WorldWideScience

Sample records for evelin kivilo-paas eli

  1. Mida sportijad vajavad? / Evelin Kivilo-Paas

    Index Scriptorium Estoniae

    Kivilo-Paas, Evelin, 1979-

    2015-01-01

    Sportijate toitainete vajaduse kohta jagavad selgitusi Tallinna Ülikooli terviseteaduste ja spordi instituudi direktor ja spordibioloog Kristjan Port, Synlab Eesti laboriarst dr Anneli Raave-Sepp ja Spordimeditsiini SA spordiarst dr Krista Veevo

  2. Kui vana on su keha? / Evelin Kivilo-Paas

    Index Scriptorium Estoniae

    Kivilo-Paas, Evelin, 1979-

    2012-01-01

    Keha vanuse testimisest Polar BodyAge'i programmi abil. Treener Kristi Roosimägi analüüsib osalejate, TV3 uudisteankur Marek Lindmaa, ilmateadustaja Liis Lusmäe ja reporter Feliks Unduski tulemusi

  3. Triatloniteel käänakuktega / Evelin Kivilo-Paas, Reeli Maasikamäe, Maret Einmann

    Index Scriptorium Estoniae

    Kivilo-Paas, Evelin, 1979-

    2012-01-01

    Kolme mehe, Tarmo Tuule, Martin Toomi ja Peeter Lume eksperimendist saavutamaks 9 kuuga paremat sportlikku vormi ja tervislikumat eluviisi. Ülevaade neljandal kuul saavutatust ja Tarmo Tuule triatloniks valmistumisest

  4. Evelin Ilves kiidab armsaid kodurestorane

    Index Scriptorium Estoniae

    2010-01-01

    Proua Evelin Ilves kiidab Facebook'is Pihode pere MerMeri restorani Kolga-Aabla külas ning Beatrice ja Priit Kuusiku nAnO restorani Tallinna vanalinnas. Vt. ka ristsõna lk. 42, mille lahenduseks on lause proua E. Ilveselt

  5. Evelin Ilves tegi transrasvadele ära

    Index Scriptorium Estoniae

    2010-01-01

    Proua Evelin Ilves kritiseeris kommivabriku Kalev toodangut transrasvhapete sisalduse pärast. Kalev Chocolate Factory on nüüdseks kõigi oma maiustuste valmistamisel loobunud hüdrogeenimata taimsete rasvade kasutamisest

  6. Evelin Ilves: hoidised head, hindamine kõikuv! / Evelin Ilves ; intervjueerinud Aldo Maksimov

    Index Scriptorium Estoniae

    Ilves, Evelin, 1968-

    2011-01-01

    Proua Evelin Ilves osales 2. novembril 2011 ajalehe Meie Maa korraldatud Saaremaa parima hoidise konkursi žüriis ning esitles Kuressaares, Rahva Raamatu kaupluses oma kokaraamatut "Kingitud maitsed"

  7. Evelin Ilvese aasta Kadriorus / Marii Karell, Aune Past, Leelo Tungal

    Index Scriptorium Estoniae

    Karell, Marii, 1980-

    2007-01-01

    Naistelehe peatoimetaja Marii Karell, raamatu "Mainekujundus ettevõtluses ja poliitikas" autor Aune Past ja lastekirjanik Leelo Tungal hindavad proua Evelin Ilvese esimest aastat presidendi abikaasa rollis

  8. Ruboxistaurin (Eli Lilly).

    Science.gov (United States)

    Wheeler, Glen D

    2003-02-01

    Eli Lilly & Co is developing the protein kinase C (PKC)-b inhibitor ruboxistaurin, the lead compound from a series of 14-membered macrocycles, for the potential treatment of diabetic retinopathy, diabetic peripheral neuropathy and macular edema.

  9. Evelin Ilves esineb Moskvas konverentsil / Jaanus Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Jaanus, 1973-

    2008-01-01

    Proua Evelin Ilves esineb Moskvas ülevenemaalises väliskirjanduse raamatukogus toimuval rahvusvahelisel konverentsil "Naised muutuvas maailmas" ettekandega "Kas meeste tervis on naiste probleem?" Proua E. Ilvese esinemise initsiaator on Moskva rahvusvahelisse naisteklubisse kuuluv Eesti suursaadik Marina Kaljurand. Proua E. Ilves külastab ka Teemandifondi Kremlis ja vaatab Et Cetera teatris Adolf Šapiro lavastatud "451 kraadi Fahrenheiti", kus peaosa mängib Elmo Nüganen. Vt. samas: Esimene esimene leedi Moskvas. Teadaolevalt on proua E. Ilves esimene Eesti riigipea abikaasa, kes ametlikult külastab oma abikaasa ametiaja jooksul Venemaa pealinna

  10. Drotrecogin alfa Eli Lilly

    NARCIS (Netherlands)

    de Jonge, E.

    2002-01-01

    Drotrecogin alfa (Xigris, recombinant activated protein C) is an anticoagulant developed and launched by Eli Lilly & Co for the treatment of sepsis [333781], [339372], [430133], [436271]. The FDA and the EMEA accepted the brand name Xigris for drotrecogin alfa in June 2001. This trade name had been

  11. Soul / Randy Becker, Bill Evans, Evelin Samuel ; interv. Sven Sapelson

    Index Scriptorium Estoniae

    Becker, Randy

    2007-01-01

    The Soulbop Bandi rajajad Randy Becker ja Bill Evans ning meie Evelin Samuel gospeli ja rhytmblues'i juurtega soulist. Lk. 72-73 Inessa Josingu ja Ande Kaalepi souliteemaline fotolavastusega ruumikujundus

  12. Evelin Ilves: E-aineid tulvil viiner pole mingi odavtoit! / Eiris Teeveere

    Index Scriptorium Estoniae

    Teeveere, Eiris

    2011-01-01

    Proua Evelin Ilves kritiseeris viinereid (Ilves, Evelin. Talvekuine. Eesti Naine, 2011, nov., lk. 138). Arvamust avaldavad lastearst ja toitumisspetsialist Mai Maser ning Rakvere lihakombinaadi kvaliteedidirektor Viiu Kübar

  13. Vanaduse garantii / Evelin Int-Lambot

    Index Scriptorium Estoniae

    Int-Lambot, Evelin, 1968-

    2005-01-01

    Olukorras, kus umbes 20% Eesti lastest elab vaesuses ja igal aastal lisandub ligi 1200 vanemliku hoolitsuseta last, ei tohiks kurta ideepuuduse üle, mida teha EL-i ja NATO-sse saamise järel. Eesmärk peaks olema, et ükski laps ei elaks vaesuses

  14. Anidulafungin (Eli Lilly & Co).

    Science.gov (United States)

    Hawser, S

    1999-12-01

    The pentyloxyterphenyl side chain derivative of echinocandin B, anidulafungin, is a 1,3-alpha-glucan synthesis inhibitor undergoing phase II clinical trials by Versicor and Eli Lilly, in various formulations, for the potential treatment of fungal and protozoal infections. Eli Lilly has retained options to the oral formulation of the compound, but development, clinical registration and marketing rights were licensed to Versicor in June 1999. The primary target of this compound is Candida, but Eli Lilly also intends to develop the drug for Aspergillus infections. No activity has been shown against Cryptococcus. The oral activity of anidulafungin is compromised by a low bioavailability, a decreased absorption when taken with food, and gastrointestinal side effects at higher doses. The development of a phosphorylated prodrug, LY-307853, which is converted in the body to anidulafungin by tissue and serum phosphatases, was discontinued in favor of an oral formulation, which uses anidulafungin directly. In February 1999, Deutsche Bank predicted sales of $100 million in 2001, rising to $300 million in 2003.

  15. Oritavancin. Eli Lilly & Co.

    Science.gov (United States)

    Barrett, J F

    2001-08-01

    Oritavancin (LY-333328), a lead glycopeptide from a series targeted at vancomycin-resistant bacteria, especially enterococci, is under development by Eli Lilly for the potential treatment of bacterial infections. It entered phase III trials in the US in January 2001 [396223] and the company expects to submit an NDA by 2003 [396478]. Oritavancin has been reported to have activity comparable to that of vancomycin and teicoplanin (Aventis Pharma AG), but retains activity against glycopeptide-resistant bacterial strains [407519]. The bactericidal activity of oritavancin suggests that it may prove useful as a single agent therapy in the treatment of antibiotic-resistant enterococci. Although its mechanism of action is unclear, dimerization of the glycosyl portion stabilizing D-Ala-D-Ala binding has been suggested [337644].

  16. Firmad kujundavad Eesti brändi / Evelin Ojamets

    Index Scriptorium Estoniae

    Ojamets, Evelin

    2001-01-01

    Eesti mainekujundamise projektijuhi Evelin Int-Lamboti sõnul tuleb Eesti märgiks valida tooted, mis tarbija jaoks ei ole juba seotud mõne teise riigi imagoga. ES Turu-uuringute AS-i koduleheküljel toimunud online-turundusfoorumist. Eesti brändid

  17. Ühe suve akvarellid / Evelin Samuel ja Liina Hergauk

    Index Scriptorium Estoniae

    Samuel, Evelin, 1975-

    2015-01-01

    Roosanupuline kampsun, idee ja teostus Evelin Samuel. Vanaroosa pluus ja barett, idee ja teostus Ruta Tännav. Mohäärlõngast topp, idee ja teostus Anna Verschik. Linane topp, idee ja teostus Liina Hergauk. Pitsmustritega mohäärkleit, idee ja teostus Ruta Tännav. Puuvillane topp, idee ja teostus Anna Verschik

  18. Evelin Ilves saab sama nimega firmalt tasuta uisutrikoosid / Kadri Jakobson

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2008-01-01

    Proua Evelin Ilves saab rulluisutrikood tootjafirmalt Ilves-Extra tasuta. Presidendi kantselei sõnul testib Rulluisuliidu president E. Ilves uisutrikood, mida Ilves-Extra alles kavatseb tootmisse võtta. Arvamust avaldavad Ilves-Extra juht Arvo Kivikas ja suhtekorraldusekspert Ivo Rull

  19. Evelin Ilves avas SOS Lasteküla

    Index Scriptorium Estoniae

    2010-01-01

    SOS Lasteküla patroon proua Evelin Ilves avas 1. juunil 2010 Põltsamaal Eesti teise SOS Lasteküla. Presidendi abikaasa tõi kingiks õunapuuistikuid ja lasteraamatuid. Ilmunud ka: Eesti Päevaleht 2. juuni 2010, lk. 4

  20. Evelin Ilves ja Gerd Kanter kohtusid Viimsi kooli õpilastega

    Index Scriptorium Estoniae

    2011-01-01

    Proua Evelin Ilves ja olümpiavõitja Gerd Kanter kohtusid 19. mail 2011 Viimsi kooli õpilastega, et tunnustada Viimsi kooli 10. klassis õppivat noore sportlase preemia saajat, purjetajat Sten Christian Taali ning tänada kooli tema toetamise eest

  1. Tomoxetine (Eli Lilly & Co).

    Science.gov (United States)

    Preti, Antonio

    2002-02-01

    Eli Lilly is developing tomoxetine, a norepinephrine reuptake inhibitor, for the potential treatment of attention deficit hyperactivity disorder (ADHD) and depression. As of May 2000, tomoxetine was undergoing phase III trials in the US [368128]. An NDA was filed with the FDA in October 2001, with a launch expected in the second half of 2002 [426786]. Tomoxetine was first investigated by Lilly in the 1980s as a potential treatment for depressive illness. The compound was selected from a series of potent inhibitors of norepinephrine reuptake, and reached large-scale phase II clinical trials for depression in 1990. Development for this indication appeared to stop at that time, despite some evidence that tomoxetine wasfairly effective [273943]. In 1996, Lilly apparently restarted preclinical development of tomoxetine as a potential therapyfor ADHD, and submitted EP-00721777 claiming tomoxetine's utility for this disorder in July of that year [273956]. In June 2001, ABN AMRO predicted sales of $121 million in 2002, rising to $4,064 million in 2012 [422762]. In October 2001, analysts at Salomon Smith Barney predicted that the product would make sales of $24 million in 2002, rising to $305 million in 2005 [427501].

  2. Drotrecogin alfa Eli Lilly.

    Science.gov (United States)

    de Jonge, E

    2002-04-01

    Drotrecogin alfa (Xigris, recombinant activated protein C) is an anticoagulant developed and launched by Eli Lilly & Co for the treatment of sepsis [333781], [339372], [430133], [436271]. The FDA and the EMEA accepted the brand name Xigris for drotrecogin alfa in June 2001. This trade name had been proposed by Lilly in place of the previous brand name, Zovant, which was deemed unacceptable by the EMEA due to concerns that the name could be confused with hospital-based drugs [412512]. Filings for sepsis were made in the US, EU and Australia in February 2001 [398514], [447870] and in March 2001, the US FDA assigned drotrecogin alfa Priority Review status [403435]. The FDA extended the action date from July 27 to October 27, 2001 for completion of its review of the biologics license application (BLA) for drotrecogin alfa to assess further supplementary data submitted by Lilly [412512]. At the October 16, 2001 meeting (postponed from September 12), the FDA Advisory Committee on Anti-Infective Drugs split 10 to 10 over whether to recommend approval [425873], [425940]. In late October 2001, Lilly received an approvable letter from the FDA for the treatment of severe sepsis. Approval was contingent upon successful negotiation of labeling, agreement on post-approval clinical trials, and successful completion of manufacturing inspections [427301]. In November 2001, the FDA approved drotrecogin alfa for the reduction of mortality in adult patients with severe sepsis who have a high risk of death [430133]; the product was launched onto the US market days later [436271]. Following the FDA committee's split decision in October 2001, Credit Suisse First Boston, which expected mid-2002 approval but with restrictive labeling, revised its predictions from $1.265 billion in 2004 sharply downwards to $543 million [425929].

  3. Pemetrexed disodium (Eli Lilly).

    Science.gov (United States)

    Norman, P

    2001-11-01

    Pemetrexed, a thymidylate synthase (TS) and transferase inhibitor, is in phase III trials with Eli Lilly as a potential treatment for several common solid tumors, including non-small cell lung cancer (NSCLC) and mesothelioma [321789], [410731]. Studies on pemetrexed have concluded that not only is the compound a TS inhibitor but also a potent inhibitor of human dihydrofolate reductase (DHFR). The results suggest that pemetrexed acts upon multiple intracellular targets and that the antitumor effect may be derived from its simultaneous inhibition of multiple folate-requiring enzymes [203662]: this compound has been designated as a multitargeted antifolate (MTA) [386680]. The drug also causes concentration- and time-dependent apoptosis [284380]. Other studies in which the 4-oxo group of the pyrimidine ring portion of pemetrexed was replaced with a hydrogen atom, demonstrated that the resulting analogs were potent DHFR inhibitors with very little activity against the enzymes glycinamide ribonucleotide formyltransferase (GARFT) and TS [310674]. In phase II European studies in 64 patients with advanced breast cancer, encouraging responses were seen in anthracycline-failure (23%) and anthracycline-refractory (19%) patients. Responses were observed in 28% of patients who had been previously treated with a taxane [326097]. Data from a phase II trial of pemetrexed (500 mg/m2 once every 21 days as a 10 min i.v. infusion) as a salvage therapy in advanced breast cancer showed that supplementation of the treatment regime with folic acid (FA) and vitamin B12 reduced its already manageable and tolerable toxicities [408821], [409650]. At doses of 500 mg/m2, the drug was also safely administered to 35 patients with impaired renal function [409953]. Phase I and II trials have shown that the main side effects include neutropenia, thrombocytopenia, mucositis, nausea and vomiting [203666], [272241]. Princeton University holds the patent rights to this drug under EP-00432677. In June

  4. Elie Menant (1927-2007)

    CERN Document Server

    2007-01-01

    We were deeply saddened to hear of the death of our former colleague and friend, Elie Menant, at Collonge-Bellerive, on 17 August, in his 80th year. Formerly of the French National Geographic Institute, for which he had conducted many geodesic surveys throughout France, Elie came to CERN in 1962, joining the team of surveyors led by Jean Gervaise in AR Division. Elie was involved in the PS, ISR, SPS and LEP projects and made a substantial contribution to the development of the group’s alignment techniques. Among the highlights of a richly creative career, we particularly recall his essential contributions to the implementation of the first computer software for the adjustment of major geodesic networks, to new computer-assisted calculation techniques, to the design of the alignment method for the ISR ring and the associated beam transfer lines, as well as his work on the site studies for the 300 GeV project. Last, but not least, his instinct for large-dimension metrolog...

  5. Nuclear Physics studies at ELI-NP

    International Nuclear Information System (INIS)

    Stevenson, P.D.; Goddard, P.M.; Rios, A.

    2015-01-01

    The mission of the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) facility is to use extreme electromagnetic fields for nuclear physics research. At ELI-NP, high-power lasers together with a very brilliant γ-ray beam are the main research tools. Their targeted operational parameters are described. The emerging experimental program of the facility in the field of nuclear physics is reported and the main directions of the research envisioned are presented. The experimental instrumentation, which will operate at ELI-NP for the realization of the research program, is discussed. The expected impact of ELI-NP on the future advance of the field is summarized

  6. Evelin Ilves ja kirjastus "Varrak" kinkisid SOS Lastekülale jõuludeks raamatuid

    Index Scriptorium Estoniae

    2009-01-01

    Proua Evelin Ilves ja kirjastus "Varrak" viisid 21. detsembril 2009 Keila SOS Lastekülale jõulukingiks raamatuid. Kingitud raamatud valiti välja laste soovide põhjal, nende hulgas on nii lastekirjandust kui ka teatmeteoseid

  7. Exenatide. Amylin/Eli Lilly.

    Science.gov (United States)

    Giannoukakis, Nick

    2003-04-01

    Amylin Pharmaceuticals Inc and Eli Lilly & Co are co-developing exenatide (AC-2993; synthetic exendin-4), a 39-amino acid, glucagon-like peptide-1 agonist derived from the venom of the Gila monster lizard (Heloderma suspectum) as a potential injectable treatment for type 2 diabetes. The first phase III trial (exenatide as a monotherapy) was initiated in December 2001. In January 2002 the second phase III trial, of exenatide in conjunction with sulfonylureas, was initiated and in March 2002, Amylin initiated the third phase III trial, of exenatide in combination with metformin and sulfonylureas.

  8. Evelin - sportlane rahva kulul või ikkagi esileedi? / Karoliina Vasli

    Index Scriptorium Estoniae

    Vasli, Karoliina

    2008-01-01

    Proua Evelin Ilvese spordiharrastusest ja imagost. Arvamust avaldavad muusik ja saatejuht Mihkel Raud, psühholoogiaprofessor Voldemar Kolga, suhtekorraldusfirma Rull & Rumm juhataja Ivo Rull, Eesti Naisliidu poolt aasta emaks valitud Külli Kangur ja astroloog Edda Paukson. Vt. samas: Evelin: ma pole sündinud, rullid all. Proua E. Ilvese vastukajast kriitikale; Võrreldes Sarkozyga, on Ilvesel vedanud. Prantsusmaa presidendi Nicolas Sarkozy abikaasast Carla Bruni-Sarkozy'st ja USA endise riigipea Bill Clintoni abikaasast Hillary Clintonist

  9. Skandaal Evelin Ilvese paljaste õlgade pärast / Karoliina Vasli

    Index Scriptorium Estoniae

    Vasli, Karoliina

    2009-01-01

    President Toomas Hendrik Ilves ja proua Evelin Ilves andsid 4. aprillil 2009 Estonia kontserdisaalis piduliku õhtusöögi Eestisse riigivisiidile saabunud Hispaania kuninga Juan Carlos I ja kuninganna Sofia auks. Proua E. Ilves kandis moekunstnik Arne Niidu loodud kleiti. Kommenteerib etiketiõpetaja Maaja Kallast. Presidendipaari riietamise kuludest aastatel 2006-2008. Vt. samas: Tagiga nooruslik president; Evelin Ilves viis kuninganna Kehrwiederisse kohvitama

  10. ELi institutsioonide ja juhtimise reform / Ivar Raig

    Index Scriptorium Estoniae

    Raig, Ivar, 1953-

    2003-01-01

    Kuna Eestist võib 2004. aasta mais saada EL-i liige, siis on vaja kujundada seisukoht, milline EL-i institutsioonide ja juhtimise reform oleks kõige vastuvõetavam Eesti kui erilise majanduspoliitikaga väikeriigi huvidest lähtuvalt. Märkused valitsuse sellekohaste seisukohtade suhtes ja ettepanekud nende muutmiseks või täiendamiseks

  11. Kes kaitseb maatootjate õigusi ELis? / Alvar Timmi

    Index Scriptorium Estoniae

    Timmi, Alvar

    1999-01-01

    Ülevaade ELi valitsusvälisest organisatsioonist COPA-COGECA, mis ühendab põllumajandustootjaid ja toodangu töötlejaid eesmärgiga mõjutada valitsusasutusi põllumajandust puudutava seadusandluse kujundamisel

  12. Eflucimibe. Pierre Fabre/Eli Lilly.

    Science.gov (United States)

    Burnett, John R

    2003-03-01

    Eflucimibe is an acyl coenzyme A:cholesterol acyltransferase inhibitor under development by Pierre Fabre SA and Eli Lilly & Co for the potential treatment of hypercholesterolemia and atherosclerosis. Phase II clinical trials commenced during 2002.

  13. Modnõi dom Ivo Nikkolo predstavila platje, sozdannoje po eskizam Evelin Ilves

    Index Scriptorium Estoniae

    2008-01-01

    15. novembril esitleti Ivo Nikkolo kaupluses Tallinnas presidendi abikaasa Evelin Ilvese eskiiside järgi valmistatud pidulikku kleiti. Eesti rahvarõivastest inspireeritud tikanditega kleiti müüakse Ivo Nikkolo jõulukollektsioonis ja saadud tulu suunatakse heategevusse. 4 fotot

  14. Tulevik on helge: noortele meeldib ettevõtlikkus / Evelin Org, Marge Rahu, Kai Isand ... [jt.

    Index Scriptorium Estoniae

    2016-01-01

    Sokos Hotels Tallinna müügi- ja turundusdirektori Evelin Orgi, kohviku Maitsvad Muffinid omaniku Marge Rahu, Garage48 SA tegevjuhi Kai Isanda, Swedbanki juriidilise divisjoni direktori Riho Roopõllu, Nortali tegevjuhi ja juhatuse liikme Andre Kulli, Veriff tegevjuhi ja asutaja Kaarel Kotkase ning Esteloni kaasasutaja ja partneri, Eesti Era- ja Riskikapitali Assotsiatsiooni tegevjuhi Kristiina Vassilkova mõtteid edukusest

  15. Evelin Ilves: Kalevi kommid on kräpp / Arvo Uustalu

    Index Scriptorium Estoniae

    Uustalu, Arvo, 1964-

    2009-01-01

    Proua Evelin Ilves kritiseeris kommivabriku Kalev toodangut transrasvhapete sisalduse pärast. Kommenteerivad ASi Kalev Chocolate Factory turundus- ja müügidirektor Monika Heinrand, suhtekorraldaja Ruth Roht ning toitumisteadlased Selma Teesalu, Mai Maser ja Tagli Pitsi. Vt. samas: Transrasvad põhjustavad rasvumist

  16. Marks & Spencer loob ELis maksupretsedenti / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 13. apr. lk. 6. Briti rõivakett Marks & Spencer kaebas, et Briti maksuseadused, mis ei lubanud emafirma Suurbritannias maksustavast tulust maha kanda Saksamaal, Prantsusmaal ja Belgias asunud tütarfirmade suuri kahjumeid üheksakümnendate aastate lõpus, on vastuolus EL-i ühisturu seadustega

  17. Towards experiments at the new ELI-NP facility

    Directory of Open Access Journals (Sweden)

    Balabanski D. L.

    2014-01-01

    Full Text Available The Extreme Light Infrastructure (ELI Pan-European initiative represents a major step forward in quest for extreme electromagnetic fields. The Extreme Light Infrastructure – Nuclear Physics (ELI-NP laboratory is one of the three pillars of the ELI project, that aims to use such extreme electromagnetic fields for nuclear physics and quantum electrodynamics research. At ELI-NP two ten petawatt high-power laser systems together with a very brilliant narrow-width γ beam are the main research tools. Here the current status of the project and the experimental program related to nuclear research, which is under preparation at ELI-NP, are presented.

  18. Evelin Ilves jäi lavalaua vahele kontsapidi kinni / Eve Heinla

    Index Scriptorium Estoniae

    Heinla, Eve, 1966-

    2008-01-01

    8. märtsil 2008 toimus Pärnus Endla teatris Eesti Lions klubide heategevusball, kus osales ka heategevusliikumise "Saa nägijaks!" aupatroon proua Evelin Ilves. Proua E. Ilvese tikk-konts jäi lavalaudade vahele kinni. Pärnu teatris juhtus äpardus ka president Toomas Hendrik Ilvesel - 23. veebruaril 2008 teenetemärkide kätteandmise tseremoonial kõnet pidades sorises kõnepuldilt vett maha

  19. Evelin Ilvese isa : oleme tütrega ära leppinud / Karoliina Vasli

    Index Scriptorium Estoniae

    Vasli, Karoliina

    2007-01-01

    Proua Evelin Ilvese Helsingis elav isa Lembit Int räägib oma suhetest tütre ja väimehega. Vt. samas: Isa: "Evelinil on kahju, et unistus külalistemajast hetkel soiku jääb." Lembit Int väljendab kahetsust, et Ärma talu enam külalistemajana ei tööta

  20. Exploring high-intensity QED at ELI

    Energy Technology Data Exchange (ETDEWEB)

    Heinzl, T. [Plymouth Univ., School of Mathematics and Statistics, Drake Circus, PL4 8AA (United Kingdom); Ilderton, A. [School of Mathematics, Hamilton Building, Trinity College, Dublin (Ireland)

    2009-11-15

    We give a non-technical overview of quantum electrodynamics (QED) effects arising in the presence of ultra-strong electromagnetic fields highlighting the new prospects provided by a realisation of the ELI laser facility. Vacuum polarization is a genuine QED process describing the probability amplitude of a propagating photon fluctuating into a virtual electron-positron pair. It has measurable effects such as the Lamb shift and charge screening at short distances. Nonlinear Compton scattering that consists of processes of the type: e + ngamma{sub L} -> e' + gamma (where n counting the number of laser photons involved) is an intensity dependent effect that is accessible to experimental observation

  1. Evelin Ilves asus Šveitsi suurfirma ausaadikuks. Meeleheaks 52 000 krooni maksev kell / Katrin Rohtla

    Index Scriptorium Estoniae

    Rohtla, Katrin, 1966-

    2008-01-01

    17. mail 2008 oli Estonia teatris "Tristani ja Isolde" esietendus, kus proua Evelin Ilves nimetati Šveitsi luksuskellade meistri Raymond Weili ausaadikuks. Tiitliga kaasnes kingitusena teemantidega käekell. Kommenteerivad Aktsiaseltsi Balti Kell juhataja Toivo Aalja ja proua E. Ilvese erasekretär Piia Vann. Vt. samas: Kadri Simson: ausaadik on peen nimetus reklaamnäole. Riigikogu korruptsioonivastase seaduse kohaldamise erikomisjoni liikme Kadri Simsoni kommentaar. Vt. ka juhtkiri lk. 8: Reklaampost. SL Õhtulehe arvates on sobimatu, et presidendiproua seotakse ühe äriettevõtte huvidega

  2. Nuclear Physics Research at ELI-NP

    Science.gov (United States)

    Zamfir, N. V.

    2018-05-01

    The new research facility Extreme Light Infrastructure - Nuclear Physics (ELI-NP) is under construction in Romania, on the Magurele Physics campus. Valued more than 300 Meuros the center will be operational in 2019. The research center will use a high brilliance Gamma Beam and a High-power Laser beam, with unprecedented characteristics worldwide, to investigate the interaction of very intense radiation with matter with specific focus on nuclear phenomena and their applications. The energetic particle beams and radiation produced by the 2x10 PW laser beam interacting with matter will be studied. The precisely tunable energy and excellent bandwidth of the gamma-ray beam will allow for new experimental approaches regarding nuclear astrophysics, nuclear resonance fluorescence, and applications. The experimental equipment is presented, together with the main directions of the research envisioned with special emphasizes on nuclear physics studies.

  3. Elis Regina e a música televisual brasileira

    Directory of Open Access Journals (Sweden)

    Alexandre Rocha da Silva

    2008-11-01

    Full Text Available Este artigo discute o modo pelo qual a televisão brasileira construiu Elis Regina como ator televisivo. Parte da idéia proposta por Augusto de Campos e Caetano Veloso de que Elis foi a primeira cantora efetivamente produzida pela televisão brasileira para investigar semioticamente o que aqui se denomina mundo televisivo. Este estudo aborda, ainda, as articulações entre gêneros, subgêneros e formatos como níveis que tecem as malhas do propriamente televisivo. Palavras-chave: mundos televisivos; audiovisualidades; imagem-música; semiótica; Elis Regina Abstract Elis Regina and Brazilian televised music - This paper discusses how Brazilian television built singer Elis Regina into a television actress. Starting from the idea proposed by Augusto de Campos and Caetano Veloso that Elis was the first singer effectively produced by Brazilian television, this paper makes a semiotic investigation into what is known as the world of television. This study also discusses the articulations between genres, subgenres and formats as levels that weave the mesh of television itself. Keywords: world of television; audiovisualities; image-music; semiotics; Elis Regina

  4. Proposed Operational Base Site, Steptoe Valley, Ely Area, Nevada.

    Science.gov (United States)

    1980-03-31

    1629, respectively (White Pine Chamber of Commerce , WPCC, 1980). The city of Ely is incorporated; the suburb of East Ely is not. For purposes of this...Site SAF Security Alert Facility WPCC White Pine Chamber of Commerce WPPP White Pine Power Project IL__ _ FN-TR-35 38 BIBLIOGRAPHY Cardinalli, J., 1979...Nevada Forecasts for the Future--Agriculture, State Engineer’s Office, Carson City, Nevada. *1 White Pine Chamber of Commerce , 1980, Oral

  5. Eli Hecksher as a Portrait Maker

    Directory of Open Access Journals (Sweden)

    Benny Carlson

    2017-04-01

    Full Text Available Eli Heckscher was not only author of extensive investigations into economic history. He was also skillful in depicting phenomena in small format in encyclopædias, journals and newspapers. This article presents Heckscher as portrait maker of economic scholars. In these portraits—what he emphasized, what he praised, what he criticized—one can discern the stance of the portrait maker himself. Overall, his portraits are permeated by admiration of sharp theoretical analyses and massive economic historical investigations. He admires the founding fathers of political economy, Adam Smith and David Ricardo, stresses continuity in the development of economic thought, praises humble innovators like David Davidson, Knut Wicksell and Alfred Marshall and denounces (what he perceives as pretentious innovators like Gustav Cassel and John Maynard Keynes. He is critical towards economists who attempt to break out of the classical and neoclassical tradition, especially representatives of the German historical school, and what he judges to be a new type of mercantilism, represented by Bertil Ohlin and Keynes. At the same time he appreciates voluminous and solid investigations into economic history, even if performed without theoretical beacons, by scholars like William Cunningham, William Ashley, John Clapham, Marc Bloch, Richard Ehrenberg and Werner Sombart.

  6. Ehitaja nõuab kohtu kaudu Evelin Ilveselt võla tasumist / Kadri Paas

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2007-01-01

    AS Nuia Melior on esitanud hagi proua Evelin Ilvese vastu, milles nõutakse Ärma talus tehtud tööde eest arvete tasumist. Firma juhataja Heino Luige sõnul küünib võlg 120 000 kroonini. Vandeadvokaat Madis Pätsi väitel ei ole OÜ Ermamaal ASi Nuia Melior ees võlgnevust, kuna AS Nuia Melior oli Ärma talus teostatavate tööde alltöövõtja ning oli sõlminud lepingu peatöövõtjaga Aus Invest OÜ. President T.H. Ilvese esivanemate talu taastamise peatöövõtja Aus Invest on pankrotis ja firma juht Aivar Aus lahkunud välismaale. Lisa: Eesti presidendid ehitajatega kimpus

  7. Esileedi Evelin Ilves läheb Kaleviga kommisõtta / Priit Pullerits ; kommenteerinud Monika Heinrand

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2009-01-01

    Liikuvat eluviisi ja tervislikku toitumist propageeriv proua Evelin Ilves on otsustanud alustada võitlust transrasvhappeid sisaldavate toiduainete vastu. Proua E. Ilves koostas nimekirja maiustustetootja Kalevi kommidest, mis märgistuse järgi sisaldavad transrasvu. Arvamust avaldavad Kalevi turundus- ja müügidirektor Monika Heinrand, kirjanik Andrus Kivirähk, koduperenaine Kadi Tarand, Tallinna Tehnikaülikooli toiduainete instituudi direktor professor Raivo Vokk. Vastukajad artiklile vt. Postimees 30. sept. 2009, lk. 15: Petrone, Epp. Poes tuleb tähelepanelik olla; Tuiksoo, Ester. Hoidkem Eesti toitu ja toiduainetetööstust; Õhtuleht 3. okt. 2009, lk. 7: Kerge, Rainer. Mahetomat tapab!; Eesti Päevaleht 5. okt. 2009, lk. 2: Teemägi, Tiina. Aasta turundustegu; Pehme, Sirli. Transrasvu tuleb vältida; Õhtuleht 5. okt. 2009, lk. 8: Kummardus Evelinile!; Rulluisud ja transrasvad; Terviseleht 6. okt. 2009, lk. 2: Laane, Aleksander. Solaariumid ja transrasvad; Postimees 13. okt. 2009, lk. 12-13: Strider, Roy. Kellele on transrasvad kasulikud?; Kambek, Liis. Transrasvhapped on üleilmne probleem; Postimees 17. okt. 2009, lk. 14: Kuusk, Hendrik. Toidupoes ei müüda mürgikokteile; Õhtuleht 24. okt. 2009, lk. 9: Levin, Adik. Igaühel on õigus toituda tervislikult; Eesti Päevaleht 27. okt. 2009, lk. 3: Trisberg, Aet. Luubiga poodi; Postimees : AK 5. dets. 2009, lk. 12 karikatuur transrasvade teemal

  8. Eli Fischer-Jørgensen, Eugeniu Coseriu et Louis Hjelmslev

    DEFF Research Database (Denmark)

    Jensen, Viggo Bank

    2015-01-01

    Based on a correspondence between Eugenio Coseriu (1921-2002) and Eli Fischer-Jørgensen (1911-2010), the article discusses the importance of Louis Hjelmslev (1899-1965) for the development of the theory of Coseriu. In a letter dated 1955, Fischer-Jørgensen agrees with Coseriu in his criticism of ...... to be a slight change in Coseriu’s view on content substance. This way, the article aims to show that Fischer-Jørgensen played an important role as a critical mediator between Hjelmslev and Coseriu.......Based on a correspondence between Eugenio Coseriu (1921-2002) and Eli Fischer-Jørgensen (1911-2010), the article discusses the importance of Louis Hjelmslev (1899-1965) for the development of the theory of Coseriu. In a letter dated 1955, Fischer-Jørgensen agrees with Coseriu in his criticism...

  9. Radiation protection of a proton beamline at ELI-Beamlines

    Czech Academy of Sciences Publication Activity Database

    Bechet, Sabrina; Versaci, Roberto; Rollet, S.; Olšovcová, Veronika; Fajstavr, Antonín; Žáková, Martina; Margarone, Daniele

    2016-01-01

    Roč. 11, č. 12 (2016), 1-5, č. článku C12019. ISSN 1748-0221 R&D Projects: GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : models * simulations * wake-field acceleration Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.220, year: 2016

  10. Subatomic and frontier physics with ELI Beamlines. Reality and dreams

    International Nuclear Information System (INIS)

    Drska, L.

    2010-01-01

    Complete text of publication follows. This contribution attempts to review some results of thinking about prospects for meaningful and procreative research by exploitation the potential of the unique laser technology to be available within the future ELI Beamlines Facility - an ultrashort-pulse, multi-petawatt, multi-beam, high-repetition-rate system. The presentation may be (hopefully) regarded as a specific contribution with the emphasis on two concrete areas to general ELI reports. Two sets of potential studies will be discussed: (1) Realistic experiments. (2) 'Dream' research. The first set (maybe realizable in the first phase of the laboratory work) includes the following topics: (1) Laser-driven electronuclear processes. (2) Unconventional / NLTE fusion reactions. (3) Laser positron / antimatter physics. Most detailed analysis will be presented for the subject. Some concrete themes planned for this part of the talk are: Challenges for laser positronium physics. Nuclear excitation in positron annihilation. Positrons and the laboratory astrophysics. Schemes of some experiments exploiting the ELI Beamlines possibilities will be displayed. The second ('dream') set to be outlined (under consideration as potential one for the second phase) should initiate a brainstorming discussion in these areas: (1) High-Z ion physics studies. (2) Exploring of high-gamma systems. (3) Search for hypothetic particles. Again, the highest attention will be paid to the topic. Key themes in this part: The search for hidden-sector lightweights. Challenges and opportunities in photon regeneration experiments. Potential of ELI Beamlines for the research in this area? The final section of the contribution will include some comments on technical issues related to the proposed research themes: (1) Novel targets and particle traps. (2) Diagnostics challenges and solutions. (3) Simulation / Evaluation problems. Some new approaches will be considered. Acknowledgements. This research has been

  11. Patients' satisfaction evaluation with the health center of elis province.

    Science.gov (United States)

    Karavida, Angeliki; Stamouli, Maria-Aggeliki; Balis, Charalampos

    2014-01-01

    Patient satisfaction related to the provided health services is a key indicator of the quality of the health sector. The SERVQUAL model was employed as a way of measuring the level of patient satisfaction with the services of the Health Center of Elis Province. Although certain aspects such as "Assurance" and "Empathy" meet the users' needs, improvements like a detailed medical record and an overhaul of the equipment need to be introduced.

  12. Ettevõtte edu sisse osta ei saa / Katrin Bats, Janne Laik, Silver Vohu, Evelin Ojamets ; intervjueerinud Küllike Heide

    Index Scriptorium Estoniae

    2012-01-01

    Kommunikatsiooni- ja turundustegevuse korraldusest ettevõtetes, mille suur osa antud projektidest hõlmab kõiki Balti riike. Mõtteid jagavad Katrin Bats Rimi Eesti Food AS-ist, Janne Laik NP Foods Eesti OÜ-st, Silver Vohu SEB Pangast ja Evelin Ojamets Coca-Cola-st

  13. Aquatic assessment of the Ely Copper Mine Superfund site, Vershire, Vermont

    Science.gov (United States)

    Seal, Robert R.; Kiah, Richard G.; Piatak, Nadine M.; Besser, John M.; Coles, James F.; Hammarstrom, Jane M.; Argue, Denise M.; Levitan, Denise M.; Deacon, Jeffrey R.; Ingersoll, Christopher G.

    2010-01-01

    The Ely Mine, which operated from 1821 to 1905, and its area of downstream impact constitute the Ely Copper Mine Superfund site. The site was placed on the National Priorities List in 2001. The mine comprises underground workings, foundations from historical structures, several waste-rock piles, roast beds associated with the smelting operation, and slag piles resulting from the smelting. The mine site is drained by Ely Brook, which includes several tributaries, one of which drains a series of six ponds. Ely Brook empties into Schoolhouse Brook, which flows 3.3 kilometers and joins the Ompompanoosuc River.

  14. Perspectives for photonuclear research at the Extreme Light Infrastructure - Nuclear Physics (ELI-NP) facility

    Energy Technology Data Exchange (ETDEWEB)

    Filipescu, D.; Balabanski, D.L.; Constantin, P.; Gales, S.; Tesileanu, O.; Ur, C.A.; Ursu, I.; Zamfir, N.V. [Horia Hulubei National Institute for R and D in Physics and Nuclear Engineering (IFIN-HH), Extreme Light Infrastructure - Nuclear Physics (ELI-NP), Bucharest-Magurele (Romania); Anzalone, A.; La Cognata, M.; Spitaleri, C. [INFN-LNS, Catania (Italy); Belyshev, S.S. [Lomonosov Moscow State University, Physics Faculty, Moscow (Russian Federation); Camera, F. [Departement of Physics, University of Milano, Milano (Italy); INFN section of Milano, Milano (Italy); Csige, L.; Krasznahorkay, A. [Hungarian Academy of Sciences (MTA Atomki), Institute of Nuclear Research, Post Office Box 51, Debrecen (Hungary); Cuong, P.V. [Vietnam Academy of Science and Technology, Centre of Nuclear Physics, Institute of Physics, Hanoi (Viet Nam); Cwiok, M.; Dominik, W.; Mazzocchi, C. [University of Warsaw, Warszawa (Poland); Derya, V.; Zilges, A. [University of Cologne, Institute for Nuclear Physics, Cologne (Germany); Gai, M. [University of Connecticut, LNS at Avery Point, Connecticut, Groton (United States); Gheorghe, I. [Horia Hulubei National Institute for R and D in Physics and Nuclear Engineering (IFIN-HH), Extreme Light Infrastructure - Nuclear Physics (ELI-NP), Bucharest-Magurele (Romania); University of Bucharest, Nuclear Physics Department, Post Office Box MG-11, Bucharest-Magurele (Romania); Ishkhanov, B.S. [Lomonosov Moscow State University, Physics Faculty, Moscow (Russian Federation); Lomonosov Moscow State University, Skobeltsyn Institute of Nuclear Physics, Moscow (Russian Federation); Kuznetsov, A.A.; Orlin, V.N.; Stopani, K.A.; Varlamov, V.V. [Lomonosov Moscow State University, Skobeltsyn Institute of Nuclear Physics, Moscow (Russian Federation); Pietralla, N. [Technische Universitat Darmstadt, Institut fur Kernphysik, Darmstadt (Germany); Sin, M. [University of Bucharest, Nuclear Physics Department, Post Office Box MG-11, Bucharest-Magurele (Romania); Utsunomiya, H. [Konan University, Department of Physics, Kobe (Japan); University of Tokyo, Center for Nuclear Study, Saitama (Japan); Weller, H.R. [Triangle Universities Nuclear Laboratory, North Carolina, Durham (United States); Duke University, Department of Physics, North Carolina, Durham (United States)

    2015-12-15

    The perspectives for photonuclear experiments at the new Extreme Light Infrastructure - Nuclear Physics (ELI-NP) facility are discussed in view of the need to accumulate novel and more precise nuclear data. The parameters of the ELI-NP gamma beam system are presented. The emerging experimental program, which will be realized at ELI-NP, is presented. Examples of day-one experiments with the nuclear resonance fluorescence technique, photonuclear reaction measurements, photofission experiments and studies of nuclear collective excitation modes and competition between various decay channels are discussed. The advantages which ELI-NP provides for all these experiments compared to the existing facilities are discussed. (orig.)

  15. ELIMED, MEDical and multidisciplinary applications at ELI-Beamlines

    International Nuclear Information System (INIS)

    Schillaci, F; Anzalone, A; Cirrone, G A P; Cuttone, G; Musumarra, A; Pisciotta, P; Romano, F; Romano, F P; Carpinelli, M; Cutroneo, M; De Martinis, C; Giove, D; Korn, G; Maggiore, M; Margarone, D; Manti, L; Perozziello, F M; Petrovic, I; Ristic-Fira, A; Renis, M

    2014-01-01

    ELI-Beamlines is one of the pillars of the pan-European project ELI (Extreme Light Infrastructure). It will be an ultra high-intensity, high repetition-rate, femtosecond laser facility whose main goal is generation and applications of high-brightness X-ray sources and accelerated charged particles in different fields. Particular care will be devoted to the potential applicability of laser-driven ion beams for medical treatments of tumors. Indeed, such kind of beams show very interesting peculiarities and, moreover, laser-driven based accelerators can really represent a competitive alternative to conventional machines since they are expected to be more compact in size and less expensive. The ELIMED project was launched thanks to a collaboration established between FZU-ASCR (ELI-Beamlines) and INFN-LNS researchers. Several European institutes have already shown a great interest in the project aiming to explore the possibility to use laser-driven ion (mostly proton) beams for several applications with a particular regard for medical ones. To reach the project goal several tasks need to be fulfilled, starting from the optimization of laser-target interaction to dosimetric studies at the irradiation point at the end of a proper designed transport beam-line. Researchers from LNS have already developed and successfully tested a high-dispersive power Thomson Parabola Spectrometer, which is the first prototype of a more performing device to be used within the ELIMED project. Also a Magnetic Selection System able to produce a small pencil beam out of a wide energy distribution of ions produced in laser-target interaction has been realized and some preliminary work for its testing and characterization is in progress. In this contribution the status of the project will be reported together with a short description of the of the features of device recently developed.

  16. Simulation of photofission experiments at the ELI-NP facility

    International Nuclear Information System (INIS)

    Constantin, P.; Balabanski, D.L.; Cuong, P.V.

    2016-01-01

    An extensive experimental program for the study of photofission will take place at the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) facility, where different actinide targets will be exposed to a brilliant gamma beam to produce fission fragments. We report on the implementation within the Geant4 simulation toolkit of the photofission process, of related background processes, and of extended ionic charge parameterization. These developments are used to evaluate the production rates of photofission fragments and their release efficiency from the actinide targets.

  17. Simulation of photofission experiments at the ELI-NP facility

    Energy Technology Data Exchange (ETDEWEB)

    Constantin, P., E-mail: paul.constantin@eli-np.ro [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Balabanski, D.L. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Cuong, P.V. [Centre of Nuclear Physics, Institute of Physics, Vietnam Academy of Science and Technology, Hanoi (Viet Nam)

    2016-04-01

    An extensive experimental program for the study of photofission will take place at the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) facility, where different actinide targets will be exposed to a brilliant gamma beam to produce fission fragments. We report on the implementation within the Geant4 simulation toolkit of the photofission process, of related background processes, and of extended ionic charge parameterization. These developments are used to evaluate the production rates of photofission fragments and their release efficiency from the actinide targets.

  18. London ja Pariis katsuvad jõudu EL-i eelarve kallal / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2005-01-01

    Kõige suuremad vaidlused EL-i eelarvega seoses käivad Suurbritannia tagasimakse ja põllumajandustoetuste üle. Suurbritannia välisministri Jack Straw nimetas EL-i eelarvet nii raiskavaks kui ka ebaõiglaseks vaesemate riikide suhtes

  19. Poola saab tülis Venemaaga kogu EL-i oma selja taha / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2006-01-01

    EL-i eesistujamaa Soome lubas Poolale lisada Venemaa kehtestatud impordikeelu Poola lihatoodetele EL-i ja Venemaa läbirääkimiste ametlikku päevakorda. Impordikeelu kiiret lõpetamist toetavad Prantsusmaa ja Leedu. Lisa: Poola püüdlused "vastuvõetamatud"

  20. Ekspert : ELi ühine välisminister tähendaks ka ühtsemat idapoliitikat / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Euroopa Poliitikauuringute Keskuse teadlase Michael Emersoni sõnul aitaks plaan anda EL-i ühise välisministri portfell senisele välispoliitika koordineerijale Javier Solanale tasakaalustada EL-i liikmesriikide ja eri institutsioonide huve. EL-i idasuunaline tegevus peaks tema sõnul olema julgem

  1. Shielding and activation studies for the ELI-beamlines project

    International Nuclear Information System (INIS)

    Fasso, Alberto; Korn, Georg; Versaci, Roberto; Ferrari, Anna

    2015-01-01

    ELI-beamlines is one of the four pillars of the Extreme Light Infrastructure, a European ESFRI Project, for the next generation of high-energy and high-intensity lasers. It aims at the development of high-brightness sources of X-rays and the acceleration of proton, electron, and ion beams, to be used both for pure research and practical applications. Aiming at a proper radiation protection assessment, for both shielding and activation, extensive FLUKA simulations have been performed, taking into account the laser high repetition rates. The present work, which is the continuation of the calculations presented at SATIF-10, is the first one based on the design of the facility being constructed and on the updated experimental set-up. (authors)

  2. Laser-driven acceleration at ELI Beamlines - radioprotection aspects

    International Nuclear Information System (INIS)

    Olsovcova, V.; Fasso, A; Versaci, R.

    2014-01-01

    The international research centre ELI Beamlines, which is under construction in the village of Dolni Brezany near Prague, will exploit high power lasers of PW class to generate and accelerate beams of charged particles (up to tens of GeVs in energy). The beams will be used for both fundamental and applied research by experts from various scientific fields, including biology, medicine, plasma physics but also dosimetry and radiation protection. As laboratories operating lasers do not belong among the traditional 'radiation workplaces', there are no suitable specialized recommendations or standards available. Therefore, it is necessary to newly implement the existing general recommendations. Further, the generated mixed fields possess unique properties due to their production methods. As a result, the routinely used detection methods are not reliable or fail completely. (authors)

  3. Taani tahab meid ELi kutsuda / Mariann Fischer Boel ; interv. Marianne Mikko

    Index Scriptorium Estoniae

    Fischer Boel, Mariann

    2002-01-01

    Taani põllumajandusminister Mariann Fischer Boel vastab küsimustele Eesti soovitud piimakvoodi, EL-i tulevaste liikmesriikide otsetoetuste, Taanis maa ostmise, Eesti üliliberaalse majanduse ja sotsiaalse heaolu ühendamise võimaluse kohta

  4. Holland piiraks sisserännet EL-i / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2004-01-01

    Hollandi justiitsministri Piet Hein Donneri sõnul otsib EL-i praegune eesistujamaa Holland lahendusi, mis aitaksid põgenikke ja potentsiaalseid asüülitaotlejaid paremini kaitsta nende asukohariikide läheduses

  5. EL-i eriesindaja usub lahendusse Transnistrias / Kalman Mizsei ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Mizsei, Kalman

    2007-01-01

    Euroopa Liidu eriesindaja Moldovas ütleb, et Moldova liigub aeglaselt EL-i standardite poole ja Eesti on toetanud Moldovat ning koos Ukrainaga leitakse lahendus Transnistria probleemile. Vt. samas: Marianne Mikko. Moldova rikastub

  6. Status of ELI-ALPS implementation (Conference Presentation)

    Science.gov (United States)

    Osvay, Karoly; Charalambidis, Dimitris; Antici, Patrizio; Dombi, Péter; Fulop, Lajos J.; Lepine, Franck; Mészáros, Gergo; Sansone, Giuseppe; Varju, Katalin G.

    2017-05-01

    The major research equipment of the Attosecond Light Pulse Source of the Extreme Light Infrastructure (ELI-ALPS) are driven by laser pulses of few cycle duration operating in the 100 W average power regime. The peak power and the repetition rate span from 1 TW at 100 kHz up to PW at 10 Hz. The systems are designed for stable and reliable operation, yet to deliver pulses with unique parameters, especially with unmatched fluxes and extreme bandwidths. This exceptional performance will enable the generation of secondary sources with exceptional characteristics, including light sources ranging from the THz to the X-ray spectral ranges, and particle sources. The experimental activities in the building complex to be inaugurated early 2017 will start with the installation of the two 100 kHz repetition rate, CEP stabilized lasers in May 2017. The MIR laser produces 0.15mJ, shorter than 4-optical-cylce pulses tunable between 2.5-3.9 µm. The first stage of the HR laser will provide pulses around 1 µm with 1 mJ energy and pulse duration less than 6.2 fs. The systems will be optically synchronized to each other with a temporal jitter below 1 fs. Along with the installation of the lasers, we will also start the assembly of the high harmonic beamlines and the THz laboratory, as well as nanoplasmonic experiments. The XUV bursts of light with attosecond duration are expected to be generated by the end of 2017.

  7. Straight talk with... Ricardo Dolmetsch. Interview by Elie Dolgin.

    Science.gov (United States)

    Dolmetsch, Ricardo

    2013-11-01

    Neuroscience, in recent years, has started to look like a graveyard for drug development, with many large pharmaceutical companies either eliminating their brain disorder programs or cutting back heavily on such research. Novartis seemed to have made exactly this kind of drastic change two years ago when the company announced plans to shutter its neuroscience operations at its global headquarters in Basel, Switzerland. But the company made it known then that its intention was to ultimately set up a new neuroscience division at the company's US base in Cambridge, Massachusetts. The US site was initially picked to take advantage of the local academic strength in the field of psychiatric genetics. Now, it seems that Novartis is also looking to add stem cell technologies to the mix with the appointment in August of Ricardo Dolmetsch as the company's global head of neurosciences-the first new hire for the company's reincarnated division. As a professor at California's Stanford University School of Medicine for the past ten years, Dolmetsch made his name using induced pluripotent stem (iPS) cells to study a rare form of autism known as Timothy syndrome. Elie Dolgin met with Dolmetsch at the Novartis Institutes for BioMedical Research in the Technology Square area of Cambridge to discuss how he plans to succeed where so many others have failed.

  8. Elie Cartan and pan-geometry of multispatial hyperspace

    International Nuclear Information System (INIS)

    Czajko, Jakub

    2004-01-01

    Elie Cartan has proved that highest dimensionality of any simple geometric space is three and that an exterior differentiation of a 3D+ geometric object gives bivector, which may correspond to some two 2D surfaces as if the 3D+ geometric object comprised two 3D objects. Since one cannot increase the dimensionality of a 3D space even though more than four independently varying physical magnitudes do exist, then an expansion of dimensionality requires a multispatial hyperspace that contains many simple geometric 3D spaces. Presence of such a hyperspace prompts for an entirely new concept of vectors with an isometric operation of vector multiplication of traditional vectors (3-tuples). This new operation on 3-vectors implies presence of a 3D mass-based linear vector space and consequently thus a 9D geometric hyperspace for classical mechanics alone. Also an outline of entirely new, synthetic approach to physics and mathematics is introduced. This synthetic approach can be used to design a computer-aided knowledge extracting system, which could generate entirely new scientific knowledge

  9. Eli Lilly and Company's bioethics framework for human biomedical research.

    Science.gov (United States)

    Van Campen, Luann E; Therasse, Donald G; Klopfenstein, Mitchell; Levine, Robert J

    2015-11-01

    Current ethics and good clinical practice guidelines address various aspects of pharmaceutical research and development, but do not comprehensively address the bioethical responsibilities of sponsors. To fill this void, in 2010 Eli Lilly and Company developed and implemented a Bioethics Framework for Human Biomedical Research to guide ethical decisions. (See our companion article that describes how the framework was developed and implemented and provides a critique of its usefulness and limitations.) This paper presents the actual framework that serves as a company resource for employee education and bioethics deliberations. The framework consists of four basic ethical principles and 13 essential elements for ethical human biomedical research and resides within the context of our company's mission, vision and values. For each component of the framework, we provide a high-level overview followed by a detailed description with cross-references to relevant well regarded guidance documents. The principles and guidance described should be familiar to those acquainted with research ethics. Therefore the novelty of the framework lies not in the foundational concepts presented as much as the attempt to specify and compile a sponsor's bioethical responsibilities to multiple stakeholders into one resource. When such a framework is employed, it can serve as a bioethical foundation to inform decisions and actions throughout clinical planning, trial design, study implementation and closeout, as well as to inform company positions on bioethical issues. The framework is, therefore, a useful tool for translating ethical aspirations into action - to help ensure pharmaceutical human biomedical research is conducted in a manner that aligns with consensus ethics principles, as well as a sponsor's core values.

  10. The elicitin-like glycoprotein, ELI025, is secreted by the pathogenic oomycete Pythium insidiosum and evades host antibody responses.

    Directory of Open Access Journals (Sweden)

    Tassanee Lerksuthirat

    Full Text Available Pythium insidiosum is a unique oomycete that can infect humans and animals. Patients with a P. insidiosum infection (pythiosis have high rates of morbidity and mortality. The pathogen resists conventional antifungal drugs. Information on the biology and pathogenesis of P. insidiosum is limited. Many pathogens secrete proteins, known as effectors, which can affect the host response and promote the infection process. Elicitins are secretory proteins and are found only in the oomycetes, primarily in Phytophthora and Pythium species. In plant-pathogenic oomycetes, elicitins function as pathogen-associated molecular pattern molecules, sterol carriers, and plant defense stimulators. Recently, we reported a number of elicitin-encoding genes from the P. insidiosum transcriptome. The function of elicitins during human infections is unknown. One of the P. insidiosum elicitin-encoding genes, ELI025, is highly expressed and up-regulated at body temperature. This study aims to characterize the biochemical, immunological, and genetic properties of the elicitin protein, ELI025. A 12.4-kDa recombinant ELI025 protein (rELI025 was expressed in Escherichia coli. Rabbit anti-rELI025 antibodies reacted strongly with the native ELI025 in P. insidiosum's culture medium. The detected ELI025 had two isoforms: glycosylated and non-glycosylated. ELI025 was not immunoreactive with sera from pythiosis patients. The region near the transcriptional start site of ELI025 contained conserved oomycete core promoter elements. In conclusion, ELI025 is a small, abundant, secreted glycoprotein that evades host antibody responses. ELI025 is a promising candidate for development of diagnostic and therapeutic targets for pythiosis.

  11. ELIMED: MEDICAL APPLICATION AT ELI-BEAMLINES. STATUS OF THE COLLABORATION AND FIRST RESULTS

    Directory of Open Access Journals (Sweden)

    Francesco Schillaci

    2014-08-01

    Full Text Available ELI-Beamlines is one of the four pillars of the ELI (Extreme Light Infrastructure pan-European project. It will be an ultrahigh-intensity, high repetition-rate, femtosecond laser facility whose main goal is to generate and apply high-brightness X-ray sources and accelerated charged particles. In particular, medical applications are treated by the ELIMED task force, which has been launched by collaboration between ELI and INFN researchers. ELIMED aims to demonstrate the clinical applicability of laser accelerated ions. In this article, the state of the ELIMED project and the first scientific results are reported. The design and realisation of a preliminary beam handling system and of an advanced spectrometer for diagnostics of high energy (multi-MeV laser-accelerated ion beams will also be briefly presented.

  12. Implementation status of the extreme light infrastructure - nuclear physics (ELI-NP) project

    Energy Technology Data Exchange (ETDEWEB)

    Gales, S., E-mail: sydney.gales@eli-np.ro; Zamfir, N. V., E-mail: sydney.gales@eli-np.ro [ELI-NP, Horia Hulubei National Institute for Physics and Nuclear Engineering, 30 Reactorului Street, RO-077125 Bucharest-Magurele (Romania)

    2015-02-24

    The Project Extreme Light Infrastructure (ELI) is part of the European Strategic Forum for Research Infrastructures (ESFRI) Roadmap. ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for Nuclear Physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10 PW lasers and a Compton back-scattering high-brilliance and intense gamma beam, a marriage of laser and accelerator technology at the frontier of knowledge. In the present paper, the technical description of the facility, the present status of the project as well as the science, applications and future perspectives will be discussed.

  13. Performance studies of X3 silicon detectors for the future ELISSA array at ELI-NP

    Science.gov (United States)

    Chesnevskaya, S.; Balabanski, D. L.; Choudhury, D.; Constantin, P.; Filipescu, D. M.; Ghita, D. G.; Guardo, G. L.; Lattuada, D.; Matei, C.; Rotaru, A.; State, A.

    2018-05-01

    ELISSA is an array of silicon strip detectors under construction at the ELI-NP facility for measurements of photodissociation reactions using high-brilliance, quasi monoenergetic gamma beams. The detection system consists of 35 single-sided position-sensitive X3 detectors arranged in a cylindrical configuration and eight QQQ3 detectors as end-caps. A batch of forty X3 detectors have been tested at ELI-NP. The energy and position resolution, ballistic deficit, leakage currents, and depletion voltage were measured and analyzed. Measurements of the energy resolution were carried out using two read-out electronic chains, one based on multichannel preamplifiers and another based on multiplexers.

  14. 78 FR 33426 - Eli Lilly and Co.; Withdrawal of Approval of a New Drug Application for ORAFLEX

    Science.gov (United States)

    2013-06-04

    ...] Eli Lilly and Co.; Withdrawal of Approval of a New Drug Application for ORAFLEX AGENCY: Food and Drug... new drug application (NDA) for ORAFLEX (benoxaprofen) Tablets, held by Eli Lilly and Co. (Lilly), Lilly Corporate Center, Indianapolis, IN 46285. Lilly has voluntarily requested that approval of this...

  15. Anti Moppel : logistikafirmadel ei tasu ELi karta / Anti Moppel ; interv. Rivo Sarapik

    Index Scriptorium Estoniae

    Moppel, Antti, 1968-

    2003-01-01

    Ilmunud ka: Delovõje Vedomosti : Avtomobili i transport 15. okt. lk. 10-11. Majandus- ja kommunikatsiooniministeeriumi osakonnajuhataja Anti Moppel vastab küsimustele, mis puudutavad logistikafirmade ootusi EL-ist, Eesti transpordituru arengut, transpordifirmade valmisolekut Eesti liitumiseks EL-iga, ministeeriumi pakutavat infot EL-i kohta

  16. Kütusehinnad Eestis ja ELis : 2004 ja edaspidi / Hede-Kerstin Luik

    Index Scriptorium Estoniae

    Luik, Hede-Kerstin

    2003-01-01

    Autor arutleb lähiajal ja kaugemas perspektiivis kütuse hinda mõjutavate võimalike tegurite üle, sh. Euroopa Komisjoni plaani üle ühtlustada mootorsõidukite kütuste aktsiisimäärad EL-i liikmesriikides. Eesti valitsuse aktsiisipoliitika kujundamisest

  17. Gija Kantšeli kui kontrastide guru / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2010-01-01

    Gruusia nüüdishelilooja Gija Kantšeli 75. sünnipäeva tähistamisest Eestis - EMTA kammersaalis 11. novembril toimunud avalikust kohtumisest ja vestlusringist ning 12, novembril toimunud autoriõhtust Estonia kontserdisaalis, kus esines ERSO Andres MUstoneni dirigeerimisel

  18. 78 FR 21849 - Television Broadcasting Services; Ely, NV to Middletown Township, NJ

    Science.gov (United States)

    2013-04-12

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [MB Docket No. 13-72; RM-11694, DA 13-448] Television Broadcasting Services; Ely, NV to Middletown Township, NJ AGENCY: Federal Communications... CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video Division...

  19. Effect of Annealing Temperature on the Ballistic Limit Velocity of Ti-6A1-4V ELI

    National Research Council Canada - National Science Library

    Burkins, M

    1997-01-01

    .... Army Research Laboratory (ARL) and the RMI Titanium Company (RMI) performed a joint research program to evaluate the effect of annealing temperature on Ti-6A1-4V alloy, extra-low interstitial (ELI...

  20. Status of the ELIMED multidisciplinary and medical beam-line at ELI-Beamlines

    International Nuclear Information System (INIS)

    Romano, F; Cirrone, G A P; Cuttone, G; Schillaci, F; Scuderi, V; Amico, A; Candiano, G; Larosa, G; Leanza, R; Manna, R; Marchese, V; Milluzzo, G; Petringa, G; Pipek, J; Giordanengo, S; Guarachi, L F; Marchetto, F; Sacchi, R; Korn, G; Margarone, D

    2017-01-01

    Nowadays, one of the biggest challenges consists in using high intensity laser-target interaction to generate high-energy ions for medical purposes, eventually replacing the old paradigm of acceleration characterized by huge and complex machines. In order to investigate the feasibility of using laser-driven ion beams for multidisciplinary application, a dedicated beam transport line will be installed at the ELI-Beamlines facility in Prague (CZ), as a part of the User-oriented ELIMAIA beam-line dedicated to ion acceleration and their potential applications. The beam-line section dedicated to transport and dosimetric endpoints is called ELIMED (ELI-Beamlines MEDical and multidisciplinary applications) and will be developed by the INFN-LNS. (paper)

  1. The good gift: a comparison of the Eli Lilly presentation copies of Aequanimitas.

    Science.gov (United States)

    Kimbrough, R C

    1995-08-01

    The Eli Lilly Pharmaceutical Company of Indianapolis, Indiana distributed some 150,000 copies of the third edition of Sir William Osler's Aequanimitas to graduating medical students between 1932 and 1953. Bibliophiles have considered these volumes identical. However, there were at least seven different printings in English and one in Spanish and one in Portuguese. The size of the book and type of paper changed over the years. The title page, spine information, and printing information also changed. A congratulatory letter from Eli Lilly and Company was placed in the front of each book. These letters have many differences. Thus, the volumes are not identical and the recognition of these differences opens a new field for research and collecting.

  2. Characterization of X3 Silicon Detectors for the ELISSA Array at ELI-NP

    Science.gov (United States)

    Chesnevskaya, S.; Balabanski, D. L.; Choudhury, D.; Cognata, M. La; Constantin, P.; Filipescu, D. M.; Ghita, D. G.; Guardo, G. L.; Lattuada, D.; Matei, C.; Rotaru, A.; Spitaleri, C.; State, A.; Xu, Y.

    2018-01-01

    Position-sensitive silicon strip detectors represent one of the best solutions for the detection of charged particles as they provide good energy and position resolution over a large range of energies. A silicon array coupled with the gamma beams at the ELI-NP facility would allow measuring photodissociation reactions of interest for Big Bang Nucleosynthesis and on heavy nuclei intervening in the p-process. Forty X3 detectors for our ELISSA (ELI-NP Silicon Strip Detectors Array) project have been recently purchased and tested. We investigated several specifications, such as leakage currents, depletion voltage, and detector stability under vacuum. The energy and position resolution, and ballistic deficit were measured and analyzed. This paper presents the main results of our extensive testing. The measured energy resolution for the X3 detectors is better than results published for similar arrays (ANASEN or ORRUBA).

  3. On the potential of laser driven isotope generation at ELI-NP for positron emission tomography

    Science.gov (United States)

    Cucoanes, A. S.; Balabanski, D. L.; Canova, F.; Cuong, P.; Negoita, F.; Puicea, F.; Tanaka, K. A.

    2017-05-01

    The huge progress made in the laser driven ion acceleration had open the possibility of using ions generated in high power laser interactions with solid targets for the production of medical isotopes. Indeed, lasers could provide several key features with respect to the traditional method where the target activation is produced by particle beams delivered by cyclotrons. The price and the dimensions of high power lasers are on a descendant slope and the quality of the produced ion beams is continuously increasing. However, in order to compete with cyclotrons, the average proton current intensity has to be increased for example by increasing the frequency of the laser pulses. In our contribution, we review the general ideas of the laser-based radioisotope production and we present our analysis on the potential of the medical isotope generation at ELI-NP with a focus on 18F. We use estimations of the proton beam parameters and a code implemented in Geant4 for computing the yield of the main production channel taking into account the experimental conditions available soon at ELI-NP. The obtained results are compatible with previous studies and will be verified by experiments foreseen at the future ELI-NP facility, under construction now in Magurele, Romania.

  4. Implementation and Setup of a System Dedicated Logbook based on ELisA

    CERN Document Server

    Van Tonder, Raynette

    2016-01-01

    ELisA is a web tool used by the ATLAS community as a daily logbook facility in order to record and share information concerning the experiment's operation and deployment. A few subsystems, notably the FTK subsystem, of the ATLAS experiment would like to setup a logbook based on the ELisA logbook for their own private usage. This new logbook would be completely separated from the main ATLAS logbook and will only be accessed from the general public network. In this project the implementation and setup of the ELisA based logbook will be discussed as well as various modifications that were made to the new logbook. These modifications were specified by the FTK users in order to make the logbook relevant to the FTK subsystem. Once the logbook was functioning as expected and the users were satisfied with the modifications, the FTK logbook was installed on a FTK dedicated machine where it is currently being used by members of the FTK group.

  5. Nuclear Astrophysics at ELI-NP: the ELISSA prototype tested at Laboratori Nazionali del Sud

    Science.gov (United States)

    Guardo, Giovanni Luca; Anzalone, Antonello; Balabanski, Dimiter; Chesnevskaya, Svetlana; Crucillá, Walter; Filipescu, Dan; Gulino, Marisa; La Cognata, Marco; Lattuada, Dario; Matei, Catalin; Pizzone, Rosario Gianluca; Rapisarda, Giuseppe; Romano, Stefano; Spitaleri, Claudio; Taffara, Alessandra; Tumino, Aurora; Xu, Yi

    2018-01-01

    The Extreme Light Infrastructure-Nuclear Physics (ELI-NP) facility, under construction in Magurele near Bucharest in Romania, will provide high-intensity and high-resolution gamma ray beams that can be used to address hotly debated problems in nuclear astrophysics, such as the accurate measurements of the cross sections of the 24Mg(γ,α)20Ne reaction, that is fundamental to determine the effective rate of 28Si destruction right before the core collapse and the subsequent supernova explosion. For this purpose, a silicon strip detector array (named ELISSA, acronym for Extreme Light Infrastructure Silicon Strip Array) will be realized in a common effort by ELI-NP and Laboratori Nazionali del Sud (INFN-LNS), in order to measure excitation functions and angular distributions over a wide energy and angular range. A prototype of ELISSA was built and tested at INFN-LNS in Catania (Italy) with the support of ELI-NP. In this occasion, we have carried out experiments with alpha sources and with a 11 MeV 7Li beam. Thanks to our approach, the first results of those tests show up a very good energy resolution (better than 1%) and very good position resolution, of the order of 1 mm. Moreover, a threshold of 150 keV can be easily achieved with no cooling.

  6. Status of the development of a HPGe-BGO pair spectrometer for ELI-NP

    Energy Technology Data Exchange (ETDEWEB)

    Homm, Ilja; Ignatov, Alexander; Ilieva, Stoyanka; Kroell, Thorsten [Technische Universitaet Darmstadt, Darmstadt (Germany)

    2016-07-01

    At the moment, the new European research facility called ELI-NP (The Extreme Light Infrastructure - Nuclear Physics) is being built in Bucharest-Magurele, Romania. It is one of three parts of the ELI project and offers applications for the investigation of questions concerning nuclear physics. The 8 HPGe (High-Purity Germanium) CLOVER detectors of ELIADE (ELI-NP Array of DEtectors) with four crystals each and high resolution are important components for the gamma spectroscopic study of photonuclear reactions. These detectors are surrounded by standard anti-Compton shields (AC shield). We investigate the possibility to operate for two of the ELIADE CLOVERS an advanced version of an AC shield as escape γ-rays pair spectrometers to extend the high-resolution spectroscopy to photon energies of several MeV where the pair production process dominates. The main tasks in this work are to develop and test such an AC shield: a pair spectrometer with BGO and CsI(Tl) crystals with APD (avalanche photodiode) or SPM (silicon photomultiplier) readout. The results of prototype testing are reported.

  7. Highlights from e-EPS: New milestone for ELI Beamlines facility

    CERN Multimedia

    Jorge Rivero González, e-EPS News

    2013-01-01

    e-EPS News is a monthly addition to the CERN Bulletin line-up, showcasing articles from e-EPS – the European Physical Society newsletter – as part of a collaboration between the two publications.   On 16 September 2013, the Extreme Light Infrastructure (ELI) Beamlines facility awarded a contract worth approximately €34.5m to Lawrence Livermore National Security LLC (LLNS, California, USA) to develop and deliver a state-of-the-art laser system that will be at the heart of the ELI Beamlines user facility. Located in the village of Dolní Břežany, Czech Republic, the ELI Beamlines facility aims to pioneer work in a number of research fields using ultra-high intensity lasers. The facility will host a cutting-edge research laser, around 100 times more powerful than any other laser in operation today. In particular, it will focus on providing users with ultra-short energetic particle beams (10 GeV) and radiation beams (up to a few MeV), produced by...

  8. Overview on the target fabrication facilities at ELI-NP and ongoing strategies

    Science.gov (United States)

    Gheorghiu, C. C.; Leca, V.; Popa, D.; Cernaianu, M. O.; Stutman, D.

    2016-10-01

    Along with the development of petawatt class laser systems, the interaction between high power lasers and matter flourished an extensive research, with high-interest applications like: laser nuclear physics, proton radiography or cancer therapy. The new ELI-NP (Extreme Light Infrastructure - Nuclear Physics) petawatt laser facility, with 10PW and ~ 1023W/cm2 beam intensity, is one of the innovative projects that will provide novel research of fundamental processes during light-matter interaction. As part of the ELI-NP facility, Targets Laboratory will provide the means for in-house manufacturing and characterization of the required targets (mainly solid ones) for the experiments, in addition to the research activity carried out in order to develop novel target designs with improved performances. A description of the Targets Laboratory with the main pieces of equipment and their specifications are presented. Moreover, in view of the latest progress in the target design, one of the proposed strategies for the forthcoming experiments at ELI-NP is also described, namely: ultra-thin patterned foil of diamond-like carbon (DLC) coated with a carbon-based ultra-low density layer. The carbon foam which behaves as a near-critical density plasma, will allow the controlled-shaping of the laser pulse before the main interaction with the solid foil. Particular emphasis will be directed towards the target's design optimization, by simulation tests and tuning the key-properties (thickness/length, spacing, density foam, depth, periodicity etc.) which are expected to have a crucial effect on the laser-matter interaction process.

  9. Allocation universelle et transferts "ELIE" : De la divergence à la compatibilité ?

    OpenAIRE

    Claude Gamel

    2008-01-01

    Van Parijs (1995) and Kolm (2005) étudient les fondements éthico-philosophiques de la fiscalité et de la redistribution des revenus à travers les projets apparemment proches d'allocation universelle et de transferts ELIE (1). En fait, les deux propositions divergent en raison de modalités plus ou moins crédibles de financement et du traitement très dissemblable des « excentriques productifs » qui choisissent de ne pas travailler (2). Les deux projets restent néanmoins compatibles : du point d...

  10. Belling the cat: Eli F. Heckscher on the gold standard as a discipline device

    OpenAIRE

    Fregert, Klas

    2013-01-01

    Unlike Knut Wicksell, Eli Heckscher did not believe the time had arrived for “managed money” to replace the gold standard after World War I. The war had shown that only a gold standard could bind the central bank to a time-consistent policy with reasonable price stability. Heckscher likened the problem of reinstating the gold standard to “Belling the cat” in Aesop’s fable. When the international gold standard crumbled in the Great Depression, he supported the Swedish price stabilization regim...

  11. Extending the ELisA Logbook to use MySQL

    CERN Document Server

    Osman Jama Ali, Yosuf

    2017-01-01

    ELisA (Electronic Logbook for the Information Storage of ATLAS Experiments at LHC) is a web tool that is used within the ATLAS community to keep track of the daily experiments and deployments within ATLAS. It is implemented using the Spring framework and consists of a web interface, a REST API and a set of client libraries. This Report summarises the process taken in replacing the Oracle database that is used with MySQL, as well as the incorporation of Docker as a deployment strategy in order to make the logbook more portable.

  12. Qualification of Ti6Al4V ELI Alloy Produced by Laser Powder Bed Fusion for Biomedical Applications

    Science.gov (United States)

    Yadroitsev, I.; Krakhmalev, P.; Yadroitsava, I.; Du Plessis, A.

    2018-03-01

    Rectangular Ti6Al4V extralow interstitials (ELI) samples were manufactured by laser powder bed fusion (LPBF) in vertical and horizontal orientations relative to the build platform and subjected to various heat treatments. Detailed analyses of porosity, microstructure, residual stress, tensile properties, fatigue, and fracture surfaces were performed based on x-ray micro-computed tomography, scanning electron microscopy, and x-ray diffraction methods. The types of fracture and the tensile fracture mechanisms of the LPBF Ti6Al4V ELI alloy were also studied. Detailed analysis of the microstructure and the corresponding mechanical properties were compared against standard specifications for conventional Ti6Al4V alloy for use in surgical implant applications. Conclusions regarding the mechanical properties and heat treatment of LPBF Ti6Al4V ELI for biomedical applications are made.

  13. Strong field physics and QED experiments with ELI-NP 2×10PW laser beams

    Energy Technology Data Exchange (ETDEWEB)

    Turcu, I. C. E., E-mail: Edmond.Turcu@eli-np.ro; Balascuta, S., E-mail: Edmond.Turcu@eli-np.ro; Negoita, F., E-mail: Edmond.Turcu@eli-np.ro [National Institute for Physics and Nuclear Engineering, ELI-NP, Str. Reactorului, nr. 30, P.O.Box MG-6, Bucharest-Magurele (Romania); Jaroszynski, D.; McKenna, P. [University of Strathclyde, Scottish Universities Physics Alliance (SUPA), Glasgow G4 0NG, Scotland (United Kingdom)

    2015-02-24

    The ELI-NP facility will focus a 10 PW pulsed laser beam at intensities of ∼10{sup 23} W/cm{sup 2} for the first time, enabling investigation of the new physical phenomena at the interfaces of plasma, nuclear and particle physics. The electric field in the laser focus has a maximum value of ∼10{sup 15} V/m at such laser intensities. In the ELI-NP Experimental Area E6, we propose the study of Radiation Reaction, Strong Field Quantum Electrodynamics (QED) effects and resulting production of Ultra-bright Sources of Gamma-rays which could be used for nuclear activation. Two powerful, synchronized 10 PW laser beams will be focused in the E6 Interaction Chamber on either gas or solid targets. One 10 PW beam is the Pump-beam and the other is the Probe-beam. The focused Pump beam accelerates the electrons to relativistic energies. The accelerated electron bunches interact with the very high electro-magnetic field of the focused Probe beam. The layout of the experimental area E6 will be presented with several options for the experimental configurations.

  14. Identification of Conserved MEL-28/ELYS Domains with Essential Roles in Nuclear Assembly and Chromosome Segregation.

    Science.gov (United States)

    Gómez-Saldivar, Georgina; Fernandez, Anita; Hirano, Yasuhiro; Mauro, Michael; Lai, Allison; Ayuso, Cristina; Haraguchi, Tokuko; Hiraoka, Yasushi; Piano, Fabio; Askjaer, Peter

    2016-06-01

    Nucleoporins are the constituents of nuclear pore complexes (NPCs) and are essential regulators of nucleocytoplasmic transport, gene expression and genome stability. The nucleoporin MEL-28/ELYS plays a critical role in post-mitotic NPC reassembly through recruitment of the NUP107-160 subcomplex, and is required for correct segregation of mitotic chromosomes. Here we present a systematic functional and structural analysis of MEL-28 in C. elegans early development and human ELYS in cultured cells. We have identified functional domains responsible for nuclear envelope and kinetochore localization, chromatin binding, mitotic spindle matrix association and chromosome segregation. Surprisingly, we found that perturbations to MEL-28's conserved AT-hook domain do not affect MEL-28 localization although they disrupt MEL-28 function and delay cell cycle progression in a DNA damage checkpoint-dependent manner. Our analyses also uncover a novel meiotic role of MEL-28. Together, these results show that MEL-28 has conserved structural domains that are essential for its fundamental roles in NPC assembly and chromosome segregation.

  15. A gamma beam profile imager for ELI-NP Gamma Beam System

    Science.gov (United States)

    Cardarelli, P.; Paternò, G.; Di Domenico, G.; Consoli, E.; Marziani, M.; Andreotti, M.; Evangelisti, F.; Squerzanti, S.; Gambaccini, M.; Albergo, S.; Cappello, G.; Tricomi, A.; Veltri, M.; Adriani, O.; Borgheresi, R.; Graziani, G.; Passaleva, G.; Serban, A.; Starodubtsev, O.; Variola, A.; Palumbo, L.

    2018-06-01

    The Gamma Beam System of ELI-Nuclear Physics is a high brilliance monochromatic gamma source based on the inverse Compton interaction between an intense high power laser and a bright electron beam with tunable energy. The source, currently being assembled in Magurele (Romania), is designed to provide a beam with tunable average energy ranging from 0.2 to 19.5 MeV, rms energy bandwidth down to 0.5% and flux of about 108 photons/s. The system includes a set of detectors for the diagnostic and complete characterization of the gamma beam. To evaluate the spatial distribution of the beam a gamma beam profile imager is required. For this purpose, a detector based on a scintillator target coupled to a CCD camera was designed and a prototype was tested at INFN-Ferrara laboratories. A set of analytical calculations and Monte Carlo simulations were carried out to optimize the imager design and evaluate the performance expected with ELI-NP gamma beam. In this work the design of the imager is described in detail, as well as the simulation tools used and the results obtained. The simulation parameters were tuned and cross-checked with the experimental measurements carried out on the assembled prototype using the beam from an x-ray tube.

  16. The Electronic Logbook for the Information Storage of ATLAS Experiment at LHC (ELisA)

    International Nuclear Information System (INIS)

    Corso Radu, A; Lehmann Miotto, G; Magnoni, L

    2012-01-01

    A large experiment like ATLAS at LHC (CERN), with over three thousand members and a shift crew of 15 people running the experiment 24/7, needs an easy and reliable tool to gather all the information concerning the experiment development, installation, deployment and exploitation over its lifetime. With the increasing number of users and the accumulation of stored information since the experiment start-up, the electronic logbook actually in use, ATLOG, started to show its limitations in terms of speed and usability. Its monolithic architecture makes the maintenance and implementation of new functionality a hard-to-almost-impossible process. A new tool ELisA has been developed to replace the existing ATLOG. It is based on modern web technologies: the Spring framework using a Model-View-Controller architecture was chosen, thus helping building flexible and easy to maintain applications. The new tool implements all features of the old electronic logbook with increased performance and better graphics: it uses the same database back-end for portability reasons. In addition, several new requirements have been accommodated which could not be implemented in ATLOG. This paper describes the architecture, implementation and performance of ELisA, with particular emphasis on the choices that allowed having a scalable and very fast system and on the aspects that could be re-used in different contexts to build a similar application.

  17. Nuclear Reactions Studies in Laser-Plasmas at the forthcoming ELI-NP facilities

    Science.gov (United States)

    Lanzalone, G.; Muoio, A.; Altana, C.; Frassetto, M.; Malferrari, L.; Mascali, D.; Odorici, F.; Tudisco, S.; Gizzi, L. A.; Labate, L.; Puglia, S. M. R.; Trifirò, A.

    2018-05-01

    This work aim to prepare a program of studies on nuclear physics and astrophysics, which will be conducted at the new ELI-NP Laser facility, which actually is under construction in Bucharest, Romania. For the arguments treated, such activity has required also a multidisciplinary approach and knowledge in the fields of nuclear physics, astrophysics, laser and plasma physics join with also some competences on solid state physics related to the radiation detection. A part of this work has concerned to the experimental test, which have been performed in several laboratories and in order to study and increase the level of knowledge on the different parts of the project. In particular have been performed studies on the laser matter interaction at the ILIL laboratory of Pisa Italy and at the LENS laboratory in Catania, where (by using different experimental set-ups) has been investigated some key points concerning the production of the plasma stream. Test has been performed on several target configurations in terms of: composition, structure and size. All the work has been devoted to optimize the conditions of target in order to have the best performance on the production yields and on energies distribution of the inner plasma ions. A parallel activity has been performed in order to study the two main detectors, which will constitute the full detections system, which will be installed at the ELI-NP facility.

  18. Eesti välisminister jätab ELis ainsana Rice'iga kohtumata / Toomas Sildam

    Index Scriptorium Estoniae

    Sildam, Toomas, 1961-

    2005-01-01

    Seoses Rein Langi ametisse astumisega 22. veebr., ei jõua ta EL-i välisministrite kohtumisele USA välisministri Condoleezza Rice'iga ega NATO Nõukogu istungile. Lisa: Kaks nädalat välisministrita

  19. CFL Labeling Harmonization in the United States, China, Brazil andELI Member Countries: Specifications, Testing, and MutualRecognition

    Energy Technology Data Exchange (ETDEWEB)

    Fridley, David; Lin, Jiang; Denver, Andrea; Biermayer, Peter; Dillavou, Tyler

    2005-07-20

    This report examines critical differences among energy-efficient labeling programs for CFLs in Brazil, China, the United States, and the seven members of the international Efficient Lighting Initiative (ELI) in terms of technical specifications and test procedures, and review issues related to international harmonization of these standards.

  20. Suhtumine tšetšeeni põgenikesse erineb EL-is seinast seina / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2006-01-01

    Euroopa Komisjoni kriitika EL-i varjupaigapoliitika varieeruvuse kohta: näiteks Austrias rahuldati 84% tšetšeenide varjupaigataotlustest, Saksamaal aga 23%. Rakendus direktiiv, millega määratletakse ühised miinimumstandardid nimetatud taotluste üle otsustamisel, tähtajaks on direktiivi rakendanud vaid kuus riiki

  1. Radiation field characterization and shielding studies for the ELI Beamlines facility

    Czech Academy of Sciences Publication Activity Database

    Ferrari, A.; Amato, E.; Margarone, Daniele; Cowan, T.; Korn, Georg

    2013-01-01

    Roč. 272, May (2013), s. 138-144 ISSN 0169-4332 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087; GA ČR(CZ) GAP205/11/1165 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; AVČR(CZ) M100101210 Institutional support: RVO:68378271 Keywords : particle acceleration from laser-matter interaction * shielding * Monte Carlo * radiation protection Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.538, year: 2013

  2. The Energy Selection System for the laser-accelerated proton beams at ELI-Beamlines

    Czech Academy of Sciences Publication Activity Database

    Tramontana, A.; Candiano, G.; Carpinelli, M.; Cirrone, G.A.P.; Cuttone, G.; Bijan Jia, S.; Korn, Georg; Licciardello, T.; Maggiore, Mario; Manti, L.; Margarone, Daniele; Pisciotta, P.; Romano, F.; Stancampiano, C.; Schillaci, Francesco; Scuderi, Valentina

    2014-01-01

    Roč. 9, May (2014), s. 1-11 ISSN 1748-0221 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : instrumentation for hadron therapy * wake-field acceleration (laser-driven, electron-driven) * plasma diagnostics * charged-particle spectroscopy Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.399, year: 2014

  3. The visual impact of Taff Ely wind farm - a case study using GIS

    International Nuclear Information System (INIS)

    Kidner, D.B.

    1997-01-01

    This paper describes a project being undertaken to validate the performance of a Geographical Information System (GIS) being developed to predict, quantify and qualify the visual impact of proposed wind farm developments. In order to determine the optimal choice of terrain data model, elevation and topographic data sets, and visibility algorithms, a validation study for the Taff Ely Wind Farm has been commissioned. The issues involved in calculating and presenting visual impact are discussed, whilst a methodology for verifying the results is also described. Existing methods for presenting for visual impact of wind farms are limited and susceptible to error, whilst the interpretation of the results can often do more harm than good. The use of GIS to visualise the probable impacts is illustrated to add meaning to the results of a wind farm visibility study. (author)

  4. Cyclic deformation and fatigue data for Ti–6Al–4V ELI under variable amplitude loading

    Directory of Open Access Journals (Sweden)

    Patricio E. Carrion

    2017-08-01

    Full Text Available This article presents the strain-based experimental data for Ti–6Al–4V ELI under non-constant amplitude cyclic loading. Uniaxial strain-controlled fatigue experiments were conducted under three different loading conditions, including two-level block loading (i.e. high-low and low-high, periodic overload, and variable amplitude loading. Tests were performed under fully-reversed, and mean strain/stress conditions. For each test conducted, two sets of data were collected; the cyclic stress–strain response (i.e. hysteresis loops in log10 increments, and the peak and valley values of stress and strain for each cycle. Residual fatigue lives are reported for tests with two-level block loading, while for periodic overload and variable amplitude experiments, fatigue lives are reported in terms of number of blocks to failure.

  5. Design of the gas cell for the IGISOL facility at ELI-NP

    Energy Technology Data Exchange (ETDEWEB)

    Constantin, P., E-mail: paul.constantin@eli-np.ro [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Balabanski, D.L. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Anh, L.T. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Graduate University of Science and Technology, Vietnam Academy of Science and Technology, Hanoi (Viet Nam); Cuong, P.V. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Centre of Nuclear Physics, Institute of Physics, Vietnam Academy of Science and Technology, Hanoi (Viet Nam); Mei, B. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania)

    2017-04-15

    One of the experimental programs that will be carried out at the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) facility is the production of exotic neutron-rich ion beams in an IGISOL facility via photofission in a stack of actinide targets placed at the center of a cell filled with He gas. Simulations with the Geant4 toolkit were done for the optimization of the target configuration that maximizes the rate of released photofission fragments. The cell geometry is established based on the stopping properties of these fragments. Studies, based on simulations with Geant4 and SIMION 8.1, of the space charge effect and its induced electric field in the gas cell are presented. Estimates of the extraction time and efficiency of the photofission fragments are derived.

  6. HOS cell adhesion on Ti6Al4V ELI texturized by CO2 laser

    Science.gov (United States)

    Sandoval-Amador, A.; Bayona–Alvarez, Y. M.; Carreño Garcia, H.; Escobar-Rivero, P.; Y Peña-Ballesteros, D.

    2017-12-01

    In this work, the response of HOS cells on Ti6Al4V ELI textured surfaces by a CO2 laser was evaluated. The test surfaces were; smooth Ti6Al4V, used as the control, and four textured surfaces with linear geometry. These four surfaces had different separation distances between textured lines, D1 (1000 microns), D2 (750 microns), D3 (500 microns) and D4 (250 microns). Toxicity of textured surfaces was assessed by MTT and the cellular adhesion test was performed using HOS ATCC CRL 1543 line cells. This test was done after 5 days of culture in a RPMI 1640 medium supplemented with 10% fetal bovine serum and 1% antibiotics. The results showed that the linear textures present 23% toxicity after 30 days of incubation, nevertheless, the adhesion tests results are inconclusive in such conditions and therefore the effect of the line separation on the cell adhesion cannot be determined.

  7. The development of molecularly targeted anticancer therapies: an Eli Lilly and Company perspective.

    Science.gov (United States)

    Perry, William L; Weitzman, Aaron

    2005-03-01

    The ability to identify activated pathways that drive the growth and progression of cancer and to develop specific and potent inhibitors of key proteins in these pathways promises to dramatically change the treatment of cancer: A patient's cancer could be characterized at the molecular level and the information used to select the best treatment options. The development of successful therapies not only requires extensive target validation, but also new approaches to evaluating drug efficacy in animal models and in the clinic compared to the development of traditional cytotoxic agents. This article highlights Eli Lilly and Company's approach to developing targeted therapies, from target identification and validation through evaluation in the clinic. A selection of drugs in the Lilly Oncology pipeline is also discussed.

  8. Radiation field characterization and shielding studies for the ELI Beamlines facility

    Energy Technology Data Exchange (ETDEWEB)

    Ferrari, A., E-mail: a.ferrari@hzdr.de [Institute of Radiation Physics, Helmholtz-Zentrum Dresden-Rossendorf, PF 510119, 01314 Dresden (Germany); Amato, E. [Department of Radiological Sciences, Messina University (Italy); Margarone, D. [ELI Beamlines Project, Institute of Physics of the ASCR, Na Slovance 2, 18221 Prague (Czech Republic); PALS Centre, Za Slovankou, 18200 Prague (Czech Republic); Cowan, T. [Institute of Radiation Physics, Helmholtz-Zentrum Dresden-Rossendorf, PF 510119, 01314 Dresden (Germany); Korn, G. [ELI Beamlines Project, Institute of Physics of the ASCR, Na Slovance 2, 18221 Prague (Czech Republic)

    2013-05-01

    The ELI (Extreme Light Infrastructure) Beamlines facility in the Czech Republic, which is planned to complete the installation in 2015, is one of the four pillars of the ELI European project. Several laser beamlines with ultrahigh intensities and ultrashort pulses are foreseen, offering versatile radiation sources in an unprecedented energy range: laser-driven particle beams are expected to range between 1 and 50 GeV for electrons and from 100 MeV up to 3 GeV for protons. The number of particles delivered per laser shot is estimated to be 10{sup 9}–10{sup 10} for the electron beams and 10{sup 10}–10{sup 12} for the proton beams. The high energy and current values of the produced particles, together with the potentiality to operate at 10 Hz laser repetition rate, require an accurate study of the primary and secondary radiation fields to optimize appropriate shielding solutions: this is a key issue to minimize prompt and residual doses in order to protect the personnel, reduce the radiation damage of electronic devices and avoid strong limitations in the operational time. A general shielding study for the 10 PW (0.016 Hz) and 2 PW (10 Hz) laser beamlines is presented here. Starting from analytical calculations, as well as from dedicated simulations, the main electron and proton fields produced in the laser-matter interaction have been described and used to characterize the “source terms” in full simulations with the Monte Carlo code FLUKA. The secondary radiation fields have been then analyzed to assess a proper shielding. The results of this study and the proposed solutions for the beam dumps of the high energy beamlines, together with a cross-check analysis performed with the Monte Carlo code GEANT4, are presented.

  9. Institutionalising co-operation : a study of the Elysée treaty and Franco-German co-operation 1963-1993

    OpenAIRE

    Sverdrup, Bjørn Otto

    1994-01-01

    "INSTITUTIONALISING CO-OPERATION. A STUDY OF THE ELYSÉE TREATY AND FRANCO-GERMAN CO-OPERATION 1963-93" In 1963, France and Germany completed 'The Franco-German Treaty on Organization and Principles of Co-operation', the so-called Elysée Treaty. The Elysée Treaty, and its protocols, are in this study viewed as a political institution, hence the Elysée Treaty will be referred to as the Franco-German institution. This study seeks to answer the question of how the Franco-German institution has...

  10. Photonuclear reactions in astrophysical p-process: Theoretical calculations and experiment simulation based on ELI-NP

    Science.gov (United States)

    Xu, Yi; Luo, Wen; Balabanski, Dimiter; Goriely, Stephane; Matei, Catalin; Tesileanu, Ovidiu

    2017-09-01

    The astrophysical p-process is an important way of nucleosynthesis to produce the stable and proton-rich nuclei beyond Fe which can not be reached by the s- and r-processes. In the present study, the astrophysical reaction rates of (γ,n), (γ,p), and (γ,α) reactions are computed within the modern reaction code TALYS for about 3000 stable and proton-rich nuclei with 12 Infrastructure-Nuclear Physics (ELI-NP) facility is being developed, which will provide the great opportunity to experimentally study the photonuclear reactions in p-process. Simulations of the experimental setup for the measurements of the photonuclear reactions 96Ru(γ,p) and 96Ru(γ,α) are performed. It is shown that the experiments of photonuclear reactions in p-process based on ELI-NP are quite promising.

  11. Study about the entrepreneurs´ or social iInnovators´ competencies case study of the EAN ELI Prize

    Directory of Open Access Journals (Sweden)

    Omar Alonso Patiño Castro

    2017-02-01

    Full Text Available Social innovation and entrepreneurship have become managerial alternatives, even if they are used for profit or non-profit purposes. This article aims at identifying the competencies of the social innovator and entrepreneur focusing on the basic concept of those who consider that they belong to those categories. The information used in this project was collected by the ELI Prize participants organized and held at Universidad EAN in 2013 and 2014.

  12. Influence of thermo hydrogen treatment on microstructure and mechanical properties of Ti-5Al-2.5Sn ELI alloy

    Directory of Open Access Journals (Sweden)

    Ya-fei Ren

    2017-01-01

    Full Text Available Thermo hydrogen treatment (THT of titanium is a process in which hydrogen is used as a temporary alloying element in titanium alloys. It is an attractive approach for controlling the microstructure and thereby improving the final mechanical properties. In the present study, the microstructure of the original (non-hydrogenated sample has only α phase and the grains is coarse with an average size of ~ 650 μm. While the grain size of thermo hydrogen treated Ti-5Al-2.5Sn ELI alloy became finer and the mechanical properties were improved significantly. When the hydrogen content of the hydrogenated Ti-5Al-2.5Sn ELI alloy is 0.321wt.%, β phase and δ titanium hydride appear. Also the average grain size decreases to 450 μm. When the hydrogen content is 0.515wt.%, the grain size decreases to 220 μm. The mechanical properties were tested after dehydrogenation, and the mechanical properties improved significantly compared to the unhydrogenated specimens. The tensile strength of the Ti-5Al-2.5Sn ELI alloy improved by 17.7% when the hydrogen content increased to 0.920wt.%, at the same time the percentage reduction of area (Z increased by 33% and the impact toughness increased by 37%.

  13. ELiXIR—Solid-State Luminaire With Enhanced Light Extraction by Internal Reflection

    Science.gov (United States)

    Allen, Steven C.; Steckl, Andrew J.

    2007-06-01

    A phosphor-converted light-emitting diode (pcLED) luminaire featuring enhanced light extraction by internal reflection (ELiXIR) with efficacy of 60 lm/W producing 18 lumens of yellowish green light at 100 mA is presented. The luminaire consists of a commercial blue high power LED, a polymer hemispherical shell lens with interior phosphor coating, and planar aluminized reflector. High extraction efficiency of the phosphor-converted light is achieved by separating the phosphor from the LED and using internal reflection to steer the light away from lossy reflectors and the LED package and out of the device. At 10 and 500 mA, the luminaire produces 2.1 and 66 lumens with efficacies of 80 and 37 lm/W, respectively. Technological improvements over existing commercial LEDs, such as more efficient pcLED packages or, alternatively, higher efficiency green or yellow for color mixing, will be essential to achieving 150 200 lm/W solid-state lighting. Advances in both areas are demonstrated.

  14. MAAGs (Medical Audit Advisory Groups): the Eli Lilly National Clinical Audit Centre.

    Science.gov (United States)

    Baker, R; Fraser, R

    1993-01-01

    Outlines the framework for promoting audit in general practice, created as one part of the health service reforms. Medical Audit Advisory Groups (MAAGs) were set up in each district with the aim of participation in audit of all general practitioners by April 1992. The activities undertaken have included those recommended by the Department of Health; the most significant of these being the appointment of lay facilitators who are able to assist general practitioners and primary care teams co-operate over efforts to improve the quality of care, and may offer one means of introducing some of the methods of total quality management into general practice. Discusses the problems which remain: audit is not yet sufficiently systematic, interface audit with secondary care is at a very early stage, the ways to involve managers and patients in audit remain to be clarified, and there is little evidence of the consequences of audit in terms of improved care. The Eli Lilly National Clinical Audit Centre has been set up within the Department of General Practice, University of Leicester, in order to address these issues.

  15. The Electronic Logbook for the Information Storage of ATLAS Experiment at LHC (ELisA)

    CERN Document Server

    Corso-Radu, A; The ATLAS collaboration; Magnoni, L

    2012-01-01

    A large experiment like ATLAS at LHC (CERN), with over three thousand members and a shift crew of 15 people running the experiment 24/7, needs an easy and reliable tool to gather all the information concerning the experiment development, installation, deployment and exploitation over its lifetime. With the increasing number of users and the accumulation of stored information since the experiment start-up, the electronic logbook actually in use, ATLOG, started to show its limitations in terms of speed and usability. Its monolithic architecture makes the maintenance and implementation of new functionality a hard-to-almost-impossible process. A new tool ELisA has been developed to replace the existing ATLOG. It is based on modern web technologies: the Spring framework using a Model-View-Controller architecture was chosen, thus helping building flexible and easy to maintain applications. The new tool implements all features of the old electronic logbook with increased performance and better graphics: it uses the ...

  16. Tertiary particle physics with ELI: from challenge to chance (Conference Presentation)

    Science.gov (United States)

    Drska, Ladislav

    2017-05-01

    . Concrete application study: muon tomography. (22) Antilepton gravity studies [14]: Possibility of antimattter gravity research using positronium and muonium [15] [16]. Lepton / antilepton gravity studiesactive with relativistic particle beams [17]. First-phase practical application : positron production for filling (commertial) particle traps, development base for multiple microtrap systems. (23) Hidden world searching [18] : Potential laser-based production / detection of selected dark mattter particles - axions, hidden photons [19] [20]. Search for hidden particles in nuclear decay processes [21]. Potential application output: intense positronium source. Conclusion: The extensive feasibility study confirms the potential of ELI to contribute to the solution of Grand Challenge Problems of physics. Laser-produced tertiary particles will play important role in this effort. : References [1] L.Drska et al.: Physics of Extreme Systems. Course ATHENS CTU18, Prague 12 - 19 Nov., 2016. http://vega.fjfi.cvut.cz/docs/athens2016/ [2] L.Drska : Lepton Diagnostics and Antimatter Physics. In: SPIE Optics+Optoelectronics, Prague, April 13 - 16, 2015 . [3] H. Chen et al.: Scaling the Yield of Laser-Driven Electron-Positron Jets to Laboratory Astrophysics Applications. Rep. LLNL-JRNL-665381, Dec. 11, 2014. [4] E Liang et al.: High e+ / e- Ratio Dense Pair Creation with 1022 W.cm-2 Laser Irradiating Solid Targets. Scientific Reports, Sept. 14, 2015. www.nature.com/scientificreports [5] G. Sarri et al.: Spectral and Spatial Characterization of Laser-driven Positron Beams. Plasma Phys. Control. Fusion 59 (2017) 014015. [6] B. Schoch: A Method to Produce Intense Positron Beams via Electro Pair Production on Electrons. arXiv:1607.03847v1 [physics.acc-ph] [7] I. Pomerantz: Laser Generation of Neutrons: Science and Applications. In: ELI-NP Summer School, Magurele, Sept. 21 - 25, 2015. http://www.eli-np.ro/2015-summer-school/presentations/23.09/Pomerantz_Eli-NP-Summer-school-2015.pdf [8] V

  17. Validatin of miniaturised tensile testing on DMLS TI6AL4V (ELI specimens

    Directory of Open Access Journals (Sweden)

    Van Zyl, Ian

    2016-11-01

    Full Text Available Direct metal laser sintering (DMLS is a relatively new technology that is developing rapidly. Since DMLS material is created by melting/solidifying tracks and layers from powder, even building geometry can influence the mechanical properties. To certify a material, the testing specimens must be designed and manufactured according to the appropriate standards. Miniaturised tensile DMLS samples could be a good alternative for express quality control, and could reduce the cost of DMLS-specific testing. In this study, as-built and stress-relieved miniaturised tensile DMLS Ti6Al4V (ELI specimens with different surface qualities were investigated. The fracture surfaces and mechanical properties of the mini-tensile specimens were analysed and compared with standard full-sized specimens also manufactured by DMLS. The obtained data showed the applicability of mini-tensile tests for the express analysis of DMLS objects if a correction factor is applied for the calculation of the load-bearing cross-section of the specimen.

  18. Benthic macroinvertebrate assemblages and sediment toxicity testing in the Ely Creek watershed restoration project

    International Nuclear Information System (INIS)

    Soucek, D.J.; Currie, R.J.; Cherry, D.S.; Latimer, H.A.

    1998-01-01

    The Ely Creek watershed in Lee County, Virginia, contains an abundance of abandoned mined land (AML) seeps that contaminate the majority of the creek and its confluence into Big Stone Creek. Contaminated sediments had high concentrations of iron (∼10,000 mg/kg), aluminum (∼1,500 mg/kg), magnesium (∼400 mg/kg) and manganese (∼150 mg/kg). Copper and zinc generally ranged from 3 to 20 mg/kg. Benthic macroinvertebrates surveys at six of 20 sites sampled in the watershed yielded no macroinvertebrates, while eight others had total abundances of 1 to 9 organisms. Four reference sites contained ≥100 organisms and at least 14 different taxa. Laboratory, 10-day survival/impairment sediments tests with Daphnia magna did not support the field data. Mortality of 92 to 100% for D. magna occurred in samples collected from six cities. Daphnid reproduction was more sensitive than laboratory test organism survivorship; however, neither daphnid survivorship nor reproduction were good predictors of taxa richness. Laboratory test concerns included the use of a reference diluent water rather than site specific diluent water

  19. Rahvusvaheline Jugoslaavia Tribunal / Evelin Lehis

    Index Scriptorium Estoniae

    Lehis, Evelin

    1996-01-01

    ÜRO Julgeolekunõukogu resolutsiooniga 1993. a. loodud Rahvusvahelisest Jugoslaavia Tribunalist asukohaga Haagis: struktuurist ja kompetentsist. Kuritegudest, mis on sooritatud siseriikliku sõjalise konflikti käigus

  20. Characteristics microstructure and microhardness of cast Ti-6Al-4V ELI for biomedical application submitted to solution treatment

    Science.gov (United States)

    Damisih, Jujur, I. Nyoman; Sah, Joni; Agustanhakri, Prajitno, Djoko Hadi

    2018-05-01

    Ti 6Al-4V ELI (Extra Low Interstitial)alloy containing 6wt% of aluminum, 4wt% of vanadium with controlled level of iron and oxygen is one of most popular alloy employed in biomedical applications as implant material. Heat treatment process for titanium alloys becomes important and could be performed by some of different ways in order to develop microstructure as well as its properties. The objective of this paper is to study the effects of solution treatment temperature on microstructure and mechanical properties of as-cast Ti-6Al-4V ELI especially microhardness value. The alloy was melted by single arc melting furnace with a water-cooled copper crucible hearth under argon atmosphere and then casted. It was heat treated through solution treatment at 3 (three) different temperaturesi.e. 850°C, 950°C and 1050°C in an argon gas atmosphere for around 30 minutes. After solution treatment, samples were water quenched and then aged at temperature of 500°C for 4 hours. To investigate its microstructure, the alloy was investigated under optical microscope and scanning electron microscope (SEM). It was observed Widmanstätten microstructure consisting of mixture α and β phase with basket-weave pattern. The Vickers microhardness test was performed and the results exhibited the optimum value was obtained at temperature of 950°C of solution treatment. From the observation, it revealed that the heat treatment has substantial effect on microstructural properties where microhardness increased due to formation of α' martensite structure. It was showed also that solution treatment followed by aging could improve mechanical properties especially microhardness value of Ti-6Al-4V ELI alloy. These results were suggesting the optimized conditions of heat treatment to obtain the best microstructure properties and microhardness value.

  1. P3: An installation for high-energy density plasma physics and ultra-high intensity laser–matter interaction at ELI-Beamlines

    Directory of Open Access Journals (Sweden)

    S. Weber

    2017-07-01

    Full Text Available ELI-Beamlines (ELI-BL, one of the three pillars of the Extreme Light Infrastructure endeavour, will be in a unique position to perform research in high-energy-density-physics (HEDP, plasma physics and ultra-high intensity (UHI (>1022W/cm2 laser–plasma interaction. Recently the need for HED laboratory physics was identified and the P3 (plasma physics platform installation under construction in ELI-BL will be an answer. The ELI-BL 10 PW laser makes possible fundamental research topics from high-field physics to new extreme states of matter such as radiation-dominated ones, high-pressure quantum ones, warm dense matter (WDM and ultra-relativistic plasmas. HEDP is of fundamental importance for research in the field of laboratory astrophysics and inertial confinement fusion (ICF. Reaching such extreme states of matter now and in the future will depend on the use of plasma optics for amplifying and focusing laser pulses. This article will present the relevant technological infrastructure being built in ELI-BL for HEDP and UHI, and gives a brief overview of some research under way in the field of UHI, laboratory astrophysics, ICF, WDM, and plasma optics.

  2. Relato literario, relato periodístico: el caso Elián González

    OpenAIRE

    Lic. María Inés Loyola; Lic. Miriam Eugenia Villa

    2000-01-01

    Nos proponemos estudiar las relaciones entre relato literario y relato periodístico a partir del caso del niño balsero cubano, Elián González, que estuvo retenido en Estados Unidos durante siete meses. En este análisis, el principal objetivo es describir las diferencias y similitudes respecto a la construcción discursiva de la historia narrada, sus personajes y escenarios. La finalidad de la comparación es demostrar cómo los relatos "no ficcionales" que los medios imponen como verdaderos y ac...

  3. Future laser-accelerated proton beams at ELI-Beamlines as potential source of positron emitters for PET

    Czech Academy of Sciences Publication Activity Database

    Amato, E.; Italiano, A.; Margarone, Daniele; Pagano, B.; Baldari, S.; Korn, Georg

    2016-01-01

    Roč. 11, Apr (2016), 1-7, č. článku C04007. ISSN 1748-0221 R&D Projects: GA MŠk EF15_008/0000162; GA MŠk LQ1606; GA ČR(CZ) GA15-02964S Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : accelerator applications * radiotherapy concepts Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.220, year: 2016

  4. Measuring GAMMA 10 end-loss ions with an ELIS [end-loss-ion spectrometers] from TMX-U

    International Nuclear Information System (INIS)

    Foote, J.H.

    1987-01-01

    The author spent the period from March 22 to July 10, 1987, at the GAMMA 10 tandem-mirror experiment at the University of Tsukuba in Tsukuba, Japan. The purpose of this extended trip was to install on GAMMA 10 one of the end-loss-ion spectrometers (ELIS) used on TMX-U (Tandem Mirror Experiment-Upgrade) at LLNL and to make plasma measurements there with this diagnostic instrument. This report discusses the considerable planning and preparations that preceded the trip, the actual experience with the ELIS equipment at GAMMA 10, data and results obtained while the author was there, GAMMA 10 experimental procedures, the scientific and technical support during the stay, and some final comments and suggestions concerning an international exchange such as this one. The data acquired on GAMMA 10 while there, along with earlier data, present an encouraging picture of a plasma in a thermal-barrier mode in a tandem-mirror, magnetic-fusion machine. 6 refs

  5. Capture and photonuclear reaction rates involving charged-particles: Impacts of nuclear ingredients and future measurement on ELI-NP

    Directory of Open Access Journals (Sweden)

    Xu Y.

    2018-01-01

    Full Text Available The astrophysical p-process is an important way of nucleosynthesis to produce the stable and proton-rich nuclei beyond Fe which can not be reached by the s- and r-processes. In the present study, the impact of nuclear ingredients, especially the nuclear potential, level density and strength function, to the astrophysical re-action rates of (p,γ, (α,γ, (γ,p, and (γ,α reactions are systematically studied. The calculations are performed basad on the modern reaction code TALYS for about 3000 stable and proton-rich nuclei with 12≤Z≤110. In particular, both of the Wood-Saxon potential and the microscopic folding potential are taken into account. It is found that both the capture and photonuclear reaction rates are very sensitive to the nuclear potential, thus the better determination of nuclear potential would be important to reduce the uncertainties of reaction rates. Meanwhile, the Extreme Light Infrastructure-Nuclear Physics (ELI-NP facility is being developed, which will provide the great opportunity to experimentally study the photonuclear reactions in p-process. Simulations of the experimental setup for the measurements of the photonuclear reactions 96Ru(γ,p and 96Ru(γ,α are performed. It is shown that the experiments of photonuclear reactions in p-process based on ELI-NP are quite promising.

  6. Capture and photonuclear reaction rates involving charged-particles: Impacts of nuclear ingredients and future measurement on ELI-NP

    Science.gov (United States)

    Xu, Y.; Goriely, S.; Balabanski, D. L.; Chesnevskaya, S.; Guardo, G. L.; La Cognata, M.; Lan, H. Y.; Lattuada, D.; Luo, W.; Matei, C.

    2018-05-01

    The astrophysical p-process is an important way of nucleosynthesis to produce the stable and proton-rich nuclei beyond Fe which can not be reached by the s- and r-processes. In the present study, the impact of nuclear ingredients, especially the nuclear potential, level density and strength function, to the astrophysical re-action rates of (p,γ), (α,γ), (γ,p), and (γ,α) reactions are systematically studied. The calculations are performed basad on the modern reaction code TALYS for about 3000 stable and proton-rich nuclei with 12≤Z≤110. In particular, both of the Wood-Saxon potential and the microscopic folding potential are taken into account. It is found that both the capture and photonuclear reaction rates are very sensitive to the nuclear potential, thus the better determination of nuclear potential would be important to reduce the uncertainties of reaction rates. Meanwhile, the Extreme Light Infrastructure-Nuclear Physics (ELI-NP) facility is being developed, which will provide the great opportunity to experimentally study the photonuclear reactions in p-process. Simulations of the experimental setup for the measurements of the photonuclear reactions 96Ru(γ,p) and 96Ru(γ,α) are performed. It is shown that the experiments of photonuclear reactions in p-process based on ELI-NP are quite promising.

  7. Medical research and multidisciplinary applications with laser-accelerated beams: the ELIMED netwotk at ELI-Beamlines

    Science.gov (United States)

    Tramontana, A.; Anzalone, A.; Candiano, G.; Carpinelli, M.; Cirrone, G. A. P.; Cuttone, G.; Korn, G.; Licciardello, T.; Maggiore, M.; Manti, L.; Margarone, D.; Musumarra, A.; Perozziello, F.; Pisciotta, P.; Raffaele, L.; Romano, F.; Romano, F. P.; Stancampiano, C.; Schillaci, F.; Scuderi, V.; Torrisi, L.; Tudisco, S.

    2014-04-01

    Laser accelerated proton beams represent nowadays an attractive alternative to the conventional ones and they have been proposed in different research fields. In particular, the interest has been focused in the possibility of replacing conventional accelerating machines with laser-based accelerators in order to develop a new concept of hadrontherapy facilities, which could result more compact and less expensive. With this background the ELIMED (ELIMED: ELI-Beamlines MEDical applications) research project has been launched by LNS-INFN researchers (Laboratori Nazionali del Sud-Istituto Nazionale di Fisica Nucleare, Catania, IT) and ASCR-FZU researchers (Academy of Sciences of the Czech Republic-Fyzikální ústar, Prague, Cz), within the pan-European ELI-Beamlines facility framework. Its main purposes are the demonstration of future applications in hadrontherapy of optically accelerated protons and the realization of a laser-accelerated ion transport beamline for multidisciplinary applications. Several challenges, starting from laser-target interaction and beam transport development, up to dosimetric and radiobiological issues, need to be overcome in order to reach the final goals. The design and the realization of a preliminary beam handling and dosimetric system and of an advanced spectrometer for high energy (multi-MeV) laser-accelerated ion beams will be shortly presented in this work.

  8. [J. Tapio. Suljetut vaunut, eli, Kadonnutta aikaa etsimässä ; Jukka Kostiainen. Kinnises tõllas, ehk, Kadunud aega otsimas ; Tatu Vaaskivi. Maarjamaa] / Hannu Oittinen

    Index Scriptorium Estoniae

    Oittinen, Hannu, 1959-

    2013-01-01

    Arvustus: Tapio, J. Suljetut vaunut, eli, Kadonnutta aikaa etsimässä. Porvoo : J. Kostiainen, 2012 ; Kostiainen, Jukka. Kinnises tõllas, ehk, Kadunud aega otsimas / tõlkinud Ants Paikre. Tartu : Atlex, 2013 ; Vaaskivi, Tatu. Maarjamaa / tõlkinud Ants Paikre. Tallinn : Kultuurileht, 2013. (Loomingu raamatukogu)

  9. La voz en la tribuna (El verbo apasionado de Jorge Eliécer Gaitán

    Directory of Open Access Journals (Sweden)

    Carlos José Reyes

    2009-05-01

    Full Text Available El uso de la voz humana comoun medio de comunicación einducción frente a la comunidad,se ha desarrollado desde las primerascivilizaciones. Sócrates creóen Grecia la primera escuela deoratoria. En Colombia, uno de lospolíticos y oradores públicos quemás utilizó la oratoria, con su vozvibrante y emotiva, fue el caudilloliberal Jorge Eliécer Gaitán, quienencontró las palabras, los acentos,giros y expresiones adecuadaspara comunicarse con ampliossectores populares. La fuerza desu movimiento lo hubiera llevadoa la presidencia, de no ser por suasesinato, el 9 de abril de 1948.Palabras clave: oratoria, pueblo, a lacarga, mamola, reconquista.

  10. Evolution of plastic deformation and its effect on mechanical properties of laser additive repaired Ti64ELI titanium alloy

    Science.gov (United States)

    Zhao, Zhuang; Chen, Jing; Tan, Hua; Lin, Xin; Huang, Weidong

    2017-07-01

    In this paper, laser additive manufacturing (LAM) technology with powder feeding has been employed to fabricate 50%LAMed specimens (i.e. the volume fraction of the laser deposited zone was set to 50%). With aid of the 3D-DIC technique, the tensile deformation behavior of 50%LAMed Ti64ELI titanium alloy was investigated. The 50%LAMed specimen exhibits a significant characteristic of strength mismatch due to the heterogeneous microstructure. The tensile fracture of 50%LAMed specimen occurs in WSZ (wrought substrate zone), but the tensile strength is slightly higher and the plastic elongation is significantly lower than that of the wrought specimen. The 3D-DIC results shows that the 50%LAMed specimen exhibits a characteristic of dramatic plastic strain heterogeneity and the maximal strain is invariably concentrated in WSZ. The ABAQUS simulation indicates that, the LDZ (laser deposited zone) can constrain the plastic deformation of the WSZ and biaxial stresses develop at the interface after yielding.

  11. User oriented end-station on VUV pump-probe magneto-optical ellipsometry at ELI beamlines

    Science.gov (United States)

    Espinoza, Shirly; Neuber, Gerd; Brooks, Christopher D.; Besner, Bastian; Hashemi, Maryam; Rübhausen, Michael; Andreasson, Jakob

    2017-11-01

    A state of the art ellipsometer for user operations is being implemented at ELI Beamlines in Prague, Czech Republic. It combines three of the most promising and exotic forms of ellipsometry: VUV, pump-probe and magneto-optical ellipsometry. This new ellipsometer covers a spectral operational range from the NIR up to the VUV, with high through-put between 1 and 40 eV. The ellipsometer also allows measurements of magneto-optical spectra with a 1 kHz switchable magnetic field of up to 1.5 T across the sample combining ellipsometry and Kerr spectroscopy measurements in an unprecedented spectral range. This form of generalized ellipsometry enables users to address diagonal and off-diagonal components of the dielectric tensor within one measurement. Pump-probe measurements enable users to study the dynamic behaviour of the dielectric tensor in order to resolve the time-domain phenomena in the femto to 100 ns range.

  12. Tensile properties and microstructure of direct metal laser-sintered TI6AL4V (ELI alloy

    Directory of Open Access Journals (Sweden)

    Moletsane, M. G.

    2016-11-01

    Full Text Available Direct metal laser sintering (DMLS is an additive manufacturing technology used to melt metal powder by high laser power to produce customised parts, light-weight structures, or other complex objects. During DMLS, powder is melted and solidified track-by-track and layer-by-layer; thus, building direction can influence the mechanical properties of DMLS parts. The mechanical properties and microstructure of material produced by DMLS can depend on the powder properties, process parameters, scanning strategy, and building geometry. In this study, the microstructure, tensile properties, and porosity of DMLS Ti6Al4V (ELI horizontal samples were analysed. Defect analysis by CT scans in pre-strained samples was used to detect the crack formation mechanism during tensile testing of as-built and heat-treated samples. The mechanical properties of the samples before and after stress relieving are discussed.

  13. Laser-induced damage threshold tests of ultrafast multilayer dielectric coatings in various environmental conditions relevant for operation of ELI beamlines laser systems

    Czech Academy of Sciences Publication Activity Database

    Ďurák, Michal; Velpula, Praveen K.; Kramer, Daniel; Cupal, Josef; Medřík, Tomáš; Hřebíček, Jan; Golasowski, Jiří; Peceli, Davorin; Kozlová, Michaela; Rus, Bedřich

    2017-01-01

    Roč. 56, č. 1 (2017), s. 1-6, č. článku 011024. ISSN 0091-3286 R&D Projects: GA MŠk LQ1606; GA MŠk LM2015065; GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091; GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 Laser Sys(XE) CZ.1.07/2.3.00/20.0091; ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : Peta-watt class laser s * ultrafast laser s * behavior at different vacuum levels * cleaning treatment Subject RIV: BH - Optics, Masers, Laser s OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.082, year: 2016

  14. ELI-NP Tesislerinde Radyasyon Dozimetri Laboratuvarı için Kalite Yönetim Sisteminin (QMS) Teknik Yönleri

    OpenAIRE

    Dorina ARANGHEL; Doina STANCIU; Chivuta-Ramona BADITA; Ana STOCHIOIU; Ion TUDOR

    2018-01-01

    The individual andenvironmental passive monitoring program of the Extreme Light Infrastructure -Nuclear Physics (ELI-NP) will use a combination of Optically StimulatedLuminescence (OSL) and Solid State Nuclear Track Detector – (SSNTD) detectors.The OSL dosimeters are dedicated for X-rays/gamma radiation monitoring and willcontain BeO detectors which provide the personal dose equivalent and theambient dose equivalent or the directional dose equivalent according to SR EN62387-1:2012. The SSNTDs...

  15. Formation of Ca/P ceramic coatings by Plasma Electrolytic Oxidation (PEO) on Ti6Al4V ELI alloy

    Science.gov (United States)

    Rodriguez-Jaimes, Y.; Naranjo, D. I.; Blanco, S.; García-Vergara, S. J.

    2017-12-01

    The formation of PEO ceramic coatings on Ti6Al4V ELI alloy was investigated using a phosphate/calcium containing electrolyte at 300 and 400V at 310K for different times. The Plasma Electrolytic Oxidation (PEO) coated specimens were then heat treated at 873 and 1073K for 2 hours. Scanning electron microscopy, Energy Dispersive X-Ray Spectroscopy (EDS) and X-ray diffraction analysis were used to study the composition and the morphology of the ceramic coatings. The corrosion behaviour of the coatings was studied by Electrochemical Impedance Spectroscopy (EIS) in Simulated Body Fluid (SBF). The PEO-treated specimens primarily revealed a porous structure with thickness between 4 and 12μm, according to the voltage and process time used. The coatings are mainly composed of hydroxyapatite; however, as the voltage and anodizing time increase, the Ca/P ratio decreases. Generally, the corrosion resistance of the alloy was improved by the PEO-treated coatings, although the specimens treated at 1073K showed the presence of cracks that reduced the protective effect of the coatings.

  16. Elie Luzac and L’homme plus que machine (1748: The Dialogic Voice of an Enlightenment Printer

    Directory of Open Access Journals (Sweden)

    Lieve Jooken

    2018-01-01

    Full Text Available Early into his career as one of the most successful printerpublishers of the Dutch Republic, Elie Luzac (1721-1796 played a pivotal role in disseminating the materialist ideas of La Mettrie’s Homme machine (1747. This paper focuses on the dialogic voice (Bakhtine in a publication by Luzac himself, which oscillates between asserting and refuting La Mettrie’s views. Descended from Huguenot refugees, Luzac condemns what he publishes and publishes what he condemns. This discursive ambiguity emerges in Luzac’s L’homme plus que machine (1748, a work which cites La Mettrie’s theses in order to contest them. Building on the succès de scandale of the English version of L’homme machine (Man a Machine, 1749, the English translation of L’homme plus que machine, Man more than a Machine, appeared in 1752. The present contribution examines how the translator’s Voice, which is defined as an enarrative voice, effaces the concealed claims of the original text and replaces them with a discourse whose explicit anti-materialist tenor contrasts with the vehement rhetoric of Man a Machine.

  17. Analysis of surface roughness and cutting force during turning of Ti6Al4V ELI in dry environment

    Directory of Open Access Journals (Sweden)

    V. G. Sargade

    2016-04-01

    Full Text Available This paper investigates the effect of cutting parameters on the surface roughness and cutting force of titanium alloy Ti-6Al-4V ELI when turning using PVD TiAlN coated tool in dry environment. Taguchi L9 orthogonal array design of experiment was used for the turning experiment 2 factors and 3 levels. Turning parameters studied were cutting speed (50, 65, 80 m/min, feed rate (0.08, 0.15, 0.2 mm/rev and depth of cut 0.5 mm constant. Linear and second order model of the surface roughness and cutting force has been developed in terms of cutting speed and feed. The results show that the feed rate was the most impact factor controlling the cutting force and surface roughness produced. MINITAB 17software was used to develop a linear and second order model of surface roughness and cutting force. Optimum condition was at 66.97 m/min of cutting speed, 0.08 mm/rev of feed rate. Surface roughness 0.57μm and cutting force 54.02 N were obtained at the optimum condition. A good agreement between the experimental and predicted surface roughness and cutting force were observed.

  18. High and low energy gamma beam dump designs for the gamma beam delivery system at ELI-NP

    International Nuclear Information System (INIS)

    Yasin, Zafar; Matei, Catalin; Ur, Calin A.; Mitu, Iani-Octavian; Udup, Emil; Petcu, Cristian

    2016-01-01

    The Extreme Light Infrastructure - Nuclear Physics (ELI-NP) is under construction in Magurele, Bucharest, Romania. The facility will use two 10 PW lasers and a high intensity, narrow bandwidth gamma beam for stand-alone and combined laser-gamma experiments. The accurate estimation of particle doses and their restriction within the limits for both personel and general public is very important in the design phase of any nuclear facility. In the present work, Monte Carlo simulations are performed using FLUKA and MCNPX to design 19.4 and 4 MeV gamma beam dumps along with shielding of experimental areas. Dose rate contour plots from both FLUKA and MCNPX along with numerical values of doses in experimental area E8 of the facility are performed. The calculated doses are within the permissible limits. Furthermore, a reasonable agreement between both codes enhances our confidence in using one or both of them for future calculations in beam dump designs, radiation shielding, radioactive inventory, and other calculations releated to radiation protection. Residual dose rates and residual activity calculations are also performed for high-energy beam dump and their effect is negligible in comparison to contributions from prompt radiation.

  19. Modification of the method of polarized orbitals for electron--alkali-metal scattering: Application to e-Li

    International Nuclear Information System (INIS)

    Bhatia, A.K.; Temkin, A.; Silver, A.; Sullivan, E.C.

    1978-01-01

    The method of polarized orbitals is modified to treat low-energy scattering of electrons from highly polarizable systems, specifically alkali-metal atoms. The modification is carried out in the particular context of the e-Li system, but the procedure is general; it consists of modifying the polarized orbital, so that when used in the otherwise orthodox form of the method, it gives (i) the correct electron affinity of the negative ion (in this case Li - ), (ii) the proper (i.e., Levinson-Swan) number of nodes of the associated zero-energy scattering orbital, and (iii) the correct polarizability. A procedure is devised whereby the scattering length can be calculated from the (known) electron affinity without solving the bound-state equation. Using this procedure we adduce a 1 S scattering length of 8.69a 0 . (The 3 S scattering length is -9.22a 0 .) The above modifications can also be carried out in the (lesser) exchange adiabatic approximation. However, they lead to qualitatively incorrect 3 S phase shifts. The modified polarized-orbital phase shifts are qualitatively similar to close-coupling and elaborate variational calculations. Quantitative differences from the latter calculations, however, remain; they are manifested most noticeably in the very-low-energy total and differential spin-flip cross sections

  20. High and low energy gamma beam dump designs for the gamma beam delivery system at ELI-NP

    Energy Technology Data Exchange (ETDEWEB)

    Yasin, Zafar, E-mail: zafar.yasin@eli-np.ro; Matei, Catalin; Ur, Calin A.; Mitu, Iani-Octavian; Udup, Emil; Petcu, Cristian [Extreme Light Infrastructure - Nuclear Physics / Horia Hulubei National Institute for R& D in Physics and Nuclear Engineering, Bucharest-Magurele (Romania)

    2016-03-25

    The Extreme Light Infrastructure - Nuclear Physics (ELI-NP) is under construction in Magurele, Bucharest, Romania. The facility will use two 10 PW lasers and a high intensity, narrow bandwidth gamma beam for stand-alone and combined laser-gamma experiments. The accurate estimation of particle doses and their restriction within the limits for both personel and general public is very important in the design phase of any nuclear facility. In the present work, Monte Carlo simulations are performed using FLUKA and MCNPX to design 19.4 and 4 MeV gamma beam dumps along with shielding of experimental areas. Dose rate contour plots from both FLUKA and MCNPX along with numerical values of doses in experimental area E8 of the facility are performed. The calculated doses are within the permissible limits. Furthermore, a reasonable agreement between both codes enhances our confidence in using one or both of them for future calculations in beam dump designs, radiation shielding, radioactive inventory, and other calculations releated to radiation protection. Residual dose rates and residual activity calculations are also performed for high-energy beam dump and their effect is negligible in comparison to contributions from prompt radiation.

  1. Airborne gamma-ray spectrometer and magnetometer survey: Lund quadrangle, Ely quadrangle, Nevada. Volume I. Final report

    International Nuclear Information System (INIS)

    1980-01-01

    An airborne combined radiometric and magnetic survey was performed for the Department of Energy (DOE) over the area covered by the Ely and Lund 1:250,000 National Topographic Map Series (NTMS quadrangle maps). The survey was part of DOE's National Uranium Resource Evaluation (NURE) Aerial Radiometric Reconnaissance program. Data were collected by a helicopter equipped with a gamma-ray spectrometer having a large crystal volume, and a high sensitivity proton precession magnetometer. The radiometric system was calibrated at the Walker Field Calibration pads and the Lake Mead Dynamic Test range. Data quality was ensured during the survey by daily test flights and equipment checks. Radiometric data were corrected for live time, aircraft and equipment background, cosmic background, atmospheric radon, Compton scatter, and altitude dependence. The corrected data were statistically evaluated, plotted, and contoured to produce anomaly maps based on the radiometric response of individual geological units. The maps were interpreted and an anomaly interpretation map produced. Volume I contains a description of the systems used in the survey, a discussion of the calibration of the systems, the data processing procedures, the data display format, the interpretation rationale, and interpretation methodology. Volume II contains the data displays for a quadrangle and the interpretation results

  2. Elie Kedourie a kapitoly britské politiky na Blízkém východě

    Directory of Open Access Journals (Sweden)

    Kristýna Kynclová

    2012-04-01

    Full Text Available Western influence on the Middle East is a theme that deservedly attracts attention of many scientists from various fields of study. Many theories with regard to the modern political history of the region have been produced and discussed. One of the authors that came out with an influential concept was Edward Said. In his critique of Orientalism (Orientalism, 1978, Said focuses on Western conceptions of the Middle East and its outcomes. The book became worldwide famous for its direct assault on Western society and its imperial politics. An influential attitude is taken by another prominent scientist, Bernard Lewis, who represents an opposition to Said´s opinion. This survey is geared towards presenting the work of Baghdad-born British historian Elie Kedourie, who maintains with regard to given topic very interesting position as well. In the course of his career Kedourie mainly focused on modern Middle Eastern history, with a consideration to British political influence in the region. Kedourie tried to analyse factors which brought Ottoman Empire to decline and Middle Eastern region to general long-lasting crisis. In his writings Kedourie questioned the matter of suitability of Ottoman reforms based on European examples. He also occupied himself in detail with the issue of McMahon-Husayn correspondence and its interpretations, as well as with the Sykes-Picot agreement. He polemised with official viewpoints of British establishment and, usually with criticism, he assessed measures of British foreign politics. His revolutionary interpretations are believed to have changed the scientific approach of the view on modern history of the Middle Eastern countries.

  3. Low energy and high energy dumps for ELI-NP accelerator facility: rational and Monte-Carlo calculations - results

    Science.gov (United States)

    Esposito, A.; Frasciello, O.; Pelliccioni, M.

    2017-09-01

    ELI-NP will be a new international research infrastructure facility for laser-based Nuclear Physics to be built in Magurele, south west of Bucharest, Romania. For the machine to operate as an intense γ rays' source based on Compton back-scattering, electron beams are employed, undergoing a two stage acceleration to 320 MeV and 740 MeV (and, with an eventual energy upgrade, also to 840 MeV) beam energies. In order to assess the radiation safety issues, concerning the effectiveness of the dumps in absorbing the primary electron beams, the generated prompt radiation field and the residual dose rates coming from the activation of constituent materials, as well as the shielding of the adjacent environments against both prompt and residual radiation fields, an extensive design study by means of Monte Carlo simulations with FLUKA code was performed, for both low energy 320 MeV and high energy 720 MeV (840 MeV) beam dumps. For the low energy dump we discuss also the rational of the choice to place it in the building basement, instead of installing it in one of the shielding wall at the machine level, as it was originally conceived. Ambient dose equivalent rate constraints, according to the Rumenian law in force in radiation protection matter were 0.1 /iSv/h everywhere outside the shielding walls and 1.4 μiSv/h outside the high energy dump area. The dumps' placements and layouts are shown to be fully compliant with the dose constraints and environmental impact.

  4. [ELIE METCHNIKOFF--THE FOUNDER OF LONGEVITY SCIENCE AND A FOUNDER OF MODERN MEDICINE: IN HONOR OF THE 170TH ANNIVERSARY].

    Science.gov (United States)

    Stambler, I S

    2015-01-01

    The years 2015-2016 mark a double anniversary--the 170th anniversary of birth and the 100th anni- versary of death--of one of the greatest Russian scientists, a person that may be considered a founding figure of modern immunology, aging and longevity science--Elie Metchnikoff (May 15, 1845-July 15, 1916). At this time of the rapid aging of the world population and the rapid development of technologies that may ameliorate degenerative aging processes, Metchnikoff's pioneering contribution to the search for anti-aging and healthspan-extending means needs to be recalled and honored.

  5. Responsabilidade social corporativa e elisão fiscal: Uma análise de empresas certificadas e não certificadas no Brasil

    OpenAIRE

    Gonçalves, Rodrigo; Santana, Grazielle; Catarino, João; Matos, Eduardo

    2017-01-01

    O estudo visa investigar se empresas certificadas como socialmente responsáveis possuem práticas de elisão fiscais diferenciadas quando comparadas às empresas não certificadas. A amostra tem como base 158 observações de empresas brasileiras entre 2010 e 2014, composta por empresas certificadas pelo índice de sustentabilidade empresarial da BM and FBovespa e grupo de controle de empresas não certificadas. No caso de Portugal, obteve-se um total de 17 observações (2010-2014) de empresas certifi...

  6. Thinking through war: the social thought of Richard T. Ely, John R. Commons, and Edward A. Ross during the First World War.

    Science.gov (United States)

    Herzberg, D L

    2001-01-01

    This paper examines the social thought of University of Wisconsin professors Richard T. Ely, John R. Commons, and Edward A. Ross during World War I. Like many of their fellow scholars, these three were actively involved in the pro-war effort. Although their support for the war was strongly conditioned by personal and occupational considerations, the impact of their wartime service was not restricted to those realms. Their social thought, which they impressed into service explaining and justifying the war, was itself altered in subtle and sometimes surprising ways by the forceful positions they took on the political, economic, and racial significance of the conflict. Copyright 2001 John Wiley & Sons, Inc.

  7. Fasidotril Eli Lilly.

    Science.gov (United States)

    Ozdener, Fatih; Ozdemir, Vural

    2003-09-01

    Lilly is developing fasidotril, a diester prodrug of the active metabolite fasidotrilat, for the potential treatment of hypertension and congestive heart failure (CHF). Phase II trials to investigate the potential of fasidotril for the treatment of hypertension and CHF had commenced by the late 1990s, and were ongoing in July 2003 in the US and Europe.

  8. Duloxetine Eli Lilly.

    Science.gov (United States)

    Anttila, Sami; Leinonen, Esa

    2002-08-01

    Duloxetine is a serotonin (5-HT) and norepinephrine (NE) uptake inhibitor in pre-registration for depression. In vivo studies demonstrate that duloxetine inhibits 5-HT and NE transporters and this may induce an antidepressant effect [159168]. In humans, duloxetine has a low affinity for most 5-HT subtypes and for muscarinic, histamine H1, alpha1-adrenergic, alpha2-adrenergic and dopamine D2 receptors [444103]. Thus, it is not surprising that the meta-analysis of four recent clinical studies suggests duloxetine is a potent and well-tolerated antidepressant [429723]. By December 2001, Lilly had filed an NDA for depression. The launch of duloxetine is planned for the second half of 2002 [434250], [436220]. In April 2002, filing for stress urinary incontinence was anticipated for later in 2002 [456894]. Analysts at Banc of America predicted in April 2002, that the drug will be launched in the first quarter of 2003. The company projects US $400 million in revenue in 2003 and anticipates duloxetine to reach peak sales of over US $1 billion [450920]. Analysts at Morgan Stanley, projected US $25 million in sales in the fourth quarter 2002, rising to US $900 million in 2006 [450937]. At the same time, Credit Suisse First Boston anticipated launch for late 2002, with US $220 million in duloxetine revenues in 2003 and US $457 million in 2004 [450936].

  9. LY-354740 (Eli Lilly).

    Science.gov (United States)

    Pilc, Andrzej

    2003-01-01

    Lilly is developing LY-354740, the lead compound in a series of derivatives of the metabotropic glutamate receptor group II agonist L-CCG-1, for the potential treatment of anxiety [212536], [276941], [276942].

  10. Duloxetine Eli Lilly & Co.

    Science.gov (United States)

    Pitsikas, N

    2000-09-01

    Lilly is developing duloxetine, a 5-HT and norepinephrine uptake inhibitor as a potential treatment for depression and urinary incontinence. In Japan, it is being jointly developed with Shionogi [187401]. Phase III trials for depression and phase II trials for urinary incontinence are underway in Japan [296442,328887]. Lilly expects to file for depression in 2002 and phase III trials for urinary incontinence are planned to start enrollment by the end of 2000 [358429,370526,373870]. Duloxetine has a half-life of 10 to 15 h in humans, and parameters reach a steady-state after 3 days of daily administration. In a 6-week, open-label study duloxetine was safe and well tolerated in 79 clinically depressed patients. Clinical response occurred in 78% of patients, and remission occurred in 60%. Insomnia and nausea occurred with an incidence of 20% [300881]. Duloxetine may offer advantages over existing antidepressants, such as Lilly's fluoxetine, because of faster recovery and fewer side effects [190226]. In June 2000, Morgan Stanley Dean Witter predicted duloxetine would reach the market in 2002 with annual sales in this year of US $50 million, rising to $200 million in 2005 [373870]. In February 1999, Deutsche Bank predicted Lilly's sales at US $200 million in 2002 rising to $400 million in 2003 [316821]. In May 2000, Deutsche Bank had made further predictions, stating that filing for duloxetine is expected in the fourth quarter of 2001, and peak sales are expected to exceed US $500 million. Also in February 1999, Lehman Brothers predicted the first major launch date (US and ex-US) to be 2002, with the year of peak sales to be 2008 [319225]. In August 1999, this prediction changed, and the expected launch date became 2001, with an 80% probability of reaching the market and sales peaking at US $150 million in 2012 [349228].

  11. Laser-induced damage threshold tests of ultrafast multilayer dielectric coatings in various environmental conditions relevant for operation of ELI beamlines laser systems

    Science.gov (United States)

    Ďurák, Michal; Velpula, Praveen Kumar; Kramer, Daniel; Cupal, Josef; Medřík, Tomáš; Hřebíček, Jan; Golasowski, Jiří; Peceli, Davorin; Kozlová, Michaela; Rus, Bedřich

    2017-01-01

    Increasing the laser-induced damage resistance of optical components is one of the major challenges in the development of Peta-watt (PW) class laser systems. The extreme light infrastructure (ELI) beamlines project will provide ultrafast laser systems with peak powers up to 10 PW available every minute and PW class beams at 10 Hz complemented by a 5-TW, 1-kHz beamline. Sustainable performance of PW class laser systems relies on the durability of the employed optical components. As part of an effort to evaluate the damage resistance of components utilized in ELI beamlines systems, damage thresholds of several optical multilayer dielectric coatings were measured with different laser parameters and in different environments. Three coatings were tested with 10 Hz and 1 kHz pulse repetition rates, and the effect of a cleaning treatment on their damage resistance was examined. To explore the damage threshold behavior at different vacuum levels, one coating was subject to tests at various residual gas pressures. No change of damage threshold in a high vacuum with respect to ambient pressure was recorded. The effect of the cleaning treatment was found to be inconsistent, suggesting that development of the optimal cleaning treatment for a given coating requires consideration of its specific properties.

  12. Igale riskile leidub sobilik kindlustus / Evelin Soots

    Index Scriptorium Estoniae

    Soots, Evelin

    2004-01-01

    Ilmunud ka: Delovõje Vedomosti : Stroitelstvo, 9. juuni 2004, lk. 13. Autor tutvustab ehituse koguriski kindlustuse võimalusi ja tingimusi. Kommenteerib Jüri Veisberg. Lisad: CAR kindlustusperiood; Kindlustada saab ka koristust

  13. Neli vaadet banaanile / Evelin Lagle, Heili Einasto

    Index Scriptorium Estoniae

    Lagle, Evelin, 1986-

    2010-01-01

    Kahest tantsulavastusest: "Kaks naist köögis, banaanist rääkimata", koreograafid ja esitajad Kaja Lindal ja Mari Mägi, esietendus 14. oktoobril 2010 Kanuti gildi saalis ning "Neli vaadet", lavastaja Maret Mursa, tantsijad Rene Nõmmik ja Tiina Ollesk, esietendus 15. oktoobril NO99s

  14. Kevadsuvine mood soosib magusaid naisi / Evelin Nõmmik

    Index Scriptorium Estoniae

    Nõmmik, Evelin

    2002-01-01

    4. aprillil esitles moefirma Bastion Pärnus Cafe Grande'is oma kevadsuvist moekollektsiooni (disainerid Merike Pääro ja Monika Randloo). Merike Pääro ja Anu Lensment 2002. aasta kevdsuvistest trendidest

  15. Revisiting the Phadia/EliA cut-off values for anticardiolipin and anti-β2-glycoprotein I antibodies: a systematic evaluation according to the guidelines.

    Science.gov (United States)

    Bor, M V; Jacobsen, I-L Søtang; Gram, J B; Sidelmann, J J

    2018-01-01

    Background Phadia/EliA fluorescence enzyme immunoassays are widely used automated assays for anticardiolipin (aCL) and anti-β2-glycoprotein I (aβ2GPI) antibodies. To date, cut-off values for these assays have not been evaluated systematically and the evidence behind manufacturer's recommended cut-off values is not clear. Objective To determine Phadia/EliA cut-off values for antiphospholipid antibodies (aPL) according to the procedures suggested by guidelines. Methods A total of 266 blood donors (135 females and 131 males) were included. The pre-handling and analysis of the samples were performed according to the International Society on Thrombosis and Hemostasis (ISTH) guideline for solid phase aPL assays. Cut-off values and corresponding 90% confidence intervals (CI) for each antibody were established and outliers were handled according to the Clinical and Laboratory Standards Institute (CLSI) guideline for reference intervals. Samples from 377 consecutive patients, referred to our thrombophilia center with evidence of thrombosis or pregnancy morbidity were included for aPL testing. Results The in-house 99th (97.5th) percentile cut-off values were 11 (8.7), 12 (6.9) 8.5 (5.0) AU/mL for aβ2GPI IgG, IgM and IgA, and 21 (13) GPL-U/mL and 41 (25) MPL-U/mL for aCL IgG and IgM, respectively. The prevalence of positive results (%) defined by these cut-off values in patients with evidence of thrombosis or pregnancy morbidity was 9.5 (12.2), 1.6 (2.9), and 7.0 (9.9), and 0.8 (3.8) for aβ2GPI IgG, IgM, and aCL IgG and IgM respectively. The use of in-house 99th percentile cut-off values compared to the manufacturer suggested cut-off values resulted in 1 and 39 fewer samples for aβ2GPI and aCL to be classified as positive for aPL, respectively. Conclusions We present Phadia/EliA cut-off values with 90% CI for aPL determined systematically according to the ISTH and CLSI guidelines. These values are different from values previously determined, suggesting variation of a

  16. P3: An installation for high-energy density plasma physics and ultra-high intensity laser–matter interaction at ELI-Beamlines

    Czech Academy of Sciences Publication Activity Database

    Weber, Stefan A.; Bechet, Sabrina; Borneis, S.; Brabec, Lukáš; Bučka, Martin; Chacon-Golcher, Edwin; Ciappina, Marcelo F.; De Marco, Massimo; Fajstavr, Antonín; Falk, Kateřina; Garcia, E.-R.; Grosz, Jakub; Gu, Yanjun; Hernandez Martin, Juan C.; Holec, M.; Janečka, Pavel; Jantač, Martin; Jirka, Martin; Kadlecová, Hedvika; Khikhlukha, Danila; Klimo, Ondřej; Korn, Georg; Kramer, Daniel; Batheja, Deepak Kumar; Laštovička, Tomáš; Lutoslawski, P.; Morejon, L.; Olšovcová, Veronika; Rajdl, Marek; Renner, Oldřich; Rus, Bedřich; Singh, Sushil K.; Šmíd, Michal; Sokol, Martin; Versaci, Roberto; Vrána, Roman; Vranic, M.; Vyskočil, Jiří; Wolf, Adam; Yu, Q.

    2017-01-01

    Roč. 2, č. 4 (2017), s. 149-176 E-ISSN 2468-080X R&D Projects: GA MŠk LQ1606; GA MŠk LM2015065; GA MŠk EF15_008/0000162; GA MŠk EF15_003/0000449 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162; OP VVV - HiFi(XE) CZ.02.1.01/0.0/0.0/15_003/0000449 Institutional support: RVO:68378271 Keywords : high-energy-density- physics * ultra-high-intensity * warm dense matter * laboratory astrophysics * high repetition rate lasers * plasma optics * inertial confinement fusion Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics )

  17. La presencia de una ausencia: Jorge Eliécer Gaitán y las desventuras del populismo en Colombia

    Directory of Open Access Journals (Sweden)

    Malik Tahar Chaouch

    2009-01-01

    Full Text Available Este texto realiza el retrato del líder político más importante de la primera parte del siglo XX en Colombia, el liberal Jorge Eliécer Gaitán, asesinado el 9 de abril de 1948, cuando la Presidencia de la República parecía estar a su alcance. Desde entonces, su fantasma acosó a una Colombia donde la violencia estalló y se mantuvo durante toda la segunda parte del siglo XX, con breves interrupciones. En este contexto, su trayectoria y pensamiento no dejaron de ser objetos de controversias y debates apasionados. El esfuerzo de clarifi cación conduce a reconocer la filiación populista del político colombiano. Es así como, a pesar de la ausencia de una experiencia populista duradera, el populismo tuvo un impacto central en la historia contemporánea del país andino. Las consecuencias de la presencia de esa ausencia son materia a reflexión sobre el resurgir de los populismos y el estancamiento democrático en la América latina contemporánea.

  18. Effects of correlations between particle longitudinal positions and transverse plane on bunch length measurement: a case study on GBS electron LINAC at ELI-NP

    Science.gov (United States)

    Sabato, L.; Arpaia, P.; Cianchi, A.; Liccardo, A.; Mostacci, A.; Palumbo, L.; Variola, A.

    2018-02-01

    In high-brightness LINear ACcelerators (LINACs), electron bunch length can be measured indirectly by a radio frequency deflector (RFD). In this paper, the accuracy loss arising from non-negligible correlations between particle longitudinal positions and the transverse plane (in particular the vertical one) at RFD entrance is analytically assessed. Theoretical predictions are compared with simulation results, obtained by means of ELEctron Generation ANd Tracking (ELEGANT) code, in the case study of the gamma beam system (GBS) at the extreme light infrastructure—nuclear physics (ELI-NP). In particular, the relative error affecting the bunch length measurement, for bunches characterized by both energy chirp and fixed correlation coefficients between longitudinal particle positions and the vertical plane, is reported. Moreover, the relative error versus the correlation coefficients is shown for fixed RFD phase 0 rad and π rad. The relationship between relative error and correlations factors can help the decision of using the bunch length measurement technique with one or two vertical spot size measurements in order to cancel the correlations contribution. In the case of the GBS electron LINAC, the misalignment of one of the quadrupoles before the RFD between  -2 mm and 2 mm leads to a relative error less than 5%. The misalignment of the first C-band accelerating section between  -2 mm and 2 mm could lead to a relative error up to 10%.

  19. Wear Mechanism of Chemical Vapor Deposition (CVD) Carbide Insert in Orthogonal Cutting Ti-6Al-4V ELI at High Cutting Speed

    International Nuclear Information System (INIS)

    Gusri, A. I.; Che Hassan, C. H.; Jaharah, A. G.

    2011-01-01

    The performance of Chemical Vapor Deposition (CVD) carbide insert with ISO designation of CCMT 12 04 04 LF, when turning titanium alloys was investigated. There were four layers of coating materials for this insert i.e.TiN-Al2O3-TiCN-TiN. The insert performance was evaluated based on the insert's edge resistant towards the machining parameters used at high cutting speed range of machining Ti-6Al-4V ELI. Detailed study on the wear mechanism at the cutting edge of CVD carbide tools was carried out at cutting speed of 55-95 m/min, feed rate of 0.15-0.35 mm/rev and depth of cut of 0.10-0.20 mm. Wear mechanisms such as abrasive and adhesive were observed on the flank face. Crater wear due to diffusion was also observed on the rake race. The abrasive wear occurred more at nose radius and the fracture on tool were found at the feed rate of 0.35 mm/rev and the depth of cut of 0.20 mm. The adhesion wear takes place after the removal of the coating or coating delaminating. Therefore, adhesion or welding of titanium alloy onto the flank and rake faces demonstrates a strong bond at the workpiece-tool interface.

  20. Sensitivity and specificity of scales ELI, SAL, MODIFIED LARSEN, KLOCKHOFF and NIOSH rating for professional hearing loss, Popayán Colombia

    Directory of Open Access Journals (Sweden)

    Aura Teresa Palacios-Pérez

    2010-09-01

    Full Text Available Objective: To determine the sensitivity and specificity of five available scales to the qualification of the Tonal Audiometry for the detection of occupationally induced hearing loss. Methods: A descriptive cross-sectional study was conducted. The study population was 92 adult workers. Participants underwent the application of the different formats of registration of the results and qualification of the tonal audiometry. Participants received a hearing evaluation by clinical audiometry. Sixty four cases met the inclusion criteria and were selected for the final analysis.Once the tonal audiometry was complete, evaluation of occupationally induced hearing loss was done by using the ELI, salt, modified LARSEN, KLOCKHOFF and NIOSH classification scales. Results were compared to FREQUENCIAL analysis. Results: The LARSEN scale was noted to detect more cases of occupationally induced hearing loss. The LARSEN modified, represented detection in 54.69% of cases for right ear and 56.25% of cases for left ear. On the other hand, noted the direct relationship of hearing loss with regard to the age. No direct correlation to time of noise exposure was found.. Conclusions: The rating scale that presented greater sensitivity was the LARSEN modified. It was represented by 93.1% and a specificity of 100%.

  1. Low energy and high energy dumps for ELI-NP accelerator facility: rational and Monte-Carlo calculationsș results

    Directory of Open Access Journals (Sweden)

    Esposito A.

    2017-01-01

    Full Text Available ELI-NP will be a new international research infrastructure facility for laser-based Nuclear Physics to be built in Magurele, south west of Bucharest, Romania. For the machine to operate as an intense γ rays’ source based on Compton back-scattering, electron beams are employed, undergoing a two stage acceleration to 320 MeV and 740 MeV (and, with an eventual energy upgrade, also to 840 MeV beam energies. In order to assess the radiation safety issues, concerning the effectiveness of the dumps in absorbing the primary electron beams, the generated prompt radiation field and the residual dose rates coming from the activation of constituent materials, as well as the shielding of the adjacent environments against both prompt and residual radiation fields, an extensive design study by means of Monte Carlo simulations with FLUKA code was performed, for both low energy 320 MeV and high energy 720 MeV (840 MeV beam dumps. For the low energy dump we discuss also the rational of the choice to place it in the building basement, instead of installing it in one of the shielding wall at the machine level, as it was originally conceived. Ambient dose equivalent rate constraints, according to the Rumenian law in force in radiation protection matter were 0.1 /iSv/h everywhere outside the shielding walls and 1.4 μiSv/h outside the high energy dump area. The dumps’ placements and layouts are shown to be fully compliant with the dose constraints and environmental impact.

  2. Production of 68Ge, 64Cu, 86Y, 89Zr, 73Se, 77Br and 124I positron emitting radionuclides through future laser-accelerated proton beams at ELI-Beamlines for innovative PET diagnostics

    OpenAIRE

    Italiano, Antonio; Amato, Ernesto; Minutoli, Fabio; Margarone, Daniele; Baldari, Sergio

    2016-01-01

    The development of innovative production pathways for high-Z positron emitters is of great interest to enlarge the applicability of PET diagnostics, especially in view of the continuous development of new radiopharmaceuticals. We evaluated the theoretical yields of 64Cu, 86Y, 89Zr, 73Se, 77Br and 124I PET isotopes, plus the 68Ge isotope, parent of the 68Ga positron emitter, in the hypothesis of production through laser-accelerated proton sources expected at the ELI-Beamlines facility. By mean...

  3. Karakavakta anaçlık yöntemiyle sırık çeliği üretim tekniğinin belirlenmesi

    Directory of Open Access Journals (Sweden)

    Dr. Selda AKGÜL

    2016-12-01

    Full Text Available Bu çalışmada, kavak dikim materyali üretiminde, en pratik ve ekonomik metot olarak tespit edilen, anaçlık usulü ile “KOCABEY”, “GAZİ” ve “GEYVE” karakavak klonlarında, ağaçlandırmalarda kullanılmak üzere, bir ve iki yaşlı sırık çeliği standart üretim metodu tespit edilmeye çalışılmıştır. Bir ve iki yaşlı sırık çeliği üretiminde, aralık-mesafenin ve anaçtaki sürgün sayısının etkili olup olmadığını belirlemek amacıyla, rastlantı bloklarında bölünmüş parseller deneme deseni kullanılarak Ankara-Behiçbey Orman Fidanlığında denemeler tesis edilmiştir. Çalışmadan elde edilen sonuçlara göre, bir yaşlı sırık çeliği üretiminde, denenen geniş aralık-mesafe grubu (1,6x0,4 m, üretilen miktar açısından daha iyi sonuç vermiştir. Anaçta bırakılacak sürgün adedi sayısının ise önemli olmadığı görülmüştür. İki yaşlı sırık çeliği üretiminde ise; her üç klonda da, denenen işlemlerin etkisinin çok fazla olmadığı kanaatine ulaşılmıştır.

  4. Absence of autoreactive CD4(+) T-cells targeting HLA-DQA1*01:02/DQB1*06:02 restricted hypocretin/orexin epitopes in narcolepsy type 1 when detected by EliSpot

    DEFF Research Database (Denmark)

    Kornum, Birgitte Rahbek; Burgdorf, Kristoffer Sølvsten; Holm, Anja

    2017-01-01

    Narcolepsy type 1, a neurological sleep disorder strongly associated with Human Leukocyte Antigen (HLA-)DQB1*06:02, is caused by the loss of hypothalamic neurons producing the wake-promoting neuropeptide hypocretin (hcrt, also known as orexin). This loss is believed to be caused by an autoimmune...... reaction. To test whether hcrt itself could be a possible target in the autoimmune attack, CD4(+) T-cell reactivity towards six different 15-mer peptides from prepro-hypocretin with high predicted affinity to the DQA1*01:02/DQB1*06:02 MHC class II dimer was tested using EliSpot in a cohort of 22 narcolepsy...

  5. Maa, vabaduse eest / Eli Pilvre

    Index Scriptorium Estoniae

    Pilvre, Eli

    2008-01-01

    Maareformist Eestis pärast iseseisvuse saavutamist 1918. aastal. Maaküsimuse korraldamisest ja maaseaduse eeltöödest. Mõisate võõrandamine, riikliku maatagavara loomine, autasumaad. Mõisamaade riigistamise seadusest ning riigimaade planeerimisest ja väljajagamisest. Lisa: Riigi Teatajas ilmunud õigusaktid. Lk. 335

  6. LY-293558. Eli Lilly & Co.

    Science.gov (United States)

    Gilron, I

    2001-09-01

    Lilly is developing the racemic compound LY-215490, a selective and competitive AMPA antagonist, as a potential treatment for cerebral infarction, cerebrovascular ischemia, epilepsy and as an analgesic [135089], [158980], [254029], [278691]. By January 2000, LY-293558 was undergoing phase II trials for pain [414000].

  7. Study of the production yields of .sup.18./sup.F, .sup.11./sup.C, .sup.13./sup.N and .sup.15./sup.O positron emitters from plasma-laser proton sources at ELI-Beamlines for labeling of PET radiopharmaceuticals

    Czech Academy of Sciences Publication Activity Database

    Amato, E.; Italiano, A.; Margarone, Daniele; Pagano, B.; Baldari, S.; Korn, Georg

    2016-01-01

    Roč. 811, Mar (2016), s. 1-5 ISSN 0168-9002 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : plasma laser * proton acceleration * positron emission tomography * microfluidics Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 1.362, year: 2016

  8. Os efeitos da subvenção governamental frente à elisão fiscal e a geração de riqueza = The effects of government subsidy towards tax avoidance and wealth generation

    Directory of Open Access Journals (Sweden)

    Rodrigo de Souza Gonçalves

    2016-07-01

    Full Text Available Esta pesquisa analisa se as empresas abertas brasileiras que receberam subvenções governamentais apresentaram maior nível de elisão fiscal (tax avoidance e se geraram mais riqueza para a sociedade no ano de 2014, quando comparadas a empresas que não receberam tais subvenções. O estudo é de natureza quantitativa. Foram analisados os indicadores de elisão fiscal (Effective Tax Rate – ETR, segundo Hanlon e Heitzman (2010, de geração de riqueza (Quociente entre o Valor Adicionado bruto e o Faturamento – QVAF e de distribuição de riqueza (Índice de Distribuição do Valor Adicionado – IDVA. A amostra contempla 64 empresas listadas na BM&FBOVESPA, divididas em dois grupos de 32, comparadas em relação ao seu porte e setor de atuação. Como resultado verificou-se que as empresas recebedoras de subvenções governamentais apresentaram um maior nível de elisão em relação aos tributos sobre o lucro e agregaram menos valor aos seus bens e serviços produzidos e comercializados. Contudo, tais empresas geraram um maior valor adicionado total, apresentando uma maior distribuição relativa de riqueza para pagamento de tributos (32,44% e de pessoal (25,05%, justificando assim os incentivos fiscais no ano estudado. This research examines whether the listed Brazilian companies that received government grants got higher tax avoidance and have generated more wealth for the society in 2014, when compared to companies that did not receive such grants. The study is quantitative in nature and it considers indicators of tax avoidance (Effective Tax Rate - ETR according to Hanlon and Heitzman (2010, of wealth generation (Quotient between the Gross Value Added and billing -QVAF and of wealth distribution (Value Added Distribution Index - IDVA. The sample includes 64 companies listed on the BM & FBOVESPA, divided into two groups of 32 companies each, compared in relation to their size and activity sector. As a result, it was found out that the

  9. Study of the production yields of "1"8F, "1"1C, "1"3N and "1"5O positron emitters from plasma-laser proton sources at ELI-Beamlines for labeling of PET radiopharmaceuticals

    International Nuclear Information System (INIS)

    Amato, Ernesto; Italiano, Antonio; Margarone, Daniele; Pagano, Benedetta; Baldari, Sergio; Korn, Georg

    2016-01-01

    The development of novel compact PET radionuclide production systems is of great interest to promote the diffusion of PET diagnostics, especially in view of the continuous development of microfluidics labeling approaches. We studied the feasibility to produce clinically-relevant amounts of PET isotopes by means of laser-accelerated proton sources such that expected at the ELI-Beamlines facility. "1"8F, "1"1C, "1"3N and "1"5O production yields were calculated through the TALYS software, by taking into account the broad proton spectra expected. With the hypothesized proton fluencies, clinically-relevant amounts of radionuclides can be obtained, suitable to prepare single doses of "1"8F-, "1"1C- and "1"3N-labeled radiopharmaceuticals exploiting fast and efficient microfluidic labeling systems.

  10. Production of 68Ge, 64Cu, 86Y, 89Zr, 73Se, 77Br and 124I positron emitting radionuclides through future laser-accelerated proton beams at ELI-Beamlines for innovative PET diagnostics

    Directory of Open Access Journals (Sweden)

    Antonio Italiano

    2016-05-01

    Full Text Available The development of innovative production pathways for high-Z positron emitters is of great interest to enlarge the applicability of PET diagnostics, especially in view of the continuous development of new radiopharmaceuticals. We evaluated the theoretical yields of 64Cu, 86Y, 89Zr, 73Se, 77Br and 124I PET isotopes, plus the 68Ge isotope, parent of the 68Ga positron emitter, in the hypothesis of production through laser-accelerated proton sources expected at the ELI-Beamlines facility. By means of the TALYS software we simulated the nuclear reactions leading to the above radionuclides, hypothesizing three possible scenarios of broad proton spectra, with maximum energies of about 9, 40 and 100 MeV. The production yields of the studied radionuclides, within the expected fluences, appear to be suitable for pre-clinical applications.

  11. Study of the production yields of {sup 18}F, {sup 11}C, {sup 13}N and {sup 15}O positron emitters from plasma-laser proton sources at ELI-Beamlines for labeling of PET radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Amato, Ernesto [Section of Radiological Sciences, Department of Biomedical and Dental Sciences and of Morphologic and Functional Imaging, University of Messina (Italy); Italiano, Antonio, E-mail: italianoa@unime.it [Istituto Nazionale di Fisica Nucleare, Gruppo Collegato di Messina (Italy); Margarone, Daniele [Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, 182 21 Prague (Czech Republic); Pagano, Benedetta [Nuclear Medicine Unit, University Hospital “G. Martino”, Messina (Italy); Baldari, Sergio [Section of Radiological Sciences, Department of Biomedical and Dental Sciences and of Morphologic and Functional Imaging, University of Messina (Italy); Nuclear Medicine Unit, University Hospital “G. Martino”, Messina (Italy); Korn, Georg [Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, 182 21 Prague (Czech Republic)

    2016-03-01

    The development of novel compact PET radionuclide production systems is of great interest to promote the diffusion of PET diagnostics, especially in view of the continuous development of microfluidics labeling approaches. We studied the feasibility to produce clinically-relevant amounts of PET isotopes by means of laser-accelerated proton sources such that expected at the ELI-Beamlines facility. {sup 18}F, {sup 11}C, {sup 13}N and {sup 15}O production yields were calculated through the TALYS software, by taking into account the broad proton spectra expected. With the hypothesized proton fluencies, clinically-relevant amounts of radionuclides can be obtained, suitable to prepare single doses of {sup 18}F-, {sup 11}C- and {sup 13}N-labeled radiopharmaceuticals exploiting fast and efficient microfluidic labeling systems.

  12. Tants - üks viis edastada kehalist kogemist / Evelin Lagle

    Index Scriptorium Estoniae

    Lagle, Evelin, 1986-

    2008-01-01

    Helsingi teatriakadeemia tantsukompanii TADaC Kumus 25. III 2008: Ervi Siren "Seize the Moment - Snatch, Catch, Enjoy", Jyrki Karttunen "Dramatic Miniatures", Maria Saivosalmi ja Andrius Katinas "Farewell Anna Karenina", Jenni Kivelä "Scrapbook for Rainy Days", Ari Tenhula videomäng/installatsioon "Entr'acte"

  13. Corporate reputation : intangible assets, tangible benefits / Katrin Rahu, Evelin Ojamets

    Index Scriptorium Estoniae

    Rahu, Katrin, 1978-

    2004-01-01

    Hill & Knowlton'i Eesti ning Läti büroode poolt tipp- ja keskastme juhtide seas 2004. a. sügisel läbiviidud uuringust korporatiivse imago kohta, mis on osa 1997. a. alustatud rahvusvahelisest uuringuprojektist Corporate Reputation Watch. Tabel. Diagrammid

  14. Suur müüdikonverents Tartus / Evelin Banhard

    Index Scriptorium Estoniae

    Banhard, Evelin

    2008-01-01

    Tartus toimunud rahvusvahelisest konverentsist "Suurte kultuuriliste ja kirjanduslike müütide saatus tänapäeval". Pikemalt Liisa Saariluoma, Jüri Talveti, Angelika Stefanova, Tanel Lepsoo, Caroline De Wagteri, Sonia Bravo Utrera, Ana Martinoska, Marin Laagi, Rutt Hinrikuse, Jeanne Elisabeth Gleseneri, Sabine Coelsch-Foisneri, Harvey L. Hixi ja Hannu K. Riikoneni ettekannetest

  15. Helsingi Teatriakadeemia tantsukompanii TADaC Eestis 2009 / Evelin Lagle

    Index Scriptorium Estoniae

    Lagle, Evelin, 1986-

    2009-01-01

    Tantsulavastustest: Harri Kuorelahti "Rough Plan" ja Ari Tehnula "Distances - Practices of Kinetic Empathy" 3. mail Pärnu Endla Küünis, 5. mail Tallinnas Kumu auditooriumis ning 7. mail Tartu Sadamateatris

  16. Ants Oras ja eesti Shakespeare'i-kultuur / Evelin Banhard

    Index Scriptorium Estoniae

    Banhard, Evelin

    2008-01-01

    Artikkel käsitleb Ants Orase rolli William Shakespeare'i pärandi tõlkija ja tutvustajana. Analüüsitakse Orase töid eesti kultuuriajakirjanduses 1920. ja 1930. aastatel ning tema hilisemaid, paguluses kirjutatud arvustusi

  17. Ärma talu iseteadlik perenaine Evelin Int-Lambot / Evelin Int-Lambot ; interv. Riina Luik

    Index Scriptorium Estoniae

    Int-Lambot, Evelin, 1968-

    2004-01-01

    Eesti tipp-poliitiku Toomas Hendrik Ilvese abikaasa, paljude arvamuslugude autor räägib oma elust metsatalus, lapse kasvatamisest, poliitikast, elu väärtushinnangutest. Kommenteerivad: Rain Pikand, Ando Kiviberg

  18. Absence of autoreactive CD4+ T-cells targeting HLA-DQA1*01:02/DQB1*06:02 restricted hypocretin/orexin epitopes in narcolepsy type 1 when detected by EliSpot.

    Science.gov (United States)

    Kornum, Birgitte Rahbek; Burgdorf, Kristoffer Sølvsten; Holm, Anja; Ullum, Henrik; Jennum, Poul; Knudsen, Stine

    2017-08-15

    Narcolepsy type 1, a neurological sleep disorder strongly associated with Human Leukocyte Antigen (HLA-)DQB1*06:02, is caused by the loss of hypothalamic neurons producing the wake-promoting neuropeptide hypocretin (hcrt, also known as orexin). This loss is believed to be caused by an autoimmune reaction. To test whether hcrt itself could be a possible target in the autoimmune attack, CD4 + T-cell reactivity towards six different 15-mer peptides from prepro-hypocretin with high predicted affinity to the DQA1*01:02/DQB1*06:02 MHC class II dimer was tested using EliSpot in a cohort of 22 narcolepsy patients with low CSF hcrt levels, and 23 DQB1*06:02 positive healthy controls. Our ELISpot assay had a detection limit of 1:10,000 cells. We present data showing that autoreactive CD4 + T-cells targeting epitopes from the hcrt precursor in the context of MHC-DQA1*01:02/DQB1*06:02 are either not present or present in a frequency is <1:10,000 among peripheral CD4 + T-cells from narcolepsy type 1 patients. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Dievar Sıcak İş Takım Çeliğinin Delinmesinde Kesme Parametrelerinin Kesme Kuvvetleri Ve Yüzey Kalitesine Etkisinin Regresyon Analiziyle Modellenmesi

    Directory of Open Access Journals (Sweden)

    İskender Özkul

    2013-01-01

    Full Text Available Bu çalışmada sıcak iş takım çeliklerinden Dievar derece çeliği üzerinde çeşitli matkaplar ile delik delme esnasında meydana gelen eksenel kuvvetler, kesme momentleri, yüzey pürüzlülükleri, ölçü tamlığı ve dairesellikten sapma değerleri araştırılmıştır. Deneyler dik işleme tezgâhında soğutma sıvısı ile Ø16 mm çaplarında kaplamasız karbür matkap ve kendinden raybalı TiAlN kaplamalı matkap kullanılarak yapılmıştır. Deneylerde ilerleme hızı 0,16 mm/dev, kesme hızı ise 36, 40, 44, 48 m/dak hızları kullanılmıştır. Çıkan sonuçlar doğrusal regresyon metodu ile modellenmiş ve polinom regresyon eğrisi eşitliği anlamlılık değerleri mukayese edilmiştir. Aynı zamanda varyans analizi yapılarak kesme hızı ve matkap tipinin eksenel ilerleme kuvveti, kesme momenti, yüzey pürüzlülüğü ölçü tamlığı ve dairesellikten sapma değeri sonuçları üzerine etkileri incelenmiştir.

  20. Production of .sup.68./sup.Ge, .sup.64./sup.Cu, .sup.86./sup.Y, .sup.89./sup.Zr, .sup.73./sup.Se, .sup.77./sup.Br and .sup.124./sup.I positron emitting radionuclides through future laser-accelerated proton beams at Eli-Beamlines for innovative PET diagnostics

    Czech Academy of Sciences Publication Activity Database

    Italiano, A.; Amato, E.; Minutoli, F.; Margarone, Daniele; Baldari, S.

    2016-01-01

    Roč. 94, č. 2 (2016), 2-10, č. článku A2. ISSN 0365-0359 R&D Projects: GA MŠk EF15_008/0000162; GA ČR(CZ) GA15-02964S; GA MŠk LQ1606 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : PET diagnostics * accelerator applications * radionuclides Subject RIV: BL - Plasma and Gas Discharge Physics

  1. Centenario de Elie Metchnikoff (1845-1916

    Directory of Open Access Journals (Sweden)

    José Manuel Ribera Casado

    2017-04-01

    Full Text Available Celebramos en este año de 2016 el centenario de la muerte de una de las grandes figuras de la medicina, surgidas a finales del siglo xix y a principios del xx, Elias Metchnikoff, Premio Nobel con Paul Ehrlich en 1908. El objetivo de este trabajo es el de rendir un homenaje a su figura con motivo de este aniversario. Metchnikoff fue quien descubrió y describió el fenómeno de la fagocitosis y en función de ello ha sido considerado como el «padre de la inmunidad celular». En paralelo fue quien acuñó la palabra «gerontología», aplicándola al estudio del envejecimiento en toda su extensión y en cualquiera de sus formas, lo que le convirtió en un pionero del trabajo interdisciplinar. Consideraba que las bacterias intestinales generaban una autointoxicación que envenenaba nuestro organismo y que la acidificación del mismo a través de los bacilos ácidos que contienen los yogures podría contribuir a mantener la salud y a prolongar la vida.

  2. AISI 4140 Çeliğinin İşlenmesinde Kesici Uç Geometrisinin Talaş Kırmaya Ve Yüzey Pürüzlülüğüne Etkisi

    Directory of Open Access Journals (Sweden)

    Suat SARIDEMİR

    2016-03-01

    Full Text Available Talaşlı imalat işlemlerinde, kesici uç geometrisinin, ilerleme miktarının ve talaş derinliğinin talaş kırma ve yüzey pürüzlülüğü üzerinde etkileri bulunmaktadır. Metal kesme uygulamasının doğru gerçekleştirilmesi, iş parçası malzemesinin bilinmesi ve doğru kesici uç geometrisi ve kalitenin seçilmesi anlamına gelir. Optimum geometri ve kalite arasındaki ilişki başarılı bir işleme prosesi için anahtardır. Bu faktör dikkatlice incelenmeli ve her işleme operasyonu içi uyarlanmalıdır. Kesildikten sonra talaşın kırılması kesici ucun geometrisi ile birebir ilişkilidir.Bu çalışmada AISI 4140 çeliği CNC tornada, kaplamalı karbür kesici takımlarla (TAEGUTEC marka tornalanmıştır. Deneylerde farklı uç geometrisine sahip kaplamalı uçlar kullanılmıştır. Kesici takım talaş kırıcı formunun, yüzey pürüzlülüğüne ve talaş formuna etkisi araştırılmıştır. Talaşlı imalatta en önemli sorunlardan biri talaşı kıramamadır. Bu çalışmada talaş kırma üzerinde incelemeler yapılmıştır. Farklı kesme parametreleri kullanılarak, CNC torna tezgâhında bir dizi deney yapılmıştır. Deneylerde kesme hızı, talaş derinliği ve ilerleme hızı değişkenleri kullanılıp talaş tipleri kıyaslanarak incelenmiştir. İşlenen malzemeler üzerinde yüzey pürüzlülüğü ölçülüp, elde edilen değerler yorumlanmıştır. Genel olarak ilerleme hızı arttığında talaşın rahat kırıldığı ve yüzey pürüzlülüğünün arttığı gözlemlenmiştir.Anahtar Kelimeler: Kesici uç geometrisi, Talaş kırılması, Yüzey pürüzlülüğü, Tornalama

  3. 78 FR 49723 - Humboldt-Toiyabe National Forests; Ely Ranger District; Ely Westside Rangeland Project

    Science.gov (United States)

    2013-08-15

    ... Month (AUM) production for the Humboldt National Forest while improving the gap between existing and...: 1. Current Management Alternative: Continue current grazing management. 2. No Grazing Alternative... documents. (Authority: 40 CFR 1501.7 and 1508.22; Forest Service Handbook 1909.15, Section 21) Dated: August...

  4. Lennujuhtide värbamiskampaania kullati üle! / Evelin Ojamets, Ann Hiiemaa

    Index Scriptorium Estoniae

    Ojamets, Evelin

    2016-01-01

    Lennuliiklusteeninduse AS palus META Advisory Groupi abi lennujuhtide värbamiskampaania elluviimisel. Kommunikatsioonikampaanias sobivate kandidaatide leidmiseks kasutati turunduskommunikatsiooni meetmeid traditsiooniliste värbamisvõtete asemel. Kampaaniaga taheti ka tutvustada lennujuhi ametikohta, Lennujuhtimiskeskust tööandjana ning kujundada noorte eelistusi Lennuakadeemiasse sisseastumisel. Lennujuhtide värbamiskampaania tõi META-le turunduskommunikatsiooni Kuldmuna ja Balti PR-konkursi hõbedase autasu korporatiivkommunikatsiooni kategoorias

  5. Kopteriõnnetuses hukkunud muusikute mälestuseks loodi fond / Evelin Nõmmik

    Index Scriptorium Estoniae

    Nõmmik, Evelin

    2005-01-01

    10. augustil kopteriõnnetuses hukkunud noorte muusikute Liisa Suusteri ja Carolina Kremenetski vanemad asutasid Eesti Rahvuskultuuri Fondi (ERKF) juurde mälestusfondi, mille põhikirja järgi toetatakse igal paarisarvulisel aastal viiuldajate ja paaritutel aastatel pianistide õpinguid (ERKF nõukogu esimees on dirigent Eri Klas)

  6. EASD konverentsi olulisemad sõnumid / Evelin Jõemägi

    Index Scriptorium Estoniae

    Jõemägi, Evelin

    2010-01-01

    Vestlusest endokrinoloog Anu Ambosega diabeedikonverentsil käsitletud tähtsamatest teemadest, milleks olid teist tüüpi diabeedi diagnostiliste kriteeriumide täienemine ning rosiglitasooni turult kõrvaldamine ja selle põhjused

  7. Bakterite Miss Marple = The Miss Marple of bacteria / Marika Mikelsaar ; interv. Evelin Kivilo

    Index Scriptorium Estoniae

    Mikelsaar, Marika, 1938-

    2008-01-01

    Intervjuu Tartu Ülikooli professori, probiootilise piimhappebakteri ME-3 avastajaga, kes pälvis president Toomas Hendrik Ilveselt Eesti Vabariigi 90. aastapäeva puhul Valgetähe III klassi teenetemärgi

  8. "Uus tants 9" - kirju ja elujõuline / Evelin Lagle, Leenu Nigu

    Index Scriptorium Estoniae

    Lagle, Evelin

    2009-01-01

    19.-21. märtsini Tallinna teatrites ja saalides toimunud üheksandast Eesti uue tantsu ülevaatefestivalist "Uus Tants 9". Tantsulavastustest "Sula jagu", "Kahe korruse rahvas", "Can't Get No / Satisfaction", "Lokaalis täna: Kann/Valkeapää", "Kass ennustab tulevikku inimesest paremini", "Hoffmann-Promenade"

  9. Balansseerimine abstraktse liikumise ning tähendusliku loo vahel / Evelin Lagle

    Index Scriptorium Estoniae

    Lagle, Evelin

    2008-01-01

    "Augusti tantsufestival" Tallinnas Kanuti gildi saalis 21.-31. VIII 2008. Tantsulavastustest "Gallina Aquatica", "Creating Sense", "Mi madre y yo", "Ball", "Radiodance", "And I just stood there watching the sky and the people below"

  10. Rebecca Kontus püüab eurolaulu võitu / Evelin Nõmmik

    Index Scriptorium Estoniae

    Nõmmik, Evelin

    2005-01-01

    Eurovisiooni rahvusliku eelvooru "Eurolaul 2005" finaalist ETV kanalil 5. veebr., lauljast Rebecca Kontusest lauludega "Have You Ever" ja "Let's Get Loud" (viimane ansambli Suntribe koosseisus), nimekiri võistluse lauludest

  11. Teatrikunstnik Iir Hermeliin - maagiline realist / Iir Hermeliin ; intervjueerinud Tiina Kolk, kommenteerinud Dmitri Demjanov, Evelin Kattai

    Index Scriptorium Estoniae

    Iir Hermeliin, pseud., 1973-

    2010-01-01

    Iir Hermeliini (Hille Ermel) teatritööst, talle olulistest paikadest Eestimaal, elust Kalamajas, välisreisidest, huvist kokanduse vastu, kunstiõpingutest, inspiratsiooniallikatest. Loetletud saadud autasud, valik lavastusi

  12. Tants pühib linnaruumilt ajalootolmu / Madli Teller ; intervjueerinud Evelin Lagle

    Index Scriptorium Estoniae

    Teller, Madli

    2010-01-01

    2011. aasta Euroopa kultuuripealinna programmi raames eesti ja soome noorte tantsukunstnike koostööprojektist "Old Spaces Living Art" ("Eakade paikade elav kunst"), kus ühendatakse nüüdistants ja Tallinna ajalooline linnaruum

  13. Eesti Muusika Päevad 2000 : ECPNMi juhatus Tallinnas / Consuelo Diez ; interv. Evelin Kõrvits

    Index Scriptorium Estoniae

    Diez, Consuelo

    2000-01-01

    28.-30. apr. pidas Tallinnas aastakoosolekut ning külastas Eesti Muusika Päevade kontserte ECPNMi (European Conference of Promoters of New Music) juhatus. ECPNMi juhatuse liikmed räägivad uue muusika üritustest oma riikides, muljeid eesti muusika päevadelt

  14. Avatud meeled ja intellektuaalsed mõttemängud / Gerhard Lock ja Evelin Lagle

    Index Scriptorium Estoniae

    Lock, Gerhard, 1978-

    2010-01-01

    10. sünnipäeva tähistava Küberstuudio tegevusest. 2. märtsil Kumu auditooriumis etendunud Monika Mattieseni ja Hasso Krulli multimeediaooperist "Loomise mõnu", kavas olid ka Mirjam Tally ja Erkki-Sven Tüüri elektroakustilised teosed flöödile ja kammerorkestrile

  15. "Baltoscandal" - jätkem vanas urgitsemine ja suunakem energia uue loomisele! / Evelin Lagle

    Index Scriptorium Estoniae

    Lagle, Evelin

    2008-01-01

    10. Baltoscandalil nähtust. Lavastustest: "50 Lovely Ways to Die", "Why Don't You Dance?", "I Apologize", "Anira", "Kool", "Võluflööt. Remix ja selgitus", "While We Were Holding It Together", "HarS"

  16. Evelin Ilvese sünnipäev möödub autos / Karoliina Vasli

    Index Scriptorium Estoniae

    Vasli, Karoliina

    2010-01-01

    President Toomas Hendrik Ilvese delegatsioon naaseb Türgi-visiidilt Eestisse autodega. 20. aprillil 2010 saab presidendi abikaasa 42-aastaseks. Vt. ka foto lk. 16. Ametlik visiit Türgi Vabariiki 15.-21.04.2010

  17. Good corporate reputation - a key to a client's heart / Katrin Rahu, Evelin Ojamets ; interv. Oksana Kostina

    Index Scriptorium Estoniae

    Rahu, Katrin, 1978-

    2005-01-01

    Hill & Knowlton Estonia poolt läbi viidud uurimusest selgus, et inimesed nii Eestis, Lätis kui ka Leedus peavad organisatsiooni tööle asumisel tähtsaks ettevõtte, eriti selle mikrokliima, head mainet. Eesti puhul ilmnes üllatuslikult, et karjäärivõimalused töökoha valikul tähtsaks motiveerivaks faktoriks ei ole. Diagrammid. Skeemid

  18. Ettevõtte edukuse määravad efektiivne juhtimine ja hea maine / Evelin Ojamets

    Index Scriptorium Estoniae

    Ojamets, Evelin

    2006-01-01

    Aasta algul Hill & Knowltoni ja MORI Põhja-Ameerikas, Euroopas ning Aasias korraldatud ülemaailmse finantsanalüütikute uuringu Return on Reputation tulemustest, millest järeldub, et ettevõtte edukuse hindamisel omab üha suuremat tähtsust hea maine ja juhtimise kvaliteet. Diagrammid

  19. Keskkonnakahju mõiste Euroopa Ühenduse keskkonnavastutuse direktiivis / Evelin Lopman

    Index Scriptorium Estoniae

    Lopman, Evelin

    2006-01-01

    Euroopa Parlamendi ja nõukogu keskkonnavastutuse direktiivi (2004/35/EÜ) ja sellega seotud Euroopa Ühenduse direktiivide (79/409/EMÜ, 92/43/EMÜ ja 2000/60/EÜ) rakendamisest ja mõjust Eesti seadusandlusele

  20. Expectation values of the e+Li system

    International Nuclear Information System (INIS)

    Mitroy, J.

    2004-01-01

    Close to converged energies and expectation values for e + Li are computed using a ground state wave function consisting of 1200 explicitly correlated Gaussians. The best estimate of the e + Li energy was -7.532 895 5 hartree which has a binding energy of 0.002 482 hartree against dissociation into Ps+Li + . The 2γ annihilation rate for the spin singlet state was 6.996x10 9 s -1 . The annihilation rate for the triplet state, taking into account core annihilation and the 3γ decay, was 9.36x10 6 s -1

  1. Bosnia esimesed sammud EL-i teel / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2005-01-01

    EL alustas Bosnia ja Hertsegoviinaga läbirääkimisi stabilisatsiooni ja assotsiatsioonilepingu sõlmimiseks. Riigi kolme etnilise grupi - serblaste, horvaatide ja muslimite juhid andsid lubaduse luua ühtne riigipea ametikoht. Olukorrast Bosnias ja Hertsegoviinas kümme aastat pärast Daytoni rahuleppe sõlmimist. Skeem: Riigi ülesehitus. Vt. samas: Ahtisaari üritab Kosovo staatust kokku leppida

  2. Õiglasem ja moodsam ELi arve / Jack Straw

    Index Scriptorium Estoniae

    Straw, Jack

    2005-01-01

    Suurbritannia välisminister selgitab Suurbritannia kui Euroopa Liidu eesistujamaa poolt esitatud ettepanekuid Euroopa Liidu järgmise, 2007.-2013. aasta eelarveperioodi rahastamiskava kohta ning kinnitab, et Suurbritannia on valmis maksma oma osa ühenduse eelarvesse, kuid ainult oma õiglase osa

  3. ELi 52 miljardist saab lõviosa keskkond / Hindrek Riikoja

    Index Scriptorium Estoniae

    Riikoja, Hindrek

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 13. veebr. lk. 3. Euroopa Liidu struktuurifondidest Eestile aastateks 2007-2013 eraldatavast 52 miljardist kroonist läheb esialgse kava kohaselt 13,4 miljardit krooni keskkonnale, 11 miljardit haridusküsimuste lahendamiseks ning 11,8 miljardit ettevõtluse ja teaduse arendamiseks. Diagramm: Euroraha saajad

  4. Microsoft vaidlustas ELi nõudmised kohtus / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2006-01-01

    Microsoft kaebas Euroopa Komisjoni konkurentsiameti otsuse, mille eesmärgiks oli reguleerida Microsofti tegevust turul, Euroopa esimese instantsi kohtusse. Vt. samas: Microsofti vastasseis Euroopa konkurentsiametnikega

  5. Majanduse tulemuslikkus ELi riikide enda asi / Stefano Micossi

    Index Scriptorium Estoniae

    Micossi, Stefano

    2004-01-01

    Autori hinnangul peaks Euroopa Komisjoni uus koosseis Lissaboni strateegia kõrvale jätma, keskendudes selle asemel Euroopa ühisturu loomise lõpuniviimisele ning liikmesriikide eelarvepoliitikate kontrolli all hoidmisele

  6. Parallelism and the Composition of Oral Narratives in Banda Eli

    Directory of Open Access Journals (Sweden)

    Timo Kaartinen

    2017-10-01

    Full Text Available While parallelism is easily recognizable as the source for various literary tropes, it is also important as a resource for the speakers’ dialogic engagement with the patterns of interaction and experience: they embody part of their linguistic habitus. This article explores the forms of parallelism found in a variety of speech and narrative genres in Bandanese, an Eastern Indonesian minority language with about 5,000 speakers. Bandanese abounds with parallel expressions in which speakers use part-whole relations based on social and cultural classifications to construct totalizing cognitive and value statements. At the same time, Bandanese poetics is more than just evidence of an integrated cultural world. The article analyzes interactions between tropes based on repetition and parallelism to suggest that speakers and narrators use them to create a resonance between immediate rhetorical effects and larger recognized aesthetic positions in their folk categories. A prominent example of such resonance is the use of parallelism in eloquent, public speech. When speakers use the lexical contrast between Bandanese and the regional or national majority language as a source of parallel expressions, they draw from an aesthetic in which powerful speech resonates with past and future dialogue with outsiders. Recent scholarship on parallelism and repetition encourages us to recognize that they produce potential dialogic relations on a larger scale than that of single utterances. This approach can produce valuable insights into possibilities for innovation in and revitalization of Bandanese and other minority languages threatened by demographic change and loss of use in their former domains.

  7. ELi sotsiaaldemokraat : plaan B on Nizza leping / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-

    2005-01-01

    31. mail 2005 Tallinnas väljasõiduistungil viibinud Euroopa Parlamendi sotsiaaldemokraatide fraktsiooni juhi Martin Schulzi hinnangul ei tohi Euroopa Liidu põhiseadusleppe ratifitseerimine prantslaste vastuseisu tõttu peatuda

  8. Kaks nädalat ELi eelarveotsuseni / Jose Manuel Barroso

    Index Scriptorium Estoniae

    Barroso, José Manuel, 1956-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke 2. dets., lk 19. Vt. ka Postimees : na russkom jazõke 5. dets. lk. 8. Euroopa Komisjoni president selgitab, miks Euroopa Liidu eelarve on oluline ja millised on eelarve prioriteedid. Autor on seisukohal, et Euroopa vajab ambitsioonikat ja õiglast eelarvet, mis vastaks eurooplaste ootustele

  9. Identificação de situações de elisão e evasão fiscal: um estudo com contadores no Estado de Santa Catarina = Identifying situations of tax avoidance and evasion: a study with accountants in the state of Santa Catarina

    Directory of Open Access Journals (Sweden)

    Rosimeri Horn Pilati

    2016-11-01

    Full Text Available O Planejamento tributário é uma forma de minimizar os custos fiscais sem desrespeitar a lei. Da mesma forma, é considerado um diferencial entre os serviços contábeis, por representar uma economia de tributos para diferentes empresas. Mas é importante averiguar qual a qualidade e o conhecimento do responsável por tal prática, o que motivou a elaboração do objetivo deste estudo: verificar qual o grau de acerto dos contadores em situações elisivas e evasivas de economia de tributos. Neste estudo, buscou-se apresentar situações práticas de planejamento tributário lícito e ilícito, através de questionário descritivo aplicado, com sete perguntas de múltipla escolha, aos contadores de diferentes cidades do estado de Santa Catarina. A formulação das perguntas originou-se de estudos em artigos, decisões judiciais, acórdãos e livros, com a abordagem em planejamento tributário para economia de ISSQN e em reorganizações societárias. Os resultados apontados pela estatística descritiva mostram que a maior parte dos contadores possui entendimento de situações práticas de elisão e evasão fiscal. Dentre o grau de acerto, aponta-se um percentual acima de 60%. No teste de médias t Student contatou-se que a média entre respostas corretas e erradas é diferente, ou seja, pode-se dizer que a média das respostas corretas foi maior. Com a análise deste percentual, a sugestão desse trabalho é passar a mensagem para que os profissionais contadores estejam sempre atualizados frente aos aspectos da legislação tributária. Há alterações constantes e lacunas para a correta interpretação dos preceitos legais. Tax planning is a way of minimizing tax costs without breaking the law, likewise, they are considered a differential among the financial services, representing a tax savings for different companies. But it is important to check what the quality and the knowledge of the person n charge of this practice is. The objective of

  10. En la periferia de un texto judeoárabe: Yefet b. ͑Eli contra filósofos y astrólogos, entre tafsīr y realidad figurada (precedido de unas notas filológicas

    Directory of Open Access Journals (Sweden)

    Monferrer Sala, Juan Pedro

    2011-12-01

    Full Text Available The present article has two complementary parts. In the first part we offer a philological analysis of Yefet b. ͑Eli’s translation of Daniel 1:20 in comparison with Sa ͑adyah’s version and the oldest Christian Arabic translation (Sin. ar. 1 which has survived. In the second part, we analyse Yefet b. ͑Eli’s commentary focusing on its periphery (not in the heart of the Biblical exegesis in itself thereby showing how the Karaite author carried out an attack against the official intelligentsia of those days. For this, the author makes use of the scene narrated in the Danielic text to represent the scene of a maǧlis in which the debate is chaired by the monarch. This debate is held, with the king’s wise men, the official intelligentsia, i.e. the Rabbanite thinkers, on the one hand and, on the other hand, the non-offical thinkers, the Karaites, who represent the superior knowledge and the truth which emanates from the Law revealed by God. The Rabbanites represent Nebuchadnezzar’s wise men of Daniel’s text, and the Karaites are Daniel and the young Jews, who are superior to them in science and perfection.El presente trabajo consta de dos partes diferenciadas al tiempo que complementarias. En la primera parte ofrecemos un análisis filológico de la traducción de Da 1:20 realizada por Yefet b. ͑Eli en comparación con la versión de Sa ͑adyah y la traducción árabe cristiana más antigua con que contamos (Sin. ar. 1. En tanto que en la segunda parte nos ocupamos del análisis de su comentario, centrado en un aspecto periférico de este (no en el corazón de la exégesis bíblica en sí, tratando de mostrar cómo el autor caraíta lleva a cabo una crítica de la intelectualidad oficial del momento. Para ello, sirviéndose de la escena que narra el texto daniélico, el autor recurre a figurar la escena de un maǧlis en el que el debate presidido por el monarca es mantenido por la intelectualidad oficial, es decir los pensadores

  11. Nüüdistantsust Eestis: kehaliste dimensioonide avardumisest ja žanriköidikute survest vabanemisest / Evelin Lagle

    Index Scriptorium Estoniae

    Lagle, Evelin, 1986-

    2015-01-01

    Nüüdistantsu seisundilisusest, kontseptuaalsusest, koreograafiapõhisusest ja kehakesksusest Kadri Noormetsa, Karl Saksa, Mart Kangro, Henri Hüti, Külli Roosna, Kenneth Flaki, Rene ja Carmel Kösteri lavastuste näitel

  12. Kaitsealade moodustamise põhimõtted Euroopa looduskaitseõiguses ja selle siseriiklik järelevalve / Evelin Lopman

    Index Scriptorium Estoniae

    Lopman, Evelin

    2007-01-01

    Kaitsealade moodustamise põhimõtetest vastavalt EL linnudirektiivile (79/409/EMÜ) ja loodusdirektiivile (92/43/EMÜ) lähtudes Euroopa Kohtu praktikast ning riiklikust järelevalvest kaitsealade moodustamise üle

  13. Kontseptuaalne ja liikumispõhine nüüdistants Täiskuu tantsufestivalil Soomes / Evelin Lagle

    Index Scriptorium Estoniae

    Lagle, Evelin, 1986-

    2010-01-01

    Tantsufestivalist "Täudenkuun Tanssit" (Full Moon Dance Festival). Tantsulavastustest - Tommi Kitti "Riff", Jyrki Karttuneni "Situation Room", Kenneth Kvanströmi "Destruction Song", Liisa Petti "Mabel or the Gueen of Bones", Elina Pirineni "A Friend of the Pianist", Johanna Tuukkaneni "Outstanding Performance" ja Palle Granhoj sooloetendus "(...It's a Very Big Secret...)"

  14. Uue ettevõtluspoliitika kujundamisel saavad kõik sõna sekka öelda / Evelin Aulik

    Index Scriptorium Estoniae

    Aulik, Evelin

    2005-01-01

    Kaasamaks majandus- ja kommunikatsiooniministeeriumi poolt ettevõtluspoliitika väljatöötamiseks aastateks 2007-2013 eri elanikkonnarühmade seisukohti, on läbi viidud uuringud elanike ettevõtlikkuse, ettevõtete arengusuundumuste ja eksportööride kohta. Ettevõtluskultuuri edendamisele suunatud tegevustest, inimkapitali arendamisest koolitustegevuse kaudu ning ettevõtete rahvusvahelistumisest

  15. [Sõltumatu Tantsu Ühenduse poolt korraldatud sarjast "Premiere"] / Evelin Lagle ; küsinud Tambet Kaugema

    Index Scriptorium Estoniae

    Lagle, Evelin, 1986-

    2012-01-01

    Uutele koreograafidele pühendatud sarja "Premiere" programmis osalevad tantsulavastustega neli tantsukunstnikku Eestist - Tallinna Ülikooli lõpetanud Svetlana Grigorjeva, Turu Kunstiakadeemia lõpetanud Kaisa Selde, Viljandi Kultuuriakadeemia lõpetanud Kristina-Maria Heinsalu ja Tallinna Ülikooli lõpetanud Christin Lunts

  16. Steni muinasjutuvõistluse võitjad selgunud / Ants Roos, Ann Roos

    Index Scriptorium Estoniae

    Roos, Ants

    2008-01-01

    Steni XVI muinasjutuvõistluse žüriisse kuulusid: Ann Roos, Ants Roos, Leelo Tungal, Krista Kumberg, Leida Olszak, Ülle Väljataga. Tulemused: I koht Siim Niinelaid, II koht Julius Air Kull, III koht Mihkel Rammu. Žürii eriauhinnad: Anna Kristin Peterson, Elis Ruus, Rain Hallikas, Mariliis Peterson, Marjaliisa Palu, Karl Kirsimäe, Margaret Pulk. Ergutusauhinnad: Karmel Klaus, Martti Kaljuste, Kristina Korell, Mirjam Võsaste, Mihkel Põder, Iirys Kalde, Miriam Jamul, Mari-Ann Mägi, Ketlin Saar, Liisbeth Kirss. Muud eriauhinnad said: Allan Läll, Berle Mees, Anett Kuuse, Karl Erik Kübarsepp, Grete Tamm, Siim Niinelaid, Kaisa Marie Sipelgas, Ellen Anett Põldmaa, Evelin Laul, Karl Laas, Karl Stamm, Kerli Retter

  17. Kuulus dress ka Evelinile!

    Index Scriptorium Estoniae

    2009-01-01

    Proua Evelin Ilves kinkis Eestis esinenud popstaar Madonnale eesti rahvusmotiividega dressid. Sarnased spordirõivad tulevad müügile ka Tallinnas Viru keskuses Bastioni esinduskaupluses. Proua Evelin Ilvesele valmistatakse ainulaadsed valgest kangast dressid

  18. Kiire liitumine rahaliiduga aitab järele jõuda ELi liidritele / Leszek Balcerowicz

    Index Scriptorium Estoniae

    Balcerowicz, Leszek

    2004-01-01

    Ilmunud ka: Delovõje Vedomosti 16. juuni lk. 8. Parim strateegia on liituda eurotsooniga nii ruttu kui võimalik, kuna see ergutab viima lõpule reforme, arvab Poola riigipanga president Leszek Balcerowisz

  19. Abnormal Nuclear Pore Formation Triggers Apoptosis in the Intestinal Epithelium of elys-Deficient Zebrafish

    NARCIS (Netherlands)

    de Jong-Curtain, Tanya A.; Parslow, Adam C.; Trotter, Andrew J.; Hall, Nathan E.; Verkade, Heather; Tabone, Tania; Christie, Elizabeth L.; Crowhurst, Meredith O.; Layton, Judith E.; Shepherd, Iain T.; Nixon, Susan J.; Parton, Robert G.; Zon, Leonard I.; Stainier, Didier Y. R.; Lieschke, Graham J.; Heath, Joan K.

    Background & Aims: Zebrafish mutants generated by ethylnitrosourea-mutagenesis provide a powerful toot for dissecting the genetic regulation of developmental processes, including organogenesis. One zebrafish mutant, "flotte lotte" (flo), displays striking defects in intestinal, liver, pancreas, and

  20. Airborne gamma-ray spectrometer and magnetometer survey: Ely quadrangle, Nevada. Final report

    International Nuclear Information System (INIS)

    1980-01-01

    Five uranium anomalies meet the minimum statistical requirements as defined in Volume I. These anomalies are tabulated and are shown on the Uranium Anomaly Interpretation Map, together with the interpretation of the magnetic data. This volume contains 12 appendices: flight line map; geology map; explanation of geologic legend; flight line/geology map; pseudo-contour maps; stacked profiles; anomaly maps; geologic histograms; speed and altitude histograms; statistical tables; magnetic and ancillary profile; and test line data

  1. ELi abi ettevõtjale lükkub osaliselt edasi / Silva Männik

    Index Scriptorium Estoniae

    Männik, Silva, 1974-

    2004-01-01

    Eesti ettevõtjatele lubatud Euroopa Liidu tõukefondide raha taotlemine Ettevõtluse Arendamise Sihtasutuses viibib majandusministeeriumis vastuvõtmata määruste tõttu. Diagrammid: Struktuurifondidest saadava abi kõrval peab Eesti liikmemaksu tasuma; EAS plaanis jagada tänavu ligi 800 miljonit krooni struktuurifondide raha. Nimekiri: Põhiosa euroabist läheb töötajate arengusse ja transporti. 5 prioriteeti. Vt. samas: Raha venimine kõige hullem. AS-i E-Arsenal juht Jüri Tümanok rahade viibimisest

  2. Terror põrkub EL-i ja Vahemere ühisrindega / Priit Kivi

    Index Scriptorium Estoniae

    Kivi, Priit

    2005-01-01

    Hispaanias Barcelona tippkohtumisel jõudsid Euroopa Liit ja Vahemeremaad kompromissini terrorismivastases võitluses, lisaks arutati ebaseadusliku sisserände ohjeldamist, Euro-Vahemere vabakaubandustsooni loomist aastaks 2010, võimalusi majanduskoostöö suurendamiseks, kaubanduse liberaliseerimiseks ning kodanikuühiskonna rolli tugevdamist hariduse ja kultuurivahetuse kaudu. Kohtumisest võttis osa ka Eesti peaminister Andrus Ansip. Lisa: Euromed

  3. Euroopa riigijuhid süüdistavad EL-i asjata / Olivier Blanchard

    Index Scriptorium Estoniae

    Blanchard, Olivier

    2005-01-01

    Ilmunud ka: Molodjozh Estonii 21. juuni lk. 13. Massachusettsi tehnoloogiainstituudi majandusprofessori analüüs Euroopa Liidu olukorrast pärast Prantsusmaa ja Hollandi rahvahääletust ning Euroopa Liidu tippkohtumist

  4. Primjena REL zavarivanja u izradi čeličnih konstrukcija

    OpenAIRE

    Horvat, Marko; Bilić, Marijan; Kondić, Veljko

    2013-01-01

    Ovaj rad govori o osnovama ručnog elektrolučnog postupka zavarivanja, o njegovoj primjeni, prednostima i nedostacima. Prikazani su parametri koji utječu na proces zavarivanja ovim postupkom, zatim dodatni materijali i na kraju osvrt na tehnologičnost samog postupka.

  5. ELi ühtne põllumajanduspoliitika on teadlaste ja looduskaitsjate kriitikatule all

    Index Scriptorium Estoniae

    2014-01-01

    Euroopa juhtteadlaste, looduskaitsepraktikute ja põllumajanduskaitsjate Euroopa Liidu põllumajanduspoliitika kriitikast, mis võimaldab ökosüsteeme ning elurikkust vähendavaid intensiivseid põllupidamise viise, mis lõppkokkuvõttes halvendab Euroopa Liidu toidujulgeolekut ja kahjustab inimeste tervvist

  6. 76 FR 53898 - Proposed Administrative Settlement Agreement and Order on Consent; In Re: Ely Copper Mine...

    Science.gov (United States)

    2011-08-30

    ..., as amended (``CERCLA''), 42 U.S.C. 9622(i), and Section 7003(d) of the Resource Conservation and... efforts to market and sell the site property, allow EPA to remove and use borrow material located on the... Director, Office of Site Remediation and Restoration, U.S. EPA, Region I. [FR Doc. 2011-21991 Filed 8-29-11...

  7. A voz de Elis Regina ou o trabalho do luto e os seus registros

    OpenAIRE

    Márcia Rosa

    2008-01-01

    This article presents the work of mourning since the report of a clinical situation occurred in a psychoanalysis process and since an interview of a Brazilian popular singer and composer. Such situations lead to the theory of mourning built by Freud (1917) in the article "Mourning and melancholy" and to another reading of Freud’s article by Lacan (1959) in The desire and its interpretation. Particular attention is given to dreams, considered important in the work of mourning.

  8. A voz de Elis Regina ou o trabalho do luto e os seus registros

    Directory of Open Access Journals (Sweden)

    Márcia Rosa

    2008-01-01

    Full Text Available This article presents the work of mourning since the report of a clinical situation occurred in a psychoanalysis process and since an interview of a Brazilian popular singer and composer. Such situations lead to the theory of mourning built by Freud (1917 in the article "Mourning and melancholy" and to another reading of Freud¿s article by Lacan (1959 in The desire and its interpretation. Particular attention is given to dreams, considered important in the work of mourning.

  9. A voz de Elis Regina ou o trabalho do luto e os seus registros

    Directory of Open Access Journals (Sweden)

    Márcia Rosa

    2014-09-01

    Full Text Available This article presents the work of mourning since the report of a clinical situation occurred in a psychoanalysis process and since an interview of a Brazilian popular singer and composer. Such situations lead to the theory of mourning built by Freud (1917 in the article "Mourning and melancholy" and to another reading of Freud’s article by Lacan (1959 in The desire and its interpretation. Particular attention is given to dreams, considered important in the work of mourning.

  10. FIREFLY (Fitting IteRativEly For Likelihood analYsis): a full spectral fitting code

    Science.gov (United States)

    Wilkinson, David M.; Maraston, Claudia; Goddard, Daniel; Thomas, Daniel; Parikh, Taniya

    2017-12-01

    We present a new spectral fitting code, FIREFLY, for deriving the stellar population properties of stellar systems. FIREFLY is a chi-squared minimization fitting code that fits combinations of single-burst stellar population models to spectroscopic data, following an iterative best-fitting process controlled by the Bayesian information criterion. No priors are applied, rather all solutions within a statistical cut are retained with their weight. Moreover, no additive or multiplicative polynomials are employed to adjust the spectral shape. This fitting freedom is envisaged in order to map out the effect of intrinsic spectral energy distribution degeneracies, such as age, metallicity, dust reddening on galaxy properties, and to quantify the effect of varying input model components on such properties. Dust attenuation is included using a new procedure, which was tested on Integral Field Spectroscopic data in a previous paper. The fitting method is extensively tested with a comprehensive suite of mock galaxies, real galaxies from the Sloan Digital Sky Survey and Milky Way globular clusters. We also assess the robustness of the derived properties as a function of signal-to-noise ratio (S/N) and adopted wavelength range. We show that FIREFLY is able to recover age, metallicity, stellar mass, and even the star formation history remarkably well down to an S/N ∼ 5, for moderately dusty systems. Code and results are publicly available.1

  11. Portugalist sai euroala äärel uus kriisikolle. Varjutab ELi Ülemkogu / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2011-01-01

    Portugali peaminister José Sócrates astus tagasi, kuna opositsiooniparteid ei toetanud tema kokkuhoiukava. Analüütikute hinnangul vajab Portugal eelarvepuudujäägi vähendamiseks umbes 80 miljardit eurot

  12. Austria otsib EL-i põhiseaduslepingu jaoks soodsat kliimat / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2006-01-01

    Viinis toimunud Austria valitsuse ja Euroopa Komisjoni ühisistungi järgsest Austria kantsleri Wolfgang Schüsseli ja Euroopa Komisjoni presidendi Manuel Barroso esinemisest, kus nad käsitlesid Euroopa põhiseaduse temaatikat. M. Barroso sõnul ei vaja Euroopa kodanikud praegu kõige rohkem mitte niivõrd konstitutsiooni, kuivõrd majanduskasvu ja töökohti

  13. ELi kaitsekoostöös terendab üleüldine vabatahtlikkus / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2017-01-01

    Tallinnas toimunud Euroopa Liidu kaitseministrite kohtumisest. Kaitseministritele korraldatud strateegilisest suurõppusest EU CYBRID 2017 ja NATO peasekretäri Jens Stoltenbergi külaskäigust Tapale

  14. Eestit kaitseb krediidipuuduse eest EL-i pühapaiste efekt / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2007-01-01

    Deutsche Bank Researchi analüütikud Marion Mühlberger ja Thorsten Nestmann peavad oma raportis Ida-Euroopas tõenäoliseks laenukasvu aeglustumist ehk pehmet maandumist. Kõige haavatavamaks peavad nad Kasahstani, Venemaa ja Läti pangasüsteemi. Reitinguagentuuri Fitch areneva Euroopa riigireitingute vanemdirektor Edward Parker põhjendab, miks Eestis ei peaks kartma suure finantskriisi tekkimist

  15. Využití Facebooku pro reklamní účely

    OpenAIRE

    Pavelka, Tomáš

    2010-01-01

    The main aim of this thesis is a description of options to use Facebook for advertising purposes. The first part of the thesis deals with social networks in general, analyses the reasons of their popularity, lists their types and mentions a couple of examples. Furthermore, the thesis compares advertising on social networks to traditional forms of advertising and analyses its advantages and disadvantages. Further part of the thesis is focused on the most popular social network in the world -- ...

  16. Understanding Elián : the politics of childhood in Miami and Havana, 1959-1962

    OpenAIRE

    Casavantes Bradford, Anita

    2011-01-01

    This dissertation examines the centrality of symbolic and actual children to the transnational processes that propelled the 1959 Cuban Revolution and the subsequent formation of the US resident Cuban exile community. It argues that the bodies and symbolic representations of children were pressed into "nation-making" service by a Revolution that sought to fulfill Cubans' frustrated dreams of democratic governance, social equality, and national autonomy; however, as it turned swiftly towards so...

  17. Smeds lükkas liikvele EL-i bürokraadid / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2009-01-01

    19. veebr. Brüsselis Flaami Kuninglikus Teatris esietendunud lavastusest "Mental Finland", autor-lavastaja Kristian Smeds Soomest, kaasa teevad eesti näitlejad Juhan Ulfsak ja Eva Klemets. Tsiteeritakse ka teatri dramaturgi Ivo Kuyli, kes vahendab ajakirjanduses ilmunud kriitikat ja räägib oma muljetest

  18. Environmental Literacy of Undergraduate College Students: Development of the Environmental Literacy Instrument (ELI)

    Science.gov (United States)

    Lloyd-Strovas, Jenny; Moseley, Christine; Arsuffi, Tom

    2018-01-01

    As the world population continues to increase and natural resources become limited, environmental education (EE) in universities play an essential role in developing environmentally literate. This study measured the environmental literacy (EL) levels (familiar knowledge, factual knowledge, attitude, behavior) of undergraduate college students.…

  19. Sõrmejäljed ja daktüloskoopiaekspertiisid : [magistritöö] / Evelin Kisand ; Tartu Ülikool, õigusteaduskond ; juhendajad: Erik Mei, Meris Sillaots

    Index Scriptorium Estoniae

    Kisand, Evelin, 1987-

    2013-01-01

    Sõrmejälgedest üldiselt, papillaarkurrustusega naha ehitusest ja omadustest, eritunnustest, numbrilisest ja holistilisest lähenemisest, sõrmejälgede avastamisest, liigitamisest ja nähtavaks muutmisestdaktüloskoopiaekspertiisist, riiklikust sõrmejälgede registrist

  20. Laenuriskid Eestis ühiskonna sotsiaalmajanduslike muutuste kontekstis : [magistritöö] / Evelin Tartlan ; Tartu Ülikool, õigusteaduskond ; juhendaja: Silvia Kaugia

    Index Scriptorium Estoniae

    Tartlan, Evelin

    2010-01-01

    Eesti pangandusest ja laenuturust, krediidiasutustest ja nende tegevust reguleerivatest õigusaktidest, laenuturu toimimispõhimõtetest, pangalaenudega kaasnevatest sotsiaalmajanduslikest probleemidest tänases Eestis, meetmetest katastroofi vältimiseks ja leevendamiseks

  1. Archaeological studies in the church and churchyard of Kose / Martin Malve, Villu Kadakas, Mauri Kiudsoo, Elis Tiidu

    Index Scriptorium Estoniae

    2014-01-01

    Artikkel käsitleb arheoloogiliste välitööde tulemusi 2011. aasta uuringutest nn Uues kirikus ja 19. sajandi keskpaigas ehitatud põhjatiivas ning 2013. aasta uuringuid kirikuaia lääne- ja põhjaosas

  2. DEMONSTRATION BULLETIN: THE ECO LOGIC THERMAL DESORPTION UNIT - MIDDLEGROUND LANDFILL - BAY CITY, MI - ELI ECO LOGIC INTERNATIONAL, INC.

    Science.gov (United States)

    ECO Logic has developed a thermal desorption unit 0"DU) for the treatment of soils contaminated with hazardous organic contaminants. This TDU has been designed to be used in conjunction with Eco Logic's patented gas-phase chemical reduction reactor. The Eco Logic reactor is the s...

  3. Teške kovine u čeličanskoj elektropećnoj prašini

    Directory of Open Access Journals (Sweden)

    Mandrino Dj.

    2005-12-01

    Full Text Available Within the scope of corporate waste management, Sisak Steelworks initiated a thorough and systematic examination of physical and chemical properties of metallurgical waste and of its behaviour in interaction with the environment. Electric arc furnace (EAF dust has been categorized as hazardous technological waste and it can not be directly disposed of to the ground / in a land fill. Therefore, it is necessary to find a way to dispose of it in an environmentally friendly and economically acceptable manner. In order to elaborate different options and chose the optimal practice for the disposal of the accumulated volumes of hazardous metallurgical waste, comprehensive and systematic research has been conducted. This paper provides only a partial survey of the research of the heavy metal Zn, Pb, Cd content in electric arc furnace dust as well. Qualitative chemical analysis of samples of electric arc furnace dust was conducted on all observed samples and the presence of Fe, Zn, Pb, Mn, Cu, Al, Ca, Mg, K, S, P, C, O and Cl was established. The results of qualitative chemical analysis of monthly average samples of electric arc furnace dust obtained by other methods established that the mass fraction of iron was between 41.08 and 48.58 %, zinc between 3.75 and 8.10 %, lead between 0.94 and 2.07 %, and cadmium between 0.010 and 0.027 %. The results of the Zn, Pb, Cd fraction analysis in the observed samples of electric arc furnace dust are considerably lower, than the content of those metals in EAF dusts presented in the available references, where the mass fraction of zinc varies between 0.14 and 50 %, lead between 0.03 and 6.8 %, and cadmium between < 0.01 and 1.8 %. Quantitative analysis of Fe, Zn, Pb and Cd fraction was carried out in grain-metrical fractions of individual samples of EAF dust as well. The results have shown that the concentrations of Fe tend to increase with smaller fraction grains compared to an average sample, whereas concentrations of Zn, Pb and Cd in the same proportion display a descending tendency. Results of the Zn, Pb and Cd fraction analysis in the EAF dust samples from Sisak Steelworks compared to the mass fraction of those metals in EAF dust from other steel mills imply that the measured concentrations of zinc, lead, and cadmium are much higher. Therefore, it is not economically viable to recycle this dust for the lead, zinc or cadmium recovery. Consequently, the disposal of this kind of hazardous metallurgical waste must first be handled in another, environmentally acceptable and economically justifiable way. Additional investigations must be carried out before the final decision is made.

  4. ELi majanduslik võimekus jääb konkurentidele alla / Maria Joao Rodrigues ; interv. Aivar Reinap

    Index Scriptorium Estoniae

    Rodrigues, Maria Joao

    2004-01-01

    Praxis'e kutsel Eestis viibinud Euroopa Komisjoni nõuniku hinnangul ei suuda Euroopa Liit tõusta lähiaastatel maailma kõige konkurentsivõimelisemaks piirkonnaks. Lissaboni strateegiast, Euroopa konkurentsivõimest, Aasia ohust, Eesti võimalustest. Lisa: Euroopa Liidu majandusideoloog

  5. Eestile väljamakstud ELi toetused ületavad Kesk- ja Ida-Euroopa keskmist / Triin Värav

    Index Scriptorium Estoniae

    Värav, Triin

    2011-01-01

    KPMG Ungari kontori poolt läbiviidud uuringu kokkuvõte "EU Funds in Central and Eastern Europe - Progress report 2007-10" annab ülevaate Kesk- ja Ida-Euroopa rahastamisvahenditest aastateks 2007-2013

  6. Using Movies in EFL Classrooms: A Study Conducted at the English Language Institute (ELI), King Abdul-Aziz University

    Science.gov (United States)

    Kabooha, Raniah Hassen

    2016-01-01

    The present study sought to examine the attitudes of Saudi English as a foreign language (EFL) learners as well as teachers towards the integration of English movies in their classes as a tool to develop students' language skills. Fifty female intermediate level students studying English in their Preparatory Year Program (PYP) in the English…

  7. Prantsusmaa ootab ELis võitlust musta tööjõuga / Catherine Colonna ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Colonna, Catherine

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 31. märts lk. 8. Eestis visiidil viibiv Prantsusmaa Euroopa asjade minister Prantsusmaa seisukohast tööjõu vaba liikumise piirangute kaotamise suhtes, Euroopa Liidu põhiseadusleppega seotud kriisist, Euroopa maksu kehtestamisest, Euroopa Liidu ühisest energiapoliitikast ning ühenduse poliitikast Venemaa suhtes. Lisa: Karjäär

  8. Komisjon püüab kaitsta EL-i uute liikmete tööjõudu / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2006-01-01

    Euroopa Komisjoni justiits- ja sisevoliniku Franco Frattini ametlikust tõlgendusest vastuolule EL-seadustikus, mis puudutab välistööjõu värbamist ja uute liikmesriikide tööjõule üleminekuperioodi kehtestamist

  9. Uus Ukraina : ELi kandidaat või taas Venemaa lähivälismaa? / Aili Ribulis

    Index Scriptorium Estoniae

    Ribulis, Aili

    2005-01-01

    Välispoliitika ekspert Aili Ribulis leiab, et suhtumises postrevolutsioonilisse Ukrainasse võiks Euroopa Liit võtta eeskuju NATO-st ja pakkuda konkreetseid tulevikuperspektiive. Euroopa Liidu naabruspoliitika

  10. ELi hiigeltrahvist hoolimata on poolakad rõõmsad / Bogdan Golik ; interv. Silja Lättemäe

    Index Scriptorium Estoniae

    Golik, Bogdan

    2005-01-01

    Euroopa Parlamendi põllumajandus- ja maaelu arengu komiteesse kuuluv sotsiaaldemokraat Bogdan Golik Poolast räägib Euroopa Liidu poolt Poolale üleliigsete laovarude eest määratud trahvist, Poola talunike olukorrast ja põllumajanduse konkurentsivõime tõstmisest

  11. Hispaania nõuab immigrantide vastu võitlemiseks EL-i abi / Anna-Maria Penu

    Index Scriptorium Estoniae

    Penu, Anna-Maria, 1978-

    2006-01-01

    Üha suureneb Kanaaridele saabuvate Aafrika paadipõgenike hulk, Hispaania asepeaminister Maria Teresa Fernandez de la Vega tahab probleemi lahendamiseks EL-ilt kaasabi. Lisa: Nädalavahetus tõi üle 1000 põgeniku

  12. Zobrazovací systém pro výukové účely

    OpenAIRE

    ŠIRHAL, Lukáš

    2012-01-01

    This work deals with presentation and work with the measurement values. The main objective of this work was to design an imaging system for PC (Windows or Mac), which will display the measured values in real time. The created application allows you to design your own charts in spreading.

  13. Presidendiproua sai proua presidendilt kepid

    Index Scriptorium Estoniae

    2007-01-01

    Soome riigivisiidi ajal kingiti proua Evelin Ilvesele Oulu firma Polar pulsimõõtja. Soome president Tarja Halonen kinkis president Toomas Hendrik Ilvesele ja proua Evelin Ilvesele kepikõnni kepid. Vabariigi President riigivisiidil Soome Vabariiki 14.-16.03.2007

  14. Saving Coalition Lives and Limbs: Disrupting the Improvised Explosive Device Network in Iraq with Center of Gravity Analysis and Social Network Viral Targeting

    Science.gov (United States)

    2008-12-21

    63, 73. 64. Evelin Gerda Lindner, ―In Times of In Times of Globalization and Human Rights: Does Humiliation Become the Most Disruptive Force...Force-Protection Issue, General Says.‖ American Forces Press Service, 14 February 2007. Lindner, Evelin Gerda . ―In Times of In Times of

  15. Braavo, presidendiproua! / Karoliina Vasli

    Index Scriptorium Estoniae

    Vasli, Karoliina

    2008-01-01

    Eesti Rulluisuliidu president proua Evelin Ilves tuli Berliini rulluisumaratonil enam kui 6000 osavõtja seas 141. kohale. Kommenteerib treener Jaanus Ritson. Vt. samas: Evelin Ilves näitusel setu kultuuri kaitsmas. Proua E. Ilves avas 25. septembril 2008 Berliinis Eesti suursaatkonna ruumides kunstnik Siiri Taimla näituse "Elu lugu", mille põhiteemaks on setu naised Eestis sajand tagasi

  16. Visit to the Library by President of Estonia

    Index Scriptorium Estoniae

    2008-01-01

    15. aprillil 2008 külastasid president Toomas Hendrik Ilves ja proua Evelin Ilves Iirimaa Rahvusraamatukogu, kus nad vaatasid näitust: Yeats : the life and works of William Butler Yeats. Juuresoleval fotol president T. H. Ilves, proua Evelin Ilves ja raamatukogutöötaja Catherine Fahy. Vabariigi President riigivisiidil Iirimaal 13.-16.04.2008

  17. Ulukiliha sobib ka jõululauale / Raivo Feldmann

    Index Scriptorium Estoniae

    Feldmann, Raivo

    2009-01-01

    Adavere lihakauplusest, mida on külastanud ka president Toomas Hendrik Ilves ja proua Evelin Ilves. OÜ Chef Foodsi kaupa tellib ka presidendi kantselei. Juuresoleval fotol president Toomas Hendrik Ilves ja proua Evelin Ilves koos OÜ Chef Foodsi juhatuse liikme Veiko Villemi ja juhataja Priit Noorhaniga

  18. Vana mõisahoone ärkas elule / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2008-01-01

    Muhus asuva Pädaste mõisa peahoone avamist tähistati kultuuriprogrammiga. Kohal viibisid ka president Toomas Hendrik Ilves ja proua Evelin Ilves. Juuresoleval fotol Muhu kooliõpetaja Tiina Saar, mõisaomanikud Martin Breuer ja Imre Sooäär ning proua Evelin Ilves härrastemaja linti läbi lõikamas

  19. Kaubavahetus on olnud eurooplaste kasuks / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    1999-01-01

    USA ja EL-i vahelised väliskaubandussuhted. Tabelid: EL-i eksport USA-sse ja import USA-st; suurimad EL-i USA-sse eksportijad ja suurimad EL-i USA-st importijad; EL-i riikide väliskaubanduse suhtarvud SKP-st, USA osatähtsus kaubanduspartnerina Euroopa riikidele

  20. Využití kukuřice seté (Zea mays L.) pro energetické účely

    OpenAIRE

    RATAJ, David

    2011-01-01

    This bachelor thesis deals with the types of energy use of flint corn (Zea mays). It compares the suitability of hybrid maize lines. The thesis is to summarize and compare the literature data on other types of energy crops and compares them suitable for cultivation for energy recovery on the basis of some production capacity and energy parameters (dry matter yield, energy recovery, combustion heat and humidity).

  1. El patrimonio cultural nos incluye a todos. Fundación Eliécer Silva Celis : una organización inteligente

    OpenAIRE

    Ardila Silva, Sandra Ximena; Correal Cabezas, Ximena Alexandra

    2011-01-01

    El proyecto consta de tres componentes fundamentales los cuales son: (1) Crear un modelo organizacional inteligente que se articule a las demandas culturales de la comunidad de Sogamoso y contribuya a apropiación del patrimonio cultural en el departamento de Boyacá. (2) Formular un plan estratégico para la FESC que promueva procesos culturales de comunicación, intercambio y apropiación del patrimonio cultural. (3) Diseñar una estrategia de sostenibilidad para la FESC basada en la importancia ...

  2. "Aga vene ajal pidi igas õppetunnis siduma õppematerjali poliitikaga" : ideoloogiline kasvatus nõukogude koolitunnis hilisstalinistlikus Eesti NSV-s / Eli Pilve

    Index Scriptorium Estoniae

    Pilve, Eli, 1982-

    2010-01-01

    Nõukogude harisdussüsteemi üldistest ideoloogilistest põhimõtetest ja koolikohustusest. Kooliõpetuse ümberkorraldamisest okupeeritud Eestis, uutest õppeprogrammidest ja õpikutest, ajaloo õpetamisest. Nõukogude patriotismi ja internatsionalismi kasvatamisest teistes ainetundides. Õpetajaskonnast, ideoloogilisest survest õpetajatele ja kaadripuhastusest

  3. Influence of process parameters on layer build-up and microstructure of Ti6Al4V (ELI) alloy on the optomec LENS

    CSIR Research Space (South Africa)

    Arthur, N

    2016-11-01

    Full Text Available The Optomec Laser Engineered Net Shaping (LENS®) system is a laser-based platform that relies on computer-aided design (CAD) files to design and produce 3 D printed components. This system is comprised of a 1 kW laser used to melt metal powders...

  4. Využití sociální sítě Facebook po účely internetového marketingu

    OpenAIRE

    Vrbasová, Magdaléna

    2009-01-01

    The aim of this thesis is to create and effectively manage Facebook web pages for individual divisions of Import Volkswagen Group s.r.o. The thesis is divided into two parts - theoretical and practical. The theoretical part contains basic information about online and offline medias, trends in the area of Internet marketing and measuring of online advertising efficiency, which, unlike the efficiency of "offline" advertising, is easily measurable. In the past two years, social networks, especia...

  5. Eesti tööandja hoiab ELis kõige rohkem töötajate pealt kokku / Kaire Uusen

    Index Scriptorium Estoniae

    Uusen, Kaire

    2005-01-01

    Rahvusvahelise uuringufirma Mercer Human Resources Consulting uuring näitas, et Eesti tööandaja vabatahtlikud kulud töötajatele on ainult 0,7% kõigist kuludest. Diagramm: Kui palju maksab Eesti töötaja?

  6. Journalismin uudet vuorovaikutuskeinot : Eli kuinka joukkoälyä käytetään osana toimituksellista työprosessia

    OpenAIRE

    Riihinen, Eleonoora

    2012-01-01

    Joukkoäly journalistisessa prosessissa on vielä vähän kokeiltu toimitustyökalu, joka yhdistää yleisön hyödyntämisen, tutkivan journalismin ja verkon datasovellukset. Joukkoälyllä tarkoitetaan jonkin tehtävän ulkoistamista ennalta nimeämättömälle joukolle ihmisiä. Tutkielmassani selvitän, millainen prosessi joukkoälyn käyttö on journalistisessa työprosessissa ja kuinka kiinnostuneita pienemmän levikkialueen maakuntalehdet ovat käyttämään yleisöä osana journalistista prosessia uusia toimitu...

  7. New research results from the smithy site of Käku in 2013-2014 / Ragnar Saage, Jüri Peets, Elis Tiidu, Liina Maldre

    Index Scriptorium Estoniae

    2015-01-01

    Praeguste teadmiste kohaselt on tegemist 14.-17. sajandisse kuuluva muistisega, kus on leitud nelja üksteisele järgneva sepikoja konstruktsioonid. Välitööde kõige olulisem tulemus oli kõige vanema sepikoja järgu eristamine eelviimasest

  8. Digitaalmälu seminaril räägiti veebisisu säilitamisest / Jaanus Kõuts, Tiiu Daniel, Elis Karpov

    Index Scriptorium Estoniae

    Kõuts, Jaanus, 1976-

    2015-01-01

    Ülevaade 28. jaanuaril Eesti Rahvusraamatukogus toimunud järjekorras kuuendast rahvusvahelisest seminarist sarjast Digitaalmälu (Digital Memory) pealkirjaga „Veebiarhiveerimise roll andmerikka ühiskonna ajaloo säilitamisel” (Web Archiving: Preserving the History of Data-Driven Society)

  9. Bartra, Eli y Huacuz Elías, María Guadalupe (Coords. (2015: Mujeres, Feminismo y Arte popular. Ciudad de México: Obra Abierta Ediciones

    Directory of Open Access Journals (Sweden)

    José Manuel Méndez Tapia

    2016-11-01

    Full Text Available Esta obra colectiva viene a enfatizar la necesaria mirada de género y la inclusión del feminismo en los espacios creativos-artísticos del denominado arte popular. Este libro es un mosaico etnográfico que compone realidades sociales. Tales como la invisibilidad y lo innombrable de la mujer en estos procesos de creación, distribución y venta que, en algunas de las comunidades citadas en los capítulos, son esenciales para la subsistencia y empoderamiento las mujeres. 

  10. factors influEncinG tHE usE of EPisiotoMY durinG VaGinal dEliVErY

    African Journals Online (AJOL)

    2008-05-05

    May 5, 2008 ... Greater attention needs to be paid to selection of women to undergo ... sex (1-6). records suggest that women who have an episiotomy do not have .... a selective use of episiotomy in multigravid women and older women. the ...

  11. Ruth Kalda: peremeditsiinis saab patsiendi tervise heaks väga palju ära teha / küsitlenud Eli Lilles

    Index Scriptorium Estoniae

    Kalda, Ruth, 1965-

    2015-01-01

    Intervjuu peremeditsiini kliiniku juhataja prof Ruth Kalda 50. sünnipäeval. Ruth Kaldast räägivad: Anneli Rätsep, Elle-Mall Keevallik, Lehte Põder,Heidi- Ingrid Maaroos ja Marje Oona ning Mart Einasto ja Pärtel Piirimäe

  12. Obnova bývalé prádelny pod hradem Veveří pro účely enviromentálních aktivit

    OpenAIRE

    Vrtek, Tomáš

    2014-01-01

    Cílem bakalářské práce bylo navržení obnovy objektu bývalé hradní prádelny hradu Veveří, při ulici Rakovecká v městské části Brno-Bystrc. Záměr k obnově vzešel od současných majitelů a spočíval v návrhu nového programu využití s environmentální tématikou a poté samotné rekonstrukce objektu. Navržen byl objekt s rekreačním ubytováním se specializovanými dílnami zaměřenými převážně na výuku a provozování tradičních řemesel. Vzhledem k špatnému technickému stavu objektu a novému plánovanému využ...

  13. Lord Owen : lõpetage rääkimine EL-i kriisidest / David Anthony Llewellyn Owen ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Owen, David Anthony Llewellyn

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 2. apr. lk. 9. Tartu Ülikoolis esinenud ja Venemaal äri ajav Briti endine välisminister vastab küsimustele Euroopa Liidu põhiseadusliku leppe, reformide, välis- ja julgeolekupoliitika, Venemaa suhete ja sisearengu, energiapoliitika kohta ning leiab, et ei taha Venemaaga uuesti alustada külma sõda. Lisa: Lord Owen

  14. Fatigue and biological properties of Ti-6Al-4V ELI cellular structures with variously arranged cubic cells made by selective laser melting.

    Science.gov (United States)

    Dallago, M; Fontanari, V; Torresani, E; Leoni, M; Pederzolli, C; Potrich, C; Benedetti, M

    2018-02-01

    Traditional implants made of bulk titanium are much stiffer than human bone and this mismatch can induce stress shielding. Although more complex to produce and with less predictable properties compared to bulk implants, implants with a highly porous structure can be produced to match the bone stiffness and at the same time favor bone ingrowth and regeneration. This paper presents the results of the mechanical and dimensional characterization of different regular cubic open-cell cellular structures produced by Selective Laser Melting (SLM) of Ti6Al4V alloy, all with the same nominal elastic modulus of 3GPa that matches that of human trabecular bone. The main objective of this research was to determine which structure has the best fatigue resistance through fully reversed fatigue tests on cellular specimens. The quality of the manufacturing process and the discrepancy between the actual measured cell parameters and the nominal CAD values were assessed through an extensive metrological analysis. The results of the metrological assessment allowed us to discuss the effect of manufacturing defects (porosity, surface roughness and geometrical inaccuracies) on the mechanical properties. Half of the specimens was subjected to a stress relief thermal treatment while the other half to Hot Isostatic Pressing (HIP), and we compared the effect of the treatments on porosity and on the mechanical properties. Fatigue strength seems to be highly dependent on the surface irregularities and notches introduced during the manufacturing process. In fully reversed fatigue tests, the high performances of stretching dominated structures compared to bending dominated structures are not found. In fact, with thicker struts, such structures proved to be more resistant, even if bending actions were present. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. The effect of post-sintering treatments on the fatigue and biological behavior of Ti-6Al-4V ELI parts made by selective laser melting.

    Science.gov (United States)

    Benedetti, M; Torresani, E; Leoni, M; Fontanari, V; Bandini, M; Pederzolli, C; Potrich, C

    2017-07-01

    Fatigue resistance and biocompatibility are key parameters for the successful implantation of hard-tissue prostheses, which nowadays are more and more frequently manufactured by selective laser melting (SLM). For this purpose, the present paper is aimed at investigating the effect of post-sintering treatments on the fatigue behavior and biological properties of Ti samples produced by SLM. After the building process, all samples are heat treated to achieve a complete stress relief. The remaining ones are tribofinished with the aim of reducing the surface roughness of the as-sintered condition. Part of the tribofinished samples are then subjected to one of the following post-sintering treatments: (i) shot peening, (ii) hot isostatic pressing (HIP), and (iii) electropolishing. It is found that shot peening and HIP are the most effective treatments to improve the high and the very-high cycle fatigue resistance, respectively. At the same time, they preserve the good biocompatibility ensured by the biomedical Titanium Grade 23. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Elon levyraati eli kuinka suomalaiset musiikki-ihmiset kokevat virolaisten rakkaimmat laulut / Jartse Tuominen, Tommi Liuhala, Mikko Alatalo, Heikki, Salo ; intervjueerinud Harri Rinne

    Index Scriptorium Estoniae

    2013-01-01

    Soome muusikud hindavad eestlaste lemmiklaule: Tõnis Mägi "Koit", Maarja "Suudlus läbi jäätunud klaasi", Siiri Sisaski "Mis maa see on" Liisi Koiksoni ja Marko Matvere "Tuulevaiksel ööl", Rihol Sibula "Videvik", Chalice´i "Minu inimesed" ja Ivo Linna "Julge laul"

  17. Euroopa Liidu mahelogo pole kuigi tuntud / ülevaate koostas Merit Mikk

    Index Scriptorium Estoniae

    2015-01-01

    2010. a muutus ELi mahelogo kasutamine mahetoodetel kohustuslikuks. Euroopa Komisjon lootis sellega elavdada ELi maheturgu. Mitmete uuringute põhjal on aga selgunud, et tarbijad ELi mahemärki siiski eriti ei tunne

  18. Bordering and ordering the European neighbourhood : a critical perspective on EU territoriality and geopolitics / James Wesley Scott

    Index Scriptorium Estoniae

    Scott, James Wesley

    2009-01-01

    Kaitse ja koostöö agendade põrkumisest ELi territooriumi piiritlemisel ELi ja naaberriikide piiriüleste kodanikeühenduste näitel. ELi ja Ukraina vahelistest suhetest Euroopa naabruspoliitika kontekstis

  19. Euroopa Parlamendist ei saa kunagi tõeliste eurooplaste esinduskogu / Jeroen Bult

    Index Scriptorium Estoniae

    Bult, Jeroen

    2004-01-01

    EL-i liikmesriikide inimeste suhtumisest Euroopa Parlamendi valimistesse ja parlamendi funktsioonide muutmise vajadusest. Vt. samas: Euroopa tähistab valimiste veerandsajandit. Lisa: EL-i liikmesriigid

  20. Trotz Richtlinie weiterhin intergouvernmental / Joachim Lippott

    Index Scriptorium Estoniae

    Lippott, Joachim

    2017-01-01

    ELi kodanike konsulaarkaitsest kolmandates riikides rahvusvahelise, Euroopa Liidu ja siseriikliku õiguse aspektist; ELi toimimise lepingu artikli 23, diplomaatiliste suhete ja konsulaarsuhete Viini konventsiooni tõlgendamisest

  1. Veider nelik jätkab!

    Index Scriptorium Estoniae

    2008-01-01

    Arvutiga animeeritud USA koguperefilmist "Madagaskar 2" (lavastanud Tim McGrath ja Eric Darnell, eesti keeles loevad teksti Karol Kuntsel, Andero Ermel, Evelin Pang, Argo Aadli, Mait Malmsten, Raivo E. Tamm, Andrus Vaarik, Anne Reemann jt)

  2. Tallinna Linnateater noppis "Tõe ja õiguse" eest auhindu

    Index Scriptorium Estoniae

    2007-01-01

    Anton Hansen Tammsaare "Tõe ja õiguse" neljanda osa lavaversioon tõi Linnateatrile parima lavastaja - Elmo Nüganen, parima naispeaosatäitja - Hele Kõre ja parima naiskõrvalosa auhinna - Evelin Pang

  3. 9. II avati taas von Krahli Akna galerii

    Index Scriptorium Estoniae

    2004-01-01

    Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid

  4. Kellele oleksid Sina presidendina autasu andnud?

    Index Scriptorium Estoniae

    2011-01-01

    Küsimusele vastavad Vabadusvõitluse muuseumi juhataja Johannes Tõrs, Viimsi Teataja peatoimetaja Annika Poldre, Saue linna elanik Evelin Povel-Puusepp, Muraste elanik Vello Malken, Kuusalu valla elanik Sirje Potisepp ja Kanama postijaama elanik Priit Pillov

  5. Neli noort sportlast said presidendi kultuurirahastu preemia

    Index Scriptorium Estoniae

    2011-01-01

    Proua Evelin Ilves andis 4. mail 2011 Kadriorus üle noore sportlase preemiad. Preemia pälvisid iluuisutajatest õed Nanette Christine ja Naomi Charlotta Andersson, purjetaja Sten Christian Taal ja ujuja Elisabeth Egel

  6. Preemia saanud õed Anderssonid sõidavad Kanadasse laagrisse / Kristi Vahemaa

    Index Scriptorium Estoniae

    Vahemaa, Kristi, 1980-

    2011-01-01

    Proua Evelin Ilves andis 4. mail 2011 Kadriorus üle noore sportlase preemiad. Preemia pälvisid iluuisutajatest õed Nanette Christine ja Naomi Charlotta Andersson, purjetaja Sten Christian Taal ja ujuja Elisabeth Egel

  7. Uisutajad tõid presidendiproua kooli / Elina Randoja

    Index Scriptorium Estoniae

    Randoja, Elina

    2011-01-01

    Proua Evelin Ilves ja endine suusataja Jaak Mae külastasid 10. mail 2011 Tartu Katoliku Kooli, kus õpivad tänavuse noore sportlase preemia pälvinud iluuisutajatest õed Nanette Christine ja Naomi Charlotta Andersson

  8. Queen Sofia Shawl

    Index Scriptorium Estoniae

    2009-01-01

    4. mail 2009 saabusid Eestisse riigivisiidile Hispaania kuningas Juan Carlos I ja kuninganna Sofia. Presidendi kantselei tellis kuningannale kingituseks Haapsalu salli. Juuresoleval fotol president Toomas Hendrik Ilves ja proua Evelin Ilves kingitust üle andmas

  9. Stolitsa baltiskoi modõ / Vladimir Stroi

    Index Scriptorium Estoniae

    Stroi, Vladimir

    2005-01-01

    Riias toimunud Balti moenädalast (Baltic Fashion Week) ja seal näidatud kollektsioonidest. Eestit esindasid Ene (?Evelin) Lill kollektsiooniga "Puudutus" ja Kätlin Kängsepp "Muudatuste uued tuuled"

  10. Kuninganna Sofia sall

    Index Scriptorium Estoniae

    2009-01-01

    4. mail 2009 saabusid Eestisse riigivisiidile Hispaania kuningas Juan Carlos I ja kuninganna Sofia. Presidendi kantselei tellis kuningannale kingituseks Haapsalu salli. Juuresoleval fotol president Toomas Hendrik Ilves ja proua Evelin Ilves kingitust üle andmas

  11. Eesti esimene leedi näitas Hispaanias kuninglikku klassi! / Helene Wait

    Index Scriptorium Estoniae

    Wait, Helene

    2007-01-01

    Fotoreportaaž president Toomas Hendrik Ilvese ja proua Evelin Ilvese riigivisiidist Hispaaniasse 8.-11.07.2007. Hispaania kuningas Juan Carlos ja kuninganna Sofia andsid Madridi kuningalossis Eesti presidendipaari auks õhtusöögi

  12. Hispaania kuningapaar külastab Eestit! / Koidu Raudvere

    Index Scriptorium Estoniae

    Raudvere, Koidu

    2009-01-01

    Portreeartikkel Hispaania kuningast Juan Carlosest ja kuninganna Sofiast. Ühel juuresolevatest fotodest president Toomas Hendrik Ilves ja proua Evelin Ilves riigivisiidil Hispaanias. Vabariigi President riigivisiidil Hispaaniasse 8.-11.07.2007

  13. Moral development and juvenile sex offending

    NARCIS (Netherlands)

    van Vugt, E.S.

    2011-01-01

    Eveline van Vugt onderzocht gewetensontwikkeling en delinquentie. Uit haar onderzoek bleek dat delinquenten met een gebrekkige gewetensontwikkeling een groot risico lopen om terug te vallen in delinquent gedrag. Opvallend was dat jongeren die een zedendelict hadden gepleegd eenzelfde

  14. PR, patriotism ja olupoliitika / Evi Arujärv

    Index Scriptorium Estoniae

    Arujärv, Evi, 1953-

    2009-01-01

    Proua Evelin Ilves kritiseeris kommivabriku Kalev toodangut transrasvade sisalduse pärast. Artikli autor analüüsib sellest hargnenud üldrahvalikku muljetevahetust kui väärtusmaailmade kokkupõrget

  15. Kultuurisild : eesti muinasjutud ilmusid hiina keeles

    Index Scriptorium Estoniae

    2010-01-01

    18. okt. esitleti maailmanäitusel EXPO Hiinas Shanghais esimest eesti keelest hiina keelde tõlgitud raamatut, kogumikku August Jakobsoni ja Friedrich Reinhold Kreutzwaldi muinasjuttudest Jüri Mildebergi illustratsioonidega. Proua Evelin Ilves osales raamatu esitlusel Shanghai Lasteraamatukogus

  16. Ando Kiviberg: igatsen rohkem kuulda ja lugeda vaba inimese väärikat mõtet / Ando Kiviberg ; intervjueerinud Margus Haav ; kommenteerinud Toomas Sildam

    Index Scriptorium Estoniae

    Kiviberg, Ando, 1969-

    2010-01-01

    Intervjuu Eesti Vabariigi 92. aastapäeva kontserdi kunstilise juhi, Eesti pärimusmuusika keskuse juhatajaga. President Toomas Hendrik Ilvese ja proua Evelin Ilvese arvamust kontserdi kohta vahendab presidendi avalike suhete nõunik Toomas Sildam

  17. Istorija vnov aktualna / Aleksandr Tšaplõgin

    Index Scriptorium Estoniae

    Tšaplõgin, Aleksandr, 1964-

    2007-01-01

    Euroopa Nõukogu Parlamentaarse Assamblee president Rene van der Linden kritiseeris Eestit seoses Teises maailmasõjas Saksa poolel sõdinute kokkutulekuga Sinimägedes. Parlamendiliikmete Marko Mihkelsoni, Peeter Kreitzbergi, Evelin Sepa ja Vladimir Velmani arvamusi

  18. Puhta toidu eest

    Index Scriptorium Estoniae

    2010-01-01

    Proua Evelin Ilves andis Eesti Kulinaaria Instituudi nimel 14. jaanuaril 2010. a. rahvusvahelisel konverentsil "Food For Future Estonia" ühistule Eesti Mahe ja selle tegevdirektorile Jaan Nõmmikule üle esimese Tuleviku Toidu Tegija auhinna

  19. Kas madonnale disainitud dress lõpetas prügikastis? / Kais Allkivi, Katrin Pauts

    Index Scriptorium Estoniae

    Allkivi, Kais

    2009-01-01

    Viru keskuse Bastioni poes tulevad müügile 25 rahvusmustriga dressi, mis on peaaegu identsed esileedi Evelin Ilvese palvel Bastioni moedisaineri Merike Pääro poolt Madonnale disainitud spordirõivastega

  20. President koges sooja vastuvõttu / Sirje Veldi, Aime Vilu

    Index Scriptorium Estoniae

    Veldi, Sirje

    2007-01-01

    President Toomas Hendrik Ilvese ja proua Evelin Ilvese visiidist Elvasse. Presidendipaar külastas häirekeskust, Õnneseene lasteaeda, kohtus Valgutas Külaliikumise Kodukant Tartumaa eestvedajatega. Valguta külaselts kinkis presidendile leivast talu. Õnneseene lasteaias valis Evelin Ilves laste joonistuste seast välja Robin Sarapuu maalitud presidendi portree. Vabariigi President Jõgeva- ja Tartumaal 15.-16.02.2007

  1. Presidendipaar külastas New Yorgi Eesti Kooli / Kärt Ulman ; fotod: Riina Sõrra

    Index Scriptorium Estoniae

    Ulman, Kärt

    2010-01-01

    President Toomas Hendrik Ilves ja proua Evelin Ilves külastasid 25. septembril 2010 New Yorgi Eesti Kooli. Õhtusel vastuvõtul kohalikele eestlastele tutvustas president programmi "Talendid koju". Proua Evelin Ilvesel oli võimalus USA presidendi abikaasa Michelle Obama kutsel külastada mahefarmi Stone Barnsis. Töövisiit Ameerika Ühendriikidesse 20.-27.09.2010

  2. Kui raha on vaja, lendab ideoloogia prügikasti / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2009-01-01

    KPMG 2009. aasta maailma maksuülevaatest. Eesti käibemaksumäär on peaaegu võrdne EL-i keskmisega, kaudsete maksude suhtelt SKT-sse on Eesti samuti EL-i keskmisel tasemel. EL-i keskmisest kõrgem on Eestis aktsiisimaks. EL-is rakendatavatest pisimaksudest. Tabelid, diagrammid, graafikud

  3. Antimikrobiální peptidy z jedu divoce žijící včely odstraňují biofilm a působí synergicky s antibiotiky proti Pseudomonas aeruginosa

    Czech Academy of Sciences Publication Activity Database

    Nešuta, Ondřej; Monincová, Lenka; Voburka, Zdeněk; Bednárová, Lucie; Slaninová, Jiřina; Čeřovský, Václav

    2013-01-01

    Roč. 107, č. 5 (2013), s. 429-430 ISSN 0009-2770. [Mezioborové setkání mladých biologů, biochemiků a chemiků /13./. 14.5.2013-17.5.2013, Žďár nad Sázavou] Institutional support: RVO:61388963 Keywords : antimicrobial peptides * Pseudomonas aeruginosa * Staphylococcus aureus * synergism * biofilm Subject RIV: CE - Biochemistry

  4. Štúdium interakcií nových antimikrobiálnych peptidov izolovaných z jedu včely Panurgus calcaratus s fosfolipidovými vezikulami

    Czech Academy of Sciences Publication Activity Database

    Čujová, Sabína; Monincová, Lenka; Slaninová, Jiřina; Fučík, Vladimír; Voburka, Zdeněk; Čeřovský, Václav

    2012-01-01

    Roč. 106, č. 5 (2012), s. 419-419 ISSN 0009-2770. [Mezioborové setkání mladých biologů, biochemiků a chemiků /12./. 29.05.2012-01.06.2012, Počátky] R&D Projects: GA ČR GA203/08/0536 Institutional research plan: CEZ:AV0Z40550506 Keywords : antimicrobial peptides * liposome Subject RIV: CC - Organic Chemistry

  5. Prognózování peněžních toků pro účely finančního řízení

    OpenAIRE

    Potůček, Aleš

    2017-01-01

    The aim of the thesis is firstly to provide a definition of cash management in global corporations, secondly to analyse and assess various methods of cash forecasting. The first part of the thesis is dedicated to describing the nature of cash management and currently available tools for more effective and efficient financial management. In the following part, theoretical methods of cash forecasting are introduced, the best of which are subsequently applied on a model company through creation ...

  6. Termo-Reaktif Difüzyon Tekniği ile Cr-Al-N Kaplanmış AISI D2 Çeliğinin Aşınma Davranışı

    OpenAIRE

    KILINÇ, Bülent; ÇEĞİL, Özkan; ŞEN, Uğur; ŞEN, Şaduman

    2014-01-01

    In this work, the wear test of uncoated, nitrided, chromium aluminum nitride coated AISI D2 cold work tool steel against silicon nitride ball realized at 0.1 m/s sliding speeds and under the loads of 2.5N, 5N and 10N.Steel samples were nitrided at 575 °C for 8 h in the first step of the coating process, and then chromium aluminum nitride coating was performed thermo-reactive deposition technique (TRD) in a powder mixture consisting of ferro-chromium, aluminum, ammonium chloride, alumina and n...

  7. Sbírka kultur půdních aktinomycetů pro účely vyhledávání nejen polyketidových antibiotik manumycinového typu

    Czech Academy of Sciences Publication Activity Database

    Krištůfek, Václav; Chroňáková, Alica; Petrásek, Jiří; Elhottová, Dana; Beníšková, Petra; Hudecová, I.

    2007-01-01

    Roč. 48, - (2007), s. 227 ISSN 0009-0646. [Kongres Československé společnosti mikrobiologické /24./. 02.10.2007-05.10.2007, Liberec] Institutional research plan: CEZ:AV0Z60660521 Keywords : secondary metabolites * Streptomyces * catalogue of cultures Subject RIV: EH - Ecology, Behaviour

  8. Měření dohlednosti kamerou pro účely studia vlivu reálné atmosféry na přenos optického bezkabelového spoje

    Czech Academy of Sciences Publication Activity Database

    Brázda, V.; Fišer, Ondřej

    2013-01-01

    Roč. 2013, č. 1 (2013) ISSN 1802-4564 R&D Pro jects: GA ČR(CZ) GAP102/11/1376 Institutional support: RVO:68378289 Keywords : visibility * digital camera * free space optical link Subject RIV: DG - Athmosphere Sciences, Meteorology http://147.228.94.30/index.php?option=com_content&view=article&id=369:meni-dohlednosti-kamerou- pro -uely-studia-vlivu-realne-atmosfery-na-penos-optickeho-bezkabeloveho-spoje&catid=44:islo-12013&Itemid=51

  9. Eesti peab ütlema "jah!" / Ken-Marti Vaher, Urmas Reinsalu

    Index Scriptorium Estoniae

    Vaher, Ken-Marti, 1974-

    2003-01-01

    Justiitsminister Ken-Marti Vaher ja parlamendiliige Urmas Reinsalu analüüsivad EL-i põhiseaduslikku korda ja esitavad seisukohad, mida Eesti peab ütlema valitsustevahelisel konverentsil EL-i föderaliseerumise vastu

  10. Jump-starting Europe to surpass America

    Index Scriptorium Estoniae

    2003-01-01

    EL-i kahepäevasel tippkohtumisel Brüsselis tegid Euroopa riikide liidrid avalduse majanduse hoogustamisest ja toetasid Euroopa Komisjoni ettepanekut suurendada EL-i investeeringuid transporti, energeetikasse ja teadusesse

  11. Olulised on kokkulepped Euroopa vaesema ja rikkama osa vahel / Viktor Sartakov ; interv. Tiia Truu

    Index Scriptorium Estoniae

    Sartakov, Viktor, 1947-

    2002-01-01

    Eestimaa Tootjate Keskliidu juhatuse esimees Viktor Sartakov osalemisest Kopenhaagenis EL-i Põllumajandusorganisatsioonide Komitee (COPA) ja Põllumajandusühistute Peakomitee (COGECA) toimkondade töös, EL-i liikmesmaade suhtumisest kandidaatriikidesse, EL-iga liitumise kasust, ohtudest

  12. Pooled eurooplased annavad euroliidule skeptilise hinnangu / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2006-01-01

    Ligi 25 000 inimest hõlmanud Eurobaromeetri uuringu "Euroopa tulevik" kohaselt arvab vaid 39%, et EL liigub õiges suunas, vaid 29% lätlastest peab EL-i kuulumist heaks. Lisa: Eestlased: EL-i suund on õige

  13. Euroopa Liit hakkab võitlema antisemitismiga / Margo Pajuste

    Index Scriptorium Estoniae

    Pajuste, Margo

    2004-01-01

    EL-i konverentsil, kus osalesid Euroopa Komisjon, Euroopa Juudikongress ja Euroopa Rabide Kongress, kutsus Romano Prodi EL-i riikide valitsusi üles kiitma heaks komisjoni ettepanekut võtta vastu rassismi- ja ksenofoobiaseadus

  14. Free movement or benefit tourism: the unreasonable burden of Brey / Herwig Verschueren

    Index Scriptorium Estoniae

    Verschueren, Herwig

    2014-01-01

    ELi direktiivist 2004/38, mis käsitleb ELi kodanike ja nende pereliikmete õigust liikuda ja elada vabalt liikmesriikide territooriumil. Määrusest 883/2004 sotsiaalkindlustussüsteemide kooskõlastamise kohta. Euroopa Kohtu praktikast

  15. Kesk-Euroopa on Euroopa Liidu tähtis kaubanduspartner / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    1999-01-01

    Kaubandusest Euroopa riikide ja Euroopa Liidu liikmesriikide vahel. Joonised: Kesk-Euroopa maade ekspordi ja -impordipartnerid, ELi eksport-import, ELi riikide väliskaubandus Kesk- ja Ida-Euroopa riikidega

  16. USA ja EL vähendavad kaubandustõkkeid / Kertu Ruus

    Index Scriptorium Estoniae

    Ruus, Kertu, 1977-

    2005-01-01

    Tippkohtumisel Washingtonis arutasid Euroopa Komisjoni president Jose Manuel Barroso ja USA president George W. Bush, kuidas EL-i ja USA majandussuhteid vabamaks muuta. Diagramm: EL-i kaubavahetus USA-ga

  17. Eurosaadikud ootavad CIA lendude uurimist / Triin Oppi

    Index Scriptorium Estoniae

    Oppi, Triin

    2007-01-01

    Euroopa Parlament mõistis hukka EL-i 14 liikmesriigi koostöö USA Luure Keskagentuuriga. Ebaseaduslike kinnipidamisasutuste probleemist EL-i liikmesriikide territooriumil. Kuubal Guantanamos asuva USA sõjaväelaagri sulgemise nõudest

  18. Euroopa Liit läks Kosovo tunnustamise osas lõhki / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2008-01-01

    Euroopa Liidu välisministrite kohtumisel ei saavutatud üksmeelt Kosovo tunnustamises. EL-i avalduse kohaselt langetab iga EL-i liikmesriik suhete loomise otsuse ise. Lisa: Kosovo jäetakse ukse taha

  19. EU commissioner says Gazprom won't be exception to trade rules

    Index Scriptorium Estoniae

    2007-01-01

    EL-i konkurentsivolinik Neelie Kroes hoiatas, et Gazprom võib loovutada oma osakud Baltimaade energiaettevõtetes ja Läänemere gaasijuhtmes, kui EL-i liikmesriigid võtavad vastu uue strateegilise energiaplaani, mis edendab konkurentsi

  20. 77 FR 31722 - New Animal Drugs; Change of Sponsor; Estradiol; Estradiol Benzoate and Testosterone Propionate...

    Science.gov (United States)

    2012-05-30

    ..., Division of Eli Lilly & Co. DATES: This rule is effective May 30, 2012. FOR FURTHER INFORMATION CONTACT... this table to Elanco Animal Health, Division of Eli Lilly & Co., Lilly Corporate Center, Indianapolis...

  1. Rauno Pukonen : Meie toodangut armastatakse, meid endid mitte / Rauno Pukonen ; interv. Svea Talving

    Index Scriptorium Estoniae

    Pukonen, Rauno

    2004-01-01

    Farmaatsiafirmast Eli Lilly, ravimifirmade madalast mainest. Eli Lilly filiaali juhi sõnul ei lase väike turg ja tagasihoidlik kompensatsioon võimalikku ravimivalikut Eestisse tuua. Lisa: Fakte ettevõttest

  2. Nashihh negrazhdan hotjat sdelat jevropeitsami / Valentin Zvegintsev

    Index Scriptorium Estoniae

    Zvegintsev, Valentin

    2004-01-01

    Brüsselis toimunud konverentsil "Venekeelne elanikkond laienenud EL-is" tõstatus küsimus partei loomise kohta venekeelse elanikkonna huvide kaitsmiseks EL-is. Eesti delegatsioon tutvustas partei programmi

  3. Die ReNEUAL Model Rules 2014: Ein Verwaltungsverfahrensrecht für Europa / Jens-Peter Schneider, Herwig C. H. Hofmann, Jacques Ziller

    Index Scriptorium Estoniae

    Schneider, Jens-Peter

    2015-01-01

    1. septembril 2014 avaldas Euroopa Liidu haldusõiguse uurimisvõrgustik (ReNEUAL) ELi halduskorra näidiseeskirjad mis aitavad ELi institutsioonidel toimida ausalt, läbipaistvalt, tõhusalt ja avatult

  4. Presidendipaaril on suurepärane tervis! / Oliver Rand

    Index Scriptorium Estoniae

    Rand, Oliver, 1971-

    2007-01-01

    President Toomas Hendrik Ilves ja proua Evelin Ilves testisid Hiiumaa tervisetoas oma tervist, lõunatasid Rannapaargus, külastasid Hiiumaa teavitamis- ja nõustamiskeskust, puuetega inimeste käsitööseltsi Sipeko Kõrgessaares, Emmaste Dale LD plastitööstust ja Vaemla villavabrikut. Avalikul kõnekoosolekul Kassaris väitlesid T.H. Ilves ja helilooja Erkki-Sven Tüür lavastaja Jaanus Rohumaa juhtimisel teemal "Eurooplaste identiteet". Vt. samas: Vasli, Karoliina. Evelinil Victoria Beckhami soeng. Proua Evelin Ilvese soengutest läbi aastate. Vabariigi President Hiiu- ja Saaremaal 8.-10.08.2007

  5. Kuninganna Silvia leidis aega ka lastele / Vilja Kohler

    Index Scriptorium Estoniae

    Kohler, Vilja, 1966-

    2007-01-01

    Rootsi kuninganna Silvia pani nurgakivi rootslaste ja eestlaste sihtasutuse Eesti Agrenska Fond poolt Tartu valda Tammistu mõisasse rajatavale puuetega laste perekeskusele. Kuningannat saatis proua Evelin Ilves, kes hakkas Eesti Agrenska Fondi patrooniks. Eesti Agrenska Fond kinkis Rootsi kuningannale ja proua E. Ilvesele eritellimusel kunstnik Piret Veski valmistatud keraamilised taldrikud, mille on kujutatud armastust, truudust ning kaitset sümboliseeriv jumalaema. Proua E. Ilves pani kingitud raamatuga aluse perekeskuse raamatukogule. Juuresoleval fotol kuninganna Silvia ja proua Evelin Ilves koos Reiniku gümnaasiumi poistekooriga

  6. Kriitikat pälvinud EL nõus langetama põllumajandustolle / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2005-01-01

    EL-i kaubandusvolinik Peter Mandelson pakkus EL-i kaubanduspartneritele, et EL kärbib tariife keskmiselt 46% võrra. Prantsusmaa on EL-i põllumajandustollide vähendamise vastu. USA tahab, et EL vähendaks oma tariife 55-90%. Lisa: WTO nõuab EL-ilt suhkrureformi

  7. Euroopa Liidu palkadest / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2001-01-01

    Euroopa Liidu elustandardi analüüs palkade põhjal. Tabelid: EL-i maade keskmine tunnipalk majandusharude järgi eurodes; EL-i madalapalgaliste üldine tase ja nende liigitus põhjuste järgi %-des; EL-i madalapalgaliste osakaalu jagunemine ja selle tõenäosus; Saksamaa Liitvabariigi palgad 1996-2000

  8. Vähem arenenud piirkonnad Euroopas / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    1999-01-01

    Missugused on majanduslikud erinevused EL-i riikide ja piirkondade vahel ning erinevus Eestiga. Kas EL-is on regionaalse arenguga probleeme, kas seal on majanduslikult mahajäänud piirkondi. Tabelid: ELi riikide SKP jooksvates hindades ostujõu pariteedi järgi; suuremad SKP-d ühe inimese kohta regiooni järgi, kui EL=100%

  9. Euroopa Liidu välisinvesteeringud / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2001-01-01

    Ilmunud ka: Buhgalterskije Novosti, nr. 6, 2001, lk. 42-47. Euroopa Liidu ühisturu kujunemisest ja välisinvesteerigute liikumisest. Tabel ja diagrammdi: EL-i välismaised otseinvesteeringud; EL-i liikmesriikide välismaale tehtud otseinvesteeringute pingerida; EL-i investeeringute suhe SKT-sse 1995-2000

  10. We're doing all right, but what about you?

    Index Scriptorium Estoniae

    2003-01-01

    Vaatamata sellele, et EL-i kandidaatriigid, võrreldes praeguste liikmesriikidega on vaesed, hakkavad nad samuti tasuma liikmemaksu EL-iga liitumisel 2004. aasta mais ning seeläbi andma ise abi teistele riikidele. Diagramm: SKP 15 EL-i liikmesriigis ja 8 EL-i kandidaatriigis aastal 2002.

  11. 76 FR 16445 - In the Matter of Certain Gemcitabine and Products Containing Same; Notice of Investigation

    Science.gov (United States)

    2011-03-23

    ... Act of 1930, as amended, 19 U.S.C. 1337, on behalf of Eli Lilly and Company of Indianapolis, Indiana. Eli Lilly filed letters supplementing the complaint on February 9 and 16, 2011. The Commission requested additional information on March 2, 1011. Eli Lilly responded with additional information...

  12. An Integrated Approach to Control Soil-Transmitted Helminthiasis, Schistosomiasis, Intestinal Protozoa Infection, and Diarrhea: Protocol for a Cluster Randomized Trial.

    Science.gov (United States)

    Raso, Giovanna; Essé, Clémence; Dongo, Kouassi; Ouattara, Mamadou; Zouzou, Fabien; Hürlimann, Eveline; Koffi, Veronique A; Coulibaly, Gaoussou; Mahan, Virginie; Yapi, Richard B; Koné, Siaka; Coulibaly, Jean Tenena; Meïté, Aboulaye; Guéhi-Kabran, Marie-Claire; Bonfoh, Bassirou; N'Goran, Eliézer Kouakou; Utzinger, Jürg

    2018-06-12

    chemotherapy, community-led total sanitation, and health education against infections with soil-transmitted helminths, schistosomes, an intestinal protozoa and prevention of diarrhea in a rural part of Côte d'Ivoire. The research provided new insights into the acceptability, strengths, and limitations of an integrated community-based control package targeting helminthiases, intestinal protozoa infections, and diarrhea in rural communities of Côte d'Ivoire. In the longer term, the study will allow determining the effect of the integrated control approach on infection patterns with parasitic worms and intestinal protozoa, diarrheal incidence, anthropometric measures, and hygiene-related knowledge, attitudes, practices, and beliefs. International Standard Randomized Controlled Trial Number (ISRCTN): 53102033; http://www.isrctn.com/ISRCTN53102033 (Archived by WebCite at http://www.webcitation.org/6wpnXEiHo). RR1-10.2196/9166. ©Giovanna Raso, Clémence Essé, Kouassi Dongo, Mamadou Ouattara, Fabien Zouzou, Eveline Hürlimann, Veronique A Koffi, Gaoussou Coulibaly, Virginie Mahan, Richard B Yapi, Siaka Koné, Jean Tenena Coulibaly, Aboulaye Meïté, Marie-Claire Guéhi-Kabran, Bassirou Bonfoh, Eliézer Kouakou N'Goran, Jürg Utzinger. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 12.06.2018.

  13. Learning, Adjustment and Stress Disorders: With Special Reference to Tsunami Affected Regions. Beitrage zur Padagogischen und Rehabilitationspsychologie. Volume 1

    Science.gov (United States)

    Witruk, Evelin, Ed.; Riha, David, Ed.; Teichert, Alexandra, Ed.; Haase, Norman, Ed.; Stueck, Marcus, Ed.

    2010-01-01

    This book contains selected contributions from the international workshop Learning, "Adjustment and Stress Disorders--with special reference to Tsunami affected Regions" organised by Evelin Witruk and the team of Educational and Rehabilitative Psychology at the University of Leipzig in January 2006. The book contains new results and the…

  14. Eesti aukonsulid tegid puudega laste toetusfondile annetuse

    Index Scriptorium Estoniae

    2008-01-01

    Ingl. k. lk. 13, pealk.: Consuls support special needs kids. Peaminister Andrus Ansip andis lastekaitsepäeval, 1. juunil 2008 puudega lapsi toetavale Agrenska Fondile üle Eesti aukonsulite 30 000 krooni suuruse annetuse. Agrenska Fondi patroon Rootsis on kuninganna Silvia ja Eestis proua Evelin Ilves

  15. Japan is far... / Peeter Miller

    Index Scriptorium Estoniae

    Miller, Peeter

    2007-01-01

    Eesti suursaadik Jaapanis Eesti ja Jaapani suhete ajaloost, Jaapani keisri Akihito ja keisrinna Michiko ametlikust visiidist Eestisse 2007. a. mais. Juuresolevatel fotodel president Toomas Hendrik Ilves ja proua Evelin Ilves kõrgeid külalisi vastu võtmas

  16. Factory conversion, Tallinn : ARS Projekt converted a 20th-century factory into homes with a veneer of history / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2009-01-01

    Endise Tallinna vineeri- ja mööblivabriku hooned ehitati ümber korterelamuks. Projekteeris ARS Projekt (Eero Jürgenson, Rasmus Tamme, Jaanus Saarepera, Andrei Pleskatsjov, Evelin Eelma). Vabrik ehitati 1912. aastal vene arhitektide Aleksei Bubõri ja Nikolai Vassiljevi projekti järgi

  17. President Ilves New Yorgi eestlaskonnale : vaadake "Talendid koju" programmi kui võimalust

    Index Scriptorium Estoniae

    2010-01-01

    President Toomas Hendrik Ilves ja proua Evelin Ilves külastasid 25. septembril 2010 New Yorgi Eesti Majas tegutsevat Eesti kooli ja osalesid New Yorgi eestlaskonnale korraldatud vastuvõtul. Ilmunud ka: Meie Kodu 6. okt. 2010, lk. 2, pealk.: President Ilves kutsus New Yorgi eestlasi kodumaale tagasi. Töövisiit Ameerika Ühendriikidesse 20.-27.09.2010

  18. Triumfalnoje vozvrashtshenije 60-h / Airika Soome, Jaanika Sootna, Merike Pääro...[jt.] ; interv. Valeria Aru

    Index Scriptorium Estoniae

    2007-01-01

    Eesti tuntuimate kaubamärkide PTA, Monton, Bastion, Ivo Nikkolo ja Mosaic moekunstnike nägemused moest kevad-suveks 2007. PTA - Airika Soome, Monton - Jaanika Sootna, Bastion - Merike Pääro, Ivo Nikkolo - Eve Hanson ja Mosaic - Evelin Lill

  19. Kontrastõ ot Baltika Grupp / Jana Kuvaitseva

    Index Scriptorium Estoniae

    Kuvaitseva, Jana

    2007-01-01

    Eesti rõivatootja Baltika Grupp uutest sügis-talvistest kollektsioonidest räägivad Montoni kaubamärgi disainerid Jaanika Sootna ja Evelin Lill ning Ivo Nikkolo kaubamärgi disainer Eve Hanson. Baltika kaubamärgid on Monton, Mosaic, Baltman ja Ivo Nikkolo

  20. Osennaja moda : tshornõm-tshorno

    Index Scriptorium Estoniae

    2008-01-01

    Baltika kaubamärkide Monton, Ivo Nikkolo, Baltman ja Mosaic moekollektsioonidest sügiseks 2008. Tutvustavad Montoni naisterõivatse disainer Jaanika Sootna ning meesterõivaste disainer Jaana Varkki, Ivo Nikkolo disainer Eve Hanson, Baltmani disainer Erkki Engso ja Mosaici naisterõivaste disainer Evelin Lill ning meesterõivaste disainer Merle Lõhmus. Värvifotod

  1. Lastekaitsepäeval avati Põltsamaal SOS-peremajad / Raivo Feldmann

    Index Scriptorium Estoniae

    Feldmann, Raivo

    2010-01-01

    Eesti teise SOS Lasteküla ametlikul avamisel Põltsamaal 1. juunil 2010. a. osalesid ka Norra suursaadik Eestis Stein Vegard Hagen ja SOS Lasteküla patroon proua Evelin Ilves. Presidendi abikaasa kinkis igale perele pereõunapuu ja koos kirjastusega Varrak igale peremajale väikese koduraamatukogu

  2. Pervaja ledi, Afrika i skeletõ / Marina Mironova

    Index Scriptorium Estoniae

    Mironova, Marina

    2006-01-01

    Endine põllumajandusminister Ivari Padar loodab, et presidendiks valitud Toomas Hendrik Ilves suudab maaelu arengusse uusi tuuli tuua, presidendi abikaasa Evelin Ilves peab oma edaspidisteks kohustusteks tegelda heategevusega, hoolitseda oma pere eest ning jääda presidendi kõrval tahaplaanile

  3. Minsk ja RAM 7 / Evelyn Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Evelyn

    2005-01-01

    Minskis toimunud RAM 7-st (Reapproaching New Media. Models of Collaboration / Ümberhinnates uut meediat. Koostöömudelid". Korraldajad Tatjana Dushina ja Denis Romanovski üritavad luua uue meedia keskust Valgevene kunstiakadeemiasse. Eestit esindasid Evelin Müürsepp ja John Grzinich (modereeris vabade ülikoolide kursust). Osalemisest fotomängus "FotoOhota"

  4. Presidendi külalismaja avatakse turistidele märtsis / Kadri Paas

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2007-01-01

    President Toomas Hendrik Ilvese ja proua Evelin Ilvese Ärma talu- ja puhkekompleks Erma Park Abja-Paluoja naabruses avatakse külalistele 2007. a. märtsis. Külaliste toad kannavad tuntud ajalooliste ühiskonna- ja kultuuritegelaste nimesid

  5. Lahkus juhmi Hundi ja kavala Jänese looja / Andri Maimets, Marko Lillemägi

    Index Scriptorium Estoniae

    Maimets, Andri, 1979-

    2006-01-01

    Suri vene animakunstnik, kuulsate tegelaskujude - Hundi ja Jänese looja joonisfilmisarjas (1969-1986) "Oota sa!" ("Nu, pogodi!") Svetozar Russakov (sünd. 3.04.1923). Filmi omaaegset mõju meenutab Rein Raamat. Kommenteerivad Raivo Järvi, Hendrik Normann, Ain Nurmela, Marika Korolev, Evelin Samuel

  6. Buenos dias, estonios! Hispaania kuningapaar lehvitas Raekoja platsil tallinlastele

    Index Scriptorium Estoniae

    2009-01-01

    Hispaania kuninga Juan Carlos I ja kuninganna Sofia riigivisiidist Eestisse. Kuningas külastas koos president Toomas Hendrik Ilvesega NATO Kooperatiivse Küberkaitse Kompetentsikeskust ja Stenbocki maja. Proua Evelin Ilves ja kuninganna Sofia käisid Olde Hansas ja Niguliste kirikus ning peatusid Saiakangi all Kehrwiederi kohvikus

  7. Hispaania kuningapaar pühendas osa külaskäiguajast kohtumistele kohaliku rahvaga

    Index Scriptorium Estoniae

    2009-01-01

    Hispaania kuninga Juan Carlos I ja kuninganna Sofia riigivisiidist Eestisse. Külalisi võõrustasid president Toomas Hendrik Ilves ja proua Evelin Ilves. Fotod pidulikult õhtusöögilt rahvusooper Estonia kontserdisaalis, jalutuskäigult Tallinna vanalinnas ja külaskäigust Eesti Lastekirjanduse Keskusse

  8. President võõrustas Hispaania kuningapaari kilu ja šokolaadiga / Allar Viivik

    Index Scriptorium Estoniae

    Viivik, Allar

    2009-01-01

    President Toomas Hendrik Ilves ja proua Evelin Ilves võtsid 4. mail 2009 Kadriorus vastu Eestisse riigivisiidile saabunud Hispaania kuninga Juan Carlos I ja kuninganna Sofia. Õhtul andis presidendipaar Estonia kontserdisaalis kuninga visiidi auks riikliku õhtusöögi

  9. Eesti Energia võttis elektri salaja ära : elektritarbija, kellel jäi kord enda süül, siis aga panga, Eesti Energia ja tarbija enda vahelise arusaamatuse tõttu elektri eest tasumata, leidis end ootamatult elektrita jäetuna / Kai Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Kai

    2003-01-01

    Otsekorralduslepinguga elektriarve tasumata jätnud kliendilt elektri väljalülitamisest. Kommenteerivad Eesti Energia pressiesindaja Riina Vändre, tarbijakaitseameti pressiesindaja Kristina Vaksmaa, Hansapanga Eesti meediasuhete juht Kristiina Tamberg ja Eesti Ühispanga pressiesindaja Evelin Pull

  10. Welcome to Estonia märk on kaotanud oma sära / Kadi Heinsalu

    Index Scriptorium Estoniae

    Heinsalu, Kadi, 1966-

    2004-01-01

    Ettevõtluse Arendamise Sihtasutus loodab parandada Welcome to Estonia märgi mainet. Märki kasutavad ettevõtjad ei näe märgist olulist kasu toodete müügil. Kommenteerivad Evelin Int-Lambot, Leena Murd ja Olaf Merisalu

  11. Presidendi kantseleile müüs vaibad PR-firma / Ingvar Bärenklau

    Index Scriptorium Estoniae

    Bärenklau, Ingvar, 1967-

    2007-01-01

    Presidendi kantseleile müüs hinnalised Türgi vaibad proua Evelin Ilvese tuttava, ajakirjanik Svea Talvingu firma ISP Factum, mille tegevusala on hoopis suhtekorraldus. Selgitavad presidendi avalike suhete nõunik Toomas Sildam ja presidendi kantselei sisekujundusega tegelev Ivi-Els Schneider

  12. Lõpuks ometi midagi tarka! / Ago-Endrik Kerge

    Index Scriptorium Estoniae

    Kerge, Ago-Endrik, 1939-

    2009-01-01

    Lavastajast autor pakub humoorikaid lahendusi presidendi iseseisvuspäeva vastuvõtu kätlemistseremoonia tõhustamiseks. Vastukaja artiklile: Ilves, Evelin. Muutused on möödapääsmatud. Postimees 10. märts 2009, lk. 12, kus presidendi abikaasa pidas vajalikuks piirata ajakirjanduse juurdepääsu presidendi iseseisvuspäeva vastuvõtule

  13. An assessment of the supply chain management for HIV/AIDS care ...

    African Journals Online (AJOL)

    An assessment of the supply chain management for HIV/AIDS care and treatment in Kilombero and Ulanga districts in Tanzania. Daniel S. Nyogea, Halfan Said, Godfrey Mwaigomole, Marcel Stoeckle, Ingrid Felger, Christoph Hatz, Lars Henning, Fabian Franzeck, Emilio Letang, Eveline Geubbels ...

  14. Moda vernulas v Tallin / Marina Poltavtseva

    Index Scriptorium Estoniae

    Poltavtseva, Marina

    2005-01-01

    Tallinnas Viru Keskuses toimuvast moeürituste sarjast FIBIT. Keskne sündmus on Kuldnõela nominentide Katrin Kuldma, Tiina Talumehe, Thea Pilveti ja Evelin Lille kollektsioonide esitamine. Lisas "Primetshai marku!" juttu moekunstnik Oksana Tanditi uuest kollektsioonist, mida näidatakse ka Viru keskuses

  15. Kuulsuste keeruline elu : [anekdoodid] / Toomas Kall ; karikatuur: Rein Lauks

    Index Scriptorium Estoniae

    Kall, Toomas, 1947-

    2014-01-01

    Anekdoodid järgmistest kuulsustest: Luisa Värk, Taavi Rõivas, Ardo Hansson, Bill Gates, Nicolas Sarkozy, Dmitri Medvedev, Edgar Savisaar, Vladimir Putin, Anton Vaino, Astrid Kannel, Viktor Janukovitš, Evelin Ilves, Toomas Hendrik Ilves, Jürgen Ligi, Urve Palo, Indrek Tarand

  16. Kleit Evelinile / Britt Rosen

    Index Scriptorium Estoniae

    Rosen, Britt, 1968-

    2009-01-01

    Moekunstnikud Aldo Järvsoo, Kirill Safonov, Anu Samarüütel-Long, Anu Hint, Reet Aus, Anne Metsis, Xenia Jedomskihh, Kätlin Kaljuvee ja Mari Aakre joonistasid proua Evelin Ilvesele vabariigi aastapäeva vastuvõtuks õhtukleidi

  17. Eurohindu tuleb näidata enne kursi selgumist / Väinu Rozental

    Index Scriptorium Estoniae

    Rozental, Väinu, 1957-

    2010-01-01

    1. juulist tuleb avaldada kaupade ja teenuste hinnad nii kroonides kui ka eurodes. Arvamust avaldavad Eesti Kaupmeeste Liidu tegevdirektor Marika Merilai, ASi Rimi Eesti Food turundusjuht Evelin Mägioja ja OÜ Maxima Eesti brändi ja kommunikatsiooni osakonna direktor Ty Lehtmäe

  18. Rikkad lõvid korjasid toidupoes kroonikaupa miljoni

    Index Scriptorium Estoniae

    2008-01-01

    Pärnu kontserdimajas toimunud Lions-liikumise aastaballil annetasid Eesti Lions-klubide esindajad heategevuskampaania "Saa nägijaks!" raames kogutud 1,43 miljonit krooni pimedatele lastele ja noortele. Tänusõnad ütles ettevõtmise aupatroon proua Evelin Ilves

  19. Loomad räägivad sel korral eesti keeles / Jaanus Noormets

    Index Scriptorium Estoniae

    Noormets, Jaanus

    2008-01-01

    Arvutiga animeeritud USA koguperefilmist "Madagaskar 2" (Madagascar: Escape 2 Africa), mis jõuab Eesti kinodesse erinevalt filmisarja esimesest osast eesti keelde dubleerituna (loomtegelastele on oma hääle laenanud Karol Kuntsel, Andero Ermel, Evelin Pang, Mait Malmsten, Raivo E. Tamm, Andrus Vaarik jt)

  20. Lutheri mööblivabriku renoveerimine korterelamuks = Renovation of the Luther furniture factory into an apartment building / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2009-01-01

    Tallinnas Vana-Lõuna 39 ja 39a asuva hoone (Aleksei Bubõr, Nikolai Vassiljev, 1912) muinsuskaitse eritingimused koostas Monika Eensalu, vastutav arhitekt Rasmus Tamme, arhitektid Andrei Pleskatšov, Jaanus Saarepera ja Evelin Eelma, sisearhitektid Reio Raudsepp, Eero Jürgenson (projektijuht) ja Liina Kink. Žürii hinnang kultuurkapitali aastapreemiale esitatud hoonele

  1. President Ilves sõidab Bakuusse

    Index Scriptorium Estoniae

    2009-01-01

    President Toomas Hendrik Ilves ja proua Evelin Ilves sõidavad 12. jaanuaril 2009 Aserbaidžaani riigipea Ilham Alijevi kutsel ametlikule visiidile Bakuusse. Vt. ka lk. 10: Soonvald, Urmo. Aserbaidžaani mõju. Autor meenutab, et Aserbaidžaanis pole demokraatiat ega sõnavabadust, kuid riik on maailmale oluline oma maavarade tõttu

  2. Tallinna Kunstihoone, Bajozi Veinikelder ja AS Kiil & Co kuulutasid käesoleva aasta sügisel välja multiplitseeritava kunstiteose

    Index Scriptorium Estoniae

    2005-01-01

    Žürii (liikmed loetletud) valis välja Merike Estna, Maksim Surini, Andres Lõo, Evelin Kuusiku, Kärt Ojavee ja Aadam Kaarma teosed. Auhinnasaajate järjekord ja preemiad tehakse teatavaks konkursitööde näituse "Mitmik" avamisel Tallinna Kunstihoone galeriis 8. XII

  3. Eestlaste (uskumatud) seiklused Handimaal / Anzori Barkalaja

    Index Scriptorium Estoniae

    Barkalaja, Anzori, 1968-

    2008-01-01

    Eesti delegatsiooni osalemisest soome-ugri rahvaste V maailmakongressil Hantõ-Mansiiskis, Venemaa presidendi Dmitri Medvedevi ja Vene Riigiduuma väliskomisjoni esimehe Konstantin Kossatshovi esinemisest kongressil. Juuresoleval fotol president Toomas Hendrik Ilves, proua Evelin Ilves ja Venemaa president Dmitri Medvedev. Vabariigi President töövisiidil Venemaal 27.-30.06.2008

  4. Tuuli Koch : SL Esileedi / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2008-01-01

    President Toomas Hendrik Ilvese väitel häirib teda kollase ajakirjanduse kasvav mõju. Proua Evelin Ilvese tegevust kajastatakse pidevalt kollases ajakirjanduses. Kui Postimees on püüdnud proua E. Ilveselt saada kommentaare tõsisematel teemadel, on põrkutud presidendi kantselei vastuseisule. Presidendi kantselei avalike suhete nõuniku Toomas Sildami kommentaaridest

  5. Ilon Wiklandi Imedemaa muudab tagasi lapseks / Janar Ala

    Index Scriptorium Estoniae

    Ala, Janar, 1979-

    2009-01-01

    Haapsalus avati 1. juulil 2009. a. lastepärane teemakeskus Iloni Imedemaa, kus saab tutvuda raamatuillustraatori Ilon Wiklandi kujutatud tegelastega. Avamisel viibis ka proua Evelin Ilves koos tütre Kadri Keiuga. Samal teemal ka "Pildi sisse: Iloni Imedemaa avab tee kunstniku loomingusse" lk. 1. Fotod sündmusest vt. ka: Postimees : Arter 4. juuli 2009, lk. 16, pealk.: Imedemaa Haapsalus

  6. The social side of noise annoyance

    NARCIS (Netherlands)

    Maris, Eveline

    2008-01-01

    Unfairness increases noise annoyance Noise annoyance increases due to unfair sound management. Fair sound management reduces annoyance, however only when the sound pressure level is high, concludes Eveline Maris based on two laboratory experiments. Being exposed to man-made sound is more than

  7. Come home, says Ilves

    Index Scriptorium Estoniae

    2010-01-01

    President Toomas Hendrik Ilves ja proua Evelin Ilves külastasid 25. septembril 2010. a. New Yorgi Eesti Majas tegutsevat Eesti kooli ja osalesid New Yorgi eestlaskonnale korraldatud vastuvõtul, kus riigipea tutvustas programmi "Talendid koju". Töövisiit Ameerika Ühendriikidesse 20.-27.09.2010

  8. A new Syndesmis from Saint-Barthélemy, Lesser Antilles (Neorhabdocoela)

    NARCIS (Netherlands)

    Marcus, Ernst

    1968-01-01

    Mrs. EVELINE DU BOIS-REYMOND MARCUS found the turbellarian described below, which belongs to the Umagillidae (Neorhabdocoela, Dalyellioida), in a vial of Dr. P. WAGENAAR HUMMELINCK’S collection of Caribbean polyclads. The species of Syndesmis are known to live in the body cavity and the intestine,

  9. Effect of water electrolysis temperature of hydrogen production system using direct coupling photovoltaic and water electrolyzer

    Directory of Open Access Journals (Sweden)

    Tetsuhiko Maeda

    2016-01-01

    Full Text Available We propose control methods of a photovoltaic (PV-water electrolyzer (ELY system that generates hydrogen by controlling the number of ELY cells. The advantage of this direct coupling between PV and ELY is that the power loss of DC/DC converter is avoided. In this study, a total of 15 ELY cells are used. In the previous researches, the electrolyzer temperature was constantly controlled with a thermostat. Actually, the electrolyzer temperature is decided by the balance of the electrolysis loss and the heat loss to the outside. Here, the method to control the number of ELY cells was investigated. Maximum Power Point Tracking efficiency of more than 96% was achieved without ELY temperature control. Furthermore we construct a numerical model taking into account of ELY temperature. Using this model, we performed a numerical simulation of 1-year. Experimental data and the simulation results shows the validity of the proposed control method.

  10. The prognosis significance and application value of peritoneal elastic lamina invasion in colon cancer.

    Science.gov (United States)

    Lu, Jun; Hu, Xiumei; Meng, Yutong; Zhao, Hongying; Cao, Qing; Jin, Mulan

    2018-01-01

    The aims of this study were to evaluate the associations between peritoneal elastic lamina invasion (ELI) and the clinicopathological prognostic factors of colon cancer, to evaluate the feasibility of ELI with use of an elastic stain to help diagnose serosal invasion of colon cancer in routine practice, so as to help us to provide a more accurate estimate for prognosis and stage of patients and a marker for postoperative treatment. 254 cases with colon cancer were included in the study. According to the presence of elastic lamina (EL) and elastic lamina invasion (ELI), all cases were divided into four groups: pT3 EL negative (pT3 EL (-)), pT3 ELI positive (pT3 ELI (+)), pT3 ELI negative (pT3 ELI (-)) and pT4a. Statistical analysis was used to analyze the relationship between elastic lamina invasion and other established adverse histologic features. The EL and ELI positive rates were 81.5% and 42.1% respectively. There were significant differences in mph node metastasis, venous invasion and tumor buds between pT3 ELI (-) and pT3 ELI (+), pT3 ELI (-) and pT4a. There was no significant difference in same factors between pT3 ELI (+) and pT4a. In pT3 stage, there were significant differences in lymph node metastasis, perineural invasion and tumor buds between EL (-) and ELI (+). There were no significant differences in same factors between EL (-) and ELI (-). EL was detected less frequently in right-sided tumors compared with left-sided tumors. ELI might be the prognostic factors of colon cancer with II stage and might be the marker of postoperative adjuvant chemotherapy. Patients with pT3 ELI (+) might have similar prognosis to patients with pT4a. For patients with pT3 colon cancer, EL(-) might have similar prognosis as ELI (-) and might take the same therapy. In addition, the right half colon EL positive rate was lower than the left colon. Elastic staining might be a useful tool to help determine the invasive depth and stage of colon cancer.

  11. Euroopa Liidu teadus ja tehnoloogia / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2001-01-01

    Ilmunud ka: Buhgalterskije Novosti, nr. 7, 2001, lk. 42-47. Euroopa Liidu teaduse ja tehnoloogia areng ja hetkeseis. Tabelid ja diagrammid: töötajate arv EL-i kõrgtehnoloogia majandusharudes ja teadusintensiivses teeninduses; EL-i regioonide uurimis-arengutöödele tehtud kulutused ning patentide arv; EL-i regioonide kõrgtehnoloogia edetabel 1997; uurimis- ja arendustöödele tehtud riiklikud kulutused SKP-st 1998; teaduse ja tehnoloogia inimressursid 1999

  12. Eesti vajab kiiresti euroabi vastuvõtmise kava / Rupinder Singh

    Index Scriptorium Estoniae

    Singh, Rupinder

    2003-01-01

    Autor leiab, et EL-i liikmelisus annab võimaluse püsivaks ja õiglaseks majanduskasvu koefitsiendiks, kuid vaid juhul, kui potentsiaalsed võimalused ära kasutatakse. Ta rõhutab tugeva poliitilise juhtimise ja strateegilise planeerimise vajalikkust valmistamaks ette infrastruktuuri EL-i rahade kasutamiseks. Samas pole Baltimaades tema hinnangul hetkel isegi piisavalt inimesi EL-i finantsvoogude suure potentsiaaliga tegelemiseks.

  13. Javier Solana: Euroopa peab tugevdama oma sõjalist võimsust / Javier Solana ; interv. Urmet Kook

    Index Scriptorium Estoniae

    Solana, Javier

    2005-01-01

    Euroopa Liidu ühtse välispoliitika juht Euroopa Liitu ohustavatest teguritest, USA-Euroopa suhetest, NATO ning EL-i dubleerivast sõjalisest tegevusest, Prantsusmaa ja Hollandi Euroopa Liidu põhiseaduse referendumite hääletamise mõjust EL-i välis- ning julgeolekupoliitikale, Iraagi küsimusest, Ukraina ja Türgi võimalikust liitumisest Euroopa Liiduga, Eesti EL-i sõjalises tegevuses osalemise vajadusest

  14. Javier Solana: Euroopa peab tugevdama oma sõjalist võimsust / intervjueerinud Urmet Kook

    Index Scriptorium Estoniae

    Solana, Javier, 1942-

    2008-01-01

    Euroopa Liidu ühtse välispoliitika juht Euroopa Liitu ohustavatest teguritest, USA-Euroopa suhetest, NATO ning EL-i dubleerivast sõjalisest tegevusest, Prantsusmaa ja Hollandi Euroopa Liidu põhiseaduse referendumite hääletamise mõjust EL-i välis- ning julgeolekupoliitikale, Iraagi küsimusest, Ukraina ja Türgi võimalikust liitumisest Euroopa Liiduga, Eesti EL-i sõjalises tegevuses osalemise vajadusest

  15. Reality check for rosy view of convergence / Kathryn Tully

    Index Scriptorium Estoniae

    Tully, Kathryn

    2002-01-01

    Ülevaade EL-i kandidaatriikide aktsiaturgude arengust ja EL-iga liitumise edasilükkumisest tulenevatest ohtudest välisinvesteeringutele. Lisa. Tabelid ja skeem: kandidaatriikide EL-i ja Euroopa Rahaliiduga liitumise tõenäosus %-des jaanuar 2004-2007; kandidaatriikide poolt välisvaluutas välja antud võlakirjad jaanuar-august 2002; võimalikud takistused EL-i laienemise ajakavale

  16. Euroopa Liit valmistab ette uutmoodi Venemaa-poliitikat / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2006-01-01

    EL-i järgmine eesistujariik Saksamaa pakub täielikku paradigma muutust EL-i ja Venemaa suhetes, autori sõnul asenduks senine rõhk "ühistel väärtustel" huvide kaine kalkulatsiooniga. Autor esitab oma seisukoha, kuidas peaks toimima Eesti: probleemid Venemaaga on vaja viia miinimumini ning EL-is tuleb toetada ühiseid valikuid vetoõiguse ja erahuvide vastu

  17. EU law on nuclear safety / Ana Stanic

    Index Scriptorium Estoniae

    Stanic, Ana

    2010-01-01

    Tuumaseadmete tuumaohutust käsitlevast õigusest Euroopa Liidus. ELi direktiivist 2009/71 ja 1994. aasta tuumaohutuse konventsioonist (Convention on Nuclear Safety), Rahvusvahelise Aatomienergiaagentuuri (IAEA) standarditest

  18. Putin mängib jätkuvalt eurooplastega / Teresa de Sousa

    Index Scriptorium Estoniae

    Sousa, Teresa de

    2007-01-01

    Autori arvates andis Mafras peetud EL-i ja Venemaa tippkohtumine Venemaa presidendile Vladimir Putinile võimaluse vastata Euroopa kriitikale seoses oma autoritaarsusega. Venemaa agressiivsest poliitikast

  19. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ely tryptophan synthetase alpha chain [Candida albicans SC5314] ... Length = 222 ... Query: 1 ... MSALLKETFARC...KKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIELGVPFSDPIA 60 ... MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNM...QNAGVDIIELGVPFSDPIA Sbjct: 1 ... MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIE

  20. Majandusvabadusi kujundav majanduspoliitika Eestis ja selle perspektiivid Euroopa Liidus / Ivar Raig

    Index Scriptorium Estoniae

    Raig, Ivar, 1953-

    2004-01-01

    Lühiülevaade majandusvabadusi kujundavast majanduspoliitikast taasiseseisvunud Eestis, EL-i mõju Eesti majanduspoliitikale, uuringu tulemustest majandusvabaduste kohta Eesti erinevates majandussektorites. Tabel

  1. Mediationsgesetze in Südosteuropa / Judith Knieper

    Index Scriptorium Estoniae

    Knieper, Judith

    2011-01-01

    Lepitusmenetluse seadustest Albaanias, Bosnias ja Hertsegoviinas, Makedoonias, Kosovos, Horvaatias, Montenegros ja Serbias. ELi direktiivist (2008/52) vahendusmenetluse teatavate aspektide kohta tsiviil- ja kaubandusasjades

  2. Teel infoühiskonda - sedakorda Euroopa Liidu abiga / Katre Talviste, Anne Märdimäe

    Index Scriptorium Estoniae

    Talviste, Katre

    1997-01-01

    Euroopa Liidu infotehnika arendusprogrammid: ACTS - arenenud sidetehnika ja teenused, ESPRIT - infotehnika, TELEMATICS APPLICATIONS - telemaatikarakendused, FEMIRC Eesti (EL'i Innovatsiooniinfo keskus Eestis)

  3. Ravimikontsern võitis soodusravimitülis kohtus sotsiaalministeeriumi / Signe Kalberg

    Index Scriptorium Estoniae

    Kalberg, Signe, 1959-

    2007-01-01

    Tallinna halduskohtu otsusest rahvusvahelise farmaatsiakontserni Eli Lilly ja sotsiaalministeeriumi vahelises kohtuasjas aktiivsus- ja tähelepanuhäiretega lastele mõeldud ravimi soodustuse taotlumise kohta

  4. Effects of Oxygen Content on Tensile and Fatigue Performance of Ti-6Al-4 V Manufactured by Selective Laser Melting

    Science.gov (United States)

    Quintana, Oscar A.; Tong, Weidong

    2017-12-01

    We investigated the selective laser melting (SLM) process for development of Ti-6Al-4 V solid material with oxygen content corresponding to the extra low interstitial (ELI) and non-ELI conditions. The microstructure, chemistry, and tensile properties of samples in as-built and hot isostatically pressed (HIPed) condition were evaluated for both material types, while fatigue performance was evaluated by rotating bending fatigue tests on both smooth and notched SLM ELI and non-ELI Ti-6Al-4 V samples in HIPed condition.

  5. EU-Geheimnisschutzrichtlinie und Schutz von Whistleblowern / Alexander Eufinger

    Index Scriptorium Estoniae

    Eufinger, Alexander

    2016-01-01

    Nn vilepuhujate kaitse regulatsioonist riigisiseses õiguses ja ELi direktiivist 2016/943 (avalikustamata oskusteabe ja äriteabe (ärisaladuste) ebaseadusliku omandamise, kasutamise ja avalikustamise vastane kaitse)

  6. Ärma talu ehitanud Aus Invest müüdi Panama riiulifirmale maha / Kadri Paas

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2007-01-01

    Ärma talu ehitanud Aus Invest OÜ ei ole maksnud tööde eest kõigile alltöövõtjatele. Proua Evelin Ilvese sõnul on Ermamaa peatöövõtjale kõigi kokkulepitud tööde eest maksnud. 2007. a. mais müüsid Aivar Aus ja Mait Aus Tartu maakohtu registriosakonna andmetel Aus Invest OÜ Panamal registreeritud riiulifirmale Arliana Enterprises Corp. Vt. samas: Nõunik sekkus presidendi teleintervjuusse. Kui telekanali TV3 Lõuna-Eesti reporter Valgamaal visiidil viibivalt Toomas Hendrik Ilveselt ja proua Evelin Ilveselt Ärma talu ehitusega kaasnenud võlgade kohta aru päris, sekkus kõnelusse presidendi avalike suhete nõunik Toomas Sildam. Vt. ka lk. 10: Urmo Soonvald. Ärma triibulised. Ajakirjanik ootab Ärma talu probleemidega seoses suuremat avalikustamist

  7. Presidendi taluehitaja mängib võlausaldajatega peitust / Ingvar Bärenklau

    Index Scriptorium Estoniae

    Bärenklau, Ingvar, 1967-

    2007-01-01

    President Toomas Hendrik Ilvese ja proua Evelin Ilvese Ärma talus ehitustöid korraldanud ning alltöövõtjatele võlgu jäänud Aus Invest OÜ omanikud Aivar ja Mait Aus on läinud võlausaldajate eest peitu Norrasse ning kirjutanud oma vara teiste isikute nimele. Vt. samas: Presidenditalu rahavaidlus. Aus Invest on jätnud tasumata maaparandus- ja pinnasetöödefirmale AS Nuia Melior ja Pärnu puidutööstusele AS Puit. Proua Evelin Ilvese kinnitusel on Ärma talu omanikfirma Ermamaa Aus Investile kui peatöövõtjale kõik arved tasunud

  8. President Ilves sõitis USAsse poega õnnitlema / Jaan Väljaots

    Index Scriptorium Estoniae

    Väljaots, Jaan, 1968-

    2009-01-01

    President Toomas Hendrik Ilves on koos proua Evelin Ilvese ja kümneliikmelise IT-ettevõtjate äridelegatsiooniga 9.-16.06.2009 töövisiidil USA läänerannikul California osariigis, et tutvustada Eestit ja Eesti tehnoloogiaettevõtjaid ning edendada teadus- ja kõrgtehnoloogia arenduse piirkonnas Silicon Valleys koostööd kohalike ettevõtjatega. Visiidi sisse mahub presidendi poja Luukas Kristjan Ilvese lõpuaktus Stanfordi ülikoolis. Selgitab presidendi pressinõunik Toomas Sildam. Vt. samas: Evelin Ilves: rasvumisega tuleb võidelda kõikjal. Presidendi abikaasa tutvus San Franciscos sotsiaalprojektiga "Glide" ning kohtus Standfordi meditsiinikoolis toitumisspetsialistide ja pediaatritega. Vt. ka juhtkiri lk. 6: Kaks ühe hinnaga

  9. A Angústia pela Diferença em At Swim, Two Boys de Jamie O'Neill

    Directory of Open Access Journals (Sweden)

    Victor Augusto da Cruz Pacheco

    2016-12-01

    Full Text Available By reading the critical bibliography on contemporary Irish novel At Swim, Two Boys (2001 by Jamie O'Neill, it was noticed that the critics pointed to a relationship with the work of James Joyce, without a detailed comparative analysis between both writers. With that, the article proposes to analyze the construction of Eveline MacMurrough compared with the short story "Eveline" from the book Dubliners (1914 by James Joyce. Based on the theoretical work on intertextuality and the idea of "anxiety of influence" proposed by the American critic Harold Bloom, the article dialogues critically with these essays and the bibliography of At Swim, Two Boys, proposing that the literary re-creation in the novel is based on an anxiety of difference, showing the artistic elaboration made by the Irish writer Jamie O'Neill. From this anxiety, one realizes that the main motivation for the intertextuality is the renewal of the corporeal representation of Ireland.

  10. Koos presidendiga kuningal külas / Annika Poldre

    Index Scriptorium Estoniae

    Poldre, Annika

    2007-01-01

    President Toomas Hendrik Ilvese ja proua Evelin Ilvese riigivisiidist Hispaania kuningriiki 8.-11.07.2007. Külalised võtsid vastu kuningas Juan Carlos ja kuninganna Sofia. T.H. Ilves esines kõnega "El futuro de Europa" kuningliku Elcano Instituudi konverentsil, kohtus Madridi ja Barcelona linnapeadega, Hispaania peaministri ning parlamendi alamkoja spiikriga, avas äriseminari, asetas pärja Hispaania langenud sõdurite monumendi juurde. Proua Evelin Ilves külastas kuningliku gobelääni manufaktuuri ja muuseume. Vt. samas: Hispaania Kuningriigi, Euroopa Liidu, Eesti Vabariigi võrdlus arvudes; Riigivisiidil käisid. Presidenti saatnud delegatsiooni koosseis; Reisimulje. Kommenteerivad: ELKE Mööbel OÜ juhatuse esimees Peeter Kangur ja ELKE GROUP ASi nõukogu esimees Vello Väinsalu

  11. Automatizace forenzního zkoumání - forenzní audit pro účely zjištění porušování autorských práv

    OpenAIRE

    DOBIÁŠ, Martin

    2015-01-01

    This bachelor thesis deals with the forensic analysis of files from a hard drive image and Windows registers. The aim is to provide a tool for the detection of installed programs and potentially illegal software.

  12. Análisis de la Comunicación no Verbal en el discurso de Jorge Eliécer Gaitán. Un acercamiento a las nuevas estrategias de comunicación política en Colombia. Período 1944 - 1948

    OpenAIRE

    Torres Muñoz, Wanda Tatiana

    2012-01-01

    Esta investigación busca demostrar cómo las estrategias comunicativas no verbales, empleadas por Gaitán, influyeron de manera positiva en su discurso político. Así, el dominio consciente e inconsciente de elementos no verbales funciona estratégicamente para complementar su discurso.

  13. Ilves sõitis Saksamaale ja Hollandisse

    Index Scriptorium Estoniae

    2007-01-01

    President Toomas Hendrik Ilves sõitis töövisiidile Saksamaale ja Hollandisse. President osaleb Berliinis konverentsil "Kontinentide konkurents - tulevikku kujundavad Saksamaa ja Euroopa" ning kohtub Saksamaa parlamendisaadikutega. Haagis kohtuvad T. H. Ilves ja proua Evelin Ilves Madalmaade kuninganna Beatrix'i, välisminister Maxime Jacques Marcel Verhageni ja Haagi linnapeaga ning külastavad dirigent Neeme Järvi 70. sünnipäeva kontserti

  14. Kõhu kaudu pankrotti - või helgesse homsesse? / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2011-01-01

    Eesti mahetootjad on käivitanud kampaania "Hea märgiga kaup. Öko", kuid eksperdid kahtlevad eestimaise mahetoidu eelistes tavatoidu ees. Mahe- ja tavatoidu kvaliteedi erinevusi ning mõju tervisele puudutava Eesti Maaülikooli uuringu tulemustest. Väga kõrgetest hindadest mahetoidule Eestis. Mainitud on ka proua Evelin Ilvese seisukohavõtte. Juuresoleval fotol proua E. Ilves koos kuninganna Silviaga külastamas Rootsi mahetööstust Salta Mill

  15. Через желудок к банкротству или к светлому будущему для здоровья? / Прийт Пуллеритс

    Index Scriptorium Estoniae

    Пуллеритс, Прийт, 1965-

    2011-01-01

    Eesti mahetootjad on käivitanud kampaania "Hea märgiga kaup. Öko", kuid eksperdid kahtlevad eestimaise mahetoidu eelistes tavatoidu ees. Mahe- ja tavatoidu kvaliteedi erinevusi ning mõju tervisele puudutava Eesti Maaülikooli uuringu tulemustest. Väga kõrgetest hindadest mahetoidule Eestis. Mainitud on ka proua Evelin Ilvese seisukohavõtte. Juuresoleval fotol proua E. Ilves koos kuninganna Silviaga külastamas Rootsi mahetööstust Salta Mill

  16. Sotsiaalmeedia osatähtsus PR tööriistana kasvab : Baltimaade, Poola ja Valgevene suhtekorraldajad / Villy Paimets

    Index Scriptorium Estoniae

    Paimets, Villy, 1972-

    2016-01-01

    Leedu suhtekorraldajate ühendus tegi uuringu Leedu ja tema naaberriikide PR turgude hetkeseisust ja tulevikuväljavaadetest. Põhjalikumalt uuriti Eesti, Läti, Leedu, Poola ja Valgevene turge. Uuringu tulemuste kohta avaldavad arvamust SEB kommunikatsioonijuht Evelin Allas, PR-ettevõtja ja -õppejõud Mart Soonik ning kaitseväe meediasuhete juhina ja suhtekorraldusfirmas PR Partner strateegilise konsultandina töötanud Riigikogi IRL-i fraktsiooni meedianõunik Ingrid Mühling

  17. Rimi toob Eesti liha lettidele ka Poola kaudu / Urmas Jaagant, Agnes Ojala

    Index Scriptorium Estoniae

    Jaagant, Urmas

    2010-01-01

    Lihatootjate ja Poolas asuvat pakendamiskeskust pidava Hilton Foodsi vahel jätkuvad läbirääkimised, et sõlmida ekspordilepingud. Hilton Foods töötleb ja pakendab nii Eesti kui ka teiste riikide liha ning müüb selle Rimi kaubamärgi all Leedu, Läti, Ungari, Eesti jt. riikide poodidele. Rimi turundusjuhi Evelin Mägioja selgitusi

  18. Ilves näitas Iirile Eestit kui luulelembest mõttekaaslast / Anneli Ammas

    Index Scriptorium Estoniae

    Ammas, Anneli, 1962-

    2008-01-01

    Vabariigi President riigivisiidil Iirimaal 13.-16.04.2008. Ametlike kohtumiste kõrval viidi Eesti riigipea iiri luuletaja William Butler Yeats'i näitusele ning James Joyce'i keskusse, proua Evelin Ilves külastas Iiri rahvuslikku muuseumi. President T. H. Ilves nimetas Iirimaad Euroopa Liidu kontekstis Eestile isegi lähedasemaks naabriks kui Soomet. Juuresoleval fotol Eesti presidendipaar koos Iirimaa presidendi Mary McAleese'iga

  19. Põhjataeva peegeldused II

    Index Scriptorium Estoniae

    2007-01-01

    Tekstiilikunsti ja sepise õpitoad Põhjala põlisrahvaste kultuurifestivalil Palmse mõisas 21.-26. V 2007. Osalevad kunstnikud Eestist, Soomest, Taanist, Rootsist. 26. V näituse avamine Palmse härjatallis ja Evelin Samueli kontsert mõisas. Jean-Loup Rousselot' loengud põhjarahvaste kultuurist 21., 22. ja 25. V Palmse mõisas, 23. V Rakvere linnuses, 24. V Käsmu meremuuseumis

  20. Fotomeenutus USBF-i galaõhtult

    Index Scriptorium Estoniae

    2008-01-01

    President Toomas Hendrik Ilves pälvis Balti riikide ja Ameerika Ühendriikide suhete edendamise eest Ameerika-Balti Fondi (USBF - The United States-Baltic Foundation) autasu - Baltic Statesmanship Award'i. Juuresoleval fotol president T. H. Ilves ja proua Evelin Ilves koos samuti autasu pälvinud riskikapitalist Steve Jürvetsoniga Ameerika-Balti Fondi pidulikul vastuvõtul. Vabariigi President töövisiidil Ameerika Ühendriikides 17.-23.04.2008

  1. Marta maailm / Marta Vaarik

    Index Scriptorium Estoniae

    Vaarik, Marta, 1987-

    2007-01-01

    Riigikogu liige Evelin Sepp käis sir Elton Johni kontserdil 15. sept. Saku Suurhallis. Poplaulja Mike Emelai on kaalus alla võtnud. Riigikogu liige Enn Eesmaa esineb Cliff Richardi looga "Don't Forget To Catch Me" 4. okt. Eesti Vähiliidu korraldataval heategevuskontserdil. "Tantsud tähtedega" saates paarina võistlevad laulja Koit Toome ja tantsija Kerttu Tänav käisid Elton Johni kontserdil

  2. Décès - French version only

    CERN Multimedia

    Affaires sociales

    2004-01-01

    Nous avons le regret d'annoncer le décès de Madame Eveline DURIEU-THIRY survenu le 14.10.2004. Mme Eveline DURIEU-THIRY, née le 26.06.1949, a travaillé au Département AB et était au CERN depuis le 16.03.1971. Le Directeur général a envoyé un message de condoléances à sa famille de la part du personnel du CERN. Affaires sociales Département des Ressources humaines C'est avec très grande tristesse que nous avons appris que notre collègue et amie, Eveline Durieu-Thiry, nous a définitivement quittés le 14 octobre. Tout au long des quatre mois de sa terrible maladie, nous l'avons admirée pour son courage et sa combativité, et nous gardions le ferme espoir de la revoir un jour parmi nous. Nous perdons en elle une collègue appréciée de tous pour son extrême gentillesse et sa grande servi...

  3. JeS - dengi k dengam / Algirdas Brazauskas ; interv. Ilja Nikiforov

    Index Scriptorium Estoniae

    Brazauskas, Algirdas, 1932-2010

    2005-01-01

    Leedu peaministri sõnul ei ole nüüd, kui EL-is hakati valmistuma uueks finantsperioodiks, tunda euroliidu humanitaarseid ideid aidata alliansi riike sõltuvalt nende arengutasemest, ei ole tunda eelkõige EL-i vanade riikide tähelepanu ega solidaarsusidee realiseerumist

  4. Euroopa muutunud vaated laienemisele / Jeroen Bult

    Index Scriptorium Estoniae

    Bult, Jeroen

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 5. okt. lk. 7. Bulgaaria ja Rumeenia liitumisse EL-iga ei suhtuta Euroopa Liidus väga positiivselt, arvab autor. Euroopa Komisjon püüab edasist EL-i laienemist vältida, kuid EL-i tegelikuks probleemiks on autoriteetide puudumine

  5. Otto von Habsburg : III maailmasõda on läbi / Otto von Habsburg ; interv. Marianne Mikko

    Index Scriptorium Estoniae

    Habsburg, Otto von, 1912-2011

    2002-01-01

    Otto von Habsburg vastab küsimustele, mis puudutavad Euroopa konvendi presidendi teadet, et Türgi koht ei ole EL-is, Iraagi võimalikku ründamist, Hiina ja Venemaa suhteid, Tšetšeeniat, tshetsheene ja terrorismi, Venemaa, EL-i ja USA suhteid, III maailmasõda, Eesti Vabariigi tulevikku

  6. Catherine Ashton avas naistele ukse / Siiri Oviir

    Index Scriptorium Estoniae

    Oviir, Siiri, 1947-

    2009-01-01

    Europarlamendi saadik Siiri Oviir peab Catherine Ashtoni EL-i välisministriks valimist suureks sammuks soolise võrdõiguslikkuse ja tasakaalustatuse poole. Samas taunib ta EL tippjuhtide valimist kinnises ringis, kuna otsuste kehv läbipaistvus ei soodusta liikmesriikide ja nende kodanike aktiivsuse kasvu ning nad ei tunne end piisavalt seotud ELi institutsioonidega

  7. Prantsusmaa on kõigest üks riik, leiavad eurosotsid / Priit Simson

    Index Scriptorium Estoniae

    Simson Priit, 1977-

    2005-01-01

    Euroopa Parlamendi sotsialistide juht Martin Schultz on seisukohal, et EL-i põhiseadusleping ei ole Prantsusmaal toimunud referendumi tõttu läbikukkunud, ning soovitab ära oodata leppe heakskiitmise teistes EL-i riikides. Euroopa Parlamendi sotsialistide väljasõiduistungist Tallinnas

  8. Euroliit vaidleb Birma diktatuuri üle / Karin Dean

    Index Scriptorium Estoniae

    Dean, Karin

    2004-01-01

    EL-i ja Aasia riikide diplomaatilisest vaidlusest, kas lubada EL-i ja Kagu-Aasia tippkohtumisele diktatuuririiki Birmat. Kagu-Aasia maade ühenduse ASEAN seisukohtadest. Vt. samas: Birma uue põhiseaduse arutelu põlu all

  9. Pamjat o Holokoste - vazhnaja tshast identitshnosti jevreiskogo gossudarstva / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2008-01-01

    Iisraeli välisministeeriumi nõunik Gil Artzyeli arvab, et pronkssõduri teisaldamine on Eesti asi, kuid ei nõustu kommunismi ja natsismi võrdsustamisega. Arvamusi EL-i laienemisest ning Iisraeli ja EL-i suhetest. 1. mai tähistamisest holokausti mälestamise päevana ja Yad Vashemi muuseumist Jeruusalemmas

  10. Ettevõtja saab raha ka otse Brüsselist / Silva Männik

    Index Scriptorium Estoniae

    Männik, Silva, 1974-

    2004-01-01

    Lisaks mitmetele Eesti asutustele, mis alates sellest aastast EL-i struktuurifondide kaudu raha jagama hakkavad, on ettevõtjatel võimalik taotleda erinevate programmide kaudu raha ka otse EL-i eelarvest. Lisa: Otse saab raha taotleda mitmest programmist

  11. Euroliidu laienemine suunab logistikafirmad koostööle / Rivo Sarapik

    Index Scriptorium Estoniae

    Sarapik, Rivo, 1981-

    2004-01-01

    Ilmunud ka: Delovõje Vedomosti 28. juuli lk. 15. Autor refereerib logistikaajakirjas Logistics Business Magazine ilmunud artiklit, milles analüütikud ja firmajuhid prognoosivad EL-i laienemisega kaasnevaid võimalikke arenguid logistikavaldkonnas. Lisa: Muutused logistikas seoses ELi laienemisega

  12. Giles Merritt: Euroopa Liit vedas inimesi alt / Giles Merritt ; interv. Liisa Past

    Index Scriptorium Estoniae

    Merritt, Giles

    2009-01-01

    Mõttekoja Friends of Europe peasekretär eelseisvatest Euroopa Parlamendi valimistest, Tšehhist EL-i eesistujamaana, Euroopa Komisjoni vähesest aktiivsusest üleilmse majanduskriisi mõju vähendamisel, protektsionismist, EL-i Venemaa-poliitikast

  13. Europarlament ihkab enam tähelepanu / Inga Höglund

    Index Scriptorium Estoniae

    Höglund, Inga

    2010-01-01

    Euroopa Parlament korraldas EL-i institutsioonide ja meedia seminari, et leida lahendust probleemile, kuidas suurendada inimeste ja meedia huvi EL-i, Euroopa Parlamendi tegemiste vastu. Parlamendi liikmete Morten Løkkegaardi, Thijs Bermani arvamusi ja ettepanekuid. Parlamendi presidendi Jerzy Buzeki seisukoht

  14. Saksamaa : türgi ärimeeste optimism / Carter Dougherty ; tõlk. Erik Aru

    Index Scriptorium Estoniae

    Dougherty, Carter

    2006-01-01

    Saksamaa türklastest ärimeeste hinnangul suureneb kaubavahetus Türgiga ja sinna investeerimine, kui Türgi peab läbirääkimisi EL-i liikmeks saamiseks. Saksamaal on 60% elanikest vastu Türgi liitumisele EL-iga. Türgi ja EL-i kaubavahetuse suurenemisest

  15. SITE PROGRAM DEMONSTRATION ECO LOGIC INTERNATIONAL GAS-PHASE CHEMICAL REDUCTION PROCESS, BAY CITY, MICHIGAN TECHNOLOGY EVALUATION REPORT

    Science.gov (United States)

    The SITE Program funded a field demonstration to evaluate the Eco Logic Gas-Phase Chemical Reduction Process developed by ELI Eco Logic International Inc. (ELI), Ontario, Canada. The Demonstration took place at the Middleground Landfill in Bay City, Michigan using landfill wa...

  16. The Baltics - the fastest developing region of the European Union / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2005-01-01

    Baltimaad kui kiiremini areneva majandusega riigid EL-is. Eesti, Läti, Leedu majandusnäitajate analüüs. Tabelid, graafikud, diagrammid sisemajanduse kogutoodangu, töötuse, tööhõive, palkade ja hindade kohta Baltimaades ning teistes EL-i riikides

  17. Euroopa Liidu ja tema kandidaatriikide majanduse areng / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2000-01-01

    Diagrammid ja tabelid: SKP aastane juurdekasv 1983-2001 USA-s ja EL-is; EUR-11 ja EL-15 kvartaalne SKP juurdekasv; EL-i kandidaatriikide SKP juurdekasv 1995-1999; kandidaatriikide SKP osakaal; SKP inimese kohta 1999.a.; SKP kvartaalne juurdekasv %-des 1999 ja 2000

  18. Euroopa liidu kandiaatriikide võtmearvude võrdlev analüüs / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2000-01-01

    Euroopa Liidu kandidaatriikide majandusnäitajad: SKP; tööstuse ja ehituse, teeninduse, põllumajanduse osakaal kogu lisandväärtusest, ELi osakaal koguimpordist ja -ekspordist; ELi otseinvesteeringute seis 1997.a. lõpus. Ilmunud ka: Buhgalterskije Novosti n. 2 lk. 38-43

  19. Natural gas quality for the future. Part 1. Technical/economical inventory of consequences of natural gas quality variations for final consumers

    International Nuclear Information System (INIS)

    Levinsky, H.B.; Van Rij, M.L.D.

    2011-01-01

    By request of various market parties (suppliers and users of natural gas), the Dutch Ministry of Economic Affairs, Agriculture and Innovation (ELI) took a leading role in anticipating the future changes in gas quality. ELI requested an inventory of the consequences of variations in natural gas quality for end users. [nl

  20. NCBI nr-aa BLAST: CBRC-ACAR-01-0089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0089 ref|YP_459771.1| hypothetical protein ELI_14410 [Erythrobacter litoral...is HTCC2594] gb|ABC64974.1| hypothetical protein ELI_14410 [Erythrobacter litoralis HTCC2594] YP_459771.1 4.4 24% ...

  1. NCBI nr-aa BLAST: CBRC-CPOR-01-1878 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1878 ref|YP_459668.1| hypothetical protein ELI_13895 [Erythrobacter litoral...is HTCC2594] gb|ABC64871.1| hypothetical protein ELI_13895 [Erythrobacter litoralis HTCC2594] YP_459668.1 4.8 29% ...

  2. Kõhklev Holland ootab riiki võõrtööliste horde / Aire Wilbrink

    Index Scriptorium Estoniae

    Wilbrink, Aire

    2004-01-01

    Hollandi valitsus otsustas kehtestada võõrtööliste maksimummäära. Esimesel kahel aastal pärast EL-i laienemist on uutest EL-i liikmesriikidest Hollandisse oodatud 20000-30000 võõrtöölist. Vt. samas: Maailmas oli mullu ilma tööta 186 miljonit inimest

  3. Euroopa eelarvet võiks täita ühtne maks / Daniel Gros, Stefano Micossi

    Index Scriptorium Estoniae

    Gros, Daniel

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 30. märts lk. 6. Autorite arvates oleks EL-i eelarve parim lahendus umbes 2-protsendiline käibemaksumäära tõus kogu Euroopa Liidus, mis kataks kõik vajadused. Diagramm: EL-i eelarvest laekub lõviosa SKP alusel

  4. Hollandi euroministri meelest peab EL kõnelema ühel häälel / Atzo Nicolai ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Nicolai, Atzo

    2004-01-01

    Eestis viibinud Hollandi Euroopa asjade minister toetab Euroopa Liidu ühehäälset kõnelemist Venemaaga, et ta laiendaks partnerlus- ja koostöölepingut EL-i uutele liikmesriikidele. EL-i põhiseaduslikust leppest, stabiilsuspakti järgimisest, suhtumisest Türgi liitumisse EL-iga

  5. Liitumisjärgsed muutused majanduskeskkonnas : [eurointegratsioonist] / Urve Valdmaa, Ants Laansalu

    Index Scriptorium Estoniae

    Valdmaa, Urve

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 66-67. 2004. a maksti Eesti põllumajandustootjatele EL-i eelarvest 25% EL-i otsetoetuste tasemest, liikmesriigil oli võimalus täiendavalt juurde maksta kuni 55% tasemini. Tabel: 2004. a rakendatud toetused ja rahastamisallikad

  6. Eestlane on Euroopas sage koju tagasi tulija / Urmas Jaagant

    Index Scriptorium Estoniae

    Jaagant, Urmas

    2011-01-01

    Sisekaitseakadeemia Euroopa rändevõrgustiku analüüsi kohaselt on Eesti nende kolme EL-i riigi seas, mille kodanikud enim tagasi pöörduvad. EL-i liikmesriikides suurenes 2008. a. väljaränne 13%. Eestisse sisserändajatest on ligi pooled Eesti kodanikud

  7. Kak vernut flot pod Estonskii flag? / Leidur Rannamets

    Index Scriptorium Estoniae

    Rannamets, Leidur

    2007-01-01

    EL-is kasvab konkurents reisilaevaliinidel. Autori sõnul kinnitavad spetsialistid, et Eesti on ainus riik EL-is, mis ei kasuta õigust võimaldada oma laevakompaniidele riiklikku subsiidiumi. Laevaomanike hinnangul on 30 miljonit krooni, mis leiti lisaeelarvest laevanduse arendamiseks, vaid 10% vajalikust summast. Laevaomanike liidu seisukohtadest

  8. John Kjaer : Nõukogude Liitu ja euroliitu seob vaid sõna "liit" / John Kjaer ; interv. Tuuli Koch

    Index Scriptorium Estoniae

    Kjaer, John

    2003-01-01

    Euroopa Komisjoni delegatsiooni juht Eestis John Kjaer vastab küsimustele, mis puudutavad Edgar Savisaare kõnet Keskerakonna kongressil, kus ta võrdles NSV Liitu Euroopa Liiduga; peamisi erinevusi EL-i ja totalitaarriigi vahel, otsuste langetamise põhimõtteid EL-is

  9. Silvio Berlusconi kosib Juhan Partsi pimedast peast / Kaarel Tarand

    Index Scriptorium Estoniae

    Tarand, Kaarel, 1966-

    2003-01-01

    EL-i eesistujamaa Itaalia ei esitanud tähtajaks kompromissettepanekuid EL-i uue põhiseaduse kohta, mis seab keerulisse olukorda Itaalia peaministriga kohtuva Eesti peaministri Juhan Partsi. Euroopas kritiseeritakse Itaalia kui eesistujamaa tegevust. Lisa: Eesti viis olulist nõudmist

  10. Rebenev Euroopa / Petra Pinzler

    Index Scriptorium Estoniae

    Pinzler, Petra

    2005-01-01

    Ajalehe Die Zeit korrespondendi sõnul ei ole EL-i kodanikud mitte kunagi varem olnud EL-i suhtes nii tõrjuvad kui praegu, hävitavalt mõjub ühise identiteedi puudumine, paljudele ei meeldi suund, mille Euroopa on võtnud

  11. Viimase hetke kokkulepe päästis WTO tippkohtumise / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2005-01-01

    Kuigi EL-i eelarvekõnelustel Brüsselis jäeti ühine põllumajanduspoliitika puutumata, sunnib WTO tippkohtumisel Hongkongis saavutatud lepe 2013. aastast alates EL-i põllumajanduse toetamist revideerima. Lisa: Politsei vahistas 900 meeleavaldajat

  12. 78 FR 44432 - New Animal Drugs; Change of Sponsor; Fentanyl; Iron Injection

    Science.gov (United States)

    2013-07-24

    ... for an NADA from Nexcyon Pharmaceuticals, Inc. to Elanco Animal Health, A Division of Eli Lilly & Co..., NADA 141-337 for RECUVYRA (fentanyl) Transdermal Solution to Elanco Animal Health, A Division of Eli Lilly & Co., Lilly Corporate Center, [[Page 44433

  13. Ainult 1%-meestest ei ole erektsioonihäire ravitav

    Index Scriptorium Estoniae

    2004-01-01

    Erektsioonihäirete põhjustest, seotud haigustest ja ravimeetoditest rääkisid ravimifirma Eli Lilly korraldatud loengupäeval uroloog Margus Punab, kardioloog Arvo Rosenthal, psühhiaater Imre Rammul ja Eli Lilly turundusjuht Katrin Lätt

  14. Rauno Pukonen : Turule tulevad vaid oma klassi parimad rohud / Rauno Pukonen ; interv. Vilve Torn

    Index Scriptorium Estoniae

    Pukonen, Rauno

    2006-01-01

    Rahvusvahelise Ravimitootjate Liidu juhatuse esimees ja Eli Lilly Balti regiooni direktor vastab küsimustele, mis puudutavad innovatiivsusest ja kvaliteedist lähtumise põhimõtet ravimitootmises, ravimihindade teket, firma 70 miljoni dollari suurust toetust tuberkuloosiprogrammile, firma tulevikku. Lisad: Eli Lilly & Co 130; Ajalugu

  15. 75 FR 9333 - Implantation or Injectable Dosage Form New Animal Drugs; Tilmicosin

    Science.gov (United States)

    2010-03-02

    ... (NADA) filed by Elanco Animal Health, A Division of Eli Lilly & Co. The supplemental NADA provides a...: [email protected] . SUPPLEMENTARY INFORMATION: Elanco Animal Health, A Division of Eli Lilly & Co., Lilly Corporate Center, Indianapolis, IN 46285, filed a supplement to NADA 140-929 for MICOTIL...

  16. 77 FR 46612 - New Animal Drugs; Change of Sponsor; Change of Sponsor Address; Azaperone; Miconazole, Polymyxin...

    Science.gov (United States)

    2012-08-06

    ... Pharmaceutica NV, to Elanco Animal Health, a Division of Eli Lilly & Co. FDA is also amending the animal drug..., polymyxin B sulfate, prednisolone acetate) Otic Suspension to Elanco Animal Health, a Division of Eli Lilly & Co., Lilly Corporate Center, Indianapolis, IN 46285. Following these changes of sponsorship, Janssen...

  17. Zdorovje - nash ressurss / Anna Litvinjuk

    Index Scriptorium Estoniae

    Litvinjuk, Anna

    2005-01-01

    Ülemaailmse Tervishoiuorganisatsiooni (WHO) andmetel on keskmine eluiga Eestis tunduvalt lühem kui teistes EL-i riikides. Samuti on Eesti elanike tervis võrreldes teiste EL-i riikide elanike tervisega tunduvalt halvem. WHO toetusel toimunud tervisefoorumist Eestis. Diagramm

  18. Syracuse University English Language Institute: Business Communication for Executives

    Science.gov (United States)

    de Berly, Geraldine; McGraw, Deborah

    2010-01-01

    The Syracuse University English Language Institute (ELI), housed within University College, has been offering noncredit executive English courses on a contract basis for the past 12 years. Despite its small size and limited resources, the ELI, whose main mission is to prepare international students for academic study, also manages a successful…

  19. Eesti Euroopas ja Euroopa Eestis / Ramon Loik

    Index Scriptorium Estoniae

    Loik, Ramon

    2005-01-01

    Autor annab ülevaate, milliseid uudiseid on välisajakirjandus Eesti kohta avaldanud, millised on lähiaastatel EL-i ees seisvad probleemid, kuhu läheb lõviosa EL-i maksumaksja rahast. Autori sõnul on Eesti sattunud nn. musta nimekirja Euroopa sotsiaalharta rikkumise pärast

  20. Briti peaminister Tony Blair tuleb hiiobisõnumiga / Andris Feldmanis, Märt Kivine

    Index Scriptorium Estoniae

    Feldmanis, Andris, 1982-

    2005-01-01

    Eestisse visiidile saabuv Suurbritannia peaminister Tony Blair soovib toetust EL-i eelarveprojektile, mis säilitaks Suurbritannia tagasimakse EL-i eelarvest ning vähendaks uute liikmesriikide toetusi. Kommenteerib Andrus Ansip. Vt. samas intervjuud Toomas Hendrik Ilvesega; Märt Kivine. Vajalik täpsustus: saagem mandri-eurooplasteks!

  1. Euroopa tulevik : liit või föderaalriik? / Paavo Palk

    Index Scriptorium Estoniae

    Palk, Paavo, 1968-

    2002-01-01

    Autor analüüsib 2002. aasta veebruaris Brüsselis kokku tulnud EL-i Tuleviku Konvendis toimuvat tulevikudebatti kolmest peamisest aspektist - liikmesriikide mõju suurendamine liidu arvelt või vastupidi, EL-i institutsioonide vahelise jõuvahekorra muutmine, teatud liikmesriikide võimaluste suurendamine või vähendamine. Tabel.

  2. EU citizen participation, openness and the European citizens initiative: the TTIP legacy / James Organ

    Index Scriptorium Estoniae

    Organ, James

    2017-01-01

    Avalikkuse põhimõttest, läbipaistvusest ja kodanike võimalusest ELi välissuhete poliitika kujundamisel osaleda ELi ja Ameerika Ühendriikide vahelise Atlandi-ülese kaubandus- ja investeerimispartnerluse (TTIP) läbirääkimisprotsessi näitel

  3. Euroopa Liidu ja Moskva suhted vajaks muudatusi / Jaanus Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Jaanus, 1973-

    2007-01-01

    Brüsselis asuva EL-i ja Venemaa keskuse direktori Fraser Cameroni hinnangul peaksid EL-i liikmesriigid andma Brüsselile Moskvaga suhtlemiseks rohkem võimu. Tema väitel avaldavad tugevat vastuseisu Venemaa ja EL-i poliitiliste suhete arendamisele Baltimaad ja Poola. Liikmesriikide kahepoolsed suhted Venemaaga sõltuvad parajasti võimul olevast juhtkonnast. Balti riigid olevat Venemaa suhtes liiga kriitilised, nimeliselt mainis F. Cameron Eesti presidendi Toomas Hendrik Ilvese avaldusi. Vt. samas : Paralleel Eestiga

  4. EU funds-related Baltic controversies in Brussels / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2011-01-01

    10.–13. okt. toimus Brüsselis Euroopa Liidu regionaalpoliitika iga-aastane foorum – Avatud Uste Päevad, kus räägiti ühtekuuluvuspoliitika teemadel. 6. oktoobril saatsid Baltimaade ja Ungari peaministrid EL-i juhtidele kirja, milles ütlevad, et nad ei ole EL-i ühtekuuluvuspoliitika rahastamisega seotud ettepanekutega nõus. Baltimaade põllumehed avaldasid Brüsselis meelt ja nõudsid võrdseid konkurentsitingimusi ning toetusi kõikidele EL-i riikidele

  5. Perfluorattujen alkyyliaineiden (PFAS) aiheuttamat ympäristöriskit Suomessa

    OpenAIRE

    Korkki, Kati

    2006-01-01

    Perfluoratut alkyyliaineet (PFAS) ovat laaja ryhmä kemikaaleja, joita on käytetty 1950-luvulta saakka teollisuudessa ja kuluttajatuotteissa. 1990-luvun lopulla tuli ilmi, että osa PFAS-aineista on levinnyt ympäristöön ja eliöihin maailmanlaajuisesti. Eniten esillä ollut PFAS-aine, PFOS eli perfluoro-oktaanisulfonaatti, on pysyvä, biokertyvä ja toksinen. Myös pitkäketjuiset perfluorokarboksyylihapot, kuten PFOA eli perfluoro-oktaanihappo, ovat pysyviä ja biokertyviä. Tutkielman tavoitteena oli...

  6. Energy efficient technology - from this all will benefit; Energieeffiziente Technik - davon profitieren alle

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-02-15

    Within the International Trade Fair of Craft between 11th and 17th March, 2009 in Munich (Federal Republic of Germany) the Federal Ministry of Economics and Technology (Berlin, Federal Republic of Germany) presented the following lectures: (1) The handicraft in context to demography - The demography in the east German federal states (Thomas Satzmann); (2) The handicraft in the financial crisis (Joachim Garrecht); (3) The transformation of the service regulation (Thomas Ernst); (4) Future handicraft (Joachim Garrecht); (5) Journalist Special: Use of electronic media such as podcast and internet-TV for public relations in the handicraft (Michael Bachmann); (6) Standardization at small and medium-sized enterprises (Thomas Ernst); (7) Crafts and tourism (Evelin Friedrich); (8) The handicraft in the financial crisis (Joachim Garrecht); (9) Activation of facades in existing buildings in combination with air heat and solar thermal power - Theory and reports from the practice (Jens Wolfensteller, Volker Drexel); (10) Fiscal reform in favour of the handicraft (Joachim Garrecht, Johannes Hoefer); (11) The transformation of the service regulation (Thomas Ernst); (12) Mould fungus, dangerous subtenant - General aspects to mould fungi, recognition, health aspects and removal (Sabine Hoer); (13) The energy competency centre of the Chamber of Commerce Potsdam (Herbert Pape); (14) The handicraft in the financial crisis (Joachim Garrecht); (15) Standardization at small and medium-sized enterprises (Thomas Ernst); (16) Reformation of the inheritance tax (Joachim Garrecht, Johannes Hoefer); (17) Amendment of the law for chimneysweepers (Joachim Garrecht); (18) Future handicraft (Joachim Garrecht); (19) Handicraft and tourism (Evelin Friedrich); (20) Politics in favour of the handicraft (Joachim Garrecht); (21) Reformation of the inheritance tax (Joachim Garrecht); (22) Challenges of the demography in the handicraft (Evelin Friedrich); (23) The handicraft in the financial crisis

  7. Suursaadik Andres Talvik : Prantsusmaa ei ole euroliidu laienemise pooldaja / Andres Talvik ; interv. Marianne Mikko

    Index Scriptorium Estoniae

    Talvik, Andres, 1947-

    2002-01-01

    Eesti suursaadik Prantsusmaal Andres Talvik Prantsusmaa presidendivalimistest, paremäärmuslase Jean-Marie Le Peni pääsemisest selle II vooru, prantslaste vastuseisust EL-i laienemisele, Prantsuse-Saksa suhetest. Andres Talviku elulooandmeid

  8. 19 CFR 101.4 - Entry and clearance of vessels at Customs stations.

    Science.gov (United States)

    2010-04-01

    ... Jacksonville. Port St. Joe Panama City. Indiana Fort Wayne Indianapolis. Maine Bucksport Belfast. Coburn Gore.... Ely Duluth, MN-Superior, WI. Lancaster Noyes. Oak Island Warroad. Mississippi Biloxi Mobile, AL...

  9. Valitsus sel korral sügisest majandusennustust ei tee / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2009-01-01

    Rahandusministeeriumi osakonnajuhataja Andrus Sääliku selgitusel on sügisese majandusprognoosi edasilükkamise taga EL-i otsus lükata sel aastal stabiilsus- ja konvergentsiprogrammide raportite esitamine kaks kuud edasi. Diagramm

  10. Pelkistetyt pakkaukset, tavaramerkkioikeudet ja ”nudging”-tyyppinen lainsäädäntö / Max Oker-Blom, Minna Aalto-Setälä

    Index Scriptorium Estoniae

    Oker-Blom, Max

    2018-01-01

    Tavalistest pakenditest (plain packaging), kaubamärgiõigusest ja käitumispõhisest regulatsioonist . Tavaliste pakendite õigusaktide ja arengute kohta ELis, Soomes ja teistes liikmesriikides (Iirimaa, Suurbritannia, Prantsusmaa, Ungari), kus on rakendatud vastavaid õigusakte

  11. Godovshtshina bez eiforii / Aleksei Klepikov

    Index Scriptorium Estoniae

    Klepikov, Aleksei

    2005-01-01

    EL-i ja NATO-ga liitumise mõjudest Baltimaade elanike turvatundele ning majandusele. Arvamust avaldavad Tiit Matsulevitsh, Ivar Sikk, Toivo Kuldkepp jt. Toimetuse kommentaar. Diagramm: Inflatsioonimäärad Ida-Euroopa riikides

  12. Lithuania lifts ban on EU-Russia talks / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2008-01-01

    Leedu nõustus loobuma oma vetost Venemaa ja EL-i vahelise strateegilise partnerlusleppe kõneluste alustamisele. Leedu, Poola, Rootsi ja Sloveenia välisministrid otsustasid arvestada kõnelustes ka Leedu tõstatatud probleeme

  13. Schengen Facility hankeprojektid on täies hoos / Helena Loorents

    Index Scriptorium Estoniae

    Loorents, Helena

    2005-01-01

    Schengen Facility toetusest uutele EL-i liikmesriikidele. Schengen Facility programmi vahenditest toetatakse Eesti piirivalvele RIB C-1100 tüüpi paatide ning piirivalvekopter hankimist, valminud on uus merevalvekeskus

  14. Klimaschutz im Verkehrssektor - Die Umsetzung der Richtlinie 1999/94/EG in Deutschland und Polen im Vergleich / Jan Hoffman, Monika Nafalska-Zgolak

    Index Scriptorium Estoniae

    Hoffman, Jan

    2011-01-01

    ELi direktiivist (1999/94), milles käsitletakse kütusesäästuga ja süsinikdioksiidi heitmetega seotud andmete tarbijale kättesaadavust uute sõiduautode turustamisel, rakendamisest Poolas ja Saksamaal

  15. Sotsiaalse kapitali mõju majanduse jätkusuutlikule arengule / Agne Nettan

    Index Scriptorium Estoniae

    Nettan, Agne

    2004-01-01

    Majanduse jätkusuutliku arengu ja sotsiaalse kapitali mõistetest, seosest majandusarenguga; sotsiaalse kapitali mõjust majanduslikule arengule EL-i liikmes- ja kandidaatriikides, kasutades alternatiivseid jätku- ja haldussuutlikkuse näitajaid

  16. Baltic PMs urge support for EU

    Index Scriptorium Estoniae

    2003-01-01

    Eesti peaministri Juhan Partsi, Läti peaministri Einars Repshe ja Leedu peaministri Algirdas Brazauskase ühisavaldusest Eestile ning Lätile järgimaks Leedu eeskuju referendumil EL-i poolt hääletamises

  17. Who owns the information held by EU agencies? Weed killers, commercially sensitive information and transparent and participatory governance / Emilia Korkea-aho, Päivi Leino

    Index Scriptorium Estoniae

    Korkea-aho, Emilia

    2017-01-01

    Infole juurdepääsu tagamisest ja tundliku info (sh ärisaladuste) kaitsmisest ELi õiguses Euroopa Kemikaaliameti (ECHA), Euroopa Toiduohutusameti (EFSA) ja Euroopa Ravimiameti (EMA) näitel ning Euroopa Kohtu ja Euroopa ombudsmani praktikas

  18. The peculiar nature of EU home affairs agencies in migration control: beyond accountability versus autonomy? / Sergio Carrera, Leonhard den Hertog, Joanna Parkin

    Index Scriptorium Estoniae

    Carrera, Sergio

    2013-01-01

    Euroopa agentuuride (Euroopa Liidu välispiiridel tehtava operatiivkoostöö juhtimise Euroopa Agentuur – FRONTEX; Euroopa Politseiamet – Europol; Euroopa Varjupaigaküsimuste Tugiamet – EASO) arengust ja tegevusest ELi sisserändepoliitikas

  19. Regionalnõje energetitsheskije problemõ JeS i stranõ Baltii / Eugene Eteris

    Index Scriptorium Estoniae

    Eteris, Eugene

    2006-01-01

    Ilmunud ka: The Baltic Course 2007 Winter (nr. 24) lk. 38-39. ELi energiaturg ning Baltimaade energeetika probleemid. Võimalikud lahendused. Alternatiivne energeetika. Tabel: Gaasi ja elektrienergia hinnad Euroopas

  20. "Predprinimatelstvo - eto neprestizhno" / Jaroslav Tolstikov

    Index Scriptorium Estoniae

    Tolstikov, Jaroslav

    2000-01-01

    Uurimus Ida-Virumaa Vene noorte hulgas "Noored muutuvas maailmas". Diagrammid: perekondade majanduslik oukord, murettekitavad probleemid, millises riigis soovitakse tulevikus töötada, suhtumine EL-i

  1. Back to the future: the UK’s EU exit and the conflict of laws / Andrew Dickinson

    Index Scriptorium Estoniae

    Dickinson, Andrew

    2016-01-01

    Suurbritannia EList lahkumise mõjust Suurbritannia tsiviilkohtusüsteemile ja rahvusvahelise eraõiguse normide kohaldamisele piiriüleste kaubandus- ja tsiviilvaidluste lahendamisel; rahvusvahelise eraõiguse, ELi õiguse ja riigisisese õiguse tõlgendamisest

  2. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-08-08

    Aug 8, 2017 ... Key Words: (CASE tools, programming technique, accounting applications) ... Journal of Fundamental and Applied Sciences is licensed under a Creative .... [3] Anton Eliëns, Principles of object-oriented software development, ...

  3. LNG terminalil on idaraha keeld / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2011-01-01

    Euroopa Komisjon kiirustab Balti riike LNG (vedeldatud maagaasi) terminali asukohas kokku leppima. Kolmest tingimusest, millele peab LNG terminali projekt vastama, et tekiks võimalus kandideerida EL-i toetusele

  4. Suurbritannia tutvustab end Paides / Sarah Squire ; interv. Signe Kalberg

    Index Scriptorium Estoniae

    Squire, Sarah

    2002-01-01

    Paides toimub Briti saatkonna, Briti Nõukogu Suurbritannia ja Euroopa päev. Suursaadik vastab küsimustele Euroopa päeva kohta 8. mail, Suurbritannia ja EL-i suhete kohta, oma diplomaatilise tegevuse kohta

  5. Europarechtliche Probleme bei Verlust beamtenrechtlicher Versorgungsanwartschaften / Arno Bokeloh

    Index Scriptorium Estoniae

    Bokeloh, Arno

    2017-01-01

    Töötajate vabast liikumisest ELis ja riigiametnike sotsiaalkaitsest (eelkõige pensionikindlustusest) erasektorisse või teise liikmesriiki tööle suundumisel Euroopa Kohtu lahendi C-187/15 põhjal

  6. "See on etnotsiid puhtal kujul!" / Vladimir Kozlov ; interv. Igor Taro

    Index Scriptorium Estoniae

    Kozlov, Vladimir

    2005-01-01

    Mari rahvusliidri arvates oli talle korraldatud rünnak seotud tema tegevusega. Olukorrast Marimaal, kus kõrvaldatakse marisid juhtivatelt ametikohtadelt, raskes seisus on praegu ka udmurdid, mordvalased ja komid. Kaart: Mari Eli Vabariik

  7. Vaja on uut kliimakokkulepet / Urmas Paet, Per Stig Moller

    Index Scriptorium Estoniae

    Paet, Urmas, 1974-

    2007-01-01

    Leevendamaks kliimamuutuste mõjusid ning tagamaks usaldusväärsed ja soodsad energiatarned, tuleb teha karme otsuseid. EL-i ülesanne on toetada keskkonnasõbralike tehnoloogiate arendamist ja julgustada energiaefektiivsemat tarbijakäitumist

  8. Nicolas Sarkozy a recu son homologue estonien

    Index Scriptorium Estoniae

    2008-01-01

    Prantsusmaa president Nicolas Sarkozy pakkus 7. aprillil 2008 Elysée palees kohtumisel president Toomas Hendrik Ilvesega Eestile Prantsusmaa abi tuumaenergeetika küsimustes. Vabariigi President töövisiidil Pariisis 6.-8.04.2008

  9. Võbor tipa svobodnoi zonõ v Estonii = The choice of the free zone model in Estonia / Jana Tshernjavskaja

    Index Scriptorium Estoniae

    Tshernjavskaja, Jana

    2004-01-01

    Tollivabatsooni mõistest ja ülesannetest vastavalt Euroopa Liidu tollikoodeksile. Eestis tegutsevate vabatsoonide (Muuga, Sillamäe, Valga) vastavusse viimisest EL-i vabakaubanduspiirkondade tüüpidega

  10. Sotsiaalne kapital ja majandusareng Euroopa Liidu kandidaatmaades / Eve Parts

    Index Scriptorium Estoniae

    Parts, Eve, 1970-

    2003-01-01

    Ülevaade sotsiaalse kapitali tasemest EL-i kandidaatmaades, kas ja kuidas mõjutab kandidaatriikide sotsiaalse kapitali taset liitumine EL-iga, kuidas oleks võimalik sotsiaalse kapitali akumulatsiooni kiirendada. Tabelid

  11. Omavalitsuse areng sõltub liialt toetustest / Merit Tatar

    Index Scriptorium Estoniae

    Tatar, Merit

    2005-01-01

    Kohalike omavalitsuste vajaduste selgitamiseks viis Innopolis Konsultatsioonid AS koostöös SEB Eesti Ühispangaga läbi uuringu, mis kaardistas omavalitsuste ootused ja vajadused seoses EL-i struktuurivahendite jaotamisega 2007-2013.

  12. EU eastward enlargement and the Baltic Sea region role in trade integration / Tiiu Paas

    Index Scriptorium Estoniae

    Paas, Tiiu, 1949-

    2003-01-01

    Läänemeremaade osast Baltimaade integratsioonis rahvusvahelisse kaubandusse. El-is on kaubavoogude elastsus peaaegu kaks korda suurem kui riikidel väljaspool seda, kusjuures see kehtib võrdselt nii ekspordi kui impordi kohta. Tabelid

  13. EU enlargement and trade integration : can we distinguish the Baltic Sea region cluster? / Tiiu Paas, Egle Tafenau

    Index Scriptorium Estoniae

    Paas, Tiiu, 1949-

    2004-01-01

    Uurimistulemused kinnitavad piiriüleste kaubandussidemete olemasolu ning Läänemere regiooni riikide omavahelise kaubandusintegratsiooni tugevust ühinevas Euroopas, millega tuleb EL-i regionaalpoliitika kujundamisel arvestada. Diagrammid. Tabel

  14. Инфотехнологии на службе трудовой миграции

    Index Scriptorium Estoniae

    2011-01-01

    Valmis analüüs immigratsioonipoliitikast Eestis, Saksamaal, Itaalias ja Kreekas ning kogu Euroopa Liidus Projektist, mis kuulub EL-i 7. raamprogrammi "Participatory Immigration Policy Making and Harmonization based on Collaborative Web2.0 Technologies"

  15. Energy leads talks

    Index Scriptorium Estoniae

    2011-01-01

    Leedu energeetikaminister Arvidas Sekmokas lubab teha kõik endast sõltuva, et Leedus hakataks põlevkivigaasi tootma. Baltimaade peaministrid ei ole suutnud siiani otsustada, millisesse riiki tuleb EL-i poolt osaliselt finantseeritav LNG-terminal

  16. Freak weather throws Balts into confusion / Talis Saule Archdeacon

    Index Scriptorium Estoniae

    Archdeacon, Talis Saule

    2007-01-01

    Erakordselt soe talv Baltimaades võib kahjustada suusakeskuste ja põllumajandusettevõtete majandustulemusi. Baltimaade võimalused EL-i uue kasvuhoonegaaside vähendamist nõudva keskkonnastrateegia täitmiseks

  17. Euroopa viis kriisi kartus pühenduda / Jeremy Rifkin ; interv. Arko Olesk

    Index Scriptorium Estoniae

    Rifkin, Jeremy

    2005-01-01

    Ameerika mõjukas mõtleja ja majandusteadlane Prantsusmaa ning Hollandi Euroopa Liidu põhiseaduse tagasilükkamise mõjust organisatsiooni arengule, ELi laienemise mõjust vanadele ja uutele liikmesriikidele, Eesti majandusmudelist

  18. Some empirical tests on the integration of economic activity between the euro area and the accession countries / Iikka Korhonen

    Index Scriptorium Estoniae

    Korhonen, Iikka

    2003-01-01

    Uurimusest, mille tulemusena selgus, et esimesena liitumisläbirääkimisi alustanud EL-i kandidaatriigid on enam integreeritud majandustegevusse eurotsoonis ning on lisaks liitumisele EL-iga valmis varem liituma ka Euroopa Rahaliiduga. Tabelid.

  19. Vizõ reshajut vsjo / Jevgenija Garanzha

    Index Scriptorium Estoniae

    Garanža, Jevgenija, 1979-

    2004-01-01

    Euroopa Komisjoni ja Venemaa läbirääkimistest, ettepanekutest lihtsustatud korra kehtestamise kohta Venemaa kodanikele viisade väljastamisel, mis viiks kaugemas tulevikus viisavabaduse kehtestamiseni Venemaa ja EL-i vahel

  20. The regulation of market communication and market behaviour: corporate social responsibility and the directives on unfair commercial practices and unfair contract terms / Anna Beckers

    Index Scriptorium Estoniae

    Beckers, Anna

    2017-01-01

    Ettevõtete sotsiaalse vastutuse poliitika õiguslikust määratlemisest ELi õiguses tarbijakaitse direktiivide 2005/29/EÜ (ebaausad kaubandustavad ettevõtjate ja tarbijate vahel) ja 1993/13/EMÜ (ebaõiglased tingimused tarbijalepingutes) taustal

  1. Fostering deep and comprehensive free trade agreements for the eastern partners / Per Magnus Wijkman

    Index Scriptorium Estoniae

    Wijkman, Per Magnus

    2011-01-01

    Laiaulatusliku ja kõikehõlmava vabakaubanduslepinguga (DCFTA) liitumise läbirääkimistest ELi idapartnerluse riikidega. Ida-Euroopa riikide ühinemisest kaupade ja teenuste vaba liikumisega. Joonised

  2. The inextricable saga of „pay for delay” cases: the EU versus the US approach / Marianna Meriani

    Index Scriptorium Estoniae

    Meriani, Marianna

    2017-01-01

    Konkurentsi ja seaduslike äristrateegiate seostest ning makseid sisaldavatest patendialastest kompromisskokkulepetest farmaatsiatööstuse näitel ELi ja Ameerika Ühendriikide käsitluste võrdluses

  3. Luubi all : www.lilly.com / Piret Potisepp

    Index Scriptorium Estoniae

    Potisepp, Piret

    2009-01-01

    Ravimifirma Eli Lilly & Company kogemusi, kuidas uusimate teadusuuringute tulemusi ravimitööstuses kasutades on võimalik arendada jätkusuutlikku tootmist ning laiendada tooteportfelli koostöövõrgustiku kujundamise teel

  4. Mari e-raamatukogu / Tatjana Verina ; vene keelest tõlkinud Ene Riet

    Index Scriptorium Estoniae

    Verina, Tatjana

    2011-01-01

    Mari e-raamatukogu loomise aluseks on Mari-Eli Vabariigi etnokultuuriliste ja rahvusvaheliste suhete arendamise projekt, hetkel on elektroonilises raamatukogus 52 täistekstilist teavikut Tšavaini nimelise Mari Rahvusraamatukogu haruldaste raamatute kogust

  5. Riik õpetab, kuidas kodud säästvalt soojaks saada / Kadri Bank

    Index Scriptorium Estoniae

    Bank, Kadri

    2008-01-01

    Riik kulutab järgneva kuue aasta jooksul elamute energiasäästlikumaks muutmisele 300 miljonit Euroopa Liidu eluasemepoliitikale mõeldud rahast. Diagramm: Energiatarbimine EL-is. Kommenteerivad Harri Paabo ja Jaan Tepp

  6. Promoting accessibility for disabled people using EU standardisation policy / David L. Hosking

    Index Scriptorium Estoniae

    Hosking, David L.

    2017-01-01

    Euroopa puuetega inimeste strateegiast juurdepääsetavusõiguste (tooted, teenused) aspektist ning ELi standardiseerimispoliitika osast selles ja ÜRO puuetega inimeste õiguste konventsiooni mõjust

  7. SOLVIT ئ abimees EL siseturul tekkivate probleemide lahendamisel

    Index Scriptorium Estoniae

    2008-01-01

    Majandus- ja kommunikatsiooniministeeriumis asuvast SOLVIT keskusest, mis on koostöövõrgustik ELi liikmesriikide vahel ja aitab lahendada siseturu probleeme kohtuväliselt. Täiendav teave aadressilt: http://www.mkm.ee/solvit

  8. Roland Peets : Piirivalvur on samasugune teenindaja nagu poemüüjagi / Roland Peets ; interv. Erik Kalda

    Index Scriptorium Estoniae

    Peets, Roland, 1957-

    2000-01-01

    Ida-Viru piirivalvepiirkonna ülem usub, et paari aasta pärast on Eesti piirivalve valmis valvama EL-i idapiiri. Piirivalve peamised probleemid Eesti-Vene piiril. Ilmunud ka: Severnoje Poberezhje 4. nov. lk. 5

  9. 75 FR 66977 - Housing Trust Fund

    Science.gov (United States)

    2010-10-29

    ...., administrative requirements; monitoring, site and neighborhood standards; and affirmative marketing). This... affordable multifamily rental housing. Income Targeting Based on tabulations of American Housing Survey data... housing for ELI households. The Secretary shall publish subsequent income targeting requirements when HUD...

  10. From Natural Monopoly to Public Utility: Technological Determinism and the Political Economy of Infrastructure in Progressive-Era America.

    Science.gov (United States)

    Plaiss, Adam

    In present-day debates regarding telecommunication policy, one frequently hears the terms natural monopoly and public utility. This article investigates the origins of these ideas, finding that Richard T. Ely-a celebrated American economist of the late nineteenth century-embedded in the term "natural monopoly" a narrative of technological determinism. By arguing that certain services had monopolizing tendencies hardwired into them, Ely argued for their regulation. Ely's theory of natural monopoly formed the basis of Wisconsin's 1907 public utilities law, which served as a model for many other states' regulatory policies. The modern notion of public utility thus carries with it the technological determinism of Ely's natural monopoly idea. By tracing the lineage of these two terms, this article recaptures the influence that activists and progressive politicians exercised over the formation of large technological systems during the Second Industrial Revolution.

  11. Asevälisminister Tshizhov avas Vene kaardid / Vladimir Tshizhov ; interv. Toomas Sildam

    Index Scriptorium Estoniae

    Tshizhov, Vladimir

    2004-01-01

    Vene asevälisminister rääkis visiidil Tallinna ajakirjanikele Venemaa murest seoses EL-i laienemisega euroliidu-Venemaa partnerluslepingust, Eesti-Vene suhetest, slaavi vähemustest Eestis, NATO kohustustest Venemaa suhtes

  12. Baltics seek representation in Russia / Marge Tubalkain-Trell

    Index Scriptorium Estoniae

    Tubalkain-Trell, Marge

    2008-01-01

    Euroopa Liidus, sh. Baltimaades elavad venelased kogunesid ümarlaual Luxembourgis. EL-i venelased soovivad oma esindatust Vene parlamendis. Gennadi Afanasjevi sõnul on venelaste olukord Eestis hea, kuid ei mõisteta tihti Eesti poliitikuid

  13. River Dialogue : empowerment & awareness building in river basin management through focus groups and citizens' juries / Margit Säre

    Index Scriptorium Estoniae

    Säre, Margit

    2004-01-01

    2003. a. käivitunud rahvusvaheline projekti Jõgede Dialoog eesmärgiks on uurida uusi efektiivseid meetodeid avalikkuse kaasamiseks veemajandus-alaste otsuste tegemisse. Üldsuse osalust nõuab EL-i Veepoliitika Raamdirektiiv

  14. 75 FR 7291 - Northeastern Great Basin Resource Advisory Council Meetings, Nevada

    Science.gov (United States)

    2010-02-18

    ...., Elko, Nevada; June 17 and 18 at the Eureka Opera House, 31 S. Main St., Eureka, Nevada; and September...; September 30 (Ely)--minerals, grazing, energy, and sustainable development Managers' reports of field office...

  15. Eesti maaelu arengukava 2004-2006 toetused / Ülle Puusta

    Index Scriptorium Estoniae

    Puusta, Ülle

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 71-72. Eesti maaelu arengukava meetmete rahastamisallikateks on EL-i eelarve (80%) ning Eesti riigieelarve (20%)

  16. Ahnus ajab Euroopa Liidu upakile / Uno Silberg

    Index Scriptorium Estoniae

    Silberg, Uno, 1964-

    2002-01-01

    Autori sõnul on EL-i ittalaienemise eesmärk seniste liikmesriikide heaolu suurendamine liituda soovivate maade arvel. Vanade ja uute liikmesriikide võrdset kohtlemist ei ole EL-il kavaski olnud. Euroskeptitsism

  17. SOS euroallutajate tagalas / Uno Silberg

    Index Scriptorium Estoniae

    Silberg, Uno, 1964-

    2001-01-01

    Autori arvates on tekkinud klassikaline revolutsioonieelne situatsioon, mille on kaasa toonud kasvav lõhe EL-i vastaste ja selle pooldajate vahel. Euroskeptitsism. Diagramm: Toetus Euroopa Liiduga liitumisele Baltimaades ning Kesk- ja Ida-Euroopa riikides

  18. LEADER jõudis Eestisse / Harda Roosna

    Index Scriptorium Estoniae

    Roosna, Harda, 1956-

    2006-01-01

    EL-i maaelu toetusprogrammi LEADER+ rakendamist on katsetatud Põlva-, Valga-, Pärnu- ja Võrumaal. Hiiumaal arutletakse programmi rakendamiseks vajaliku tegevusgrupi moodustamise üle märtsis. Lisad: Ajalugu; Näited

  19. Tulevikukujundaja avaldas kavandi Ühendatud Euroopast / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2002-01-01

    Prantsuse endine president Valery Giscard d'Estaing, kes juhib Euroopa tulevikku kavandavat konventi, esitas esialgse plaani EL-i tulevikust Ühendatud Euroopa või lausa Euroopa Ühendriikide nime all

  20. Parts : oleme valmis kompromissideks / Juhan Parts ; interv. Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Parts, Juhan, 1966-

    2004-01-01

    Peaminister Juhan Parts vastab küsimustele, mis on seotud Brüsselis algava Euroopa Liidu ülemkogu ehk EL-i valitsusjuhtide tippkohtumisega, põhiseaduse lepingu projektiga. Vt. samas: Volinike arvu piiramine kasulik