greater the magnitude 6 within 10 km for two Swedish sites, Oskarshamn and Forsmark, in connection with a glaciation cycle. The experts' median value vas 0,1 earthquakes for one glaciation cycle.
Estimating Production Potentials: Expert Bias in Applied Decision Making
International Nuclear Information System (INIS)
Matthews, L.J.; Burggraf, L.K.; Reece, W.J.
1998-01-01
A study was conducted to evaluate how workers predict manufacturing production potentials given positively and negatively framed information. Findings indicate the existence of a bias toward positive information and suggest that this bias may be reduced with experience but is never the less maintained. Experts err in the same way non experts do in differentially processing negative and positive information. Additionally, both experts and non experts tend to overestimate production potentials in a positive direction. The authors propose that these biases should be addressed with further research including cross domain analyses and consideration in training, workplace design, and human performance modeling
Propulsive efficiency and non- expert swimmers performance
Directory of Open Access Journals (Sweden)
Tiago Barbosa
2009-12-01
Full Text Available Propulsive efficiency is one of the most interesting issues for competitive swimming researchers, has it presents significant relationships with the swimmer’s biophysical behavior and his/her performance. Although propulsive efficiency is a variable that has been quite studied in elite swimmers, there is no research on this issue in young and non-expert swimmers. Thus, the aim of this study was to: (i estimate the propulsive efficiency on non-expert swimmers; (ii identify biomechanical and anthropometrical parameters that are associated with propulsive efficiency; (iii identify the association between the propulsive efficiency and swim performance. Twenty-eight non-expert swimmers participated on this study. It was assessed the propulsive efficiency, biomechanical and anthropometrical parameters, as well as, the swim performance. The propulsive efficiency of non-expert swimmers is lower than data reported in the literature to higher competitive levels swimmers and there are no significant differences between boys and girls. It was also noted that several biomechanical and anthropometrical parameters, as well as, the swim performance are associated with the propulsive efficiency.
Pappas and Tepe's Pathways to Knowledge Model.
Zimmerman, Nancy P.; Pappas, Marjorie L.; Tepe, Ann E.
2002-01-01
Describes the Pathways to Knowledge model for helping students achieve information literacy in library media programs. Discusses the searcher's thinking, information search or seeking, and instructional strategies; information skills; the six stages in the model, including appreciation, presearch, search, interpretation, communication, and…
The Study of Expert System Utilization for the Accelerator Operation
International Nuclear Information System (INIS)
Budi-Santosa; Slamet-Santosa; Subari-Santosa
2000-01-01
The utilization of expert system in the accelerator laboratory has been studied. The study covers the utilization of expert system in the setting up experiment (tuning parameter), controlling system, safety or warning system. The results study shows, that using the expert system in the accelerator would be easy to operate the accelerator for user and operator. Increasing the skill of expert system could be updated without logical mechanism modification. (author)
Requirements to obtain the recognition of radiological protection experts
International Nuclear Information System (INIS)
Arguelles, R.; Villarroel, R.; Senderos, V.; Campos, R.; Pinos, M.; Ponjuan, G.; Franco, P.; Rueda, D.
2003-01-01
The scope of this paper is to summarize the general requirements related to education, training and skill of the individual to obtain the recognition of radiological protection experts on ionizing radiation (experts on radiological protection- RP). There has been established two levels according to the grade of responsibility: Qualified expert provided with a diploma given by de Nuclear Safety Council. Technician expert on radiological protection whose certification is made by the Qualified expert that supervise their work. To obtain the diploma of qualified expert is required an official degree, a title of Architecture, Engineering or equivalent in case of no national degrees; specific training on radiological protection (300 hours) and the knowledge on safety and radiological protection of the facilities to be supervised. Three years of experience on radiological protection must be proved. To get the recognition of technician expert on radiological protection is required Formacion Profesional de Grado Superior or equivalent and specific training on safety and radiological protection. Knowledge on basis and principles of radiological protection are required. According to the type of the facilities to be supervised there are two models: A model: to deal with facilities included in RD 1836/1999 (nuclear and radioactive facilities). B model: to deal with medical X rays facilities approved under RD 1891/1991 three months of experience on the selected model must be proved. (Author)
USING OF SOFTWARE FOR ESTIMATION OF EXPERT COMPETENCE
Directory of Open Access Journals (Sweden)
Oleg N. Velichko
2015-01-01
Full Text Available The features of estimation of expert’s competence in the field of higher education are considered, got with a help, both universal statistical software and special software. The comparative analysis of quantitative estimation of expert’s competence is conducted, that showed possibility of forming of the most competent group of experts for realization of necessary group expert estimation in the field of higher education. An analysis showed the high degree of coincidence of results that allow declining less competent experts.
Use of expert systems in nuclear power plants
International Nuclear Information System (INIS)
Uhrig, R.E.
1989-01-01
The application of technologies, particularly expert systems, to the control room activities in a nuclear power plant has the potential to reduce operator error and increase plant safety, reliability, and efficiency. Furthermore, there are a large number of nonoperating activities (testing, routine maintenance, outage planning, equipment diagnostics, and fuel management) in which expert systems can increase the efficiency and effectiveness of overall plant and corporate operations. This document presents a number of potential applications of expert systems in the nuclear power field. 36 refs., 2 tabs
Expert system for transuranic waste assay
Energy Technology Data Exchange (ETDEWEB)
Zoolalian, M.L.; Gibbs, A.; Kuhns, J.D.
1989-01-01
Transuranic wastes are generated at the Savannah River Site (SRS) as a result of routine production of nuclear materials. These wastes contain Pu-238 and Pu-239 and are placed into lined 55-gallon waste drums. The drums are placed on monitored storage pads pending shipment to the Waste Isolation Pilot Plant in New Mexico. A passive-active neutron (PAN) assay system is used to determine the mass of the radioactive material within the waste drums. Assay results are used to classify the wastes as either low-level or transuranic (TRU). During assays, the PAN assay system communicates with an IBM-AT computer. A Fortran computer program, called NEUT, controls and performs all data analyses. Unassisted, the NEUT program cannot adequately interpret assay results. To eliminate this limitation, an expert system shell was used to write a new algorithm, called the Transuranic Expert System (TRUX), to drive the NEUT program and add decision making capabilities for analysis of the assay results. The TRUX knowledge base was formulated by consulting with human experts in the field of neutron assay, by direct experimentation on the PAN assay system, and by observing operations on a daily basis. TRUX, with its improved ability to interpret assay results, has eliminated the need for close supervision by a human expert, allowing skilled technicians to operate the PAN assay system. 4 refs., 1 fig., 4 tabs.
Expert system for transuranic waste assay
International Nuclear Information System (INIS)
Zoolalian, M.L.; Gibbs, A.; Kuhns, J.D.
1989-01-01
Transuranic wastes are generated at the Savannah River Site (SRS) as a result of routine production of nuclear materials. These wastes contain Pu-238 and Pu-239 and are placed into lined 55-gallon waste drums. The drums are placed on monitored storage pads pending shipment to the Waste Isolation Pilot Plant in New Mexico. A passive-active neutron (PAN) assay system is used to determine the mass of the radioactive material within the waste drums. Assay results are used to classify the wastes as either low-level or transuranic (TRU). During assays, the PAN assay system communicates with an IBM-AT computer. A Fortran computer program, called NEUT, controls and performs all data analyses. Unassisted, the NEUT program cannot adequately interpret assay results. To eliminate this limitation, an expert system shell was used to write a new algorithm, called the Transuranic Expert System (TRUX), to drive the NEUT program and add decision making capabilities for analysis of the assay results. The TRUX knowledge base was formulated by consulting with human experts in the field of neutron assay, by direct experimentation on the PAN assay system, and by observing operations on a daily basis. TRUX, with its improved ability to interpret assay results, has eliminated the need for close supervision by a human expert, allowing skilled technicians to operate the PAN assay system. 4 refs., 1 fig., 4 tabs
Diagnosis - Using automatic test equipment and artificial intelligence expert systems
Ramsey, J. E., Jr.
Three expert systems (ATEOPS, ATEFEXPERS, and ATEFATLAS), which were created to direct automatic test equipment (ATE), are reviewed. The purpose of the project was to develop an expert system to troubleshoot the converter-programmer power supply card for the F-15 aircraft and have that expert system direct the automatic test equipment. Each expert system uses a different knowledge base or inference engine, basing the testing on the circuit schematic, test requirements document, or ATLAS code. Implementing generalized modules allows the expert systems to be used for any different unit under test. Using converted ATLAS to LISP code allows the expert system to direct any ATE using ATLAS. The constraint propagated frame system allows for the expansion of control by creating the ATLAS code, checking the code for good software engineering techniques, directing the ATE, and changing the test sequence as needed (planning).
Expert systems - basic principles and possible applications in nuclear energy
International Nuclear Information System (INIS)
Cain, D.G.; Schmidt, F.
1987-01-01
One of the primary goals of the application of mathematical methods and computational techniques in reactor physics is the effective and accurate solution of the neutron diffusion equation under various conditions. To reach this goal still requires much skill, experience, knowledge and imagination as can be seen from various contributions at this and other conferences. Experts are necessary. Will expert systems replace them. We shall discuss this question by describing the basic principles of problem solving by expert systems as compared to problem solving by mathematical and computational methods. From this we shall identify areas of possible applications of the new techniques in nuclear energy and develop some thoughts on present limitations. As a result we conclude that expert systems will not be able to replace experts as long as the experts use the systems to improve their own expertise
THE ARCHITECTURE OF MULTI-COMPONENT DISTRIBUTED HYBRID EXPERT TRAINING SYSTEM
Directory of Open Access Journals (Sweden)
Оleh Shevchuk
2016-09-01
Full Text Available The paper reports on the design of a multi-component architecture of distributed hybrid expert training system that can be used for the study of knowledge base of both internal and external expert systems and artificial intelligence systems that are distributed on Internet servers and other computer networks. Expert training system is based on three groups of basic principles: cybernetic, reflecting experience of previous research of systems of artificial intelligence, expert training systems; pedagogical, determining the principles, on which pedagogical design and use of expert training systems are based; psychological, determining preconditious and understanding of pupils psychics, on which the processes of design and use of expert training systems in professional training of future specialists are based.It accounts for the efficient training through the distributed knowledge via the Internet, which greatly increases the didactic capabilities of the system.
A study on expert system applications for nuclear power plant
International Nuclear Information System (INIS)
Huh, Young Hwan; Kim, Yeong Jin; Park, Nam Seog; Dong, In Sook; Choi, In Seon
1987-12-01
The application of artificial intelligence techniques to nuclear power plants such as expert systems is rapidly emerging. expert systems can contribute significantly to the availability and the improved operation and safety of nuclear power plants. The objective of the project is to develop an expert system in a selected application area in the nuclear power plants. This project will last for 3 years. The first year's tasks are: - Information collection and literature survey on expert systems. - Analysis of several applicable areas for applying AI technologies to the nuclear power plants. - Conceptual design of a few selected domains. - Selection of hardware and software tools for the development of the expert system
Environmental policy. 2000 environmental expert opinion of the Council of Experimental Experts
International Nuclear Information System (INIS)
2000-05-01
The reorientation of energy policy is a key issue. The Council of Environmental Experts considers the further use of atomic energy to be irresponsible and recommends a new orientation. Recommendations are made on ecology-centered taxation. Critical comments are made in the context of conservation of nature, where many species of plants and animals still continue to be endangered. The conservation programme of the Federal government, which also comprises a system of large, interconnected biotopes on 10% of Germany's total surface, is approved, and the potential contribution of sustainable agricultural and forestry policy is discussed in a separate chapter. Further subjects discussed are recycling and waste management, protection of water and soil, air pollution abatement, health protection and genetic engineering. The environmental aspects of Eastern European states becoming EC members are gone into in particular. The network of Europen Environmental Councils, for which the German Council of Environmental Experts currently acts as a coordinator, makes intensive efforts to improve environmental counselling in these states [de
Auditory memory function in expert chess players.
Fattahi, Fariba; Geshani, Ahmad; Jafari, Zahra; Jalaie, Shohreh; Salman Mahini, Mona
2015-01-01
Chess is a game that involves many aspects of high level cognition such as memory, attention, focus and problem solving. Long term practice of chess can improve cognition performances and behavioral skills. Auditory memory, as a kind of memory, can be influenced by strengthening processes following long term chess playing like other behavioral skills because of common processing pathways in the brain. The purpose of this study was to evaluate the auditory memory function of expert chess players using the Persian version of dichotic auditory-verbal memory test. The Persian version of dichotic auditory-verbal memory test was performed for 30 expert chess players aged 20-35 years and 30 non chess players who were matched by different conditions; the participants in both groups were randomly selected. The performance of the two groups was compared by independent samples t-test using SPSS version 21. The mean score of dichotic auditory-verbal memory test between the two groups, expert chess players and non-chess players, revealed a significant difference (p≤ 0.001). The difference between the ears scores for expert chess players (p= 0.023) and non-chess players (p= 0.013) was significant. Gender had no effect on the test results. Auditory memory function in expert chess players was significantly better compared to non-chess players. It seems that increased auditory memory function is related to strengthening cognitive performances due to playing chess for a long time.
The neural organization of perception in chess experts.
Krawczyk, Daniel C; Boggan, Amy L; McClelland, M Michelle; Bartlett, James C
2011-07-20
The human visual system responds to expertise, and it has been suggested that regions that process faces also process other objects of expertise including chess boards by experts. We tested whether chess and face processing overlap in brain activity using fMRI. Chess experts and novices exhibited face selective areas, but these regions showed no selectivity to chess configurations relative to other stimuli. We next compared neural responses to chess and to scrambled chess displays to isolate areas relevant to expertise. Areas within the posterior cingulate, orbitofrontal cortex, and right temporal cortex were active in this comparison in experts over novices. We also compared chess and face responses within the posterior cingulate and found this area responsive to chess only in experts. These findings indicate that the configurations in chess are not strongly processed by face-selective regions that are selective for faces in individuals who have expertise in both domains. Further, the area most consistently involved in chess did not show overlap with faces. Overall, these results suggest that expert visual processing may be similar at the level of recognition, but need not show the same neural correlates. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Estimating unknown parameters in haemophilia using expert judgement elicitation.
Fischer, K; Lewandowski, D; Janssen, M P
2013-09-01
The increasing attention to healthcare costs and treatment efficiency has led to an increasing demand for quantitative data concerning patient and treatment characteristics in haemophilia. However, most of these data are difficult to obtain. The aim of this study was to use expert judgement elicitation (EJE) to estimate currently unavailable key parameters for treatment models in severe haemophilia A. Using a formal expert elicitation procedure, 19 international experts provided information on (i) natural bleeding frequency according to age and onset of bleeding, (ii) treatment of bleeds, (iii) time needed to control bleeding after starting secondary prophylaxis, (iv) dose requirements for secondary prophylaxis according to onset of bleeding, and (v) life-expectancy. For each parameter experts provided their quantitative estimates (median, P10, P90), which were combined using a graphical method. In addition, information was obtained concerning key decision parameters of haemophilia treatment. There was most agreement between experts regarding bleeding frequencies for patients treated on demand with an average onset of joint bleeding (1.7 years): median 12 joint bleeds per year (95% confidence interval 0.9-36) for patients ≤ 18, and 11 (0.8-61) for adult patients. Less agreement was observed concerning estimated effective dose for secondary prophylaxis in adults: median 2000 IU every other day The majority (63%) of experts expected that a single minor joint bleed could cause irreversible damage, and would accept up to three minor joint bleeds or one trauma related joint bleed annually on prophylaxis. Expert judgement elicitation allowed structured capturing of quantitative expert estimates. It generated novel data to be used in computer modelling, clinical care, and trial design. © 2013 John Wiley & Sons Ltd.
Computer-assisted expert case definition in electronic health records.
Walker, Alexander M; Zhou, Xiaofeng; Ananthakrishnan, Ashwin N; Weiss, Lisa S; Shen, Rongjun; Sobel, Rachel E; Bate, Andrew; Reynolds, Robert F
2016-02-01
To describe how computer-assisted presentation of case data can lead experts to infer machine-implementable rules for case definition in electronic health records. As an illustration the technique has been applied to obtain a definition of acute liver dysfunction (ALD) in persons with inflammatory bowel disease (IBD). The technique consists of repeatedly sampling new batches of case candidates from an enriched pool of persons meeting presumed minimal inclusion criteria, classifying the candidates by a machine-implementable candidate rule and by a human expert, and then updating the rule so that it captures new distinctions introduced by the expert. Iteration continues until an update results in an acceptably small number of changes to form a final case definition. The technique was applied to structured data and terms derived by natural language processing from text records in 29,336 adults with IBD. Over three rounds the technique led to rules with increasing predictive value, as the experts identified exceptions, and increasing sensitivity, as the experts identified missing inclusion criteria. In the final rule inclusion and exclusion terms were often keyed to an ALD onset date. When compared against clinical review in an independent test round, the derived final case definition had a sensitivity of 92% and a positive predictive value of 79%. An iterative technique of machine-supported expert review can yield a case definition that accommodates available data, incorporates pre-existing medical knowledge, is transparent and is open to continuous improvement. The expert updates to rules may be informative in themselves. In this limited setting, the final case definition for ALD performed better than previous, published attempts using expert definitions. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Topics in expert system design methodologies and tools
Tasso, C
1989-01-01
Expert Systems are so far the most promising achievement of artificial intelligence research. Decision making, planning, design, control, supervision and diagnosis are areas where they are showing great potential. However, the establishment of expert system technology and its actual industrial impact are still limited by the lack of a sound, general and reliable design and construction methodology.This book has a dual purpose: to offer concrete guidelines and tools to the designers of expert systems, and to promote basic and applied research on methodologies and tools. It is a coordinated coll
An expert system in medical diagnosis
International Nuclear Information System (INIS)
Raboanary, R.; Raoelina Andriambololona; Soffer, J.; Raboanary, J.
2001-01-01
Health problem is still a crucial one in some countries. It is so important that it becomes a major handicap in economic and social development. In order to solve this problem, we have conceived an expert system that we called MITSABO, which means TO HEAL, to help the physicians to diagnose tropical diseases. It is clear that by extending the data base and the knowledge base, we can extend the application of the software to more general areas. In our expert system, we used the concept of 'self organization' of neural network based on the determination of the eigenvalues and the eigenvectors associated to the correlation matrix XX t . The projection of the data on the two first eigenvectors gives a classification of the diseases which is used to get a first approach in the diagnosis of the patient. This diagnosis is improved by using an expert system which is built from the knowledge base.
Meanings & motives. Experts debating tobacco addiction.
Mars, Sarah G; Ling, Pamela M
2008-10-01
Over the last 50 years, tobacco has been excluded from and then included in the category of addictive substances. We investigated influences on these opposing definitions and their application in expert witness testimony in litigation in the 1990s and 2000s. A scientist with ties to the tobacco industry influenced the selection of a definition of addiction that led to the classification of tobacco as a "habituation" in the 1964 Surgeon General's Advisory Committee report. Tobacco was later defined as addictive in the 1988 surgeon general's report. Expert witnesses for tobacco companies used the 1964 report's definition until Philip Morris Tobacco Company publicly changed its position in 1997 to agree that nicotine was addictive. Expert witnesses for plaintiffs suing the tobacco industry used the 1988 report's definition, arguing that new definitions were superior because of scientific advance. Both sides viewed addiction as an objective entity that could be defined more or less accurately.
Energy Technology Data Exchange (ETDEWEB)
Wheeler, T A; Cramond, W R [Sandia National Laboratories, Albuquerque, NM (United States); Hora, S C [University of Hawii at Hilo (United States); Unwin, S D [Brookhaven National Laboratory (United States)
1989-04-01
Quantitative modeling techniques have limitations as to the resolution of important issues in probabilistic risk assessment (PRA). Not all issues can be resolved via the existing set of methods such as fault trees, event trees, statistical analyses, data collection, and computer simulation. Therefore, an expert judgment process was developed to address issues perceived as important to risk in the NUREG-1150 analysis but which could not be resolved with existing techniques. This process was applied to several issues that could significantly affect the internal event core damage frequencies of the PRAs performed on six light water reactors. Detailed descriptions of these issues and the results of the expert judgment elicitation are reported here, as well as an explanation of the methodology used and the procedure followed in performing the overall elicitation task. The process is time-consuming and expensive. However, the results are very useful, and represent an improvement over the draft NUREG-1150 analysis in the areas of expert selection, elicitation training, issue selection and presentation, elicitation of judgment and aggregation of results. The results are presented in two parts. Part documents the expert panel elicitations, where the most important issues were presented to a panel of experts convened from throughout the nuclear power risk assessment community. Part 2 documents the process by which the project staff performed expert judgment on other important issues, using the project staff as panel members. (author)
The rational thinking of expert opinion and communicating in courtroom
Directory of Open Access Journals (Sweden)
Bing Li
2017-01-01
Full Text Available Since the past half century, expert testimony has played an increasingly important role in Chinese litigation. As the amount of expert testimony has grown, the issues about its admissibility and scientific foundation related to evidence are becoming to be questioned commonly. Since eighteenth central committee (China adopted the decision of the Central Committee of China on several important issues in promoting the legal system, the evidence was redefined to become the predominance in the whole proceeding. This article reviews the expert knowledge implicit in the opinions. It argues that the expert opinions ask judges to be aware of the role of communicationg between participants. Expert opinion is not only gained from laboratory, but also socially constructed in the rational expression and communication, which requir us think logically in terms of legal perceptions of science and expert knowledge in the empirical world.
Prognostic aspects of imaging method development
International Nuclear Information System (INIS)
Steinhart, L.
1987-01-01
A survey is presented of X-ray diagnostic methods and techniques and possibilities of their further development. Promising methods include direct imaging using digital radiography. In connection with computer technology these methods achieve higher resolution. The storage of obtained images in the computer memory will allow automated processing and evaluation and the use of expert systems. Development is expected to take place especially in computerized tomography using magnetic resonance, and positron computed tomography and other non-radioactive diagnostic methods. (J.B.). 5 figs., 1 tab., 1 ref
Energy Technology Data Exchange (ETDEWEB)
Flandoli, F. [Dip.to di Matematica Applicata, Universita di Pisa, Pisa (Italy); Giorgi, E. [Dip.to di Matematica Applicata, Universita di Pisa, Pisa (Italy); Istituto Nazionale di Geofisica e Vulcanologia, Sezione di Pisa, via della Faggiola 32, 56126 Pisa (Italy); Aspinall, W.P. [Dept. of Earth Sciences, University of Bristol, and Aspinall and Associates, Tisbury (United Kingdom); Neri, A., E-mail: neri@pi.ingv.it [Istituto Nazionale di Geofisica e Vulcanologia, Sezione di Pisa, via della Faggiola 32, 56126 Pisa (Italy)
2011-10-15
The problem of ranking and weighting experts' performances when quantitative judgments are being elicited for decision support is considered. A new scoring model, the Expected Relative Frequency model, is presented, based on the closeness between central values provided by the expert and known values used for calibration. Using responses from experts in five different elicitation datasets, a cross-validation technique is used to compare this new approach with the Cooke Classical Model, the Equal Weights model, and individual experts. The analysis is performed using alternative reward schemes designed to capture proficiency either in quantifying uncertainty, or in estimating true central values. Results show that although there is only a limited probability that one approach is consistently better than another, the Cooke Classical Model is generally the most suitable for assessing uncertainties, whereas the new ERF model should be preferred if the goal is central value estimation accuracy. - Highlights: > A new expert elicitation model, named Expected Relative Frequency (ERF), is presented. > A cross-validation approach to evaluate the performance of different elicitation models is applied. > The new ERF model shows the best performance with respect to the point-wise estimates.
Advisory expert system for test rig operator
International Nuclear Information System (INIS)
Zielczynski, P.
1994-01-01
The advisory expert system MAESTRO (Modular Advisory Expert System for Test Rig Operator) has been designed to guide the operator of large experimental installation during start-up, steady state and shut down. The installation is located in the research reactor MARIA in the Institute of Atomic Energy in Swierk, Poland. The system acquires and analyses on line signals from installation and performs two tasks in real time: leading the operator and monitoring of the installation (including signal validation). Systems tasks, architecture and knowledge representation concepts are described. The system is based on expert systems techniques what makes in phases of continuous change of process parameters and it has been achieved by special knowledge representation allowing its dynamical modification. (author). 147 refs, 42 figs, 5 tab
An expert system approach for safety diagnosis
International Nuclear Information System (INIS)
Erdmann, R.C.; Sun, B.K.H.
1988-01-01
An expert system was developed with the intent to provide real-time information about an accident to an operator who is in the process of diagnosing and bringing that accident under control. Explicit use was made of probabilistic risk analysis techniques and plant accident response information in constructing this system. The expert system developed contains 70 logic rules and provides contextual messages during simulated accident sequences and logic sequence information on the entire sequence in graphical form for accident diagnosis. The present analysis focuses on integrated control system-related transients with Babcock and Wilcox-type reactors. While the system developed here is limited in extent and was built for a composite reactor, it demonstrates that an expert system may enhance the operator's capability in the control room
An expert system for diesel generator diagnostics
International Nuclear Information System (INIS)
Bley, D.C.; Read, J.W.; Kaplan, S.; Liming, J.K.; Brosee, N.M.; Hanley, D.W.
1987-01-01
The idea of developing artificial intelligence (AI) systems to capture the knowledge of human experts is receiving much attention these days. The idea is even more attractive when important expertise resides within a single individual, especially one who is nearing retirement and who has not otherwise recorded or passed along his important knowledge and thought processes. The diesel generators at Pilgrim Nuclear Power Station have performed exceptionally well, primarily due to the care and attention of one man. Therefore, the authors are constructing an expert system for the diagnosis of diesel generator problems at Pilgrim. This paper includes a description of the expert system design and operation, examples from the knowledge base, and sample diagnoses, so the reader can observe the process in action
Bioethics for Technical Experts
Asano, Shigetaka
Along with rapidly expanding applications of life science and technology, technical experts have been implicated more and more often with ethical, social, and legal problems than before. It should be noted that in this background there are scientific and social uncertainty elements which are inevitable during the progress of life science in addition to the historically-established social unreliability to scientists and engineers. In order to solve these problems, therefore, we should establish the social governance with ‘relief’ and ‘reliance’ which enables for both citizens and engineers to share the awareness of the issues, to design social orders and criterions based on hypothetical sense of values for bioethics, to carry out practical use management of each subject carefully, and to improve the sense of values from hypothetical to universal. Concerning these measures, the technical experts can learn many things from the present performance in the medical field.
The Most Quoted Danish Economic Expert and the Welfare State
DEFF Research Database (Denmark)
Madsen, Poul Thøis
It is well-known that economic experts (as well as other experts) are biased. However, it is not normally demonstrated systematically. By identifying and analyzing the viewpoints of the most quoted Danish expert on five characteristic debates bias is demonstrated. The character of the bias...
Rational consensus under uncertainty: Expert judgment in the EC-USNRC uncertainty study
International Nuclear Information System (INIS)
Cooke, R.; Kraan, B.; Goossens, L.
1999-01-01
Governmental bodies are confronted with the problem of achieving rational consensus in the face of substantial uncertainties. The area of accident consequence management for nuclear power plants affords a good example. Decisions with regard to evacuation, decontamination, and food bans must be taken on the basis of predictions of environmental transport of radioactive material, contamination through the food chain, cancer induction, and the like. These predictions use mathematical models containing scores of uncertain parameters. Decision makers want to take, and want to be perceived to take, these decisions in a rational manner. The question is, how can this be accomplished in the face of large uncertainties? Indeed, the very presence of uncertainty poses a threat to rational consensus. Decision makers will necessarily base their actions on the judgments of experts. The experts, however, will not agree among themselves, as otherwise we would not speak of large uncertainties. Any given expert's viewpoint will be favorable to the interests of some stakeholders, and hostile to the interests of others. If a decision maker bases his/her actions on the views of one single expert, then (s)he is invariably open to charges of partiality toward the interests favored by this viewpoint. An appeal to 'impartial' or 'disinterested' experts will fail for two reasons. First, experts have interests; they have jobs, mortgages and professional reputations. Second, even if expert interests could somehow be quarantined, even then the experts would disagree. Expert disagreement is not explained by diverging interests, and consensus cannot be reached by shielding the decision process from expert interests. If rational consensus requires expert agreement, then rational consensus is simply not possible in the face of uncertainty. If rational consensus under uncertainty is to be achieved, then evidently the views of a diverse set of experts must be taken into account. The question is how
Application of expert systems in damage assessment of reinforced concrete structures
International Nuclear Information System (INIS)
Fazel Zarandi, M. H.; Sobhani, J.
2003-01-01
Expert systems are receiving great attentions in construction industry to support decision making processes in diagnostics, design, repair and rehabilitation of the structures. Although several expert systems have been examined in engineering since the 1970's, their applications in construction industry are rate. This was largely due to the lack of expert system tools available to represent the domain knowledge. Lack of flexibility, applicability, and robustness of the classical models, have forced the scientists to discover the ability of the expert systems in problem solving of civil engineering. This paper present an expert system for diagnosis the deterioration of concrete structures. This expert system emphasizes on cracking distress in reinforced concrete elements. A case study has been presented to examine and evaluate the proposed expert system. The system demonstrates a straightforward method for diagnosing the cause of reinforced concrete elements cracking
Expert system based radionuclide identification
International Nuclear Information System (INIS)
Aarnio, P.A.; Ala-Heikkil, J.J.; Hakulinen, T.T.; Nikkinen, M.T.
1998-01-01
An expert system coupled with the gamma spectrum analysis system SAMPO has been developed for automating the qualitative identification of radionuclides as well as for determining the quantitative parameters of the spectrum components. The program is written in C-language and runs in various environments ranging from PCs to UNIX workstations. The expert system utilizes a complete gamma library with over 2600 nuclides and 80,000 lines, and a rule base of about fifty criteria including energies, relative peak intensities, genesis modes, half lives, parent-daughter relationships, etc. The rule base is furthermore extensible by the user. This is not an original contribution but a somewhat updated version of papers and reports previously published elsewhere. (author)
An Embedded Rule-Based Diagnostic Expert System in Ada
Jones, Robert E.; Liberman, Eugene M.
1992-01-01
Ada is becoming an increasingly popular programming language for large Government-funded software projects. Ada with it portability, transportability, and maintainability lends itself well to today's complex programming environment. In addition, expert systems have also assumed a growing role in providing human-like reasoning capability expertise for computer systems. The integration is discussed of expert system technology with Ada programming language, especially a rule-based expert system using an ART-Ada (Automated Reasoning Tool for Ada) system shell. NASA Lewis was chosen as a beta test site for ART-Ada. The test was conducted by implementing the existing Autonomous Power EXpert System (APEX), a Lisp-based power expert system, in ART-Ada. Three components, the rule-based expert systems, a graphics user interface, and communications software make up SMART-Ada (Systems fault Management with ART-Ada). The rules were written in the ART-Ada development environment and converted to Ada source code. The graphics interface was developed with the Transportable Application Environment (TAE) Plus, which generates Ada source code to control graphics images. SMART-Ada communicates with a remote host to obtain either simulated or real data. The Ada source code generated with ART-Ada, TAE Plus, and communications code was incorporated into an Ada expert system that reads the data from a power distribution test bed, applies the rule to determine a fault, if one exists, and graphically displays it on the screen. The main objective, to conduct a beta test on the ART-Ada rule-based expert system shell, was achieved. The system is operational. New Ada tools will assist in future successful projects. ART-Ada is one such tool and is a viable alternative to the straight Ada code when an application requires a rule-based or knowledge-based approach.
Expert Graphics System Research in the Department of the Navy.
Duff, Jon M.
1987-01-01
Presents current trends in the development of expert systems within the Department of the Navy, particularly research into expert graphics systems intended to support the Authoring Instructional Methods (AIM) research project. Defines artificial intelligence and expert systems. Discusses the operations and functions of the Navy's intelligent…
Expert System for ASIC Imaging
Gupta, Shri N.; Arshak, Khalil I.; McDonnell, Pearse; Boyce, Conor; Duggan, Andrew
1989-07-01
With the developments in the techniques of artificial intelligence over the last few years, development of advisory, scheduling and similar class of problems has become very convenient using tools such as PROLOG. In this paper an expert system has been described which helps lithographers and process engineers in several ways. The methodology used is to model each work station according to its input, output and control parameters, combine these work stations in a logical sequence based on past experience and work out process schedule for a job. In addition, all the requirements vis-a-vis a particular job parameters are converted into decision rules. One example is the exposure time, develop time for a wafer with different feature sizes would be different. This expert system has been written in Turbo Prolog. By building up a large number of rules, one can tune the program to any facility and use it for as diverse applications as advisory help, trouble shooting etc. Leitner (1) has described an advisory expert system that is being used at National Semiconductor. This system is quite different from the one being reported in the present paper. The approach is quite different for one. There is stress on job flow and process for another.
Problematic Aspects of the Use of Expert Systems in Law
Directory of Open Access Journals (Sweden)
Marius Kalinauskas
2011-08-01
Full Text Available Summary. The usage of expert systems in law brings many problematic questions. Complexity and intricacy of law, combined with limited possibilities of information technologies makes it difficult to create flawlessly working expert systems. In this article the author analyses problematic aspects related to expert system usage in law. Comparisons of various research are made according to analysis of scientific articles. The author analyses practical difficulties of legal norm representation, creation of expert knowledge ontology, expert systems liability issues. Legal responsibility of expert system developers, users, and owners are also covered in this paper. Creation of legal ontologies is a complicated process because of the nature of the subject itself and the complexity and quantity of knowledge which must be represented in order to have fully functional legal expert system. Legal information basically consists of legal norms, doctrine, precedents and expert knowledge. All of these areas have specific representation issues, but the most difficult part is to make ontology and representation of expert knowledge. Different experts may have distinct points of view in some similar cases. Human decisions are made not only by applying certain rules to the problem decision pattern. Providence, analytical skills and critical thinking is required in legal professional work. Human reasoning and decision-making is not only based on symbolic values, it also consists of intermediate symbolic assumptions. So the question is: is it possible to give a clear structure to something which has no permanent state? The other problem which is analyzed in this article is artificial reasoning methods, which are basically different forms of pattern recognition with some specific methods applied to them. The second part of the paper analyses the liability of expert systems. Nowadays expert systems can’t be legally responsible for their decisions. They lack
Problematic Aspects of the Use of Expert Systems in Law
Directory of Open Access Journals (Sweden)
Marius Kalinauskas
2013-08-01
Full Text Available The usage of expert systems in law brings many problematic questions. Complexity and intricacy of law, combined with limited possibilities of information technologies makes it difficult to create flawlessly working expert systems. In this article the author analyses problematic aspects related to expert system usage in law. Comparisons of various research are made according to analysis of scientific articles. The author analyses practical difficulties of legal norm representation, creation of expert knowledge ontology, expert systems liability issues. Legal responsibility of expert system developers, users, and owners are also covered in this paper. Creation of legal ontologies is a complicated process because of the nature of the subject itself and the complexity and quantity of knowledge which must be represented in order to have fully functional legal expert system. Legal information basically consists of legal norms, doctrine, precedents and expert knowledge. All of these areas have specific representation issues, but the most difficult part is to make ontology and representation of expert knowledge. Different experts may have distinct points of view in some similar cases. Human decisions are made not only by applying certain rules to the problem decision pattern. Providence, analytical skills and critical thinking is required in legal professional work. Human reasoning and decision-making is not only based on symbolic values, it also consists of intermediate symbolic assumptions. So the question is: is it possible to give a clear structure to something which has no permanent state? The other problem which is analyzed in this article is artificial reasoning methods, which are basically different forms of pattern recognition with some specific methods applied to them. The second part of the paper analyses the liability of expert systems. Nowadays expert systems can’t be legally responsible for their decisions. They lack intellectual
Expert System Applications for the Electric Power Industry: Proceedings
International Nuclear Information System (INIS)
1992-06-01
A conference on Expert System Applications for the Electric Power Industry was held in Boston on September 8--11, 1991 to provide a forum for technology transfer, technical information exchange, and education. The conference was attended by more than 150 representatives of electric utilities, equipment manufacturers, engineering consulting organizations, universities, national laboratories, and government agencies. The meeting included a keynote address, 70 papers, and 18 expert system demonstrations. Sessions covered expert systems in power system planning operations, fossil power plant applications, nuclear power plant applications, and intelligent user interfaces. The presentations showed how expert systems can provide immediate benefits to the electric power industry in many applications. Individual papers are indexed separately
Expert elicitation and the problem of detecting undeclared activities
International Nuclear Information System (INIS)
Pilat, Joseph F.; Sylvester, Kori Budlong; Stanbro, William D.
2002-01-01
Measures applicable to the detection of undeclared activities are not well established, and their effectiveness is uncertain. To detect clandestine paths, the IAEA is still developing processes and procedures. As the Agency gains experience with new measures and with integrated safeguards, dealing with such problems may become more experience-based and perhaps more closely parallel the process with current safeguards where detection probabilities for the measures to be utilized on declared paths are well characterized. Whether or not this point will be reached for undeclared and mixed paths, the only tool that appears suitable at present for the purpose of generating a reasonable detection probability that can over time be tested against reality and, if necessary, adjusted is formal expert judgment, or expert elicitation. Formal expert elicitation is a structured process that makes use of people knowledgeable in certain areas to make assessments. To provide a 'proof of principle' of this methodology for presentation to the Agency, experts in nuclear technology, nonproliferation, safeguards and open source information, as well as in formal expert elicitation processes, engaged in three illustrative expert elicitations on assessing information analysis as a means to detect undeclared activities. These elicitations were successful. This paper will discuss the process of and issues raised by the elicitations.
AN EXPERT SYSTEM USED IN DESIGN
Directory of Open Access Journals (Sweden)
Hüdayim BAŞAK
2001-03-01
Full Text Available In this work, an expert system used in computer aided design has been developed. In the developed program, the features which are used in the models prepared by a feature based design program are evaluated by the expert system module and are used in part modeling after determining of their compatibilty according to the rules. This program, particulary for those who do not know or know very little manufacturing stages, accomplishes the duty of informing and directing them. The program developed warns the user for design mistakes made during modeling.
The Management and Security Expert (MASE)
Miller, Mark D.; Barr, Stanley J.; Gryphon, Coranth D.; Keegan, Jeff; Kniker, Catherine A.; Krolak, Patrick D.
1991-01-01
The Management and Security Expert (MASE) is a distributed expert system that monitors the operating systems and applications of a network. It is capable of gleaning the information provided by the different operating systems in order to optimize hardware and software performance; recognize potential hardware and/or software failure, and either repair the problem before it becomes an emergency, or notify the systems manager of the problem; and monitor applications and known security holes for indications of an intruder or virus. MASE can eradicate much of the guess work of system management.
A statistical modeling approach to build expert credit risk rating systems
DEFF Research Database (Denmark)
Waagepetersen, Rasmus
2010-01-01
This paper presents an efficient method for extracting expert knowledge when building a credit risk rating system. Experts are asked to rate a sample of counterparty cases according to creditworthiness. Next, a statistical model is used to capture the relation between the characteristics...... of a counterparty and the expert rating. For any counterparty the model can identify the rating, which would be agreed upon by the majority of experts. Furthermore, the model can quantify the concurrence among experts. The approach is illustrated by a case study regarding the construction of an application score...
Expert system for web based collaborative CAE
Hou, Liang; Lin, Zusheng
2006-11-01
An expert system for web based collaborative CAE was developed based on knowledge engineering, relational database and commercial FEA (Finite element analysis) software. The architecture of the system was illustrated. In this system, the experts' experiences, theories and typical examples and other related knowledge, which will be used in the stage of pre-process in FEA, were categorized into analysis process and object knowledge. Then, the integrated knowledge model based on object-oriented method and rule based method was described. The integrated reasoning process based on CBR (case based reasoning) and rule based reasoning was presented. Finally, the analysis process of this expert system in web based CAE application was illustrated, and an analysis example of a machine tool's column was illustrated to prove the validity of the system.
An Analysis of the Working Memories of Expert Sport Instructors
McCullick, Bryan; Schempp, Paul; Hsu, Shan-Hui; Jung, Jin Hong; Vickers, Brad; Schuknecht, Greg
2006-01-01
A distinguishing characteristic of expert teachers appears to be an excellent memory (Berliner, 1986; Tan, 1997). Possessing an excellent memory aids experts in building a substantial knowledge base relative to teaching and learning. Despite its importance, the memory skills of expert teachers have yet to be investigated. Therefore, the purpose of…
Computers Simulate Human Experts.
Roberts, Steven K.
1983-01-01
Discusses recent progress in artificial intelligence in such narrowly defined areas as medical and electronic diagnosis. Also discusses use of expert systems, man-machine communication problems, novel programing environments (including comments on LISP and LISP machines), and types of knowledge used (factual, heuristic, and meta-knowledge). (JN)
Acquisition of Expert/Non-Expert Vocabulary from Reformulations.
Antoine, Edwige; Grabar, Natalia
2017-01-01
Technical medical terms are complicated to be correctly understood by non-experts. Vocabulary, associating technical terms with layman expressions, can help in increasing the readability of technical texts and their understanding. The purpose of our work is to build this kind of vocabulary. We propose to exploit the notion of reformulation following two methods: extraction of abbreviations and of reformulations with specific markers. The segments associated thanks to these methods are aligned with medical terminologies. Our results allow to cover over 9,000 medical terms and show precision of extractions between 0.24 and 0.98. The results and analyzed and compared with the existing work.
L’évaluation des experts dans les organisations
Directory of Open Access Journals (Sweden)
Pierre Mirralès
2009-03-01
Full Text Available L’avènement des nouvelles technologies et le développement de la société de connaissance n’ont fait qu’amplifier le rôle central de l’expert dans l’organisation. Plus que tout autre individu évoluant dans un milieu professionnel, son évaluation s’avère incontournable et cruciale. Du point de vue managérial pourtant, cette nécessaire évaluation génère très souvent de nombreuses frustrations de l’ensemble des parties prenantes. Notre travail de recherche s’attache à comprendre et à apporter des éléments de réponse à une évaluation des experts qui soit acceptable par eux –mêmes, par les dirigeants de l’organisation et par les autres parties prenantes (Etat, clients, actionnaires, fournisseurs…. Il met en évidence deux grandes modalités de l’évaluation : l’évaluation contrôle et l’évaluation régulation, pour lesquelles les réactions des experts sont diamétralement opposées. Notre méthodologie de recherche utilise des études de cas entreprises auprès d’une trentaine d’experts de deux secteurs d’activité différents.The advent of new technologies and the development of the Knowledge society have increased the central role of experts in organizations. More than any other professional individual, his evaluation is crucial. From the managerial point of view however, this evaluation often creates frustration of many stakeholders. This article tries to understand the process and develop a method which is acceptable to the management of the organization but also for other stakeholders (State, clients, shareholders, suppliers…. The article highlights two methods of evaluation: the control and regulation methods, for which the reactions of the experts are completely opposed. The methodology is based on case studies of firms with some 30 experts in two sectors of activity.
An investigation into the use of ''expert systems'' for system-wide diagnostics
International Nuclear Information System (INIS)
Booth, A.W.; Carroll, J.T.
1987-01-01
This paper has explained how expert systems function and how they might be used to provide a FASTBUS system-wide diagnostic program. The authors propose that the system be used to diagnose the FASTBUS system at FERMILAB's CDF experiment. There are many important areas which have not been addressed in great detail in this paper (such as the roles of the knowledge engineer and the expert during the knowledge acquisition phase), but the central idea of the embodiment of an expert skill in a computer is clear. Development of a system-wide diagnostic program requires building knowledge from all our system experts, into the system. To expand the expert system beyond its network diagnostic ability, to include finding faulty modules would be worthwhile. Having an ''intelligent'' assistant who is on shift 24 hours each day would relieve the ''real'' experts from laborious, time-consuming and sometimes repetitive tasks undertaken during the debugging process. The system could also provide a testbed for evaluation and comparison when considering future expert-system applications such as ''run-control'' and ''data analysis''. In the context of a system-wide diagnostic program, an ''expert system'' is not intended to replace human experts but simply to help them. It is envisaged that there will always be important interaction between the human expert and the ''expert system''. The incremental development of the ''expert system'' should ensure that it is useful in the short term (by debugging to the S.I./segment level for example), and even more useful in the medium to longer term as it acquires more and more knowledge and the ability to debug to the module level. Expert systems exist and are working successfully in many problem domains. See the bibliography for examples of ''expert systems'' built in the high energy physics environment
Water Sensation During Passive Propulsion for Expert and Nonexpert Swimmers.
Kusanagi, Kenta; Sato, Daisuke; Hashimoto, Yasuhiro; Yamada, Norimasa
2017-06-01
This study determined whether expert swimmers, compared with nonexperts, have superior movement perception and physical sensations of propulsion in water. Expert (national level competitors, n = 10) and nonexpert (able to swim 50 m in > 3 styles, n = 10) swimmers estimated distance traveled in water with their eyes closed. Both groups indicated their subjective physical sensations in the water. For each of two trials, two-dimensional coordinates were obtained from video recordings using the two-dimensional direct linear transformation method for calculating changes in speed. The mean absolute error of the difference between the actual and estimated distance traveled in the water was significantly lower for expert swimmers (0.90 ± 0.71 meters) compared with nonexpert swimmers (3.85 ± 0.84 m). Expert swimmers described the sensation of propulsion in water in cutaneous terms as the "sense of flow" and sensation of "skin resistance." Therefore, expert swimmers appear to have a superior sense of distance during their movement in the water compared with that of nonexpert swimmers. In addition, expert swimmers may have a better perception of movement in water. We propose that expert swimmers integrate sensations and proprioceptive senses, enabling them to better perceive and estimate distance moved through water.
Telecontrol - Expert systems. Real-time monitoring and remote diagnostic
Energy Technology Data Exchange (ETDEWEB)
Lam, A.
1996-09-01
The role of expert systems in programming simple and complex tasks in utilities companies was discussed with examples from B.C. Hydro, where expert systems have been used in such diverse applications as an in-house programmable logic controller (PLC) training course, and a machine audit on a 150 MW steam turbine generating unit at their Burrard Thermal Generating Plant. The PLC tutoring program uses expert system technology for the air blast circuit breakers` air drier system, for individualized on-site training. The steam turbine audits (an eight-month long project) were performed remotely by dialing an on-site computer configured with customized expert software. Details of these, and other potential applications, such as transformer monitoring and diagnostics, circuit breaker performance analysis, and information management, were described.
[Development of expert diagnostic system for common respiratory diseases].
Xu, Wei-hua; Chen, You-ling; Yan, Zheng
2014-03-01
To develop an internet-based expert diagnostic system for common respiratory diseases. SaaS system was used to build architecture; pattern of forward reasoning was applied for inference engine design; ASP.NET with C# from the tool pack of Microsoft Visual Studio 2005 was used for website-interview medical expert system.The database of the system was constructed with Microsoft SQL Server 2005. The developed expert system contained large data memory and high efficient function of data interview and data analysis for diagnosis of various diseases.The users were able to perform this system to obtain diagnosis for common respiratory diseases via internet. The developed expert system may be used for internet-based diagnosis of various respiratory diseases,particularly in telemedicine setting.
Directory of Open Access Journals (Sweden)
Mark Lyons
2013-06-01
Full Text Available Exploring the effects of fatigue on skilled performance in tennis presents a significant challenge to the researcher with respect to ecological validity. This study examined the effects of moderate and high-intensity fatigue on groundstroke accuracy in expert and non-expert tennis players. The research also explored whether the effects of fatigue are the same regardless of gender and player's achievement motivation characteristics. 13 expert (7 male, 6 female and 17 non-expert (13 male, 4 female tennis players participated in the study. Groundstroke accuracy was assessed using the modified Loughborough Tennis Skills Test. Fatigue was induced using the Loughborough Intermittent Tennis Test with moderate (70% and high-intensities (90% set as a percentage of peak heart rate (attained during a tennis-specific maximal hitting sprint test. Ratings of perceived exertion were used as an adjunct to the monitoring of heart rate. Achievement goal indicators for each player were assessed using the 2 x 2 Achievement Goals Questionnaire for Sport in an effort to examine if this personality characteristic provides insight into how players perform under moderate and high-intensity fatigue conditions. A series of mixed ANOVA's revealed significant fatigue effects on groundstroke accuracy regardless of expertise. The expert players however, maintained better groundstroke accuracy across all conditions compared to the novice players. Nevertheless, in both groups, performance following high-intensity fatigue deteriorated compared to performance at rest and performance while moderately fatigued. Groundstroke accuracy under moderate levels of fatigue was equivalent to that at rest. Fatigue effects were also similar regardless of gender. No fatigue by expertise, or fatigue by gender interactions were found. Fatigue effects were also equivalent regardless of player's achievement goal indicators. Future research is required to explore the effects of fatigue on
Expert systems for C3I. Volume 1. A user's introduction
Clapp, J. A.; Hockett, S. M.; Prelle, M. J.; Tallant, A. M.; Triant, D. D.
1985-10-01
There has been a tremendous burgeoning of interest in artificial intelligence (AI) over the last few years. Investments of commercial and government sponsors reflect a widespread belief that AI is now ready for practical applications. The area of AI currently receiving the greatest attention and investment is expert system technology. Most major high tech corporations have begun to develop expert systems, and many software houses specializing in expert system tools and applications have recently appeared. The defense community is one of the heaviest investors in expert system technology, and within this community one of the application areas receiving greatest attention is C3I. Many ESD programs are now beginning to ask whether expert system applications for C3I are ready for incorporation into ESD-developed systems, and, if so, what are the potential benefits and risks of doing so. This report was prepared to help ESD and MITRE personnel working on acquisition programs to address these issues and to gain a better understanding of what expert systems are all about. The primary intention of this report is to investigate what expert systems are and the advances that are being made in expert system technology for C3I applications. The report begins with a brief tutorial on expert systems, emphasizing how they differ from conventional software systems and what they are best at doing.
Abou-Warda, Sherein Hamed
2016-01-01
Purpose: The overall objective of the current study is to explore how universities can better developing new educational services. The purpose of this paper is to develop framework for technology entrepreneurship education (TEPE) within universities. Design/Methodology/Approach: Qualitative and quantitative research approaches were employed. This…
Lawley, Russell; Barron, Mark; Lark, Murray
2015-04-01
At BGS, expert elicitation has been used to evaluate uncertainty of surveyed boundaries in several, common, geological scenarios. As a result, a 'collective' understanding of the issues surrounding each scenario has emerged. The work has provoked wider debate in three key areas: a) what can we do to resolve those scenarios where a 'consensus' of understanding cannot be achieved b) what does it mean for survey practices and subsequent use of maps in 3D models c) how do we communicate the 'collective' understanding of geological mapping (with or without consensus for specific scenarios). Previous work elicited expert judgement for uncertainty in six contrasting mapping scenarios. In five cases it was possible to arrive at a consensus model; in a sixth case experts with different experience (length of service, academic background) took very different views of the nature of the mapping problem. The scenario concerned identification of the boundary between two contrasting tills (one derived from Triassic source materials being red in colour; the other, derived from Jurassic materials being grey in colour). Initial debate during the elicitation identified that the colour contrast should provide some degree of confidence in locating the boundary via traditional auger-traverse survey methods. However, as the elicitation progressed, it became clear that the complexities of the relationship between the two Tills were not uniformly understood across the experts and the panel could not agree a consensus regarding the spatial uncertainty of the boundary. The elicitation process allowed a significant degree of structured knowledge-exchange between experts of differing backgrounds and was successful in identifying a measure of uncertainty for what was considered a contentious scenario. However, the findings have significant implications for a boundary-scenario that is widely mapped across the central regions of Great Britain. We will discuss our experience of the use of
The Development of Russian-Chinese Expert Contacts on International Relations
Directory of Open Access Journals (Sweden)
Ivan A. Safranchuk
2015-01-01
Full Text Available Abstract: This article is devoted to the contacts of Russian and Chinese experts on international relations and to the visit of MGIMO-University delegation to Beijing in June 2015. The article studies the major tracks of expert dialogue between Russian and Chinese experts on contemporary international affairs: the situation in the Near and Middle East, the developments in Eurasia, the major regional conflicts. The particular attention in the Russian-Chinese expert debates is devoted to the topic of Eurasia and the perspective for agreed implementation of Russia-sponsored Eurasian Economic Union and China-sponsored Economic belt of Silk Road. The article dwells upon the key issues in the Russian-Chinese dialogue on the Eurasian affairs. Additionally the article unveils the proposals by the US experts, concerning the development of Russian-Chinese dialogue on these matters. In 2015 the US experts developed new ideas on the regional issues in Eurasia, they offer to coordinate the Chinese project Economic belt of Silk Road and the US project of New Silk Road. In 2015 the historical topic gained momentum in the Russian-Chinese expert debates. Now Russia and China jointly oppose the attempts of some countries to revisit the results of World War II. However while Russia and China are both committed to the traditional interpretations of World war II and resist any revisionism of those results, still the Chinese experts argue in favor of greater appreciation of the role and contribution by China to the victory over fascism and militarism in World war II. The article also overviews interesting discussions between Russian and Chinese experts on the reform of global governance and the formation of the new world order.
29 CFR 18.703 - Bases of opinion testimony by experts.
2010-07-01
... Bases of opinion testimony by experts. The facts or data in the particular case upon which an expert... 29 Labor 1 2010-07-01 2010-07-01 true Bases of opinion testimony by experts. 18.703 Section 18.703 Labor Office of the Secretary of Labor RULES OF PRACTICE AND PROCEDURE FOR ADMINISTRATIVE HEARINGS...
Feed type based expert systems in mineral processing plants
International Nuclear Information System (INIS)
Jamsa-Jounela, S.-L.; Laine, S.; Laurila, H.
1999-01-01
Artificial Intelligence includes excellent tools for the control and supervision of industrial processes. Several thousand industrial applications have been reported worldwide. Recently, the designers of the AI systems have begun to hybridize the intelligent techniques, expert systems, fuzzy logic and neural networks, to enhance the capability of the AI systems. Expert systems have proved to be ideal candidates especially for the control of mineral processes. As successful case projects, expert system based on on-line classification of the feed type is described in this paper. The essential feature of this expert system is the classification of different feed types and their distinct control strategies at the plant. In addition to the classification, the expert system has a database containing information about how to handle the determined feed type. This self-learning database scans historical process data to suggest the best treatment for the ore type under processing. The system has been tested in two concentrators, the Outokumpu Finnmines Oy, Hitura mine and Outokumpu Chrome Oy, Kemi mine. (author)
Expert systems applied to two problems in nuclear power plants
International Nuclear Information System (INIS)
Kim, K.Y.
1988-01-01
This dissertation describes two prototype expert systems applied to two problems in nuclear power plants. One problem is spare parts inventory control, and the other one is radionuclide release from containment during severe accident. The expert system for spare parts inventory control can handle spare parts requirements not only in corrective, preventive, or predictive maintenance, but also when failure rates of components or parts are updated by new data. Costs and benefits of spare parts inventory acquisition are evaluated with qualitative attributes such as spare part availability to provide the inventory manager with an improved basis for decision making. The expert system is implemented with Intelligence/Compiler on an IBM-AT. The other expert system for radionuclide release from containment can estimate magnitude, type, location, and time of release of radioactive materials from containment during a severe accident nearly on line, based on the actual measured physical parameters such as temperature and pressure inside the containment. The expert system has a function to check the validation of sensor data. The expert system is implemented with KEE on a Symbolics LISP machine
Expert systems for assisting the analysis of hazards
International Nuclear Information System (INIS)
Evrard, J.M.; Martinez, J.M.; Souchet, Y.
1990-01-01
The advantage of applying expert systems in the analysis of safety in the operation of nuclear power plants is discussed. Expert systems apply a method based on a common representation of nuclear power plants. The main steps of the method are summarized. The applications given concern in the following fields: the analysis of hazards in the electric power supplies of a gas-graphite power plant; the evaluation of the availability of safety procedures in a PWR power plant; the search for the sources of leakage in a PWR power plant. The analysis shows that expert systems are a powerful tool in the study of safety of nuclear power plants [fr
An expert system for spare parts inventory control
International Nuclear Information System (INIS)
Kim, K.Y.; Chen, P.Y.C.; Okrent, D.
1987-01-01
This paper describes an expert system which can handle spare part requirements not only in corrective maintenance (CM) or preventive maintenance (PM), but also when failure rates of components or parts are updated by new data or by predictive maintenance (PDM), and which can also decide optimum stocking level of each spare part. This expert system provides a maintenance (or inventory) manager with an improved basis for decision making in the maintenance related to spare parts. The definitions of PM and PDM from NUREG-1212 (USNRC 1986) are used herein. This expert system used Intellignece/Compiler (Intelligence Ware, 1986) as a language/tool in the IBM-PC
REXS : A financial risk diagnostic expert system
Directory of Open Access Journals (Sweden)
W. Richter
2012-01-01
Full Text Available
ENGLISH ABSTRACT: Artificial intelligence techniques are rapidly emerging as important contributors to more effective management. One of the greatest growth areas probably lies in the use of Expert System methodology for supporting managerial decision processes.
Existing Decision Support Systems often attempt to apply analytical techniques in combination with traditional data access and retrieval functions. One of the problems usually encountered while developing such decision support systems is the need to transform an unstructured problem environment into a structured analytical model. Using an expert system approach to strategic decision making in such unstructured problem environments may provide significant advantages.
The financial Risk diagnostic EXpert System (REXS concentrates on Financial Risk Analysis. Based on a Forecasting Model the system will, with the support of several expert system knowledge bases, attempt to evaluate the financial risk of a business and provide guidelines for improvement.
AFRIKAANSE OPSOMMING: Tegnieke gebaseer op Kunsmatige Intelligensie toon tans die belofte om belangrike bydraes te maak tot meerBestaande Besluitsteunstelsels poog dikwels om analitiese tegnieke en lradisionele datatoegang- en onttrekkingsfunksies te kombineer. Een van die probleme wat gewoonlik ondervind word gedurende die ontwikkeling van '0 besluitsteunstelsel bestaan uit die behoefte om 'n ongestruktueerde probleemomgewing te transformeer na 'n gestruktueerde analitiese model. 'n Ekspertstelselbenadering lot strategiese besluitneming in 'n ongeSlruktureerde probleemomgewing mag betekenisvolle voordele inhou.
Die "financial Risk diagnostic EXpert System (REXS" konsentreer op fmansiele risiko-analise. Uitgaande vanaf 'n Vooruitskattingsmode~ en deur gebruik te maak van verskeie ekspertstelselkennisbasisse, poog die stelsel om die fmansiele risiko van 'n onderneming te evalueer en riglyne vir moontlike verbetering
Not All Flavor Expertise Is Equal: The Language of Wine and Coffee Experts
Majid, Asifa
2016-01-01
People in Western cultures are poor at naming smells and flavors. However, for wine and coffee experts, describing smells and flavors is part of their daily routine. So are experts better than lay people at conveying smells and flavors in language? If smells and flavors are more easily linguistically expressed by experts, or more “codable”, then experts should be better than novices at describing smells and flavors. If experts are indeed better, we can also ask how general this advantage is: do experts show higher codability only for smells and flavors they are expert in (i.e., wine experts for wine and coffee experts for coffee) or is their linguistic dexterity more general? To address these questions, wine experts, coffee experts, and novices were asked to describe the smell and flavor of wines, coffees, everyday odors, and basic tastes. The resulting descriptions were compared on a number of measures. We found expertise endows a modest advantage in smell and flavor naming. Wine experts showed more consistency in how they described wine smells and flavors than coffee experts, and novices; but coffee experts were not more consistent for coffee descriptions. Neither expert group was any more accurate at identifying everyday smells or tastes. Interestingly, both wine and coffee experts tended to use more source-based terms (e.g., vanilla) in descriptions of their own area of expertise whereas novices tended to use more evaluative terms (e.g., nice). However, the overall linguistic strategies for both groups were en par. To conclude, experts only have a limited, domain-specific advantage when communicating about smells and flavors. The ability to communicate about smells and flavors is a matter not only of perceptual training, but specific linguistic training too. PMID:27322035
The technical qualified expert on radiation protection in Spain
International Nuclear Information System (INIS)
Marco Arboli, M.; Rodriguez Suarez, M.
2002-01-01
Education and training is considered an important tool for promoting safety culture and improving the level of competence of workers. In the different disciplines involved in Radiation Protection (PR), training programmes are being revised to ensure effective protection of individuals. In the European Union framework, the new normative and its adaptation in the Member States, as well as the past actions in each country, make the community to conclude that harmonization of educational programmes and European recognition of the qualification must be reached. An important point of these actions is the definition of the European Qualified Expert. Article 38 of the EURATOM Basic Safety Standards imposes requirements on training and education of the qualified experts and their exchange within the European Union. Since then, there has been many initiatives to seek to harmonization of the qualified expert requirements. In the Spanish education system, there has been a standard training and competent authority recognition of the high level qualified experts on radiation protection since 1986, whose programme is continuously being updating and improving. Taking into account the European actions to define the qualified expert training requirements, it has been designed an educational course for the Technical Qualified Expert on Radiation Protection. This pilot course has being carried out during May, 2002. The results of this project is shown in this paper. (Author)
Expert systems intelligent tutoring systems and the power industry: A future scenario
International Nuclear Information System (INIS)
Bloom, C.P.; Bullemer, P.T.; Cochran, E.L.
1990-01-01
One use to which fielded expert systems have been put is the training of less experienced personnel. However, since expert systems are not developed for the purpose of training, their knowledge contains gaps, particularly in the areas of explanation and reasoning-essential components of expertise. The incidental learning that results from interacting with an expert system produces a memorization of the expert system's procedures without an understanding of the logic behind those procedures. Although learning without comprehension can provide adequate task performance, it affords inadequate transfer or generalization of knowledge, producing task-specific learning. In other words, the expert system user performs the task like an expert, but has not really become an expert. To become an expert, specialized training is required. This training could be provided by professional educators, or, in the future, by artificial intelligence programs, called intelligent tutoring systems, specifically designed for training
Cornell Mixing Zone Expert System
This page provides an overview Cornell Mixing Zone Expert System water quality modeling and decision support system designed for environmental impact assessment of mixing zones resulting from wastewater discharge from point sources
Artificial Intelligence and Expert Systems.
Wilson, Harold O.; Burford, Anna Marie
1990-01-01
Delineates artificial intelligence/expert systems (AI/ES) concepts; provides an exposition of some business application areas; relates progress; and creates an awareness of the benefits, limitations, and reservations of AI/ES. (Author)
Expert and novice categorization of introductory physics problems
Wolf, Steven Frederick
Since it was first published 30 years ago, Chi et al.'s seminal paper on expert and novice categorization of introductory problems led to a plethora of follow-up studies within and outside of the area of physics [Chi et al. Cognitive Science 5, 121 -- 152 (1981)]. These studies frequently encompass "card-sorting" exercises whereby the participants group problems. The study firmly established the paradigm that novices categorize physics problems by "surface features" (e.g. "incline," "pendulum," "projectile motion,"... ), while experts use "deep structure" (e.g. "energy conservation," "Newton 2,"... ). While this technique certainly allows insights into problem solving approaches, simple descriptive statistics more often than not fail to find significant differences between experts and novices. In most experiments, the clean-cut outcome of the original study cannot be reproduced. Given the widespread implications of the original study, the frequent failure to reproduce its findings warrants a closer look. We developed a less subjective statistical analysis method for the card sorting outcome and studied how the "successful" outcome of the experiment depends on the choice of the original card set. Thus, in a first step, we are moving beyond descriptive statistics, and develop a novel microscopic approach that takes into account the individual identity of the cards and uses graph theory and models to visualize, analyze, and interpret problem categorization experiments. These graphs are compared macroscopically, using standard graph theoretic statistics, and microscopically, using a distance metric that we have developed. This macroscopic sorting behavior is described using our Cognitive Categorization Model. The microscopic comparison allows us to visualize our sorters using Principal Components Analysis and compare the expert sorters to the novice sorters as a group. In the second step, we ask the question: Which properties of problems are most important in problem
International Nuclear Information System (INIS)
Tsoukalas, L.; Ikonomopoulos, A.; Uhrig, R.E.
1991-01-01
This paper presents a methodology that couples rule-based expert systems using fuzzy logic, to pre-trained artificial neutral networks (ANN) for the purpose of transient identification in Nuclear Power Plants (NPP). In order to provide timely concise, and task-specific information about the may aspects of the transient and to determine the state of the system based on the interpretation of potentially noisy data a model-referenced approach is utilized. In it, the expert system performs the basic interpretation and processing of the model data, and pre-trained ANNs provide the model. having access to a set of neural networks that typify general categories of transients, the rule based system is able to perform identification functions. Membership functions - condensing information about a transient in a form convenient for a rule-based identification system characterizing a transient - are the output of neural computations. This allows the identification function to be performed with a speed comparable to or faster than that of the temporal evolution of the system. Simulator data form major secondary system pipe rupture is used to demonstrate the methodology. The results indicate excellent noise-tolerance for ANN's and suggest a new method for transient identification within the framework of Fuzzy Logic
Expert system for USNRC emergency response
International Nuclear Information System (INIS)
Sebo, D.E.; Bray, M.A.; King, M.A.
1986-01-01
The Reactor Safety Assessment System (RSAS) is an expert system under development for the United States Nuclear Regulatory Commission (USNRC). RSAS is intended for use at the NRC's Operations Center in the event of a serious incident at a licensed nuclear power plant. RSAS is a situation assessment expert system which uses plant parametric data to generate conclusions for use by the NRC Reactor Safety Team. RSAS uses multiple rule bases and plant specific setpoint files in order to be applicable to all licensed power plants. RSAS currently covers several generic reactor types and power plants within those classes
A computerized expert system for mammography
International Nuclear Information System (INIS)
Jackson, V.P.; Dines, K.A.; Bassett, L.W.
1988-01-01
The authors have developed a computer-based expert system to aid in the interpretation of mammograms, breast sonograms, and clinical findings. The radiologist enters clinical and image data into the artificial intelligence system and receives a prediction of the etiology of lesions seen on breast imaging studies. This prototype interactive system has undergone preliminary clinical testing and evaluation. Ultimately, a more refined and complex system will be of value in mammography education, for general radiologists without ready access to mammography experts, for paramedical personnel, and for all mammographers in need of a breast imaging database and reporting systems
Expert System Techniques and Applications in AEC-Design
DEFF Research Database (Denmark)
Andersen, Tom
This part of a book presents expert system techniques applicable to building design and construction, and it reports and evaluates on systems developed in thar domain.......This part of a book presents expert system techniques applicable to building design and construction, and it reports and evaluates on systems developed in thar domain....
Expert systems development: some problems, motives and issues in an exploratory study
International Nuclear Information System (INIS)
Mehdi Sagheb-Tehrani.
1993-10-01
Even though expert systems (ES) have been in use since the early eighties, there is a remarkable lack of a strong theoretical base for handling expert systems development problems. There is a requirement in the ES field for theories or explanatory models to formulate propositions, to conduct research and interpret findings in a coherent way. This work presents an exploratory investigation designed to identify some problems, motives and issues associated with developing expert systems. Totally, twenty-five expert systems were developed by various organizations which participated in the study. The study attempts to provide evidence that either supports or refutes the anecdotes, gossips and speculations currently being spread through the academic journals dealing with the expert systems development in organizations. This study provides evidence that knowledge acquisition is indeed the bottleneck of expert systems development. It also points out that most expert systems are still in the prototype stage, and that current expert systems are mostly used for aiding the decision making of less skilled domain personnel and to a lesser extent for advice to experts. The rationale behind these uses seems to be the search by organizations for better decision making in the hope of improving competitiveness. A conceptual model of expert systems development is introduced based upon theoretical studies and the findings of this study from which some hypotheses are drawn. The main objective of the model is to contribute to a larger theoretical framework. Another aim is to create a broader theoretical framework for expert systems development in order to implement such systems more successfully. The results of the study confirm that the linkages of various concepts involved in the expert systems development process are very important for the design of a successful expert system project
An expert system technology for work authorization information systems
International Nuclear Information System (INIS)
Munchausen, J.H.; Glazer, K.A.
1988-01-01
This paper describes the effort by Southern California Edison Company (SCE) and the Electric Power Research Institute (EPRI) to develop an expert systems work station designed to support the San Onofre Nuclear Generating Station (SONGS). The expert systems work station utilizes IntelliCorp KEE (Knowledge Engineering Environment) and EPRI-IntelliCorp PLEXSYS (PLant EXpert SYStem) technology, and SCE Piping and Instrumentation Diagrams (P and ID's) and host-based computer applications to assist plant operations and maintenance personnel in the development of safety tagout boundaries. Of significance in this venture is the merging of conventional computer applications technology with expert systems technology. The EPRI PLEXSYS work station will act as a front-end for the SONGS Tagout Administration and Generation System (TAGS), a conventional CICS/COBOL mainframe computer application
What defines an Expert? - Uncertainty in the interpretation of seismic data
Bond, C. E.
2008-12-01
Studies focusing on the elicitation of information from experts are concentrated primarily in economics and world markets, medical practice and expert witness testimonies. Expert elicitation theory has been applied in the natural sciences, most notably in the prediction of fluid flow in hydrological studies. In the geological sciences expert elicitation has been limited to theoretical analysis with studies focusing on the elicitation element, gaining expert opinion rather than necessarily understanding the basis behind the expert view. In these cases experts are defined in a traditional sense, based for example on: standing in the field, no. of years of experience, no. of peer reviewed publications, the experts position in a company hierarchy or academia. Here traditional indicators of expertise have been compared for significance on affective seismic interpretation. Polytomous regression analysis has been used to assess the relative significance of length and type of experience on the outcome of a seismic interpretation exercise. Following the initial analysis the techniques used by participants to interpret the seismic image were added as additional variables to the analysis. Specific technical skills and techniques were found to be more important for the affective geological interpretation of seismic data than the traditional indicators of expertise. The results of a seismic interpretation exercise, the techniques used to interpret the seismic and the participant's prior experience have been combined and analysed to answer the question - who is and what defines an expert?
An Accurate and Impartial Expert Assignment Method for Scientific Project Review
Directory of Open Access Journals (Sweden)
Mingliang Yue
2017-12-01
Full Text Available Purpose: This paper proposes an expert assignment method for scientific project review that considers both accuracy and impartiality. As impartial and accurate peer review is extremely important to ensure the quality and feasibility of scientific projects, enhanced methods for managing the process are needed. Design/methodology/approach: To ensure both accuracy and impartiality, we design four criteria, the reviewers’ fitness degree, research intensity, academic association, and potential conflict of interest, to express the characteristics of an appropriate peer review expert. We first formalize the expert assignment problem as an optimization problem based on the designed criteria, and then propose a randomized algorithm to solve the expert assignment problem of identifying reviewer adequacy. Findings: Simulation results show that the proposed method is quite accurate and impartial during expert assignment. Research limitations: Although the criteria used in this paper can properly show the characteristics of a good and appropriate peer review expert, more criteria/conditions can be included in the proposed scheme to further enhance accuracy and impartiality of the expert assignment. Practical implications: The proposed method can help project funding agencies (e.g. the National Natural Science Foundation of China find better experts for project peer review. Originality/value: To the authors’ knowledge, this is the first publication that proposes an algorithm that applies an impartial approach to the project review expert assignment process. The simulation results show the effectiveness of the proposed method.
Prioritizing risks via several expert perspectives with application to runway safety
International Nuclear Information System (INIS)
Rogerson, Ellen C.; Lambert, James H.
2012-01-01
Factor hierarchies have been widely used in the literature to represent the view of an expert of what factors most contribute to reliability or safety. The methods for rating and aggregating the influences across a set of expert-elicited factors to risk or reliability are well known as multiple criteria decision analysis. This paper describes a method for distinguishing levels of risk across a set of locations via the use of multiple factor hierarchies. The method avoids averaging across experts and is thus useful for situations where experts disagree and where an absence of expert consensus on the causative or contributing factors is important information for risk management. A case study demonstrates using seven expert perspectives on the airport-specific factors that can contribute to runway incursions. The results are described for eighty towered airports in the US. The expert perspectives include differing relative emphases across the following set of factors: airport geometry, operations, weather, geography, and days since last safety review. Future work is suggested to include human factors issues as pilot-and-controller communications styles at airports. - Highlights: ► We examine influential factors in seven expert perspectives on the problem domain. ► We assess eighty US airports with qualitative measurement scales for each risk factor. ► Results show robustness and sensitivity of the risk index to expert perspective. ► We examine factors of several types including runway geometry, operations, weather, and geography.
Eliciting and communicating expert judgments: methodology and application to nuclear safety
International Nuclear Information System (INIS)
Winterfeldt, D. von; Commission of the European Communities, Ispra
1989-01-01
Expert judgment has always been used informally in the analysis of complex engineering problems. Increasingly, however, the use of expert judgment has been formalized by eliciting judgments in an explicit, documented and often quantitative way. In nuclear safety studies the need for formal elicitation of expert judgments arises because of the lack of data and experiences, the need to adapt model results to the specific circumstances of a plant, and the large uncertainties surrounding the events and quantities that characterize an accident sequence. The recognition of the need for a formal elicitation of expert judgments has led to one of the most extensive expert elicitation processes to date in the context of the NUREG 1150 study. About 30 safety issues were quantified using expert judgments about probabilities of various uncertain events and quantities, ranging from the failure of a check valve in the cooling system to the pressure built up due to hydrogen production to release fractions of various radionuclides. In total, some 1000 probability distributions were elicited from some 50 experts. This paper first motivates the use of formal expert elicitation in complex engineering studies and describes the methodology of formal expert elicitation. Subsequently, it describes the overall approach of NUREG 1150 and provides an example of the elicitation of the probability of a bypass failure in a pressurized water reactor. The paper ends by discussing some lessons learned, problems encountered and by providing some recommendations
Impact of education with authorized technical experts on colorectal laparoscopic skills.
Iwata, Takashi; Kurita, Nobuhiro; Nishioka, Masanori; Morimoto, Shinya; Yoshikawa, Kozo; Higashijima, Jun; Nakao, Toshihiro; Komatsu, Masato; Shimada, Mitsuo
2012-01-01
Laparoscopic skills training is becoming the standard for educating surgical residents. Because of the specific procedure which differs from that of open surgery, it is imperative to establish a unique training system to promote efficiency of learning laparoscopic skills. The aim of this study was to evaluate the efficiency of learning laparoscopic skills with or without authorized experts of JSES. Among 71 patients who underwent laparoscopic colectomy from 2004 to 2009, 30 patients who underwent operation in introduction era without a technical expert (2004-2006), 17 patients who underwent operation in late period of introduction era without a technical expert (2006-2008), 12 patients who underwent operation by resident with technical expert (2008-2009) and 12 patients who underwent operation by technical expert, were investigated. Operative time, amount of blood loss, intra- and post-operative complications and conversion to open surgery were investigated. Operative time: 477:333:262:220 minutes (early period:late period:resident:expert), amount of blood loss: 494:73:21:20mL and complications: ileus: 0:1:0:0, leakage: 1:1:3:0, neurological disturbance: 2:1:0:0. Instruction by authorized technical experts of JSES is helpful to avoid pitfalls which are not seen in open surgery without an expert.
Tools and technologies for expert systems: A human factors perspective
Rajaram, Navaratna S.
1987-01-01
It is widely recognized that technologies based on artificial intelligence (AI), especially expert systems, can make significant contributions to the productivity and effectiveness of operations of information and knowledge intensive organizations such as NASA. At the same time, these being relatively new technologies, there is the problem of transfering technology to key personnel of such organizations. The problems of examining the potential of expert systems and of technology transfer is addressed in the context of human factors applications. One of the topics of interest was the investigation of the potential use of expert system building tools, particularly NEXPERT as a technology transfer medium. Two basic conclusions were reached in this regard. First, NEXPERT is an excellent tool for rapid prototyping of experimental expert systems, but not ideal as a delivery vehicle. Therefore, it is not a substitute for general purpose system implementation languages such a LISP or C. This assertion probably holds for nearly all such tools on the market today. Second, an effective technology transfer mechanism is to formulate and implement expert systems for problems which members of the organization in question can relate to. For this purpose, the LIghting EnGineering Expert (LIEGE) was implemented using NEXPERT as the tool for technology transfer and to illustrate the value of expert systems to the activities of the Man-System Division.
Expert2OWL: A Methodology for Pattern-Based Ontology Development.
Tahar, Kais; Xu, Jie; Herre, Heinrich
2017-01-01
The formalization of expert knowledge enables a broad spectrum of applications employing ontologies as underlying technology. These include eLearning, Semantic Web and expert systems. However, the manual construction of such ontologies is time-consuming and thus expensive. Moreover, experts are often unfamiliar with the syntax and semantics of formal ontology languages such as OWL and usually have no experience in developing formal ontologies. To overcome these barriers, we developed a new method and tool, called Expert2OWL that provides efficient features to support the construction of OWL ontologies using GFO (General Formal Ontology) as a top-level ontology. This method allows a close and effective collaboration between ontologists and domain experts. Essentially, this tool integrates Excel spreadsheets as part of a pattern-based ontology development and refinement process. Expert2OWL enables us to expedite the development process and modularize the resulting ontologies. We applied this method in the field of Chinese Herbal Medicine (CHM) and used Expert2OWL to automatically generate an accurate Chinese Herbology ontology (CHO). The expressivity of CHO was tested and evaluated using ontology query languages SPARQL and DL. CHO shows promising results and can generate answers to important scientific questions such as which Chinese herbal formulas contain which substances, which substances treat which diseases, and which ones are the most frequently used in CHM.
International Nuclear Information System (INIS)
Janeschitz, G.; Connor, J.W.; Cordey, G.; Kardaun, O.; Mukhovatov, V.; Stambaugh, R.; Ryter, F.; Wakatani, M.
1999-01-01
This contribution to the ITER EDA Newsletter reports on the combined meeting of the core confinement and internal transport barrier expert group, confinement database and modeling expert group and edge pedestal expert group in Garching, Germany. This is the first workshop of its kind after the re-organisation of the expert groups. The new scheme of the meetings, namely to permit more interaction between groups by arranging them at the same time and location turned out to be very successful. The main issues discussed were for the Confinement Database: merging of edge pedestal and confinement data, improvement of the density- and magnetic shape parameters, addition of new dedicated threshold data, the effect of different divertors in JET; for the H-Mode Power Threshold Database: assembly of a new version of the database with about 650 time points from 10 tokamaks; for the 1-D Modelling Workshop: management of the database after the re-organisation of the Joint Central Team an ongoing efforts in plasma transport modelling; for the newly formed pedestal group: issues of the H-mode shear layer at the plasma edge. There was also an executive summary given of a recent USA workshop on internal transport barriers and regimes with weak or negative magnetic shear
The Finishing Touch: Anatomy of Expert Lesson Closures
Webster, Collin A.; Connolly, Graeme; Schempp, Paul G.
2009-01-01
Background: Based on the idea that students remember best what is presented last, the lesson closure is commonly identified as an important component of effective teaching and has recently surfaced as a routine practice of expert teachers in sport. Despite its link to both effective and expert instruction, the lesson closure has seen scarce…
International Nuclear Information System (INIS)
Gravelotte, D.
2008-01-01
The radiation protection expert (PCR in French for Personne Competente en Radioprotection) is a central actor in the organization of radioprotection. Such a person is required within radioprotection departments of basic nuclear installations as well in external companies intervening in these installations. After having recalled that relationship between these both experts is promoted by the legal framework, the author describes how this relationship is planned in the Paluel French nuclear power station. He indicates the type of data and information concerning the power station activities which are exchanged between them. He also presents the actions which have been defined to promote this relationship
Processes in construction of failure management expert systems from device design information
Malin, Jane T.; Lance, Nick
1987-01-01
This paper analyzes the tasks and problem solving methods used by an engineer in constructing a failure management expert system from design information about the device to te diagnosed. An expert test engineer developed a trouble-shooting expert system based on device design information and experience with similar devices, rather than on specific expert knowledge gained from operating the device or troubleshooting its failures. The construction of the expert system was intensively observed and analyzed. This paper characterizes the knowledge, tasks, methods, and design decisions involved in constructing this type of expert system, and makes recommendations concerning tools for aiding and automating construction of such systems.
Inquiry and Digital Learning Centers
Pappas, Marjorie L.
2005-01-01
"Inquiry is an investigative process that engages students in answering questions, solving real world problems, confronting issues, or exploring personal interests" (Pappas and Tepe 2002, 27). Students who engage in inquiry learning need tools and resources that enable them to independently gather and use information. Scaffolding is important for…
Expert Coaching in Weight Loss: Retrospective Analysis
Kushner, Robert F; Hill, James O; Lindquist, Richard; Brunning, Scott; Margulies, Amy
2018-01-01
Background Providing coaches as part of a weight management program is a common practice to increase participant engagement and weight loss success. Understanding coach and participant interactions and how these interactions impact weight loss success needs to be further explored for coaching best practices. Objective The purpose of this study was to analyze the coach and participant interaction in a 6-month weight loss intervention administered by Retrofit, a personalized weight management and Web-based disease prevention solution. The study specifically examined the association between different methods of coach-participant interaction and weight loss and tried to understand the level of coaching impact on weight loss outcome. Methods A retrospective analysis was performed using 1432 participants enrolled from 2011 to 2016 in the Retrofit weight loss program. Participants were males and females aged 18 years or older with a baseline body mass index of ≥25 kg/m², who also provided at least one weight measurement beyond baseline. First, a detailed analysis of different coach-participant interaction was performed using both intent-to-treat and completer populations. Next, a multiple regression analysis was performed using all measures associated with coach-participant interactions involving expert coaching sessions, live weekly expert-led Web-based classes, and electronic messaging and feedback. Finally, 3 significant predictors (Pcoaching session attendance (Pcoaching sessions, attending 60% of live weekly Web-based classes, and receiving a minimum of 1 food log feedback day per week were associated with clinically significant weight loss. Conclusions Participant’s one-on-one expert coaching session attendance, live weekly expert-led interactive Web-based class attendance, and the number of food log feedback days per week from expert coach were significant predictors of weight loss in a 6-month intervention. PMID:29535082
What is an expert? A systems perspective on expertise
Caley, Michael Julian; O'Leary, Rebecca A; Fisher, Rebecca; Low-Choy, Samantha; Johnson, Sandra; Mengersen, Kerrie
2014-01-01
Expert knowledge is a valuable source of information with a wide range of research applications. Despite the recent advances in defining expert knowledge, little attention has been given to how to view expertise as a system of interacting contributory factors for quantifying an individual's expertise. We present a systems approach to expertise that accounts for many contributing factors and their inter-relationships and allows quantification of an individual's expertise. A Bayesian network (BN) was chosen for this purpose. For illustration, we focused on taxonomic expertise. The model structure was developed in consultation with taxonomists. The relative importance of the factors within the network was determined by a second set of taxonomists (supra-experts) who also provided validation of the model structure. Model performance was assessed by applying the model to hypothetical career states of taxonomists designed to incorporate known differences in career states for model testing. The resulting BN model consisted of 18 primary nodes feeding through one to three higher-order nodes before converging on the target node (Taxonomic Expert). There was strong consistency among node weights provided by the supra-experts for some nodes, but not others. The higher-order nodes, “Quality of work” and “Total productivity”, had the greatest weights. Sensitivity analysis indicated that although some factors had stronger influence in the outer nodes of the network, there was relatively equal influence of the factors leading directly into the target node. Despite the differences in the node weights provided by our supra-experts, there was good agreement among assessments of our hypothetical experts that accurately reflected differences we had specified. This systems approach provides a way of assessing the overall level of expertise of individuals, accounting for multiple contributory factors, and their interactions. Our approach is adaptable to other situations where it
COMPETENCE APPROACH TO TRAINING OF EXPERTS IN RADIATION HYGIENE
Directory of Open Access Journals (Sweden)
T. B. Baltrukova
2015-01-01
Full Text Available Modification of attitude to labor in the society, in professional communities and among people is necessary for further development of society and national economy. This goal may be achieved if the system of professional training is modified: switched to competence approach which should include training of experts, including those in radiation hygiene, with a set of general cultural and professional competences. The system of future experts training should be based on traditions of domestic and international education; it should use modern forms of active and interactive education (computer simulations, business games and role-playing, analysis of concrete situations, portfolio, psychological and other trainings, remote education, etc. It should consider actuality of knowledge and skills and develop independence and responsibility that will enable the young expert to be competitive at the modern labor market and to meet employers’ expectations. Under the new federal educational standard on radiation hygiene accepted in 2014 at present primary specialization in radiation hygiene takes place in internship. At training of experts the new standard provides great use of on-the-job training, independent work, scientific and practical work. Employers should play an important role in training of experts.
Does expert perceptual anticipation transfer to a dissimilar domain?
Müller, Sean; McLaren, Michelle; Appleby, Brendyn; Rosalie, Simon M
2015-06-01
The purpose of this experiment was to extend theoretical understanding of transfer of learning by investigating whether expert perceptual anticipation skill transfers to a dissimilar domain. The capability of expert and near-expert rugby players as well as novices to anticipate skill type within rugby (learning sport) was first examined using a temporal occlusion paradigm. Participants watched video footage of an opponent performing rugby skill types that were temporally occluded at different points in the opponent's action and then made a written prediction. Thereafter, the capability of participants to transfer their anticipation skill to predict pitch type in baseball (transfer sport) was examined. Participants watched video footage of a pitcher throwing different pitch types that were temporally occluded and made a written prediction. Results indicated that expert and near-expert rugby players anticipated significantly better than novices across all occlusion conditions. However, none of the skill groups were able to transfer anticipation skill to predict pitch type in baseball. The findings of this paper, along with existing literature, support the theoretical prediction that transfer of perceptual anticipation is expertise dependent and restricted to similar domains. (c) 2015 APA, all rights reserved).
Considerations in development of expert systems for real-time space applications
Murugesan, S.
1988-01-01
Over the years, demand on space systems has increased tremendously and this trend will continue for the near future. Enhanced capabilities of space systems, however, can only be met with increased complexity and sophistication of onboard and ground systems. Artificial Intelligence and expert system techniques have great potential in space applications. Expert systems could facilitate autonomous decision making, improve in-orbit fault diagnosis and repair, enhance performance and reduce reliance on ground support. However, real-time expert systems, unlike conventional off-line consultative systems, have to satisfy certain special stringent requirements before they could be used for onboard space applications. Challenging and interesting new environments are faced while developing expert system space applications. This paper discusses the special characteristics, requirements and typical life cycle issues for onboard expert systems. Further, it also describes considerations in design, development, and implementation which are particularly important to real-time expert systems for space applications.
AN EXPERT SYSTEM FOR SUPPORTING THE PRODUCTION OF PLEASURE BOATS
Directory of Open Access Journals (Sweden)
Tomasz GONCIARZ
2013-07-01
Full Text Available Expert systems can be defined as computer programs, whose main task is to simulate a human expert, usually in a narrow field of expertise. Possible applications of modern information technology are very extensive, ranging from medicine, geology and technology to applications in the field of economic and financial decision support. The purpose of this paper is to present the practical application of an expert system that supports the process of managing the production of yachts and has a high suitability for use in this application. Using the expert system described in the paper reduces the time during the design and production preparation process.
Building reactor operator sustain expert system with C language integrated production system
International Nuclear Information System (INIS)
Ouyang Qin; Hu Shouyin; Wang Ruipian
2002-01-01
The development of the reactor operator sustain expert system is introduced, the capability of building reactor operator sustain expert system is discussed with C Language Integrated Production System (Clips), and a simple antitype of expert system is illustrated. The limitation of building reactor operator sustain expert system with Clips is also discussed
Quality dependent fusion of intramodal and multimodal biometric experts
Kittler, J.; Poh, N.; Fatukasi, O.; Messer, K.; Kryszczuk, K.; Richiardi, J.; Drygajlo, A.
2007-04-01
We address the problem of score level fusion of intramodal and multimodal experts in the context of biometric identity verification. We investigate the merits of confidence based weighting of component experts. In contrast to the conventional approach where confidence values are derived from scores, we use instead raw measures of biometric data quality to control the influence of each expert on the final fused score. We show that quality based fusion gives better performance than quality free fusion. The use of quality weighted scores as features in the definition of the fusion functions leads to further improvements. We demonstrate that the achievable performance gain is also affected by the choice of fusion architecture. The evaluation of the proposed methodology involves 6 face and one speech verification experts. It is carried out on the XM2VTS data base.
Knowledge Representation Using Multilevel Flow Model in Expert System
International Nuclear Information System (INIS)
Wang, Wenlin; Yang, Ming
2015-01-01
As for the knowledge representation, of course, there are a great many methods available for knowledge representation. These include frames, causal models, and many others. This paper presents a novel method called Multilevel Flow Model (MFM), which is used for knowledge representation in G2 expert system. Knowledge representation plays a vital role in constructing knowledge bases. Moreover, it also has impact on building of generic fault model as well as knowledge bases. The MFM is particularly useful to describe system knowledge concisely as domain map in expert system when domain experts are not available
Expert system for nuclear power plant feedwater system diagnosis
International Nuclear Information System (INIS)
Meguro, R.; Kinoshita, Y.; Sato, T.; Yokota, Y.; Yokota, M.
1987-01-01
The Expert System for Nuclear Power Plant Feedwater System Diagnosis has been developed to assist maintenance engineers in nuclear power plants. This system adopts the latest process computer TOSBAC G8050 and the expert system developing tool TDES2, and has a large scale knowledge base which consists of the expert knowledge and experience of engineers in many fields. The man-machine system, which has been developed exclusively for diagnosis, improves the man-machine interface and realizes the graphic displays of diagnostic process and path, stores diagnostic results and searches past reference
A Belief Rule-Based Expert System to Diagnose Influenza
DEFF Research Database (Denmark)
Hossain, Mohammad Shahadat; Khalid, Md. Saifuddin; Akter, Shamima
2014-01-01
, development and application of an expert system to diagnose influenza under uncertainty. The recently developed generic belief rule-based inference methodology by using the evidential reasoning (RIMER) approach is employed to develop this expert system, termed as Belief Rule Based Expert System (BRBES......). The RIMER approach can handle different types of uncertainties, both in knowledge representation, and in inference procedures. The knowledge-base of this system was constructed by using records of the real patient data along with in consultation with the Influenza specialists of Bangladesh. Practical case...
Knowledge Representation Using Multilevel Flow Model in Expert System
Energy Technology Data Exchange (ETDEWEB)
Wang, Wenlin; Yang, Ming [Harbin Engineering University, Harbin (China)
2015-05-15
As for the knowledge representation, of course, there are a great many methods available for knowledge representation. These include frames, causal models, and many others. This paper presents a novel method called Multilevel Flow Model (MFM), which is used for knowledge representation in G2 expert system. Knowledge representation plays a vital role in constructing knowledge bases. Moreover, it also has impact on building of generic fault model as well as knowledge bases. The MFM is particularly useful to describe system knowledge concisely as domain map in expert system when domain experts are not available.
Component aging evaluation with expert systems
International Nuclear Information System (INIS)
Wiesemann, J.S.; Maguire, H.T. Jr.
1988-01-01
The age degradation of components involves a complex relationship between a variety of variables. These relationships are typically modeled using probabilistic and deterministic analyses. These methods depend upon a formal understanding of the underlying degradation mechanisms and a database of experience which allows statistical analyses to extract numerical trends. At present, not all age degradation mechanisms are adequately modeled and available data for age degradation is in most cases insufficient. In addition, these methods tend to focus upon answers to isolated questions (e.g., What is the component failure rate?) rather than the more pertinent questions concerning operations and maintenance (e.g., should the component be replaced at the next outage). Fortunately, knowledge in the form of personal experience does exist which allows plant personnel to make decisions concerning operations and maintenance. This knowledge can be modeled using expert systems. This paper discusses CAGES (Component Aging Expert System). It combines expert rules (heuristics), probabilistic models, and deterministic models to make evaluations of component aging; predict the implications for component life extension, operational readiness, maintenance effectiveness, and safety, and make recommendations for maintenance and operation
Expert judgement combination using moment methods
International Nuclear Information System (INIS)
Wisse, Bram; Bedford, Tim; Quigley, John
2008-01-01
Moment methods have been employed in decision analysis, partly to avoid the computational burden that decision models involving continuous probability distributions can suffer from. In the Bayes linear (BL) methodology prior judgements about uncertain quantities are specified using expectation (rather than probability) as the fundamental notion. BL provides a strong foundation for moment methods, rooted in work of De Finetti and Goldstein. The main objective of this paper is to discuss in what way expert assessments of moments can be combined, in a non-Bayesian way, to construct a prior assessment. We show that the linear pool can be justified in an analogous but technically different way to linear pools for probability assessments, and that this linear pool has a very convenient property: a linear pool of experts' assessments of moments is coherent if each of the experts has given coherent assessments. To determine the weights of the linear pool we give a method of performance based weighting analogous to Cooke's classical model and explore its properties. Finally, we compare its performance with the classical model on data gathered in applications of the classical model
Domestic violence: the role of the mental health expert.
Packer, I K
1990-01-01
Mental health experts are often called upon to testify in trials of battered woman who have killed their husbands. Such experts have an important role to play in educating both the public and the legal profession about the Battered Woman Syndrome.
Expert Systems: An Introduction -46 ...
Indian Academy of Sciences (India)
Research Scientist in the. Knowledge Based. Computer Systems Group at NeST. He is one of the ... Expert systems encode human expertise in limited domains ... answers questions the user has and provides an explanation of its reasoning.
A Study on Satellite Diagnostic Expert Systems Using Case-Based Approach
Directory of Open Access Journals (Sweden)
Young-Tack Park
1997-06-01
Full Text Available Many research works are on going to monitor and diagnose diverse malfunctions of satellite systems as the complexity and number of satellites increase. Currently, many works on monitoring and diagnosis are carried out by human experts but there are needs to automate much of the routine works of them. Hence, it is necessary to study on using expert systems which can assist human experts routine work by doing automatically, thereby allow human experts devote their expertise more critical and important areas of monitoring and diagnosis. In this paper, we are employing artificial intelligence techniques to model human experts' knowledge and inference the constructed knowledge. Especially, case-based approaches are used to construct a knowledge base to model human expert capabilities which use previous typical exemplars. We have designed and implemented a prototype case-based system for diagnosing satellite malfunctions using cases. Our system remembers typical failure cases and diagnoses a current malfunction by indexing the case base. Diverse methods are used to build a more user friendly interface which allows human experts can build a knowledge base in as easy way.
Operation and maintenance support expert systems for BWR nuclear power plants
International Nuclear Information System (INIS)
Miyazawa, Tatsuo; Hayakawa, Hiroyasu; Fukutomi, Shigeki
1990-01-01
Toshiba has been developing expert systems for operation and maintenance support in BWRs. These expert systems are designed to be integrated with conventional plant monitoring systems, and maintenance management systems to provide both comprehensive and powerful support capabilities. Some of these expert systems are already being used on a trial basis both within Toshiba and in electric power utility companies. This paper describes expert systems for the support of plant and equipment monitoring, maintenance scheduling, and maintenance work procedure planning. (author)
Adaptive capture of expert knowledge
Energy Technology Data Exchange (ETDEWEB)
Barrett, C.L.; Jones, R.D. [Los Alamos National Lab., NM (United States); Hand, Un Kyong [Los Alamos National Lab., NM (United States)]|[US Navy (United States)
1995-05-01
A method is introduced that can directly acquire knowledge-engineered, rule-based logic in an adaptive network. This adaptive representation of the rule system can then replace the rule system in simulated intelligent agents and thereby permit further performance-based adaptation of the rule system. The approach described provides both weight-fitting network adaptation and potentially powerful rule mutation and selection mechanisms. Nonlinear terms are generated implicitly in the mutation process through the emergent interaction of multiple linear terms. By this method it is possible to acquire nonlinear relations that exist in the training data without addition of hidden layers or imposition of explicit nonlinear terms in the network. We smoothed and captured a set of expert rules with an adaptive network. The motivation for this was to (1) realize a speed advantage over traditional rule-based simulations; (2) have variability in the intelligent objects not possible by rule-based systems but provided by adaptive systems: and (3) maintain the understandability of rule-based simulations. A set of binary rules was smoothed and converted into a simple set of arithmetic statements, where continuous, non-binary rules are permitted. A neural network, called the expert network, was developed to capture this rule set, which it was able to do with zero error. The expert network is also capable of learning a nonmonotonic term without a hidden layer. The trained network in feedforward operation is fast running, compact, and traceable to the rule base.
Experts and novices use the same factors--but differently--to evaluate pearl quality.
Directory of Open Access Journals (Sweden)
Yusuke Tani
Full Text Available Well-trained experts in pearl grading have been thought to evaluate pearls according to their glossiness, interference color, and shape. However, the characteristics of their evaluations are not fully understood. Using pearl grading experiments, we investigate the consistency of novice (i.e., without knowledge of pearl grading and expert participants' pearl grading skill and then compare the novices' grading with that of experts; furthermore, we discuss the relationship between grading, interference color, and glossiness. We found that novices' grading was significantly less concordant with experts average grading than was experts' grading; more than half of novices graded pearls the opposite of how experts graded those same pearls. However, while experts graded pearls more consistently than novices did, novices' consistency was relatively high. We also found differences between the groups in regression analyses that used interference color and glossiness as explanatory variables and were conducted for each trial. Although the regression coefficient was significant in 60% of novices' trials, there were fewer significant trials for the experts (20%. This indicates that novices can also make use of these two factors, but that their usage is simpler than that of the experts. These results suggest that experts and novices share some values about pearls but that the evaluation method is elaborated for experts.
Science Communication in the Post-Expert Digital Age
Luers, A.
2014-12-01
The digital age has given rise to a post-expert world, which is poses challenges for science communication. Mass communication is shifting from a "broadcast" to "conversation" model, while audiences increasingly are finding information with search tools that create personalized filters showing only news they want to see. Such changes dilute expert voices and strengthen insular "tribal" discourse. We argue that these changes in communication pose particular challenges for science communication around politically charged issues such as climate change, because they create mini-echo chambers that can feed cultural wars. To overcome these challenges the scientific community must rethink how we engage the public. In the post-expert world, we need to shift our mindset from reporting the facts to joining diverse conversations.
Anticipation and visual search behaviour in expert soccer goalkeepers
Savelsbergh, G.J.P.; van der Kamp, J.; Williams, A.M.; Ward, P.
2005-01-01
A novel methodological approach is presented to examine the visual search behaviours employed by expert goalkeepers during simulated penalty kick situations in soccer. Expert soccer goalkeepers were classified as successful or unsuccessful based on their performance on a film-based test of
Combining SKU-level sales forecasts from models and experts
Ph.H.B.F. Franses (Philip Hans); R. Legerstee (Rianne)
2009-01-01
textabstractWe study the performance of SKU-level sales forecasts which linearly combine statistical model forecasts and expert forecasts. Using a large and unique database containing model forecasts for monthly sales of various pharmaceutical products and forecasts given by about fifty experts, we
Supporting experts to handle tweet collections about significant events
Hürriyetoglu, Ali; Oostdijk, Nelleke; Basar, Erkan; van den Bosch, A.; Frasincar, F.; Ittoo, A.; Nguyen, L.; Metais, E.
2017-01-01
We introduce Relevancer that processes a tweet set and enables generating an automatic classifier from it. Relevancer satisfies information needs of experts during significant events. Enabling experts to combine automatic procedures with expertise is the main contribution of our approach and the
Experts' Views Regarding the Conceptualization of Narcissism.
Ackerman, Robert A; Hands, Aaron J; Donnellan, M Brent; Hopwood, Christopher J; Witt, Edward A
2017-06-01
There is debate over the definition of narcissism across social/personality and clinical psychology. The current article aims to quantify the level of disagreement by measuring experts' opinions concerning the attributes most central to narcissism. Accordingly, we developed a comprehensive list of attributes associated with narcissism and had 49 self-identified experts (among them 17 women, 23 psychologists from clinical psychology and 22 from social/personality psychology) rate these characteristics and provide their opinions on several issues related to the conceptualization of narcissism. Experts generally believe that the grandiose features of narcissism are more central than the vulnerable features. However, differences between clinical and social/personality psychologists were evident, especially regarding the relevance of self-esteem. Given the results, we suggest that researchers specify the kind of narcissism being assessed in a given study and consider using assessments of the full range of narcissistic features in future research to provide a more comprehensive perspective on the construct.
Gupta, N.; Fischer, A.R.H.; George, S.; Frewer, L.J.
2013-01-01
The introduction of different applications of nanotechnology will be informed by expert views regarding which (types of) application will be most societally acceptable. Previous research in Northern Europe has indicated that experts believe that various factors will be influential, predominant among
An expert panel approach to support risk-informed decision making
International Nuclear Information System (INIS)
Pulkkinen, U.; Simola, K.
2000-01-01
The report describes the expert panel methodology developed for supporting risk-informed decision making. The aim of an expert panel is to achieve a balanced utilisation of information and expertise from several disciplines in decision-making including probabilistic safety assessment as one decision criterion. We also summarise the application of the methodology in the STUK's RI-ISI (Risk-Informed In-Service Inspection) pilot study, where the expert panel approach was used to combine the deterministic information on degradation mechanisms and probabilistic information on pipe break consequences. The expert panel served both as a critical review of the preliminary results and as a decision support for the final definition of risk categories of piping. (orig.)
An expert system for improving nuclear emergency response
International Nuclear Information System (INIS)
Salame-Alfie, A.; Goldbogen, G.C.; Ryan, R.M.; Wallace, W.A.; Yeater, M.L.
1987-01-01
The accidents at TMI-2 and Chernobyl have produced initiatives aimed at improving nuclear plant emergency response capabilities. Among them are the development of emergency response facilities with capabilities for the acquisition, processing, and diagnosis of data which are needed to help coordinate plant operations, engineering support and management under emergency conditions. An effort in this direction prompted the development of an expert system. EP (EMERGENCY PLANNER) is a prototype expert system that is intended to help coordinate the overall management during emergency conditions. The EP system was built using the GEN-X expert system shell. GEN-X has a variety of knowledge representation mechanisms including AND/OR trees, Decision trees, and IF/THEN tables, and runs on an IBM PC-XT or AT computer or compatible. Among the main features, EP is portable, modular, user friendly, can interact with external programs and interrogate data bases. The knowledge base is made of New York State (NYS) Procedures for Emergency Classification, NYS Radiological Emergency Preparedness Plan (REPP) and knowledge from experts of the NYS Radiological Emergency Preparedness Group and the Office of Radiological Health and Chemistry of the New York Power Authority (NYPA)
Introducing Managers to Expert Systems.
Finlay, Paul N.; And Others
1991-01-01
Describes a short course to expose managers to expert systems, consisting of (1) introductory lecture; (2) supervised computer tutorial; (3) lecture and discussion about knowledge structuring and modeling; and (4) small group work on a case study using computers. (SK)
A Fuzzy Rule-Based Expert System for Evaluating Intellectual Capital
Directory of Open Access Journals (Sweden)
Mohammad Hossein Fazel Zarandi
2012-01-01
Full Text Available A fuzzy rule-based expert system is developed for evaluating intellectual capital. A fuzzy linguistic approach assists managers to understand and evaluate the level of each intellectual capital item. The proposed fuzzy rule-based expert system applies fuzzy linguistic variables to express the level of qualitative evaluation and criteria of experts. Feasibility of the proposed model is demonstrated by the result of intellectual capital performance evaluation for a sample company.
THE COPYRIGHT ON THE INTELLECTUAL PROPERTY EXPERT REPORT. CONSEQUENCES
Directory of Open Access Journals (Sweden)
Raul Sorin Fântână
2013-11-01
Full Text Available Currently, according to the law, the expert is treated as a witness, and the expertise - presented as a report - is treated as a work implemented in support of justice only. Referring to the intellectual property, an expert report is often a research work with pronounced character of investigation. According to the copyright law, such a unique work should be cited even in the court device resolution, scientifically commented, as bibliographical source. The immediate consequence in support of the act of justice is that, unlike the jurisprudence - which in many countries is not a source of law, having an informative character only, a written report - especially the technical work – cannot be commented by any court. Evaluated as technical work, an expert report on the one hand should be treated as such - cited - by the courts of law and on the other hand implemented according to the rules imposed in the scientific works: documented, with a minimum number of references to and quotations from serious sources, including previous expert reports from completed files. We think that such an approach of the expert report would lead to a significant improvement of the justice act at least in Business Law.
Football experts versus sports economists: Whose forecasts are better?
Frick, Bernd; Wicker, Pamela
2016-08-01
Given the uncertainty of outcome in sport, predicting the outcome of sporting contests is a major topic in sport sciences. This study examines the accuracy of expert predictions in the German Bundesliga and compares their predictions to those of sports economists. Prior to the start of each season, a set of distinguished experts (head coaches and players) express their subjective evaluations of the teams in school grades. While experts may be driven by irrational sentiments and may therefore systematically over- or underestimate specific teams, sports economists use observable characteristics to predict season outcomes. The latter typically use team wage bills given the positive pay-performance relationship as well as other factors (average team age, tenure, appearances on national team, and attendance). Using data from 15 consecutive Bundesliga seasons, the predictive accuracy of expert evaluations and sports economists is analysed. The results of separate estimations show that relative grade and relative wage bill significantly affect relative points, while age, tenure, appearances, and attendance are insignificant. In a joint model, relative grade and relative wage bill are still statistically significant, suggesting that the two types of predictions are complements rather than substitutes. Consequently, football experts and sports economists seem to rely on completely different sources of information when making their predictions.
Aerodynamics of the EXPERT Re-Entry Ballistic Vehicle
Kharitonov, A. M.; Adamov, N. P.; Mazhul, I. I.; Vasenyov, L. G.; Zvegintsev, V. I.; Muylaert, J. M.
2009-01-01
Since 2002 till now, experimental studies of the EXPERT reentry capsule have been performed in ITAM SB RAS wind tunnels. These studies have been performed in consecutive ISTC project No. 2109, 3151, and currently ongoing project No. 3550. The results of earlier studies in ITAM wind tunnels can be found in [1-4]. The present paper describes new data obtained for the EXPERT model.
Instructional Design Thought Processes of Expert Nurse Educators
Gross, Monty Dale
2006-01-01
This study explores how expert nurse educators design instruction. Six female expert nurse educators volunteered to participate. Each participant had over ten years experience teaching, and all were recognized for their teaching excellence. They also had master's or doctoral degrees. Participants worked in small private schools, community colleges, or large public universities. The methodology was based in developmental research. Qualitative data sources included interviews, think-aloud proto...
Experts and equipment: The IAEA programme in 1965
International Nuclear Information System (INIS)
1965-01-01
Nearly 100 projects are being assisted by Agency experts and equipment in 38 countries under the 1965 programme to be financed from Agency funds, which the Board of Governors approved at its meeting in February, together with four other countries where projects previously approved extend into 1965. In addition, further work is being financed under the UN Expanded Programme of Technical Assistance, including several important regional projects. Under the Agency's long-term programme, it is desirable that all types of technical assistance, whether training, research, or expert advice, should be combined as far as possible. Each country will therefore be asked, in respect of its 1966 programme, to make its requests for experts, equipment, fellowships, scientific visits and research grants as a single submission. The Agency then prepares a country programme of technical assistance, in collaboration with the Government. The number of requests for experts and equipment continues to grow year by year, and it has not been possible to finance them all. This increase is largely because a number of Member States have now set up research reactors and established a nucleus of laboratories under bilateral arrangements; they then turn to the Agency for assistance in developing their programmes. The estimated cost of experts and equipment being provided from Agency resources is $874 000 in 1965, of which $596 800 is for experts, and $277 200 is for equipment and supplies. The Agency also assists some Member States in making arrangements to receive technical assistance directly from other Member States. The work covers a wide range, with isotopes predominating; about 30 projects deal with production of isotopes, their applications in medicine, agriculture and hydrology, in food preservation and industry. A number of projects are concerned with various aspects of reactor construction and use; others deal with health and safety, instrumentation, special branches of chemistry and
Employing expert systems for process control
International Nuclear Information System (INIS)
Ahrens, W.
1987-01-01
The characteristic features of expert systems are explained in detail, and the systems' application in process control engineering. Four points of main interest are there, namely: Applications for diagnostic tasks, for safety analyses, planning, and training and expert training. For the modelling of the technical systems involved in all four task fields mentioned above, an object-centred approach has shown to be the suitable method, as process control techniques are determined by technical objects that in principle are specified by data sheets, schematic representations, flow charts, and plans. The graphical surface allows these data to be taken into account, so that the object can be displayed in the way best suited to the individual purposes. (orig./GL) [de
Zhang, Jing; Wang, Yang; Zhou, Ye; He, Qing-Yu
2017-10-31
Colorectal carcinoma (CRC) remains one of the leading causes of death in cancer-related diseases. In this study, we aimed to investigate the anticancer effect of Jolkinolide B (JB), a bioactive diterpenoid component isolated from the dried roots of Euphorbia fischeriana Steud, on CRC cells and its underlying mechanisms. We found that JB suppressed the cell viability and colony formation of CRC cells, HT29 and SW620. Annexin V/PI assay revealed that JB induced apoptosis in CRC cells, which was further confirmed by the increased expression of cleaved-caspase3 and cleaved-PARP. iTRAQ-based quantitative proteomics was performed to identify JB-regulated proteins in CRC cells. Gene Ontology (GO) analysis revealed that these JB-regulated proteins were mainly involved in ER stress response, which was evidenced by the expression of ER stress marker proteins, HSP90, Bip and PDI. Moreover, we found that JB provoked the generation of reactive oxygen species (ROS), and that inhibition of the ROS generation with N-acetyl L-cysteine could reverse the JB-induced apoptosis. Confocal microscopy and flow cytometry showed that JB treatment enhanced intracellular and mitochondrial Ca 2+ level and JC-1 assay revealed a loss of mitochondrial membrane potential in CRC after JB treatment. The mitochondrial Ca 2+ uptake and depolarization can be blocked by Ruthenium Red (RuRed), an inhibitor of mitochondrial Ca 2+ uniporter. Taken together, we demonstrated that JB exerts its anticancer effect by ER stress-Ca 2+ -mitochondria signaling, suggesting the promising chemotherapeutic potential of JB for the treatment of CRC.
The use of Fuzzy expert system in robots decision-making
International Nuclear Information System (INIS)
Jamaseb, Mehdi; Jafari, Shahram; Montaseri, Farshid; Dadgar, Masoud
2014-01-01
The main issue that is investigated in this paper, is a method for decision making of mobile robots in different conditions for this purpose, we have used expert system. In this way, that the conditions of the robot are analyzed by on expert person a special issue (like following a ball) using knowledge base and suitable decisions will be mode. Then, using this information fuzzy rules well be built, and using its rules, robots decisions can be implemented like an expert person. In this study, we have used delta3d base for implementing expert systems and CLIPS and also we have used NAO for simulation rcssserver3d robot and 3d football simulation have been used for implementing operation program
Using hybrid expert system approaches for engineering applications
Allen, R. H.; Boarnet, M. G.; Culbert, C. J.; Savely, R. T.
1987-01-01
In this paper, the use of hybrid expert system shells and hybrid (i.e., algorithmic and heuristic) approaches for solving engineering problems is reported. Aspects of various engineering problem domains are reviewed for a number of examples with specific applications made to recently developed prototype expert systems. Based on this prototyping experience, critical evaluations of and comparisons between commercially available tools, and some research tools, in the United States and Australia, and their underlying problem-solving paradigms are made. Characteristics of the implementation tool and the engineering domain are compared and practical software engineering issues are discussed with respect to hybrid tools and approaches. Finally, guidelines are offered with the hope that expert system development will be less time consuming, more effective, and more cost-effective than it has been in the past.
Expert Systems: An Introduction -46 ...
Indian Academy of Sciences (India)
C++, and Microsoft C/C++ compilers. The personal edition is licensed for educational, research, and hobby use. Applications created with RT -Expert personal edition are not licensed for commercial purposes. Professional editions are available for commercial applications using DOS, Windows, and. Unix environments.
A Web-Based Rice Plant Expert System Using Rule-Based Reasoning
Directory of Open Access Journals (Sweden)
Anton Setiawan Honggowibowo
2009-12-01
Full Text Available Rice plants can be attacked by various kinds of diseases which are possible to be determined from their symptoms. However, it is to recognize that to find out the exact type of disease, an agricultural expert’s opinion is needed, meanwhile the numbers of agricultural experts are limited and there are too many problems to be solved at the same time. This makes a system with a capability as an expert is required. This system must contain the knowledge of the diseases and symptom of rice plants as an agricultural expert has to have. This research designs a web-based expert system using rule-based reasoning. The rule are modified from the method of forward chaining inference and backward chaining in order to to help farmers in the rice plant disease diagnosis. The web-based rice plants disease diagnosis expert system has the advantages to access and use easily. With web-based features inside, it is expected that the farmer can accesse the expert system everywhere to overcome the problem to diagnose rice diseases.
Comparison expert and novice scan behavior for using e-learning
Novita Sari, Felisia; Insap Santosa, Paulus; Wibirama, Sunu
2017-06-01
E-Learning is an important media that an educational institution must have. Successful information design for e-learning depends on its user's characteristics. This study explores differences between novice and expert users' eye movement data. This differences between expert and novice users were compared and identified based on gaze features. Each participant must do three main tasks of e-learning. This paper gives the result that there are differences between gaze features of experts and novices.
The Effect of Customer Empowerment on Adherence to Expert Advice
Camacho, Nuno; Jong, Martijn; Stremersch, Stefan
2014-01-01
textabstractCustomers often receive expert advice related to their health, finances, taxes or legal procedures, to name just a few. A noble stance taken by some is that experts should empower customers to make their own decisions. In this article, we distinguish informational from decisional empowerment and study whether empowerment leads customers to adhere more or less to expert advice. We empirically test our model using a unique dataset involving 11,735 respondents in 17 countries on four...
Distributed expert systems for nuclear reactor control
International Nuclear Information System (INIS)
Otaduy, P.J.
1992-01-01
A network of distributed expert systems is the heart of a prototype supervisory control architecture developed at the Oak Ridge National Laboratory (ORNL) for an advanced multimodular reactor. Eight expert systems encode knowledge on signal acquisition, diagnostics, safeguards, and control strategies in a hybrid rule-based, multiprocessing and object-oriented distributed computing environment. An interactive simulation of a power block consisting of three reactors and one turbine provides a realistic, testbed for performance analysis of the integrated control system in real-time. Implementation details and representative reactor transients are discussed
Expert-systems and computer-based industrial systems
International Nuclear Information System (INIS)
Terrien, J.F.
1987-01-01
Framatome makes wide use of expert systems, computer-assisted engineering, production management and personnel training. It has set up separate business units and subsidiaries and also participates in other companies which have the relevant expertise. Five examples of the products and services available in these are discussed. These are in the field of applied artificial intelligence and expert-systems, in integrated computer-aid design and engineering, structural analysis, computer-related products and services and document management systems. The structure of the companies involved and the work they are doing is discussed. (UK)
Expert System Software Assistant for Payload Operations
Rogers, Mark N.
1997-01-01
The broad objective of this expert system software based application was to demonstrate the enhancements and cost savings that can be achieved through expert system software utilization in a spacecraft ground control center. Spacelab provided a valuable proving ground for this advanced software technology; a technology that will be exploited and expanded for future ISS operations. Our specific focus was on demonstrating payload cadre command and control efficiency improvements through the use of "smart" software which monitors flight telemetry, provides enhanced schematic-based data visualization, and performs advanced engineering data analysis.
Subject Matter Expert Workshop to Identify Cybersecurity ...
Report In recognition of the growing need to better address cyber risk and cyber management, the U.S. Environmental Protection Agency’s (EPA) National Homeland Security Research Center (NHSRC) held a Subject Matter Expert Workshop to Identify Cybersecurity Research Gaps and Needs of the Nation’s Water and Wastewater Systems Sector on March 30th and 31st, 2016, at the Ronald Reagan Building in Washington, D.C. The workshop was designed to create a forum for subject matter experts (SMEs) to exchange ideas and address important cybersecurity challenges facing the water sector.
International Nuclear Information System (INIS)
Son, Young-Ok; Hitron, J. Andrew; Wang Xin; Chang Qingshan; Pan Jingju; Zhang Zhuo; Liu Jiankang; Wang Shuxia; Lee, Jeong-Chae; Shi Xianglin
2010-01-01
Cr(VI) compounds are known to cause serious toxic and carcinogenic effects. Cr(VI) exposure can lead to a severe damage to the skin, but the mechanisms involved in the Cr(VI)-mediated toxicity in the skin are unclear. The present study examined whether Cr(VI) induces cell death by apoptosis or necrosis using mouse skin epidermal cell line, JB6 Cl41 cells. We also investigated the cellular mechanisms of Cr(VI)-induced cell death. This study showed that Cr(VI) induced apoptotic cell death in a dose-dependent manner, as demonstrated by the appearance of cell shrinkage, the migration of cells into the sub-G1 phase, the increase of Annexin V positively stained cells, and the formation of nuclear DNA ladders. Cr(VI) treatment resulted in the increases of mitochondrial membrane depolarization and caspases activation. Electron spin resonance (ESR) and fluorescence analysis revealed that Cr(VI) increased intracellular levels of reactive oxygen species (ROS) such as hydrogen peroxide and superoxide anion radical in dose-dependent manner. Blockage of p53 by si-RNA transfection suppressed mitochondrial changes of Bcl-2 family composition, mitochondrial membrane depolarization, caspase activation and PARP cleavage, leading to the inhibition of Cr(VI)-induced apoptosis. Further, catalase treatment prevented p53 phosphorylation stimulated by Cr(VI) with the concomitant inhibition of caspase activation. These results suggest that Cr(VI) induced a mitochondrial-mediated and caspase-dependent apoptosis in skin epidermal cells through activation of p53, which are mainly mediated by reactive oxidants generated by the chemical.
Solving Accounting Problems: Differences between Accounting Experts and Novices.
Marshall, P. Douglas
2002-01-01
Performance of 90 accounting experts (faculty and practitioners) and 60 novices (senior accounting majors) was compared. Experts applied more accounting principles to solving problems. There were no differences in types of principles applied and no correlation between (1) principles applied and number of breadth comments or (2) importance placed…
Artificial Experts: The Computer as Diagnostician Has Definite Limits.
Pournelle, Jerry
1984-01-01
Argues that, although expert systems--which are supposed to give users all the advantages of consulting with human experts--can be useful for medical diagnosis, where tests tend to be reliable, they can be hazardous in such areas as psychological testing, where test reliability is difficult to measure. (MBR)
The development of an expert system for arid rangeland ...
African Journals Online (AJOL)
Currently, the expert system uses wiki technology, as this allows a high level of interaction between user and administrator. The expert system includes embedded links to photographs and additional information. It allows easy updating of the knowledge base. An additional booklet was also developed, since access to ...
Curricula for Media Literacy Education According to International Experts
Fedorov, Alexander; Levitskaya, Anastasia; Camarero, Emma
2016-01-01
The article analyzes the results of the international experts' survey regarding the curriculum of media literacy education, which was administrated by the authors in September-October 2015. The expert panel includes specialists actively involved in the real process of media literacy education in schools, universities and other educational…
Expert Systems the Old Fashioned Way: Person to Person.
McCleary, Hunter; Mayer, William J.
1988-01-01
Describes the services of Teltech, Inc., which mimic the desirable attributes of artificial intelligence and expert systems via a "database" of 5,000 experts in technical areas and interactive literature searches executed by staff. Advantages and shortcomings of the network are exemplified by sample searches. Several sample menus and…
Expert system verification and validation for nuclear power industry applications
International Nuclear Information System (INIS)
Naser, J.A.
1990-01-01
The potential for the use of expert systems in the nuclear power industry is widely recognized. The benefits of such systems include consistency of reasoning during off-normal situations when humans are under great stress, the reduction of times required to perform certain functions, the prevention of equipment failures through predictive diagnostics, and the retention of human expertise in performing specialized functions. The increased use of expert systems brings with it concerns about their reliability. Difficulties arising from software problems can affect plant safety, reliability, and availability. A joint project between EPRI and the US Nuclear Regulatory Commission is being initiated to develop a methodology for verification and validation of expert systems for nuclear power applications. This methodology will be tested on existing and developing expert systems. This effort will explore the applicability of conventional verification and validation methodologies to expert systems. The major area of concern will be certification of the knowledge base. This is expected to require new types of verification and validation techniques. A methodology for developing validation scenarios will also be studied
Lawley, Russell; Barron, Mark; Lee, Katy
2014-05-01
Uncertainty in geological linework: communicating the expert's tacit model to the data user(s) by expert elicitation. R. Lawley, M. Barron and K. Lee. NERC - British Geological Survey, Environmental Science Centre, Keyworth, Nottingham, UK, NG12 5GG The boundaries mapped in traditional field geological survey are subject to a wide range of inherent uncertainties. A map at a survey-scale of 1:10,000 is created by a combination of terrain interpretation, direct observations from boreholes and exposures (often sparsely distributed), and indirect interpretation of proxy variables such as soil properties, vegetation and remotely sensed images. A critical factor influencing the quality of the final map is the skill and experience of the surveyor to bring this information together in a coherent conceptual model. The users of geological data comprising or based on mapped boundaries are increasingly aware of these uncertainties, and want to know how to manage them. The growth of 3D modelling, which takes 2D surveys as a starting point, adds urgency to the need for a better understanding of survey uncertainties; particularly where 2D mapping of variable vintage has been compiled into a national coverage. Previous attempts to apply confidence on the basis of metrics such as data density, survey age or survey techniques have proved useful for isolating single, critical, factors but do not generally succeed in evaluating geological mapping 'in the round', because they cannot account for the 'conceptual' skill set of the surveyor. The British Geological Survey (BGS) is using expert elicitation methods to gain a better understanding of uncertainties within the national geological map of Great Britain. The expert elicitation approach starts with the assumption that experienced surveyors have an intuitive sense of the uncertainty of the boundaries that they map, based on a tacit model of geology and its complexity and the nature of the surveying process. The objective of
Expert Coaching in Weight Loss: Retrospective Analysis.
Painter, Stefanie Lynn; Ahmed, Rezwan; Kushner, Robert F; Hill, James O; Lindquist, Richard; Brunning, Scott; Margulies, Amy
2018-03-13
Providing coaches as part of a weight management program is a common practice to increase participant engagement and weight loss success. Understanding coach and participant interactions and how these interactions impact weight loss success needs to be further explored for coaching best practices. The purpose of this study was to analyze the coach and participant interaction in a 6-month weight loss intervention administered by Retrofit, a personalized weight management and Web-based disease prevention solution. The study specifically examined the association between different methods of coach-participant interaction and weight loss and tried to understand the level of coaching impact on weight loss outcome. A retrospective analysis was performed using 1432 participants enrolled from 2011 to 2016 in the Retrofit weight loss program. Participants were males and females aged 18 years or older with a baseline body mass index of ≥25 kg/m², who also provided at least one weight measurement beyond baseline. First, a detailed analysis of different coach-participant interaction was performed using both intent-to-treat and completer populations. Next, a multiple regression analysis was performed using all measures associated with coach-participant interactions involving expert coaching sessions, live weekly expert-led Web-based classes, and electronic messaging and feedback. Finally, 3 significant predictors (Pcoaching session attendance (Pcoaching sessions, attending 60% of live weekly Web-based classes, and receiving a minimum of 1 food log feedback day per week were associated with clinically significant weight loss. Participant's one-on-one expert coaching session attendance, live weekly expert-led interactive Web-based class attendance, and the number of food log feedback days per week from expert coach were significant predictors of weight loss in a 6-month intervention. ©Stefanie Lynn Painter, Rezwan Ahmed, Robert F Kushner, James O Hill, Richard Lindquist, Scott
Gao, Xiang; Han, Han
2018-06-01
Jolkinolide B (JB), a bioactive compound isolated from herbal medicine, has been found to inhibit tumor growth by altering glycolysis. However, whether glycolysis is influenced by JB in non-small cell lung cancer (NSCLC) cells and the mechanism remain unknown. The aim of the present study was to evaluate the effect of JB on the glycolysis in NSCLC cells and the underlying molecular mechanism. The results showed that JB treatment inhibited cell viability of A549 and H1299 cells in a concentration-dependent manner. JB reduced the glucose consumption, lactate production, and HK2 expression. The expressions of p-Akt and p-mTOR were also decreased by JB treatment. Knockdown of HK2 reduced glucose consumption and lactate production. Inhibition of the Akt/mTOR pathway decreased HK2 expression and inhibited glycolysis. In conclusion, the results indicated that JB inhibits glycolysis by down-regulating HK2 expression through inactivating the Akt/mTOR pathway in NSCLC cells, suggesting that JB might be a potential therapeutic agent for the treatment of NSCLC. © 2018 Wiley Periodicals, Inc.
Expert Team Decision-Making and Problem Solving: Development and Learning
Directory of Open Access Journals (Sweden)
Simona Tancig
2009-12-01
Full Text Available Traditional research of decision-making has not significantly contributed towards better understanding of professional judgment and decisions in practice. Researchers dealing with decision-making in various professions and natural settings initiated new perspectives called naturalistic, which put the expert in the focus of research and the expertise thus entered the core of decision-making research in natural situations.Expert team is more than a group of experts. It is defined as a group of interdependent team members with a high level of task related expertise and the mastering of team processes.There have been several advances in understanding of expertise and the team. By combining theories, models, and empirical evidence we are trying to explain effectiveness and adaptation of expert teams in problem-solving and decision-making in complex and dynamic situations.A considerable research has been devoted to finding out what are the characteristics of experts and expert teams during their optimal functioning. These characteristics are discussed as input, process and output factors. As input variables the cognitive, social-affective, and motivational characteristics are presented. Process variables encompass individual and team learning, problem solving and decision-making as presented in Kolb’s cycle of learning, in deeper structures of dialogue and discussion, and in phenomena of collaboration, alignment, and distributed cognition. Outcome variables deal with task performance – activities.
Strategies for adding adaptive learning mechanisms to rule-based diagnostic expert systems
Stclair, D. C.; Sabharwal, C. L.; Bond, W. E.; Hacke, Keith
1988-01-01
Rule-based diagnostic expert systems can be used to perform many of the diagnostic chores necessary in today's complex space systems. These expert systems typically take a set of symptoms as input and produce diagnostic advice as output. The primary objective of such expert systems is to provide accurate and comprehensive advice which can be used to help return the space system in question to nominal operation. The development and maintenance of diagnostic expert systems is time and labor intensive since the services of both knowledge engineer(s) and domain expert(s) are required. The use of adaptive learning mechanisms to increment evaluate and refine rules promises to reduce both time and labor costs associated with such systems. This paper describes the basic adaptive learning mechanisms of strengthening, weakening, generalization, discrimination, and discovery. Next basic strategies are discussed for adding these learning mechanisms to rule-based diagnostic expert systems. These strategies support the incremental evaluation and refinement of rules in the knowledge base by comparing the set of advice given by the expert system (A) with the correct diagnosis (C). Techniques are described for selecting those rules in the in the knowledge base which should participate in adaptive learning. The strategies presented may be used with a wide variety of learning algorithms. Further, these strategies are applicable to a large number of rule-based diagnostic expert systems. They may be used to provide either immediate or deferred updating of the knowledge base.
Rule base system in developing groundwater pollution expert system: predicting model
International Nuclear Information System (INIS)
Mongkon Ta-oun; Mohamed Daud; Mohd Zohadie Bardaie; Shamshuddin Jusop
2000-01-01
New techniques are now available for use in the protection of the environment. One of these techniques is the use of expert system for prediction groundwater pollution potential. Groundwater Pollution Expert system (GWPES) rules are a collection of principles and procedures used to know the comprehension of groundwater pollution prediction. The rules of groundwater pollution expert system in the form of questions, choice, radio-box, slide rule, button or frame are translated in to IF-THEN rule. The rules including of variables, types, domains and descriptions were used by the function of wxCLIPS (C Language Integrate Production System) expert system shell. (author)
Can journalistic "false balance" distort public perception of consensus in expert opinion?
Koehler, Derek J
2016-03-01
Media critics have expressed concern that journalistic "false balance" can distort the public's perceptions of what ought to be noncontroversial subjects (e.g., climate change). I report several experiments testing the influence of presenting conflicting comments from 2 experts who disagree on an issue (balance condition) in addition to a complete count of the number of experts on a panel who favor either side. Compared with a control condition, who received only the complete count, participants in the balance condition gave ratings of the perceived agreement among the experts that did not discriminate as clearly between issues with and without strong expert consensus. Participants in the balance condition also perceived less agreement among the experts in general, and were less likely to think that there was enough agreement among experts on the high-consensus issues to guide government policy. Evidently, "false balance" can distort perceptions of expert opinion even when participants would seem to have all the information needed to correct for its influence. (c) 2016 APA, all rights reserved).
Expert system for quality control in the INIS database
International Nuclear Information System (INIS)
Todeschini, C.; Tolstenkov, A.
1990-05-01
An expert system developed to identify input items to INIS database with a high probability of containing errors is described. The system employs a Knowledge Base constructed by the interpretation of a large number of intellectual choices or expert decisions made by human indexers and incorporated in the INIS database. On the basis of the descriptor indexing, the system checks the correctness of the categorization. A notable feature of the system is its capability of self improvement by the continuous updating of the Knowledge Base. The expert system has also been found to be extremely useful in identifying documents with poor indexing. 3 refs, 9 figs
PERFORMANCE EVALUATION OF PENSION FUNDS WITH FUZZY EXPERT SYSTEM
Directory of Open Access Journals (Sweden)
SERDAR KORUKOĞLU
2013-06-01
Full Text Available Financial rating and ranking firms often use linguistic instead of numerical values. When input data are mostly qualitative and are based on subjective knowledge of experts, the Fuzzy Set Theory provides a solid mathematical model to represent and handle these data. The aim of this study is developing a fuzzy expert model to evaluate the performance of the pension funds by using their risk and return values. The method is used for evaluating the performance of the randomly selected of twenty seven Turkish pension funds. The obtained results proved that the fuzzy expert system is appropriate and consistent for performance evaluation.
Expert system for quality control in the INIS database
Energy Technology Data Exchange (ETDEWEB)
Todeschini, C; Tolstenkov, A [International Atomic Energy Agency, Vienna (Austria)
1990-05-01
An expert system developed to identify input items to INIS database with a high probability of containing errors is described. The system employs a Knowledge Base constructed by the interpretation of a large number of intellectual choices or expert decisions made by human indexers and incorporated in the INIS database. On the basis of the descriptor indexing, the system checks the correctness of the categorization. A notable feature of the system is its capability of self improvement by the continuous updating of the Knowledge Base. The expert system has also been found to be extremely useful in identifying documents with poor indexing. 3 refs, 9 figs.
Experts' opinions on the role of diet in caries prevention.
van Loveren, C; Duggal, M S
2004-01-01
A questionnaire was sent to 54 experts in preventive dentistry in 23 European countries in order to make an inventory of existing national dietary guidelines for the prevention of dental caries. In addition, the experts were asked to give their personal opinion on several issues concerning the relationship between diet and dental caries. Forty-five experts from 20 countries returned the questionnaire. In 13 European countries dietary guidelines for caries prevention were available issued by a National (Dental) Association or a Government Body. All guidelines emphasised a reduction of the frequency of intakes of cariogenic foods. Two of them included a threshold level for the amount of sugar. When asked for their personal opinions, almost all experts mentioned reduction of frequency of 'cariogenic' intakes as the principal dietary messages for caries prevention. Four experts, however, explicitly mentioned that proper oral hygiene with fluoride toothpaste is more important. There was no agreement among the experts about a daily number of cariogenic intakes in between meals that can be regarded as safe, nor whether the message: 'Use products with sugar substitutes' should be part of the dietary guidelines for the prevention of dental caries. There was no agreement amongst experts on preventive dentistry in Europe on the contemporary validity of the paradigm: 'Sucrose is the arch criminal of dental caries.' Taking the variation in opinions into account and the fact that a balanced diet may lead to a moderate eating and snacking frequency, the authors propose that the emphasis on good versus bad foods for caries prevention should be replaced by an emphasis on good versus bad diets. Copyright 2004 S. Karger AG, Basel
Expert and non-expert groups perception of LILW repository site selection procedure
International Nuclear Information System (INIS)
Zeleznik, N.; Polic, M.
2001-01-01
Slovenia is now in the process of the site selection for a low and intermediate level radioactive waste (LILW) repository. Earlier searches for the LILW repository site confronted the Agency for radwaste management (ARAO) with a number of problems, mainly concerning the contacts with the local communities and their willingness to accept the repository. Therefore the Agency started with a new, so-called mixed mode approach to the site selection, where the special role of a mediator is introduced. The mediator represents the link between the investor and the local community, and facilitates the communication and negotiations between both. In this study we try to find out how people perceive the mediating process and conditions under which the LILW repository would be accepted in the local community. Therefore a special survey was conducted. The results showed some of the conditions under which participants would possibly accept the LILW repository. Differences in the perception between non-expert and expert groups were demonstrated and analysed, especially in the assessment of the consequences of LILW repository construction on the environment. Also the socio-psychological influences of the LILW repository were noted and examined. Consequences and recommendations for future work on the site selection procedure were prepared on the basis of the research results.(author)
Toward the efficient implementation of expert systems in Ada
Lee, S. Daniel
1990-01-01
Here, the authors describe Ada language issues encountered during the development of ART-Ada, an expert system tool for Ada deployment. ART-Ada is being used to implement several expert system applications for the Space Station Freedom and the U.S. Air Force. Additional information is given on dynamic memory allocation.
An expert system for the quantification of fault rates in construction fall accidents.
Talat Birgonul, M; Dikmen, Irem; Budayan, Cenk; Demirel, Tuncay
2016-01-01
Expert witness reports, prepared with the aim of quantifying fault rates among parties, play an important role in a court's final decision. However, conflicting fault rates assigned by different expert witness boards lead to iterative objections raised by the related parties. This unfavorable situation mainly originates due to the subjectivity of expert judgments and unavailability of objective information about the causes of accidents. As a solution to this shortcoming, an expert system based on a rule-based system was developed for the quantification of fault rates in construction fall accidents. The aim of developing DsSafe is decreasing the subjectivity inherent in expert witness reports. Eighty-four inspection reports prepared by the official and authorized inspectors were examined and root causes of construction fall accidents in Turkey were identified. Using this information, an evaluation form was designed and submitted to the experts. Experts were asked to evaluate the importance level of the factors that govern fall accidents and determine the fault rates under different scenarios. Based on expert judgments, a rule-based expert system was developed. The accuracy and reliability of DsSafe were tested with real data as obtained from finalized court cases. DsSafe gives satisfactory results.
An Expert System for Diagnosing Eye Diseases using Forward Chaining Method
Munaiseche, C. P. C.; Kaparang, D. R.; Rompas, P. T. D.
2018-02-01
Expert System is a system that seeks to adopt human knowledge to the computer, so that the computer can solve problems which are usually done by experts. The purpose of medical expert system is to support the diagnosis process of physicians. It considers facts and symptoms to provide diagnosis. This implies that a medical expert system uses knowledge about diseases and facts about the patients to suggest diagnosis. The aim of this research is to design an expert system application for diagnosing eye diseases using forward chaining method and to figure out user acceptance to this application through usability testing. Eye is selected because it is one of the five senses which is very sensitive and important. The scope of the work is extended to 16 types of eye diseases with 41 symptoms of the disease, arranged in 16 rules. The computer programming language employed was the PHP programming language and MySQL as the Relational Database Management System (RDBMS). The results obtained showed that the expert system was able to successfully diagnose eye diseases corresponding to the selected symptoms entered as query and the system evaluation through usability testing showed the expert system for diagnosis eye diseases had very good rate of usability, which includes learnability, efficiency, memorability, errors, and satisfaction so that the system can be received in the operational environment.
Towards a Fuzzy Expert System on Toxicological Data Quality Assessment.
Yang, Longzhi; Neagu, Daniel; Cronin, Mark T D; Hewitt, Mark; Enoch, Steven J; Madden, Judith C; Przybylak, Katarzyna
2013-01-01
Quality assessment (QA) requires high levels of domain-specific experience and knowledge. QA tasks for toxicological data are usually performed by human experts manually, although a number of quality evaluation schemes have been proposed in the literature. For instance, the most widely utilised Klimisch scheme1 defines four data quality categories in order to tag data instances with respect to their qualities; ToxRTool2 is an extension of the Klimisch approach aiming to increase the transparency and harmonisation of the approach. Note that the processes of QA in many other areas have been automatised by employing expert systems. Briefly, an expert system is a computer program that uses a knowledge base built upon human expertise, and an inference engine that mimics the reasoning processes of human experts to infer new statements from incoming data. In particular, expert systems have been extended to deal with the uncertainty of information by representing uncertain information (such as linguistic terms) as fuzzy sets under the framework of fuzzy set theory and performing inferences upon fuzzy sets according to fuzzy arithmetic. This paper presents an experimental fuzzy expert system for toxicological data QA which is developed on the basis of the Klimisch approach and the ToxRTool in an effort to illustrate the power of expert systems to toxicologists, and to examine if fuzzy expert systems are a viable solution for QA of toxicological data. Such direction still faces great difficulties due to the well-known common challenge of toxicological data QA that "five toxicologists may have six opinions". In the meantime, this challenge may offer an opportunity for expert systems because the construction and refinement of the knowledge base could be a converging process of different opinions which is of significant importance for regulatory policy making under the regulation of REACH, though a consensus may never be reached. Also, in order to facilitate the implementation
International Nuclear Information System (INIS)
Andersson, Kjell
2006-01-01
The author discussed the role and behaviour of experts in the context of gaining stakeholder confidence. The author underscored the many reasons to make explicit experts' values. Complex policy issues often involve many challenges, factual issues with uncertainties, values, emotions and vested interests. All of these factors should be exposed to policy makers and the public before decisions are made. Experts may set the agendas too narrowly, there may be mistrust in expertise and authorities, and there may be low awareness in the political system. Excessively narrow framing of the issues can result in frustration and inability to solve important societal problems. It was noted further, that in a democratic society decisions are based not on expert values, but on citizen values. Democracy implies accountability and requires awareness and transparency. Modern society is demanding higher levels of transparency and public participation dialogue and incorporation of public values. The author reviewed some of the models which have been advanced for awareness building with transparency and participation within frameworks of representative democracy. The RISKOM model was discussed, as was the VALDOC model, both of which invoke the practice of 'stretching' - inviting questions to be raised from new angles through challenges from society. Another key element of the RISKOM model is 'intelligence' - understanding future developments and outside forces, as well as studying and planning for the future. Crucial aspects of the VALDOC methodology include the authenticity of the approach itself, its identity in awareness and transparency, fairness in process setting and ensure neutral venues for hearings and transparency arenas. The presentation highlighted some applications of these models in a variety of industries in Sweden. The presentation reviewed a number of arenas in which experts' value systems may be exposed. Within the expert arena, it was
The commission of independent experts has labeled Mochovce as safe
International Nuclear Information System (INIS)
Grujbar, V.
1998-01-01
An independent commission of experts, appointed by IAEA, said that it did not find any faults concerning the integrity of the pressure vessel of the reactor in first block of the NPP Mochovce. The commission, comprising experts from the U.S.A., Belgium, Finland, Germany and Russia, was given the same documents as the Austrian mission, appointed by the office of the Austrian Chancellor, in May. The Austrian experts then expressed two serious concerns about the security of the first block in Mochovce.The experts of the IAEA agreed that the real condition of Mochovce is a lot better that shown in the technical documentation and they did not find any faults. IAEA was in this case, for the first time, an arbiter solving an international dispute about security of a NPP
Holistic processing of fingerprints by expert forensic examiners.
Vogelsang, Macgregor D; Palmeri, Thomas J; Busey, Thomas A
2017-01-01
Holistic processing is often characterized as a process by which objects are perceived as a whole rather than a compilation of individual features. This mechanism may play an important role in the development of perceptual expertise because it allows for rapid integration across image regions. The present work explores whether holistic processing is present in latent fingerprint examiners, who compare fingerprints collected from crime scenes against a set of standards taken from a suspect. We adapted a composite task widely used in the face recognition and perceptual expertise literatures, in which participants were asked to match only a particular half of a fingerprint with a previous image while ignoring the other half. We tested both experts and novices, using both upright and inverted fingerprints. For upright fingerprints, we found weak evidence for holistic processing, but with no differences between experts and novices with respect to holistic processing. For inverted fingerprints, we found stronger evidence of holistic processing, with weak evidence for differences between experts and novices. These relatively weak holistic processing effects contrast with robust evidence for holistic processing with faces and with objects in other domains of perceptual expertise. The data constrain models of holistic processing by demonstrating that latent fingerprint experts and novices may not substantively differ in terms of the amount of holistic processing and that inverted stimuli actually produced more evidence for holistic processing than upright stimuli. Important differences between the present fingerprint stimuli and those in the literature include the lack of verbal labels for experts and the absence of strong vertical asymmetries, both of which might contribute to stronger holistic processing signatures in other stimulus domains.
Energy Technology Data Exchange (ETDEWEB)
Groundwater, E.H.; Miller, L.A.; Mirsky, S.M. [Science Applications International Corp., McLean, VA (United States)
1995-03-01
This report is the third volume in the final report for the Expert System Verification and Validation (V&V) project which was jointly sponsored by the Nuclear Regulatory Commission and the Electric Power Research Institute. The ultimate objective is the formulation of guidelines for the V&V of expert systems for use in nuclear power applications. The purpose of this activity was to survey and document techniques presently in use for expert system V&V. The survey effort included an extensive telephone interviewing program, site visits, and a thorough bibliographic search and compilation. The major finding was that V&V of expert systems is not nearly as established or prevalent as V&V of conventional software systems. When V&V was used for expert systems, it was almost always at the system validation stage after full implementation and integration usually employing the non-systematic dynamic method of {open_quotes}ad hoc testing.{close_quotes} There were few examples of employing V&V in the early phases of development and only weak sporadic mention of the possibilities in the literature. There is, however, a very active research area concerning the development of methods and tools to detect problems with, particularly, rule-based expert systems. Four such static-testing methods were identified which were not discovered in a comprehensive review of conventional V&V methods in an earlier task.
Fuzzy Expert System for Heart Attack Diagnosis
Hassan, Norlida; Arbaiy, Nureize; Shah, Noor Aziyan Ahmad; Afizah Afif@Afip, Zehan
2017-08-01
Heart attack is one of the serious illnesses and reported as the main killer disease. Early prevention is significant to reduce the risk of having the disease. The prevention efforts can be strengthen through awareness and education about risk factor and healthy lifestyle. Therefore the knowledge dissemination is needed to play role in order to distribute and educate public in health care management and disease prevention. Since the knowledge dissemination in medical is important, there is a need to develop a knowledge based system that can emulate human intelligence to assist decision making process. Thereby, this study utilized hybrid artificial intelligence (AI) techniques to develop a Fuzzy Expert System for Diagnosing Heart Attack Disease (HAD). This system integrates fuzzy logic with expert system, which helps the medical practitioner and people to predict the risk and as well as diagnosing heart attack based on given symptom. The development of HAD is expected not only providing expert knowledge but potentially become one of learning resources to help citizens to develop awareness about heart-healthy lifestyle.
[Psychiatric expert opinions on asylum seekers in Germany].
Sieberer, Marcel; Ziegenbein, Marc; Eckhardt, Gudrun; Machleidt, Wielant; Calliess, Iris T
2011-01-01
To investigate the frequency of traumatisation, suicidality and given diagnoses in expert opinions on asylum seekers and to describe the sociodemographic characteristics of this population. The psychiatric expert opinions on asylum seekers, furnished in an 8-year-period at Hannover Medical School, were analysed retrospectively for qualitative and quantitative characteristics. 62 psychiatric expert opinions on asylum seekers were included in this study. The asylum seekers originated from 18 different countries, mainly from Turkey and former Yugoslavia. Most expert opinions were given in secondary asylum procedures, i. e. after the initial asylum request had been rejected. The asylum seekers reported on traumatisation in 82.3 %. The most frequently reported forms of traumatisation were rape in female, and torture in male persons. According to ICD-10 or DSM-IV-R criteria posttraumatic stress disorder (PTSD) was the most frequent diagnosis (74.1 %) in this study. The second most common diagnoses were depressive disorders (ICD-10: F32.x in 33.9 % and ICD-10: F33.x in 25.9 %). Suicidal tendency was found in 56.5 % of the asylum seekers. Cultural differences, language barriers, a heavy burden by psychological symptoms, and clinical severity are difficulties in the process of psychiatric assessment of refugees in legal asylum procedures. © Georg Thieme Verlag KG Stuttgart · New York.
Expert assessment of advanced power sources. Contract report
International Nuclear Information System (INIS)
Gardner, C.L.
2007-07-01
Although DRDC published an exhaustive technical report (in August 2001) on technology trends in advanced power sources projected out to the year 2020, the terrorist attacks on the US on September 11, 2001 (and the consequent, augmented and more broadly-based defence and national security posture adopted by the CF/DND), together with rapid developments in power source technologies over the past five years, internationally, prompted DRDC to update the 2001 report, on a selected number of power source technologies or applications and to provide further guidance to DRDC's Advanced Power Source R and D program. Eight wide-ranging, power source technologies or applications were investigated, using the technique of 'expert elicitation' (that is, using independent experts in the various and diverse technological fields), based on a standardized questionnaire, augmented by the contractor's own expertise (and his overall analysis of the experts' responses) in these diverse areas. In addition, each expert was asked about his/her view on the likely role of nanotechnology in each technological area or application. Following collection and analysis of all the data, the contractor made recommendations on the ability of each power source to meet the future requirements of the CF/DND, taking into account the Technology Readiness Level, for each technology or application
QUEST: Quality of Expert Systems
Perre, M.
1991-01-01
TNO Physics and Electronics laboratory, in collaboration with the University of Limburg and the Research Institute for Knowledge Systems, worked on a technology project named 'QUEST: Quality of Expert Systems' [FEL90]. QUEST was carried out under commision of the Dutch Ministry of Defence. A strong
Characterizing Health-Related Information Needs of Domain Experts
Znaidi , Eya; Tamine , Lynda; Chouquet , Cécile; Latiri , Chira
2013-01-01
International audience; In information retrieval literature, understanding the users’ intents behind the queries is critically important to gain a better insight of how to select relevant results. While many studies investigated how users in general carry out exploratory health searches in digital environments, a few focused on how are the queries formulated, specifically by domain expert users. This study intends to fill this gap by studying 173 health expert queries issued from 3 medical in...
Taylor Backor, Karen; Gordon, Stephen P.
2015-01-01
Although research has established links between the principal's instructional leadership and student achievement, there is considerable concern in the literature concerning the capacity of principal preparation programs to prepare instructional leaders. This study interviewed educational leadership faculty as well as expert principals and teacher…
A study on expert system applications for nuclear power plant
International Nuclear Information System (INIS)
Huh, Young Hwan; Kim, Kil Yoo; Kang, Soon Ju; Park, Nam Seok; Ryu, Chan Ho; Choi, In Seon; Chung, Young Moo; Chung, Tae Eon; Yim, Chang Jae; Lee, Yoon Sang.
1990-01-01
The objectives of this research are 1) to develop an expert system which can automatically evaluate eddy current (EC) signal during an eddy current test (ECT) of SG U tube inspection, 2) to build an effective data base management system for ECT data. By this expert system the reliability in EC signal evaluation can be improved, and the required man-power can be reduced. And this expert system can supply a stable ECT and contribute to a safe operation of the nuclear power plant. (author)
Planning bioinformatics workflows using an expert system
Chen, Xiaoling; Chang, Jeffrey T.
2017-01-01
Abstract Motivation: Bioinformatic analyses are becoming formidably more complex due to the increasing number of steps required to process the data, as well as the proliferation of methods that can be used in each step. To alleviate this difficulty, pipelines are commonly employed. However, pipelines are typically implemented to automate a specific analysis, and thus are difficult to use for exploratory analyses requiring systematic changes to the software or parameters used. Results: To automate the development of pipelines, we have investigated expert systems. We created the Bioinformatics ExperT SYstem (BETSY) that includes a knowledge base where the capabilities of bioinformatics software is explicitly and formally encoded. BETSY is a backwards-chaining rule-based expert system comprised of a data model that can capture the richness of biological data, and an inference engine that reasons on the knowledge base to produce workflows. Currently, the knowledge base is populated with rules to analyze microarray and next generation sequencing data. We evaluated BETSY and found that it could generate workflows that reproduce and go beyond previously published bioinformatics results. Finally, a meta-investigation of the workflows generated from the knowledge base produced a quantitative measure of the technical burden imposed by each step of bioinformatics analyses, revealing the large number of steps devoted to the pre-processing of data. In sum, an expert system approach can facilitate exploratory bioinformatic analysis by automating the development of workflows, a task that requires significant domain expertise. Availability and Implementation: https://github.com/jefftc/changlab Contact: jeffrey.t.chang@uth.tmc.edu PMID:28052928
Brain mechanisms of persuasion: how 'expert power' modulates memory and attitudes.
Klucharev, Vasily; Smidts, Ale; Fernández, Guillén
2008-12-01
Human behaviour is affected by various forms of persuasion. The general persuasive effect of high expertise of the communicator, often referred to as 'expert power', is well documented. We found that a single exposure to a combination of an expert and an object leads to a long-lasting positive effect on memory for and attitude towards the object. Using functional magnetic resonance imaging, we probed the neural processes predicting these behavioural effects. Expert context was associated with distributed left-lateralized brain activity in prefrontal and temporal cortices related to active semantic elaboration. Furthermore, experts enhanced subsequent memory effects in the medial temporal lobe (i.e. in hippocampus and parahippocampal gyrus) involved in memory formation. Experts also affected subsequent attitude effects in the caudate nucleus involved in trustful behaviour, reward processing and learning. These results may suggest that the persuasive effect of experts is mediated by modulation of caudate activity resulting in a re-evaluation of the object in terms of its perceived value. Results extend our view of the functional role of the dorsal striatum in social interaction and enable us to make the first steps toward a neuroscientific model of persuasion.
Expert Opinion Elicitation Using Fuzzy Set Theory and Distempers-Shaker's Theory
International Nuclear Information System (INIS)
Yu, Donghan
1993-01-01
This study presents a new approach for expert opinion elicitation. The need to work with rare events and limited data is severe accident have led analysts to use expert opinions extensively. Unlike the conventional approaches using point-valued probabilities, the study proposes the concept of fuzzy probability to represent expert opinion. The use of fuzzy probability has an advantage over the conventional approach when an expert's judgment is used under limited data and imprecise knowledge. The study demonstrates a method of combining fuzzy probabilities in a manner consistent with the Distempers-Shaper's Theory (DDT). The propagation of fuzzy probabilities through a system is also introduced
A study on the development and application of expert system for nuclear power plant
Energy Technology Data Exchange (ETDEWEB)
Woo, Hee Gon; Kim, Seong Bok [Korea Electric Power Corp. (KEPCO), Taejon (Korea, Republic of). Research Center
1995-12-31
It is a final report of the research that is a study on the development and application of expert system for nuclear power plants and development of the schemes computing environments and user interfaces for the expert system, which is a systematic and efficient development of expert system for nuclear power plants in the future. This report is consisted of -Development trends of expert system for nuclear power plants. -Classification of expert system applications for nuclear power plants. -Systematic and efficient developments schemes of expert system for nuclear power plants, and -Suitable computing environments and user interfaces for the expert systems. (author). 113 refs., 85 figs.
A study on the development and application of expert system for nuclear power plant
Energy Technology Data Exchange (ETDEWEB)
Woo, Hee Gon; Kim, Seong Bok [Korea Electric Power Corp. (KEPCO), Taejon (Korea, Republic of). Research Center
1996-12-31
It is a final report of the research that is a study on the development and application of expert system for nuclear power plants and development of the schemes computing environments and user interfaces for the expert system, which is a systematic and efficient development of expert system for nuclear power plants in the future. This report is consisted of -Development trends of expert system for nuclear power plants. -Classification of expert system applications for nuclear power plants. -Systematic and efficient developments schemes of expert system for nuclear power plants, and -Suitable computing environments and user interfaces for the expert systems. (author). 113 refs., 85 figs.
Oracle Hyperion Interactive Reporting 11 Expert Guide
Cody, Edward J
2011-01-01
This book is written in a simple, easy to understand format with screenshots, code samples, and step-by-step explanations that will guide you through the advanced techniques used by the experts. If you are an Oracle Hyperion Interactive reporting user or developer looking to become an expert in the product, then this book is for you. You will require a basic knowledge of Interactive Reporting, as this book starts with a brief overview and then dives into advanced techniques, functions, and best practices. Beginner users should consult The Business Analyst's Guide to Oracle Hyperion Interactive
Early-career experts essential for planetary sustainability
Lim, Michelle; Lynch, Abigail J.; Fernández-Llamazares, Alvaro; Balint, Lenke; Basher, Zeenatul; Chan, Ivis; Jaureguiberry, Pedro; Mohamed, A.A.A.; Mwampamba, Tuyeni H.; Palomo, Ignacio; Pliscoff, Patricio; Salimov, R.A.; Samakov, Aibek; Selomane, Odirilwe; Shrestha, Uttam B.; Sidorovich, Anna A.
2017-01-01
Early-career experts can play a fundamental role in achieving planetary sustainability by bridging generational divides and developing novel solutions to complex problems. We argue that intergenerational partnerships and interdisciplinary collaboration among early-career experts will enable emerging sustainability leaders to contribute fully to a sustainable future. We review 16 international, interdisciplinary, and sustainability-focused early-career capacity building programs. We conclude that such programs are vital to developing sustainability leaders of the future and that decision-making for sustainability is likely to be best served by strong institutional cultures that promote intergenerational learning and involvement.
Temporal logics and real time expert systems.
Blom, J A
1996-10-01
This paper introduces temporal logics. Due to the eternal compromise between expressive adequacy and reasoning efficiency that must decided upon in any application, full (first order logic or modal logic based) temporal logics are frequently not suitable. This is especially true in real time expert systems, where a fixed (and usually small) response time must be guaranteed. One such expert system, Fagan's VM, is reviewed, and a delineation is given of how to formally describe and reason with time in medical protocols. It is shown that Petri net theory is a useful tool to check the correctness of formalised protocols.
Online NPP monitoring with neuro-expert system
International Nuclear Information System (INIS)
Nabeshima, K.
2002-01-01
This study present a hybrid monitoring system for nuclear power plant utilizing neural networks and a rule-based expert system. The whole monitoring system including a data acquisition system and the advisory displays has been tested by an on-line simulator of pressurized water reactor. From the testing results, it was shown that the neural network in the monitoring system successfully modeled the plant dynamics and detected the symptoms of anomalies earlier than the conventional alarm system. The expert system also worked satisfactorily in diagnosing and displaying the system status by using the outputs of neural networks and a priori knowledge base
An expert system for USNRC emergency response
International Nuclear Information System (INIS)
Sebo, D.E.; Bray, M.A.; King, M.A.
1986-01-01
The Reactor Safety Assessment System (RSAS) is an expert system under development for the United States Nuclear Regulatory Commission (USNRC). RSAS is intended for use at the NRO's Operations Center in the event of a serious incident at a licensed nuclear power plant. RSAS is a situation assessment expert system which uses plant parametric data to generate conclusions for use by the NRC Reactor Safety Team. RSAS uses multiple rule bases and plant specific setpoint files in order to be applicable to all licensed power plants. RSAS currently covers several generic reactor types and power plants within those classes
Hybrid expert system implementation to determine core reload patterns
International Nuclear Information System (INIS)
Greek, K.J.; Robinson, A.H.
1989-01-01
Determining reactor reload fuel patterns is a computationally intensive problem solving process for which automation can be of significant benefit. Often much effort is expended in the search for an optimal loading. While any modern programming language could be used to automate solution, the specialized tools of artificial intelligence (AI) are the most efficient means of introducing the fuel management expert's knowledge into the search for an optimum reload pattern. Prior research in pressurized water reactor refueling strategies developed FORTRAN programs that automated an expert's basic knowledge to direct a search for an acceptable minimum peak power loading. The dissatisfaction with maintenance of compiled knowledge in FORTRAN programs has served as the motivation for the development of the SHUFFLE expert system. SHUFFLE is written in Smalltalk, an object-oriented programming language, and evaluates loadings as it generates them using a two-group, two-dimensional nodal power calculation compiled in a personal computer-based FORTRAN. This paper reviews the object-oriented representation developed to solve the core reload problem with an expert system tool and its operating prototype, SHUFFLE
The World (of Warcraft through the eyes of an expert
Directory of Open Access Journals (Sweden)
Yousri Marzouki
2017-09-01
Full Text Available Negative correlations between pupil size and the tendency to look at salient locations were found in recent studies (e.g., Mathôt et al., 2015. It is hypothesized that this negative correlation might be explained by the mental effort put by participants in the task that leads in return to pupil dilation. Here we present an exploratory study on the effect of expertise on eye-movement behavior. Because there is no available standard tool to evaluate WoW players’ expertise, we built an off-game questionnaire testing players’ knowledge about WoW and acquired skills through completed raids, highest rated battlegrounds, Skill Points, etc. Experts (N = 4 and novices (N = 4 in the massively multiplayer online role-playing game World of Warcraft (WoW viewed 24 designed video segments from the game that differ in regards with their content (i.e, informative locations and visual complexity (i.e, salient locations. Consistent with previous studies, we found a negative correlation between pupil size and the tendency to look at salient locations (experts, r = − .17, p < .0001, and novices, r = − .09, p < .0001. This correlation has been interpreted in terms of mental effort: People are inherently biased to look at salient locations (sharp corners, bright lights, etc., but are able (i.e., experts to overcome this bias if they invest sufficient mental effort. Crucially, we observed that this correlation was stronger for expert WoW players than novice players (Z = − 3.3, p = .0011. This suggests that experts learned to improve control over eye-movement behavior by guiding their eyes towards informative, but potentially low-salient areas of the screen. These findings may contribute to our understanding of what makes an expert an expert.
An expert system for sensor data validation and malfunction detection
International Nuclear Information System (INIS)
Hashemi, S.; Hajek, B.K.; Miller, D.W.
1987-01-01
Nuclear power plant operation and monitoring in general is a complex task which requires a large number of sensors, alarms and displays. At any instant in time, the operator is required to make a judgment about the state of the plant and to react accordingly. During abnormal situations, operators are further burdened with time constraints. The possibility of an undetected faulty instrumentation line, adds to the complexity of operators' reasoning tasks. Recent work at The Ohio State University Laboratory of Artificial Intelligence Research (LAIR) and the nuclear engineering program has concentrated on the problem of diagnostic expert systems performance and their applicability to the nuclear power plant domain. The authors have also been concerned about the diagnostic expert systems performance when using potentially invalid sensor data. Because of this research, they have developed an expert system that can perform diagnostic problem solving despite the existence of some conflicting data in the domain. This work has resulted in enhancement of a programming tool, CSRL, that allows domain experts to create a diagnostic system that will be to some degree, tolerant of bad data while performing diagnosis. This expert system is described here
Development of an expert system for radioactive material transportation
International Nuclear Information System (INIS)
Tamanoi, K.; Ishitobi, M.; Shinohara, Y.
1990-01-01
An expert system to deal with radioactive material transportation was developed. This expert system is based on 'Regulations for the Safe Transport of Radioactive Material' by IAEA issued 1985. IAEA published the regulations under such environments that safety transportation has become increasingly being focused as uses of radioactive materials are more pervasive, not only in nuclear field but also in non-nuclear purposes. Attentions are payed for operators and environment to establish safety in handling radioactive materials. In the 1985 regulations, detailed categorization of radioactive materials and, correspondingly, new classification of packages are introduced. This categorization is more complicated than old regulations, leading us to develop an expert system to evaluate easily the packages categorization. (author)
NDT-based bridge condition assessment supported by expert tools
Bień, J.; KuŻawa, M.
2016-06-01
This paper is focused on the progress in the application of Expert Tools supporting integration of inspection and NDT testing findings in order to effectuate effective decision making by bridge owners. Possibilities of knowledge representation in the intelligent computer Expert Tools by means of the multi-level hybrid network technology are described. These multi-level hybrid networks can be built of neural, fuzzy and functional components depending on the problem that needs to be solved and on the type of available information. Application of the technology is illustrated by an example of the Bridge Evaluation Expert Function (BEEF) implemented in the Railway Bridge Management System "SMOK" operated by the Polish State Railways.
Techniques and implementation of the embedded rule-based expert system using Ada
Liberman, Eugene M.; Jones, Robert E.
1991-01-01
Ada is becoming an increasingly popular programming language for large Government-funded software projects. Ada with its portability, transportability, and maintainability lends itself well to today's complex programming environment. In addition, expert systems have also assured a growing role in providing human-like reasoning capability and expertise for computer systems. The integration of expert system technology with Ada programming language, specifically a rule-based expert system using an ART-Ada (Automated Reasoning Tool for Ada) system shell is discussed. The NASA Lewis Research Center was chosen as a beta test site for ART-Ada. The test was conducted by implementing the existing Autonomous Power EXpert System (APEX), a Lisp-base power expert system, in ART-Ada. Three components, the rule-based expert system, a graphics user interface, and communications software make up SMART-Ada (Systems fault Management with ART-Ada). The main objective, to conduct a beta test on the ART-Ada rule-based expert system shell, was achieved. The system is operational. New Ada tools will assist in future successful projects. ART-Ada is one such tool and is a viable alternative to the straight Ada code when an application requires a rule-based or knowledge-based approach.
Key properties of expert movement systems in sport : an ecological dynamics perspective.
Seifert, Ludovic; Button, Chris; Davids, Keith
2013-03-01
This paper identifies key properties of expertise in sport predicated on the performer-environment relationship. Weaknesses of traditional approaches to expert performance, which uniquely focus on the performer and the environment separately, are highlighted by an ecological dynamics perspective. Key properties of expert movement systems include 'multi- and meta-stability', 'adaptive variability', 'redundancy', 'degeneracy' and the 'attunement to affordances'. Empirical research on these expert system properties indicates that skill acquisition does not emerge from the internal representation of declarative and procedural knowledge, or the imitation of expert behaviours to linearly reduce a perceived 'gap' separating movements of beginners and a putative expert model. Rather, expert performance corresponds with the ongoing co-adaptation of an individual's behaviours to dynamically changing, interacting constraints, individually perceived and encountered. The functional role of adaptive movement variability is essential to expert performance in many different sports (involving individuals and teams; ball games and outdoor activities; land and aquatic environments). These key properties signify that, in sport performance, although basic movement patterns need to be acquired by developing athletes, there exists no ideal movement template towards which all learners should aspire, since relatively unique functional movement solutions emerge from the interaction of key constraints.
Team of experts concludes review of safety issues at Temelin
International Nuclear Information System (INIS)
2001-01-01
Full text: At the request of the Czech Government, the International Atomic Energy Agency (IAEA) assembled a team of national experts from Bulgaria, France, Germany, Spain, and the United Kingdom, with an observer from Austria, to review safety issues at the Temelin power plant that were identified in 1996 as relevant to reactors of the generic Temelin design (WWER-1000/320 type). Following a detailed on-site review from 18 to 23 November 2001, the experts concluded that most identified issues had been addressed and resolved. Work is continuing on the few remaining issues. These issues, however, are not judged by them to be significant and would not from the experts' standpoint preclude the safe operation of the Temelin nuclear power plant. The final report of the team of experts will be available to the Czech Government in one month's time. (author)
Expert vs. novice: Problem decomposition/recomposition in engineering design
Song, Ting
The purpose of this research was to investigate the differences of using problem decomposition and problem recomposition among dyads of engineering experts, dyads of engineering seniors, and dyads of engineering freshmen. Fifty participants took part in this study. Ten were engineering design experts, 20 were engineering seniors, and 20 were engineering freshmen. Participants worked in dyads to complete an engineering design challenge within an hour. The entire design process was video and audio recorded. After the design session, members participated in a group interview. This study used protocol analysis as the methodology. Video and audio data were transcribed, segmented, and coded. Two coding systems including the FBS ontology and "levels of the problem" were used in this study. A series of statistical techniques were used to analyze data. Interview data and participants' design sketches also worked as supplemental data to help answer the research questions. By analyzing the quantitative and qualitative data, it was found that students used less problem decomposition and problem recomposition than engineer experts in engineering design. This result implies that engineering education should place more importance on teaching problem decomposition and problem recomposition. Students were found to spend less cognitive effort when considering the problem as a whole and interactions between subsystems than engineer experts. In addition, students were also found to spend more cognitive effort when considering details of subsystems. These results showed that students tended to use dept-first decomposition and experts tended to use breadth-first decomposition in engineering design. The use of Function (F), Behavior (B), and Structure (S) among engineering experts, engineering seniors, and engineering freshmen was compared on three levels. Level 1 represents designers consider the problem as an integral whole, Level 2 represents designers consider interactions between
Expert decisionmaking in risk analysis: The case of the Yucca Mountain facility
Energy Technology Data Exchange (ETDEWEB)
Shrader-Frechette, K [University of Notre Dame, IN (United States)
1999-12-01
Thirty-five or forty centuries ago, there were probably Egyptian experts who argued that they could safeguard the tombs of the pharaohs for 10,000 or a million years. Six centuries ago, there were probably Italian experts who believed that they could secure their Renaissance art treasures. Neither the Egyptians nor the Italians succeeded completely in their efforts. Today's experts, working on permanent nuclear waste disposal, face no easier a task. To understand some of the most difficult problems of expert judgment regarding nuclear repositories, these remarks address, 10 problematic judgments of scientists about the proposed Yucca Mountain permanent nuclear repository for spent fuel and high-level nuclear waste; argue that legal constraints imposed by the US government exacerbate these problems of expert scientific judgment; and conclude that, for any permanent repository program to succeed, nations ought to avoid problems (in expert scientific judgment and in the law) that have dogged US repository efforts.
Expert decisionmaking in risk analysis: The case of the Yucca Mountain facility
International Nuclear Information System (INIS)
Shrader-Frechette, K.
1999-01-01
Thirty-five or forty centuries ago, there were probably Egyptian experts who argued that they could safeguard the tombs of the pharaohs for 10,000 or a million years. Six centuries ago, there were probably Italian experts who believed that they could secure their Renaissance art treasures. Neither the Egyptians nor the Italians succeeded completely in their efforts. Today's experts, working on permanent nuclear waste disposal, face no easier a task. To understand some of the most difficult problems of expert judgment regarding nuclear repositories, these remarks address, 10 problematic judgments of scientists about the proposed Yucca Mountain permanent nuclear repository for spent fuel and high-level nuclear waste; argue that legal constraints imposed by the US government exacerbate these problems of expert scientific judgment; and conclude that, for any permanent repository program to succeed, nations ought to avoid problems (in expert scientific judgment and in the law) that have dogged US repository efforts
Expert decisionmaking in risk analysis: The case of the Yucca Mountain facility
Energy Technology Data Exchange (ETDEWEB)
Shrader-Frechette, K. [University of Notre Dame, IN (United States)
1999-12-01
Thirty-five or forty centuries ago, there were probably Egyptian experts who argued that they could safeguard the tombs of the pharaohs for 10,000 or a million years. Six centuries ago, there were probably Italian experts who believed that they could secure their Renaissance art treasures. Neither the Egyptians nor the Italians succeeded completely in their efforts. Today's experts, working on permanent nuclear waste disposal, face no easier a task. To understand some of the most difficult problems of expert judgment regarding nuclear repositories, these remarks address, 10 problematic judgments of scientists about the proposed Yucca Mountain permanent nuclear repository for spent fuel and high-level nuclear waste; argue that legal constraints imposed by the US government exacerbate these problems of expert scientific judgment; and conclude that, for any permanent repository program to succeed, nations ought to avoid problems (in expert scientific judgment and in the law) that have dogged US repository efforts.
Evaluation of a Performance-Based Expert Elicitation: WHO Global Attribution of Foodborne Diseases
DEFF Research Database (Denmark)
Aspinall, W. P.; Cooke, R. M.; Havelaar, A. H.
2016-01-01
. This paper presents new findings from a large-scale international SEJ study intended to estimate the global burden of foodborne disease on behalf of WHO. The study involved 72 experts distributed over 134 expert panels, with panels comprising thirteen experts on average. Elicitations were conducted in five...... languages. Performance-based weighted solutions for target questions of interest were formed for each panel. These weights were based on individual expert's statistical accuracy and informativeness, determined using between ten and fifteen calibration variables from the experts' field with known values...
ASSESSMENT OF POWER QUALITY DISTURBANCE USING EXPERT SYSTEM
A.N.MALLESWARA RAO,; Dr. K.RAMESH REDDY,; Dr. B.V.SANKER RAM
2011-01-01
This paper describes a fuzzy expert system in order to understand and deal with power quality problems encountered in distribution systems in a better way. Because of the technology and software now available this monitoring is highly effective, the fuzzy expert system not only can provide information about the quality of the power and the causes of power system disturbances, but it can identify problem conditions throughout the system before they cause widespread customer complains and equip...
Web-based expert system for foundry pollution prevention
Moynihan, Gary P.
2004-02-01
Pollution prevention is a complex task. Many small foundries lack the in-house expertise to perform these tasks. Expert systems are a type of computer information system that incorporates artificial intelligence. As noted in the literature, they provide a means of automating specialized expertise. This approach may be further leveraged by implementing the expert system on the internet (or world-wide web). This will allow distribution of the expertise to a variety of geographically-dispersed foundries. The purpose of this research is to develop a prototype web-based expert system to support pollution prevention for the foundry industry. The prototype system identifies potential emissions for a specified process, and also provides recommendations for the prevention of these contaminants. The system is viewed as an initial step toward assisting the foundry industry in better meeting government pollution regulations, as well as improving operating efficiencies within these companies.
International Nuclear Information System (INIS)
Groundwater, E.H.; Miller, L.A.; Mirsky, S.M.
1995-03-01
This report is the third volume in the final report for the Expert System Verification and Validation (V ampersand V) project which was jointly sponsored by the Nuclear Regulatory Commission and the Electric Power Research Institute. The ultimate objective is the formulation of guidelines for the V ampersand V of expert systems for use in nuclear power applications. The purpose of this activity was to survey and document techniques presently in use for expert system V ampersand V. The survey effort included an extensive telephone interviewing program, site visits, and a thorough bibliographic search and compilation. The major finding was that V ampersand V of expert systems is not nearly as established or prevalent as V ampersand V of conventional software systems. When V ampersand V was used for expert systems, it was almost always at the system validation stage after full implementation and integration usually employing the non-systematic dynamic method of open-quotes ad hoc testing.close quotes There were few examples of employing V ampersand V in the early phases of development and only weak sporadic mention of the possibilities in the literature. There is, however, a very active research area concerning the development of methods and tools to detect problems with, particularly, rule-based expert systems. Four such static-testing methods were identified which were not discovered in a comprehensive review of conventional V ampersand V methods in an earlier task
Saturated Zone Flow and Transport Expert Elicitation Project
Energy Technology Data Exchange (ETDEWEB)
Coppersmith, Kevin J.; Perman, Roseanne C.
1998-01-01
This report presents results of the Saturated Zone Flow and Transport Expert Elicitation (SZEE) project for Yucca Mountain, Nevada. This project was sponsored by the US Department of Energy (DOE) and managed by Geomatrix Consultants, Inc. (Geomatrix), for TRW Environmental Safety Systems, Inc. The DOE's Yucca Mountain Site Characterization Project (referred to as the YMP) is intended to evaluate the suitability of the site for construction of a mined geologic repository for the permanent disposal of spent nuclear fuel and high-level radioactive waste. The SZEE project is one of several that involve the elicitation of experts to characterize the knowledge and uncertainties regarding key inputs to the Yucca Mountain Total System Performance Assessment (TSPA). The objective of the current project was to characterize the uncertainties associated with certain key issues related to the saturated zone system in the Yucca Mountain area and downgradient region. An understanding of saturated zone processes is critical to evaluating the performance of the potential high-level nuclear waste repository at Yucca Mountain. A major goal of the project was to capture the uncertainties involved in assessing the saturated flow processes, including uncertainty in both the models used to represent the physical processes controlling saturated zone flow and transport, and the parameter values used in the models. So that the analysis included a wide range of perspectives, multiple individual judgments were elicited from members of an expert panel. The panel members, who were experts from within and outside the Yucca Mountain project, represented a range of experience and expertise. A deliberate process was followed in facilitating interactions among the experts, in training them to express their uncertainties, and in eliciting their interpretations. The resulting assessments and probability distributions, therefore, provide a reasonable aggregate representation of the knowledge and
Heuristics in Managing Complex Clinical Decision Tasks in Experts' Decision Making.
Islam, Roosan; Weir, Charlene; Del Fiol, Guilherme
2014-09-01
Clinical decision support is a tool to help experts make optimal and efficient decisions. However, little is known about the high level of abstractions in the thinking process for the experts. The objective of the study is to understand how clinicians manage complexity while dealing with complex clinical decision tasks. After approval from the Institutional Review Board (IRB), three clinical experts were interviewed the transcripts from these interviews were analyzed. We found five broad categories of strategies by experts for managing complex clinical decision tasks: decision conflict, mental projection, decision trade-offs, managing uncertainty and generating rule of thumb. Complexity is created by decision conflicts, mental projection, limited options and treatment uncertainty. Experts cope with complexity in a variety of ways, including using efficient and fast decision strategies to simplify complex decision tasks, mentally simulating outcomes and focusing on only the most relevant information. Understanding complex decision making processes can help design allocation based on the complexity of task for clinical decision support design.
Eliciting expert opinion for economic models: an applied example.
Leal, José; Wordsworth, Sarah; Legood, Rosa; Blair, Edward
2007-01-01
Expert opinion is considered as a legitimate source of information for decision-analytic modeling where required data are unavailable. Our objective was to develop a practical computer-based tool for eliciting expert opinion about the shape of the uncertainty distribution around individual model parameters. We first developed a prepilot survey with departmental colleagues to test a number of alternative approaches to eliciting opinions on the shape of the uncertainty distribution around individual parameters. This information was used to develop a survey instrument for an applied clinical example. This involved eliciting opinions from experts to inform a number of parameters involving Bernoulli processes in an economic model evaluating DNA testing for families with a genetic disease, hypertrophic cardiomyopathy. The experts were cardiologists, clinical geneticists, and laboratory scientists working with cardiomyopathy patient populations and DNA testing. Our initial prepilot work suggested that the more complex elicitation techniques advocated in the literature were difficult to use in practice. In contrast, our approach achieved a reasonable response rate (50%), provided logical answers, and was generally rated as easy to use by respondents. The computer software user interface permitted graphical feedback throughout the elicitation process. The distributions obtained were incorporated into the model, enabling the use of probabilistic sensitivity analysis. There is clearly a gap in the literature between theoretical elicitation techniques and tools that can be used in applied decision-analytic models. The results of this methodological study are potentially valuable for other decision analysts deriving expert opinion.
Neural correlates related to action observation in expert archers.
Kim, Yang-Tae; Seo, Jee-Hye; Song, Hui-Jin; Yoo, Done-Sik; Lee, Hui Joong; Lee, Jongmin; Lee, Gunyoung; Kwon, Eunjin; Kim, Jin Goo; Chang, Yongmin
2011-10-01
A growing body of evidence suggests that activity of the mirror neuron system is dependent on the observer's motor experience of a given action. It remains unclear, however, whether activity of the mirror neuron system is also associated with the observer's motor experience in sports game. Therefore, the aim of the present study is to investigate differences in activation of the mirror neuron system during action observation between experts and non-archer control subjects. We used video of Western-style archery in which participants were asked to watch the archery movements. Hyperactivation of the premotor and inferior parietal cortex in expert archers relative to non-archer control subjects suggests that the human mirror neuron system could contain and expand representations of the motor repertoire. The fact that dorsomedial prefrontal cortex was more active in expert archers than in non-archer control subjects indicates a spontaneous engagement of theory of mind in experts when watching video of Western-style archery. Compared with the non-archer control subjects, expert archers showed greater activation in the neural system in regions associated with episodic recall from familiar and meaningful information, including the cingulate cortex, retrosplenial cortex, and parahippocampal gyrus. The results demonstrate that expertise effects stimulate brain activity not only in the mirror neuron system but also in the neural networks related to theory of mind and episodic memory. Copyright © 2011 Elsevier B.V. All rights reserved.
Diagnosing battery behavior with an expert system in Prolog
International Nuclear Information System (INIS)
Kirkwood, N.; Weeks, D.J.
1986-01-01
Power for the Hubble Space Telescope comes from a system of 20 solar panel assemblies (SPAs) and six nickel-cadmium batteries. The HST battery system is simulated by the HST Electrical Power System (EPS) testbed at Marshall Space Flight Center. The Nickel Cadmium Battery Expert System (NICBES) is being used to diagnose faults of the testbed system, evaluate battery status and provide decision support for the engineer. Extensive telemetry of system operating conditions is relayed through a DEC LSI-11, and sent on to an IBM PC-AT. A BASIC program running on the PC monitors the flow of data, figures cell divergence and recharge ratio and stores these values, along with other selected data, for use by the expert system. The expert system is implemented in the logic programming language Prolog. It has three modes of operation: fault diagnosis, status and advice, and decision support. An alert or failure of the system will trigger a diagnosis by the system to assist the operator. The operator can also request battery status information as well as a number of plots and histograms of recent battery behavior. Trends in EOC and EOD voltage, recharge ratio and divergence are used by the expert system in its analysis of battery status. A future enhancement to the system includes the statistical prediction of battery life. Incorporating learning into the expert system is another possible enhancement; This is a difficult task, but one which could promise great rewards in improved battery performance
School Construction Management: Expert Administrators Speak.
Fickes, Michael
2001-01-01
Presents expert opinion on school construction management communication concerning educational needs, obtaining consensus among diverse groups, and envisioning what schools must offer in the future. Why furniture issues are also important is highlighted. (GR)
Expert incentives: cure versus prevention
de Jaegher, K.
This paper distinguishes between two scenarios for the expert-client encounter. In the cure scenario, the client does not know whether a loss can be recovered. In the prevention scenario, the client faces a threat but does not know whether this threat is real enough to justify preventive action. The
Expert System dan Aplikasinya dalam Auditing: Suatu Metode Mempelajari Pertimbangan Materialitas
Directory of Open Access Journals (Sweden)
Erni Suryandari
2005-07-01
Full Text Available Expert system is an intellegence computer system that uses knowledge and inference procedures to solve quite a difficult problem which in unstructured in its nature. This purpose of this study is to discuss the benefit of expert system as an aid in decision making by auditors in auditing financial statement, especially when auditors are making audit planner. In making audit planner, expert system helps evaluate audit risk and judgment materiality. Judgment materiality planning will effect the nature, time and the extent of audit procedure. In the future, expert system will be a challenge to the accounting profession in order to get the benefit from the coming technology to improve performance and reduce cost.
Application of expert system in library and information science: a review
International Nuclear Information System (INIS)
Bhatti, A.R.
1988-09-01
This study seeks to provide an overview of the current state of development in the application of expert system in technology in the field of library and information science. The study starts briefly looking into the capabilities of Artificial Intelligence (AI) in general and then its relevance to LIS (Library Information System) work. A basic introduction to expert system technology and outgrowth of AI research is given. The major components of a generalized expert system are discussed in some detail, and the ways in which system development can be approached are looked at. The main area of expert system applications in library and information science are discussed, looking at cataloguing, classification, reference work and library management etc. (author)
The Expert Project Management System (EPMS)
Silverman, Barry G.; Diakite, Coty
1986-01-01
Successful project managers (PMs) have been shown to rely on 'intuition,' experience, and analogical reasoning heuristics. For new PMs to be trained and experienced PMs to avoid repeating others' mistakes, it is necessary to make the knowledge and heuristics of successful PMs more widely available. The preparers have evolved a model of PM thought processes over the last decade that is now ready to be implemented as a generic PM aid. This aid consists of a series of 'specialist' expert systems (CRITIC, LIBRARIAN, IDEA MAN, CRAFTSMAN, and WRITER) that communicate with each other via a 'blackboard' architecture. The various specialist expert systems are driven to support PM training and problem solving since any 'answers' they pass to the blackboard are subjected to conflict identification (AGENDA FORMULATOR) and GOAL SETTER inference engines.
Expert systems as applied to bridges and pavements : an overview.
1986-01-01
Expert systems is a rapidly emerging new application of computers to aid decision makers in solving problems. This report gives an overview of what expert systems are and of what use they may be to a transportation department. The focus of the applic...
Chinese academic experts' assessment for forest bio-energy development in China
International Nuclear Information System (INIS)
Qu Mei; Ahponen, Pirkkoliisa; Tahvanainen, Liisa; Pelkonen, Paavo
2010-01-01
The aim of this study was to assess the current situation of the forest bio-energy development in China. This assessment is based on opinions of Chinese academic experts. Key drivers and uncertainties regarding the implementation, and the strategies for the future practices in the development of forest bio-energy were investigated. In addition, the purpose of this study was also to determine whether there is a consensus among the experts concerning forest bio-energy and if this consensus agrees with policy-makers in China. A thorough assessment was conducted using a two-round Delphi survey of sixty-one bio-energy experts in China. The results revealed the advantages, potential problems, and the experts' recommendations for the future development. Furthermore, the experts agreed that the Chinese government plays a dominant role in the development process of forest bio-energy in the country. The experts recognized that the process of developing forest bio-energy is a challenging task both domestically and globally. At the same time they also highlighted the potential benefits of developing forest bio-energy in China during the next ten years. The outcomes of this study could be used to give advice to policy-makers and to support the implementation of the future forest bio-energy policies in China.
Expert system for controlling plant growth in a contained environment
May, George A. (Inventor); Lanoue, Mark Allen (Inventor); Bethel, Matthew (Inventor); Ryan, Robert E. (Inventor)
2011-01-01
In a system for optimizing crop growth, vegetation is cultivated in a contained environment, such as a greenhouse, an underground cavern or other enclosed space. Imaging equipment is positioned within or about the contained environment, to acquire spatially distributed crop growth information, and environmental sensors are provided to acquire data regarding multiple environmental conditions that can affect crop development. Illumination within the contained environment, and the addition of essential nutrients and chemicals are in turn controlled in response to data acquired by the imaging apparatus and environmental sensors, by an "expert system" which is trained to analyze and evaluate crop conditions. The expert system controls the spatial and temporal lighting pattern within the contained area, and the timing and allocation of nutrients and chemicals to achieve optimized crop development. A user can access the "expert system" remotely, to assess activity within the growth chamber, and can override the "expert system".
Experiment with expert system guidance of an engineering analysis task
International Nuclear Information System (INIS)
Ransom, V.H.; Fink, R.K.; Callow, R.A.
1986-01-01
An experiment is being conducted in which expert systems are used to guide the performance of an engineering analysis task. The task chosen for experimentation is the application of a large thermal hydraulic transient simulation computer code. The expectation from this work is that the expert system will result in an improved analytical result with a reduction in the amount of human labor and expertise required. The code associated functions of model formulation, data input, code execution, and analysis of the computed output have all been identified as candidate tasks that could benefit from the use of expert systems. Expert system modules have been built for the model building and data input task. Initial results include the observation that human expectations of an intelligent environment rapidly escalate and structured or stylized tasks that are tolerated in the unaided system are frustrating within the intelligent environment
Expert systems for space power supply: design, analysis, and evaluation
International Nuclear Information System (INIS)
Cooper, R.S.; Thomson, M.K.; Hoshor, A.
1987-01-01
The authors evaluated the feasibility of applying expert systems to the conceptual design, analysis, and evaluation of space power supplies in particular, and complex systems in general. To do this, they analyzed the space power supply design process and in associated knowledge base, and characterized them in a form suitable for computer emulation of a human expert. The existing expert system tools and the results achieved with them were evaluated to assess their applicability to power system design. They applied some new concepts for combining program architectures (modular expert systems and algorithms) with information about the domain to create a deep system for handling the complex design problem. They authors developed, programmed and tested NOVICE, a code to solve a simplified version of a scoping study of a wide variety of power supply types for a broad range of missions, as a concrete feasibility demonstration
ANAPPRES: An expert system for interference well-test analysis
Energy Technology Data Exchange (ETDEWEB)
Arellano, V.M.; Iglesias, E.R.; Arellano, J.; Schwarzblat, M.
1988-01-01
We present ANAPPRES V1.0, the first version of a computerized expert system capable of analyzing constant- and variable-flowrate interference tests, in which there is one active well and an arbitrary number of observation wells, in liquid-saturated homogeneous reservoirs. ANAPPRES successfully couples mathematical models, optimization techniques, heuristic knowledge and computerized graphics, a combination not often found in published expert systems. Its main advantages are that it is user friendly, requires essentially no experience on the part of the analyst, eliminates subjectivity associated with earlier techniques of analysis, can handle complex cases and large data sets, completes the analysis of even the most complex cases (including plotting the results) in one run, and is significantly faster than a human expert.
Rule - based Fault Diagnosis Expert System for Wind Turbine
Directory of Open Access Journals (Sweden)
Deng Xiao-Wen
2017-01-01
Full Text Available Under the trend of increasing installed capacity of wind power, the intelligent fault diagnosis of wind turbine is of great significance to the safe and efficient operation of wind farms. Based on the knowledge of fault diagnosis of wind turbines, this paper builds expert system diagnostic knowledge base by using confidence production rules and expert system self-learning method. In Visual Studio 2013 platform, C # language is selected and ADO.NET technology is used to access the database. Development of Fault Diagnosis Expert System for Wind Turbine. The purpose of this paper is to realize on-line diagnosis of wind turbine fault through human-computer interaction, and to improve the diagnostic capability of the system through the continuous improvement of the knowledge base.
The development of an expert system to tune a beam line
International Nuclear Information System (INIS)
Schultz, D.E.; Brown, P.A.; British Columbia Univ., Vancouver, BC
1989-01-01
The experience of developing an Expert System to aid in the tuning of the Ion Source Injection beam line at TRIUMF is described. The challenging and complex task of introducing Expert System technology into an established accelerator operation is outlined. Success in this environment depends strongly on the choice of project, the choice of experts, the choice of tools, and the methods used to represent the expertise. All these choices are discussed
The contribution of research on expertise to understanding of expert thinking
Directory of Open Access Journals (Sweden)
Krnjaić Zora
2013-01-01
Full Text Available Expertise is determined based on the high level of mastery of knowledge and skills in different areas of human activities (science, art, sports and other less formal domains. This paper explores the contribution of empirical research on expertise to understanding of the nature of expert thinking. For that purpose we have compiled an overview and performed an analysis of the findings of relevant research on expertise based on different approaches and paradigms. We have included the studies that researched experts singled out based on their exceptional performances in different domains (absolute expertise and the studies based on comparing experts with novices (relative expertise. We have analyzed the studies using different paradigms: psychometric and cognitive paradigms, as well as the new offshoot, the paradigm based on viewing giftedness as developing expertise. Research results provide empirically grounded findings on the characteristics of expert thinking and consistently point to the fact that knowledge is the core of expertise. The characteristics of expert knowledge are operationalized via the quantity and organization of knowledge and the mastery of deep contents and knowledge systems, which enables the recognition of rules, models and information sets, as well as the use of knowledge in further studying, detecting and solving different problems. It can be concluded that research findings on expertise are one of the foundations in the conceptualization of expert thinking. They significantly contribute to obtaining an insight into the way in which knowledge shapes thought and into understanding the mechanisms of demonstrating knowledge in the mental processes of experts.
Johnson, Randy
2011-01-01
Throughout history, advances in technology have come in spurts. A single great idea can often spur rapid change as the idea takes hold and is propagated, often in totally unexpected directions. Exadata embodies such a change in how we think about and manage relational databases. The key change lies in the concept of offloading SQL processing to the storage layer. That concept is a huge win, and its implementation in the form of Exadata is truly a game changer. Expert Oracle Exadata will give you a look under the covers at how the combination of hardware and software that comprise Exadata actua
International Nuclear Information System (INIS)
Martin, B.
1982-01-01
In an article critical of experts, the cases argued for and against nuclear power are discussed under the headings: environmental hazards arising from the nuclear fuel cycle; proliferation of nuclear weapons capabilities via expansion of the nuclear power industry; political and social threats and restraints of a nuclear society (terrorism, reduction in civil liberties, centralised political and economic power); economic and employment disadvantages of nuclear power; impact of uranium mining on (Australian) aboriginal culture; inadequacy of nuclear power as a solution to energy problems; advantages of a 'soft energy path' based around conservation and renewable energy technologies. (U.K.)
The Effect of Customer Empowerment on Adherence to Expert Advice
N.M.A. Camacho (Nuno); M.G. de Jong (Martijn); S. Stremersch (Stefan)
2014-01-01
textabstractCustomers often receive expert advice related to their health, finances, taxes or legal procedures, to name just a few. A noble stance taken by some is that experts should empower customers to make their own decisions. In this article, we distinguish informational from decisional
Sensitivity Verification of PWR Monitoring System Using Neuro-Expert For LOCA Detection
International Nuclear Information System (INIS)
Muhammad Subekti
2009-01-01
Sensitivity Verification of PWR Monitoring System Using Neuro-Expert For LOCA Detection. The present research was done for verification of previous developed method on Loss of Coolant Accident (LOCA) detection and perform simulations for knowing the sensitivity of the PWR monitoring system that applied neuro-expert method. The previous research continuing on present research, has developed and has tested the neuro-expert method for several anomaly detections in Nuclear Power Plant (NPP) typed Pressurized Water Reactor (PWR). Neuro-expert can detect the LOCA anomaly with sensitivity of primary coolant leakage of 7 gallon/min and the conventional method could not detect the primary coolant leakage of 30 gallon/min. Neuro expert method detects significantly LOCA anomaly faster than conventional system in Surry-1 NPP as well so that the impact risk is reducible. (author)
Expert System For Diagnosis Pest And Disease In Fruit Plants
Dewanto, Satrio; Lukas, Jonathan
2014-03-01
This paper discussed the development of an expert system to diagnose pests and diseases on fruit plants. Rule base method was used to store the knowledge from experts and literatures. Control technique using backward chain and started from the symptoms to get conclusions about the pests and diseases that occur. Development of the system has been performed using software Corvid Exsys developed by Exsys company. Results showed that the development of this expert system can be used to assist users in identifying the type of pests and diseases on fruit plants. Further development and possibility of using internet for this system are proposed.
An Expert System for the Development of Efficient Parallel Code
Jost, Gabriele; Chun, Robert; Jin, Hao-Qiang; Labarta, Jesus; Gimenez, Judit
2004-01-01
We have built the prototype of an expert system to assist the user in the development of efficient parallel code. The system was integrated into the parallel programming environment that is currently being developed at NASA Ames. The expert system interfaces to tools for automatic parallelization and performance analysis. It uses static program structure information and performance data in order to automatically determine causes of poor performance and to make suggestions for improvements. In this paper we give an overview of our programming environment, describe the prototype implementation of our expert system, and demonstrate its usefulness with several case studies.
A framework for building real-time expert systems
Lee, S. Daniel
1991-01-01
The Space Station Freedom is an example of complex systems that require both traditional and artificial intelligence (AI) real-time methodologies. It was mandated that Ada should be used for all new software development projects. The station also requires distributed processing. Catastrophic failures on the station can cause the transmission system to malfunction for a long period of time, during which ground-based expert systems cannot provide any assistance to the crisis situation on the station. This is even more critical for other NASA projects that would have longer transmission delays (e.g., the lunar base, Mars missions, etc.). To address these issues, a distributed agent architecture (DAA) is proposed that can support a variety of paradigms based on both traditional real-time computing and AI. The proposed testbed for DAA is an autonomous power expert (APEX) which is a real-time monitoring and diagnosis expert system for the electrical power distribution system of the space station.
[The application of the expert system in prosthedontics].
Lu, P; Li, G; Wang, Y
1996-11-01
In this study, we developed an expert system for designing of frame work of Removable Partial Denture by the method of Artificial Intelligence. Both of Quick Basic and Tuber C language are used in this program. This system consider more other relative factors in removable partial denture designing except the amount and position of missing teeth. Base the idea of multy-layer knowledge we divide the process RPD designing into different layers according to their logical relationships. So, this system could imitate better the expert of prosthedontics to do the clinical examination, diagnosis, treatment plan and denture designing. There are 11 modules in this system totally. They are used to accomplish the case register, first visit examination, treatment plan, abutment examination, denture designing, biomechanic analysis of abutment, reference, explanation and etc. We used this system for 20 partial edentulous patients and compared the results with the designing plans of expert of prosthedontics, the rate of conformity is 83.6%.
Are expert systems needed on the power exchange?
International Nuclear Information System (INIS)
Nilsson, David.
1991-09-01
The goal of this masters thesis is to investigate whether it is possible to improve the activities at the power production unit (PDP) at Sydkraft with the help of expert systems. Another goal is that the produced result should work as an education material for the production operators. Therefore the work contains a detailed description of the power exchange and the factors that influence it, in addition to a description of the work tasks of the operators. The conclusions are, first, that an embedded critiquing system would enable a quicker training of new operators, while also giving the more experienced operators feedback on their decisions. Secondly, the water storage operation should be documented, to create a basis for the development of an expert system, and to create more material for education. The thesis also suggests a new model for the development of expert systems in areas where it is not known whether such a solution is possible. (au)
An expert system framework for nondestructive waste assay
International Nuclear Information System (INIS)
Becker, G.K.
1996-01-01
Management and disposition of transuranic (RU) waste forms necessitates determining entrained RU and associated radioactive material quantities as per National RU Waste Characterization Program requirements. Technical justification and demonstration of a given NDA method used to determine RU mass and uncertainty in accordance with program quality assurance is difficult for many waste forms. Difficulties are typically founded in waste NDA methods that employ standards compensation and/or employment of simplifying assumptions on waste form configurations. Capability to determine and justify RU mass and mass uncertainty can be enhanced through integration of waste container data/information using expert system and empirical data-driven techniques with conventional data acquisition and analysis. Presented is a preliminary expert system framework that integrates the waste form data base, alogrithmic techniques, statistical analyses, expert domain knowledge bases, and empirical artificial intelligence modules into a cohesive system. The framework design and bases in addition to module development activities are discussed
Expert system for skin problem consultation in Thai traditional medicine.
Nopparatkiat, Pornchai; na Nagara, Byaporn; Chansa-ngavej, Chuvej
2014-01-01
This paper aimed to demonstrate the research and development of a rule-based expert system for skin problem consulting in the areas of acne, melasma, freckle, wrinkle, and uneven skin tone, with recommended treatments from Thai traditional medicine knowledge. The tool selected for developing the expert system is a software program written in the PHP language. MySQL database is used to work together with PHP for building database of the expert system. The system is web-based and can be reached from anywhere with Internet access. The developed expert system gave recommendations on the skin problem treatment with Thai herbal recipes and Thai herbal cosmetics based on 416 rules derived from primary and secondary sources. The system had been tested by 50 users consisting of dermatologists, Thai traditional medicine doctors, and general users. The developed system was considered good for learning and consultation. The present work showed how such a scattered body of traditional knowledge as Thai traditional medicine and herbal recipes could be collected, organised and made accessible to users and interested parties. The expert system developed herein should contribute in a meaningful way towards preserving the knowledge and helping promote the use of Thai traditional medicine as a practical alternative medicine for the treatment of illnesses.
Expert systems for the transportation of hazardous and radioactive materials
International Nuclear Information System (INIS)
Luce, C.E.; Clover, J.C.; Ferrada, J.J.
1994-01-01
Under the supervision of the Transportation Technologies Group which is in the Chemical Technology Division at Oak Ridge National Laboratory, an expert system prototype for the transportation and packaging of hazardous and radioactive materials has been designed and developed. The development of the expert system prototype focused on using the combination of hypermedia elements and the Visual Basic trademark programming language. Hypermedia technology uses software that allows the user to interact with the computing environment through many formats: text, graphics, audio, and full-motion video. With the use of hypermedia, a user-friendly prototype has been developed to sort through numerous transportation regulations, thereby leading to the proper packaging for the materials. The expert system performs the analysis of regulations that an expert in shipping information would do; only the expert system performs the work more quickly. Currently, enhancements in a variety of categories are being made to the prototype. These include further expansion of non-radioactive materials, which includes any material that is hazardous but not radioactive; and the addition of full-motion video, which will depict regulations in terms that are easy to understand and which will show examples of how to handle the materials when packaging them
Regional brain changes occurring during disobedience to "experts" in financial decision-making.
Directory of Open Access Journals (Sweden)
Victoria Y M Suen
Full Text Available It is well recognized that individuals follow "Expert" advice, even when flawed and offers no advantage, and sometimes leads to disadvantages. The neurobiology underlying this is uncertain, and in particular there is an incomplete understanding of which brain regions are most involved when individuals chose to disobey an expert. To study this we examined functional magnetic resonance imaging (fMRI differences during an investment game where subjects received differentially credible investment advice. Participants (n = 42; 32 males played an investment game, in which they could Buy or Not Buy a sequence of stocks. The better they did, the more money they made. Participants received either "Expert" advice or "Peer" advice. Those receiving Expert advice were told the advice came from a certified financial "Expert". Those receiving Peer Advice were told the advice was that of the student administering the scans, who deliberately dressed and acted casually. Both streams of advice were predetermined and identical. The advice was scripted to be helpful initially, but progressively worse as the task continued, becoming 100% wrong by the end of the task. Subjects receiving Expert Advice followed the advice significantly longer on average, even though this was progressively worse advice. Thus, following Expert advice had poorer consequences for individuals, but this did not dissuade them from continuing to follow the advice. In contrast, when subjects disobeyed Expert advice they exhibited significant anterior cingulate cortex (ACC and superior frontal gyrus activation relative to those disobeying Peer advice. These findings may suggest that in subjects who defy authority, or believe they are doing so (in this case by disobeying an "Expert" there is increased activation of these two brain regions. This may have relevance to several areas of behavior, and the potential role of these two brain regions in regard to disobedience behavior requires further
Application of expert elicitation techniques in human reliability, assessment
International Nuclear Information System (INIS)
Sanyasi Rao, V.V.S.; Saraf, R.K.; Ghosh, A.K.; Kushwaha, H.S.
2006-01-01
Expert elicitation techniques are being used, in the area of technological forecasting, in estimating data needed for analysis when it is either difficult to arrive at the data by experimental means or when it is quite involved to plan and conduct the experiment. In this study, expert elicitation techniques are applied to the evaluation of the frequencies of the various accident sequences that can result from the initiating event (IE) 'High Pressure Process Water (HPPW) system failure' in typical Indian Pressurised Heavy Water Reactor (IPHWR) of the older generation. The Operating Procedure under Emergency Conditions (OPEC) for this IE involves human actions according to a pre-defined procedure. The Human Error Probabilities for all these human actions are obtained using expert elicitation techniques. These techniques aim at eliciting the opinion of the experts in the area of interest with regard to the issue in question. The uncertainty is analysed by employing the measure of dissonance and the most probable range of human error probabilities are arrived at by maximizing this measure. These values are combined using the same procedures mentioned above to yield a distribution representing the uncertainty associated with the predictions. (author)
Developing knowledge management systems with an active expert methodology
International Nuclear Information System (INIS)
Sandahl, K.
1992-01-01
Knowledge management, understood as the ability to store, distribute and utilize human knowledge in an organization, is the subject of this dissertation. In particular we have studied the design of methods and supporting software for this process. Detailed and systematic description of the design and development processes of three case-study implementations of knowledge management software are provided. The outcome of the projects is explained in terms of an active expert development methodology, which is centered around support for a domain expert to take substantial responsibility for the design and maintenance of a knowledge management system in a given area of application. Based on the experiences from the case studies and the resulting methodology, an environment for automatically supporting knowledge management was designed in the KNOWLEDGE-LINKER research project. The vital part of this architecture is a knowledge acquisition tool, used directly by the experts in creating and maintaining a knowledge base. An elaborated version of the active expert development methodology was then formulated as the result of applying the KNOWLEDGE-LINKER approach in a fourth case study. This version of the methodology is also accounted for and evaluated together within the supporting KNOWLEDGE-LINKER architecture. (au)
1st Advanced Marine Renewable Energy Instrumentation Experts Workshop
Energy Technology Data Exchange (ETDEWEB)
none,
2011-10-01
The U.S. marine energy industry is actively pursuing development of offshore wind and marine hydrokinetic (MHK) energy systems. Experience in the wind energy sector demonstrates that new technology development requires thorough measurement and characterization of the environmental conditions prevalent at installation sites and of technology operating in the field. Presently, there are no turn-key instrumentation system solutions that meet the measurement needs of the marine energy industry. The 1st Advanced Marine Renewable Energy Instrumentation Experts Workshop brought together technical experts from government laboratories, academia, and industry representatives from marine energy, wind, offshore oil and gas, and instrumentation developers to present and discuss the instrumentation needs of the marine energy industry. The goals of the meeting were to: 1. Share the latest relevant knowledge among technical experts; 2. Review relevant state-of-the-art field measurement technologies and methods; 3. Review lessons learned from recent field deployments; 4. Identify synergies across different industries; 5. Identify gaps between existing and needed instrumentation capabilities; 6. Understand who are the leading experts; 7. Provide a forum where stakeholders from the marine energy industry could provide substantive input in the development of new marine energy field deployable instrumentation packages.
Expert System Dan Aplikasinya Dalam Auditing: Suatu Metode Mempelajari Pertimbangan Materialitas
Suryandari, Erni
2001-01-01
Expert system is an intellegence computer system that uses knowledge and inference procedures to solve quite a difficult problem which in unstructured in its nature. This purpose of this study is to discuss the benefit of expert system as an aid in decision making by auditors in auditing financial statement, especially when auditors are making audit planner. In making audit planner, expert system helps evaluate audit risk and judgment materiality. Judgment materiality planning will effect the...
Expert System dan Aplikasinya dalam Auditing: Suatu Metode Mempelajari Pertimbangan Materialitas
Erni Suryandari
2005-01-01
Expert system is an intellegence computer system that uses knowledge and inference procedures to solve quite a difficult problem which in unstructured in its nature. This purpose of this study is to discuss the benefit of expert system as an aid in decision making by auditors in auditing financial statement, especially when auditors are making audit planner. In making audit planner, expert system helps evaluate audit risk and judgment materiality. Judgment materiality planning will effect the...
Registration of qualified radiation protection experts in the Netherlands
International Nuclear Information System (INIS)
Abrahamse, J.C.; Kops, J.A.M.M.; Vermeulen, A.M.T.I.; Zuur, C.
2002-01-01
In Euratom Directive 96/29 (1) the Euratom Basic Safety Standards are given. The member states of the EC have to implement this directive in their national legislation. In the Netherlands this is done in the new radiation protection legislation (Radiation Protection Decree 2002 (2)), which came into force in the first half of 2002. In this new regulation is stated that radiological activities must be done by or under supervision of a qualified radiation protection expert. With respect to the qualified expert is stated that: the qualified expert must be registered in a notified registration system; rules will be formulated with respect to the demanded qualification levels of the experts. These demands can be different for different tasks rules will be formulated for the notification of the register, the way to become registered, the costs and so on. Mid 2001 a project is started to prepare the registration system. Information was gained from and discussions took place with the important parties on the radiological playing field in the Netherlands (employers, organisations of experts and education institutes). Furthermore information is obtained from certification institutes. It was decided to accept as starting point the education levels obtained from the radiation protection education institutes, which are approved at the moment. At a later phase will be evaluated whether this system needs to be changed. In section 2 of this paper the radiation protection system in the Netherlands will be discussed in more detail. Section 2 deals with the target group and in section 3 the outlines of the registration system to be developed are discussed
Risk communication between Experts and the Public: Perceptions and Intentions
International Nuclear Information System (INIS)
Sjoeberg, Lennart; Verhost, Philippe; Bouzon, Arlette
2002-01-01
This paper develops a conceptual and theoretical analysis of risk communication in cases where experts and the public have widely divergent views about the size of a risk: experts find it very small but some members of the public have an opposite view. Other members of the public agree with the experts. Applications are chosen from the risk management problems inhere in the handling of spent nuclear fuel. It is pointed out that the conflicting views have very different bases.The role of trust is analyzed and while it is a crucial issue, it is much broader than what has usually been assumed. Trust refers not only to social trust (i.e. trust in experts or authorities/corporation) but also to basic notions regarding knowledge and science. In a communication situation, the communicated position with regard to risk seems may not be perceived correctly by any of the parties, and positions tend to be entrenched
Energy Technology Data Exchange (ETDEWEB)
Meyer, M.A.; Booker, J.M.
1990-01-01
Expert opinion is frequently used in probabilistic safety assessment (PSA), particularly in estimating low probability events. In this paper, we discuss some of the common problems encountered in eliciting and analyzing expert opinion data and offer solutions or recommendations. The problems are: that experts are not naturally Bayesian. People fail to update their existing information to account for new information as it becomes available, as would be predicted by the Bayesian philosophy; that experts cannot be fully calibrated. To calibrate experts, the feedback from the known quantities must be immediate, frequent, and specific to the task; that experts are limited in the number of things that they can mentally juggle at a time to 7 {plus minus} 2; that data gatherers and analysts can introduce bias by unintentionally causing an altering of the expert's thinking or answers; that the level of detail the data, or granularity, can affect the analyses; and the conditioning effect poses difficulties in gathering and analyzing of the expert data. The data that the expert gives can be conditioned on a variety of factors that can affect the analysis and the interpretation of the results. 31 refs.
Maria Tallchief. Raintree/Rivilo American Indian Stories Series.
Erdrich, Heidi Ellen
The great American ballerina, Maria Tallchief, was born in 1925 in Fairfax, Oklahoma. Her mother was White and her father was a full-blood Osage. Her younger sister, Marjorie, also became a famous dancer. The Osage originally lived in western Missouri. They lived in lodges or tepees and were farmers and hunters. The U.S. Government moved them to…
[Multicenter evaluation of the Nutri-Expert Telematic System in diabetic patients].
Turnin, M C; Bolzonella-Pene, C; Dumoulin, S; Cerf, I; Charpentier, G; Sandre-Banon, D; Valensi, P; Grenier, J L; Cathelineau, G; Mattei, C
1995-02-01
Nutri-Expert is a system for self-monitoring and dietetic education, accessible through Minitel. A preliminary randomised evaluation of one hundred diabetic patients in the Midi-Pyrénées region showed that Nutri-Expert improved dietetic knowledge, dietary habits and metabolic balance. The aim of the present study was to show that the system can be successfully prescribed to patients by physicians outside the center which originated it, indicating the benefit of a wider use of Nutri-Expert, among the diabetic population. One hundred and fifty-five patients, recruited by six French centres of diabetology, used Nutri-Expert from their homes for six months. Clinical examination, tests of dietetic knowledge and biological tests, including lipid fractions, were carried out before and after six months of use. After six months, there was a significant improvement in the patients' dietetic knowledge and in some biological parameters. Nutri-Expert is thus useful even when prescribed by a centre other than the hospital which devised the system. It is an additional beneficial tool in the ambulatory management of diabetic patients.
Objectification of injuries and consequences in expert medical opinions
Directory of Open Access Journals (Sweden)
Miran Vrabl
2007-04-01
Full Text Available Background: Only unequivocal evidence confirming the total extent of injury. Biomechanical analysis, objectifications of permanent consequences after injury and objectification, whether such injuries influence life activities of an injured person, should be the basics for preparation of expert medical opinion. To make a necessary distinction from the previous injuries or illnesses that might have influence on current health state of a patient and its treatment, analysis of all medical records of a certain injured person is needed. Therefore this are inevitable steps in preparation of an expert medical opinion. In cases when medical opinion should explain disability of a patient as a consequence of a certain contractual relationship, the contract should be taken into consideration when such opinions is prepared.Methods: 500 opinions have been retrospectively analysed, selected at random out of 3452 opinions, submitted in claims for damages at Zavarovalnica Maribor, d. d., in the period from January 2001 until January 2006. Thirteen typical data have been analysed and evaluated on the basis of objective evidences.Results: On the basis of analyses it has been established that there is a great difference between principles of objectification and the data in analysed opinions. It has been noticed the most obvious deviation in biomechanical analysis (95 %, in records of decreased life activities (90 %, in all medical records of an injured person (65 % and in objectification of permanent consequences after injuries (55 %.Conclusions: As results of analysis demonstrate, there are significant differences in preparations of expert and medical opinions in Slovenia, particularly when basic principles are analysed that need to be considered when writing such opinions. Irrational avoidance of basic principle of objectification, nomination of experts without licence in certain fields of medicine, avoidance of objectification of subjective statements of injured
National Cyber Expert Addresses ELP Class
Center for Homeland Defense and Security
2012-01-01
Center for Homeland Defense and Security, PRESS RELEASES Governments, businesses and educational institutions should be making cybersecurity a top priority, a leading expert told a class of the Center for Homeland Defense and Security’s Executive Leaders Program. Brian...
Construct validity and expert benchmarking of the haptic virtual reality dental simulator.
Suebnukarn, Siriwan; Chaisombat, Monthalee; Kongpunwijit, Thanapohn; Rhienmora, Phattanapon
2014-10-01
The aim of this study was to demonstrate construct validation of the haptic virtual reality (VR) dental simulator and to define expert benchmarking criteria for skills assessment. Thirty-four self-selected participants (fourteen novices, fourteen intermediates, and six experts in endodontics) at one dental school performed ten repetitions of three mode tasks of endodontic cavity preparation: easy (mandibular premolar with one canal), medium (maxillary premolar with two canals), and hard (mandibular molar with three canals). The virtual instrument's path length was registered by the simulator. The outcomes were assessed by an expert. The error scores in easy and medium modes accurately distinguished the experts from novices and intermediates at the onset of training, when there was a significant difference between groups (ANOVA, p<0.05). The trend was consistent until trial 5. From trial 6 on, the three groups achieved similar scores. No significant difference was found between groups at the end of training. Error score analysis was not able to distinguish any group at the hard level of training. Instrument path length showed a difference in performance according to groups at the onset of training (ANOVA, p<0.05). This study established construct validity for the haptic VR dental simulator by demonstrating its discriminant capabilities between that of experts and non-experts. The experts' error scores and path length were used to define benchmarking criteria for optimal performance.
Values in breast cancer screening: an empirical study with Australian experts
Parker, Lisa; Rychetnik, Lucie; Carter, Stacy
2015-01-01
Objective To explore what Australian experts value in breast screening, how these values are conceptualised and prioritised, and how they inform experts’ reasoning and judgement about the Australian breast-screening programme. Design Qualitative study based on interviews with experts. Participants 33 experts, including clinicians, programme managers, policymakers, advocates and researchers selected for their recognisable influence in the Australian breast-screening setting. Setting Australian breast-screening policy, practice and research settings. Results Experts expressed 2 types of values: ethical values (about what was good, important or right) and epistemological values (about how evidence should be created and used). Ethical values included delivering benefit, avoiding harm, promoting autonomy, fairness, cost effectiveness, accountability, professionalism and transparency. Epistemological values informed experts’ arguments about prioritising and evaluating evidence methodology, source population and professional interests. Some values were conceptualised differently by experts: for example, delivering benefit could mean reducing breast cancer mortality, reducing all-cause mortality, reducing mortality in younger women, reducing need for aggressive treatment, and/or reassuring women they were cancer free. When values came into conflict, experts prioritised them differently: for example, when experts perceived a conflict between delivering benefits and promoting autonomy, there were differences in which value was prioritised. We explain the complexity of the relationship between held values and experts’ overall views on breast cancer screening. Conclusions Experts’ positions in breast screening are influenced by evidence and a wide range of ethical and epistemological values. We conclude that discussions about values should be a regular part of breast-screening review in order to build understanding between those who hold different positions, and