WorldWideScience

Sample records for europium 138

  1. Thermodynamic and structural description of europium complexation in 1-octanol - H2O solutions

    International Nuclear Information System (INIS)

    Vu, T.H.; Charbonnel, M.C.; Boubals, N.; Couston, L.; Arnaud, F.

    2008-01-01

    Polydentate N-bearing ligands such as bis-triazinyl-pyridines (BTPs) are interesting extractants for actinide(III)/lanthanide(III) separation. A description of europium complexation in 1-octanol solutions was undertaken to enhance the knowledge of the extraction mechanisms. The first solvation shell for europium(III) nitrate, chloride, and perchlorate with different amounts of water was determined by Time-Resolved Laser-Induced Fluorescence (TRLIF) spectroscopy. Europium nitrate complexation by iPr-BTP was then studied by TRLIF and micro-calorimetry; similar stability constants related to the formation of Eu(BTP) 2 3+ and Eu(BTP) 3 3+ were obtained by both techniques (log(β 2 ) = 9.0 ± 0.3 and log(β 3 ) = 13.8 ± 0.2). The presence of water in the octanol diluent has an influence on solvation of europium and also on the [Eu(BTP) 2 3+ ] / [Eu(BTP) 3 3+ ] ratio. (authors)

  2. Moessbauer studies of {sup 151}Eu in europium oxalate, europium bissalen ammonium and europium benzoate

    Energy Technology Data Exchange (ETDEWEB)

    Wynter, C. I., E-mail: wynterc@ncc.edu [Nassau Community College, Department of Chemistry (United States); Ryan, D. H. [McGill University, Centre for the Physics Materials, Department of Physics (Canada); Taneja, S. P. [Maharshi Dayanand University, Department of Physics (India); May, L. [Catholic University of America, Department of Chemistry (United States); Oliver, F. W. [Morgan State University, Department of Physics (United States); Brown, D. E. [Northern Illinois University, Department of Physics (United States); Iwunzie, M. [Morgan State University, Department of Chemistry (United States)

    2005-11-15

    Although a number of europium water insoluble chelates have been prepared for several decades, the covalent nature of these compounds has never been established in any quantitative fashion. Shifts in the I.R. bands and conductivity measurements of these salts were hitherto used to qualitatively compare their molecular nature. In this communique we have used temperature coefficients of {sup 151}Eu Moessbauer spectra to determine the Debye temperatures ({theta}{sub D}) of three europium chelates: namely europium oxalate, europium bissalen ammonium (recently reported) and europium benzoate and compared their {theta}{sub D} with the measured {theta}{sub D} of the known ionic EuF{sub 3}. Additionally, the mean square amplitude (europium bissalen ammonium (133 {+-} 5 K) and lastly the europium benzoate with a {theta}{sub D} of (105 {+-} 5 K).

  3. Thermodynamic and structural description of europium complexation in 1-octanol - H{sub 2}O solutions

    Energy Technology Data Exchange (ETDEWEB)

    Vu, T.H.; Charbonnel, M.C.; Boubals, N.; Couston, L. [CEA Marcoule, DEN/DRCP/SCPS/LCAM, BP 17171, 30207 Bagnols-sur-Ceze (France); Arnaud, F. [Laboratoire de Chimie Physique, IPHC, 25 rue Becquerel, 67087 Strasbourg (France)

    2008-07-01

    Polydentate N-bearing ligands such as bis-triazinyl-pyridines (BTPs) are interesting extractants for actinide(III)/lanthanide(III) separation. A description of europium complexation in 1-octanol solutions was undertaken to enhance the knowledge of the extraction mechanisms. The first solvation shell for europium(III) nitrate, chloride, and perchlorate with different amounts of water was determined by Time-Resolved Laser-Induced Fluorescence (TRLIF) spectroscopy. Europium nitrate complexation by iPr-BTP was then studied by TRLIF and micro-calorimetry; similar stability constants related to the formation of Eu(BTP){sub 2}{sup 3+} and Eu(BTP){sub 3}{sup 3+} were obtained by both techniques (log({beta}{sub 2}) = 9.0 {+-} 0.3 and log({beta}{sub 3}) = 13.8 {+-} 0.2). The presence of water in the octanol diluent has an influence on solvation of europium and also on the [Eu(BTP){sub 2}{sup 3+}] / [Eu(BTP){sub 3}{sup 3+}] ratio. (authors)

  4. Europium-151 Moessbauer spectroscopic and XANES investigation of europium-exchanged Y-zeolite

    International Nuclear Information System (INIS)

    Berry, F.J.; Marco, J.F.; Steel, A.T.

    1994-01-01

    Eu 3+ in ca. 10 wt% europium-exchanged Y-zeolite is partially reduced by treatment in hydrogen at 600 C to Eu 2+ . The reduction of Eu 3+ is more readily achieved in Y-zeolite than in europium(III) oxide. The discrepancy in the extent of reduction as revealed by 151 Eu Moessbauer spectroscopy and near edge X-ray absorption fine structure (XANES) is associated with any difference in the recoil free fractions of Eu 2+ and Eu 3+ which may exist at 298 K and the enhanced sensitivity of the XANES to changes in the europium oxidation state. (orig.)

  5. Synthesis and spectral properties of europium phthalocyanine complexes

    International Nuclear Information System (INIS)

    Maksimova, K.N.; Bazyakina, N.L.; Kutyreva, V.V.; Suvorova, O.N.; Domrachev, G.A.

    2008-01-01

    Synthesis of europium monophthalocyanic complexes with thenoyltrifluroacetonate (tta) and ferrocenoyltrifluoroacetate (fta) ligands has been considered. Spectral characteristics of complexes PcEu(tta)(ttaH) and PcEu(fta)(ftaH) (Pc - phthalocyanine ligand) have been investigated. One of β-diketonate ligand is proposed to bind with europium ion covalently, and the second ligand saturates coordination sphere of europium due to donor-acceptor binding [ru

  6. Europium-155 in Debris from Nuclear Weapons

    DEFF Research Database (Denmark)

    Aarkrog, Asker; Lippert, Jørgen Emil

    1967-01-01

    The lithium-drifted germanium detector enables determination of europium-155 on a routine basis in environmental samples contaminated with debris from nuclear weapons. From measurements of europium-155, cesium-144, and strontium-90 in air filters collected between 1961 and 1966, the yield...

  7. Statistical optimization of synthesis procedure and characterization of europium (III) molybdate nano-plates

    Energy Technology Data Exchange (ETDEWEB)

    Pourmortazavi, Seied Mahdi [Malek Ashtar University of Technology, Faculty of Material and Manufacturing Technologies, P. O. Box 16765-3454, Tehran (Iran, Islamic Republic of); Rahimi-Nasrabadi, Mehdi [Imam Hossein University, Nano Science Center, Tehran (Iran, Islamic Republic of); Fazli, Yousef [Islamic Azad University, Department of Chemistry, Faculty of Science, Arak Branch, Arak (Iran, Islamic Republic of); Mohammad-Zadeh, Mohammad [Sabzevar University of Medical Sciences, Department of Physiology and Pharmacology, School of Medicine, Sabzevar (Iran, Islamic Republic of)

    2015-06-15

    Europium (III) molybdate nano-plates were synthesized in this work via chemical precipitation route involving adding of europium (III) ion solution to the aqueous solution of molybdate reagent. Effects of some reaction variables such as concentrations of europium and molybdate ions, flow rate of europium reagent, and reactor temperature on the diameter of the synthesized europium (III) molybdate nano-plates were experimentally investigated by orthogonal array design. The results showed that the size of europium (III) molybdate nano-plates can be optimized by adjusting the concentrations of europium (III) and molybdate ions, as well as the reactional temperature. Europium (III) molybdate nano-plates prepared under the optimum conditions were characterized by X-ray powder diffraction, scanning electron microscopy, and Fourier transform infrared spectroscopy. (orig.)

  8. X-ray structural analysis of plasma sprayed europium oxide

    Energy Technology Data Exchange (ETDEWEB)

    Gorshkov, B.N.; Loskutov, V.S.; Gavrish, A.A.; Shakh, G.E.

    1981-12-01

    An X-ray structure microanalysis is made for europium oxide powder produced by sintering and plasmic spheroidization for plasma spraying. The technique of concern is shown not to alter chemical composition of the powder. It is stated that a rise in the plasma jet enthalpy while spraying does not result in dissociation of europium oxide and its interaction with the plasma flux. The coating (to 15.2 kWxs/g) is found to have only a high-temperature (monoclinic) europium oxide phase and there appears a low-temperature (cubic) phase with a subsequent increase in the enthalpy. The plasma jet enthalpy increasing the grain size and the crystal lattice c parameter of the sprayed europium oxide are shown to decrease; the a parameter reduces with an enthalpy growth to 16.2 kW s/g and then smoothly increases with the enthalpy further growth. It is noticed that the europium oxide coating does not interact with an aluminium D16 alloy substrate.

  9. Resonance ionization scheme development for europium

    Energy Technology Data Exchange (ETDEWEB)

    Chrysalidis, K., E-mail: katerina.chrysalidis@cern.ch; Goodacre, T. Day; Fedosseev, V. N.; Marsh, B. A. [CERN (Switzerland); Naubereit, P. [Johannes Gutenberg-Universität, Institiut für Physik (Germany); Rothe, S.; Seiffert, C. [CERN (Switzerland); Kron, T.; Wendt, K. [Johannes Gutenberg-Universität, Institiut für Physik (Germany)

    2017-11-15

    Odd-parity autoionizing states of europium have been investigated by resonance ionization spectroscopy via two-step, two-resonance excitations. The aim of this work was to establish ionization schemes specifically suited for europium ion beam production using the ISOLDE Resonance Ionization Laser Ion Source (RILIS). 13 new RILIS-compatible ionization schemes are proposed. The scheme development was the first application of the Photo Ionization Spectroscopy Apparatus (PISA) which has recently been integrated into the RILIS setup.

  10. Study of the europium behavior in aqueous media

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.; Martinez M, V.

    1999-01-01

    Europium as waste can produce a pollution problem in water that is in contact with it, what would has a heavy environmental impacts, because of the possibilities of diffusion of these wastes from their place of confinement or storage until the geo and biosphere. The solution of such problem requires of a lot of knowledge over the behavior of several chemical elements such as europium in aqueous solutions. In this work it was used a low ion force (0.02 M). The data set will allow extrapolate the hydrolytic behavior of europium in too much minors ion force media, such as the ground waters, including in ion force zero

  11. Enhancement in red emission at room temperature from europium doped ZnO nanowires by 1,10 phenanthroline-europium interface induced resonant excitations

    Directory of Open Access Journals (Sweden)

    Soumen Dhara

    2017-02-01

    Full Text Available We show that europium doped ZnO nanowires after surface modification with organic ligand, 1,10 phenanthroline (phen leads to strong red emission at 613 nm which is a characteristic emission from the atomic levels of Eu3+. Surface modification with phen leads to formation of phenanthroline-europium interface on the surface of the nanowires due to attachment of Eu3+ ions. After an optimized surface modification with phen, intensity of both the UV emission (band edge and red emission improved by two orders of magnitude at room temperature. We observed multiple energy transfer pathways to the energy levels of Eu3+ ions through the phenanthroline-europium interface, which found to be very effective to the significant enhancement of emission from the dopant Eu3+. This study shows a new insight in to the energy transfer process from phen to the europium doped ZnO system.

  12. Preparation and spectral properties of europium hydrogen squarate microcrystals

    Science.gov (United States)

    Kolev, T.; Danchova, N.; Shandurkov, D.; Gutzov, S.

    2018-04-01

    A simple scheme for preparation of europium hydrogen squarate octahydrate microcrystals, Eu(HSq)3·8H2O is demonstrated. The microcrystalline powders obtained have a potential application as non-centrosymmetric and UV radiation - protective hybrid optical material. The site-symmetry of the Eu - ion is C2V or lower, obtained from diffuse reflectance spectra. The formation of europium hydrogen squarate is supported by IR - spectroscopy, UV-vis spectroscopy, chemical analysis and X-ray diffraction. A detailed analysis of the UV-vis and IR spectra of the micropowders prepared is presented. The reaction between europium oxide and squaric acid leads to formation of microcrystalline plate-like crystals of europium hydrogen squarate Eu(HSq)3·8H2O, a non-centrosymmetric hybrid optical material with a potential application as UV radiation - protective coatings.

  13. Europium polyoxometalates encapsulated in silica nanoparticles - characterization and photoluminescence studies

    Energy Technology Data Exchange (ETDEWEB)

    Neves, Cristina S.; Granadeiro, Carlos M.; Cunha-Silva, Luis; Eaton, Peter; Balula, Salete S.; Pereira, Eulalia [REQUIMTE/Departamento de Quimica e Bioquimica, Faculdade de Ciencias, Universidade do Porto (Portugal); Ananias, Duarte [CICECO, Departamento de Quimica, Universidade de Aveiro (Portugal); Gago, Sandra [REQUIMTE, Departamento de Quimica, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Monte de Caparica (Portugal); Feio, Gabriel [CENIMAT/I3N, Departamento de Ciencia dos Materiais, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Monte de Caparica (Portugal); Carvalho, Patricia A. [ICEMS/Departamento de Bioengenharia, Instituto Superior Tecnico, Lisboa (Portugal)

    2013-06-15

    The incorporation of europium polyoxometalates into silica nanoparticles can lead to a biocompatible nanomaterial with luminescent properties suitable for applications in biosensors, biological probes, and imaging. Keggin-type europium polyoxometalates Eu(PW{sub 11}){sub x} (x = 1 and 2) with different europium coordination environments were prepared by using simple methodologies and no expensive reactants. These luminescent compounds were then encapsulated into silica nanoparticles for the first time through the water-in-oil microemulsion methodology with a nonionic surfactant. The europium polyoxometalates and the nanoparticles were characterized by using several techniques [FTIR, FT-Raman, {sup 31}P magic angle spinning (MAS) NMR, and TEM/energy-dispersive X-ray spectroscopy (TEM-EDS), AFM, dynamic light scattering (DLS), and inductively coupled plasma MS (ICP-MS) analysis]. The stability of the material and the integrity of the europium compounds incorporated were also examined. Furthermore, the photoluminescence properties of the Eu(PW{sub 11}){sub x} rate at SiO{sub 2} nanomaterials were evaluated and compared with those of the free europium polyoxometalates. The silica surface of the most stable nanoparticles was successfully functionalized with appropriate organosilanes to enable the covalent binding of oligonucleotides. (Copyright copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. Europium ion as a probe for binding sites to carrageenans

    International Nuclear Information System (INIS)

    Ramos, Ana P.; Goncalves, Rogeria R.; Serra, Osvaldo A.; Zaniquelli, Maria Elisabete D.; Wong, Kenneth

    2007-01-01

    Carrageenans, sulfated polysaccharides extracted from red algae, present a coil-helix transition and helix aggregation dependence on the type and concentration of counterions. In this study, we focus attention on a mixed valence counterion system: Eu 3+ /Na + or K + with different gel-forming carrageenans: kappa, iota, and kappa-2. Results of stationary and time-dependent luminescence showed to be a suitable tool to probe ion binding to both the negatively charged sulfate group and the hydroxyl groups present in the biopolymer. For lower europium ion concentrations, a single longer decay emission lifetime was detected, which was attributed to the binding of europium ion to the carrageenan sulfate groups. An additional decay ascribed to europium binding to hydroxyl groups was observed above a threshold concentration, and this decay was dependent on the carrageenan charge density. Symmetry of the europium ion microenvironment was estimated by the ratio between the intensities of its emission bands, which has been shown to depend on the concentration of europium ions and on the specificity of the monovalent counterion bound to the carrageenan

  15. Europium ion as a probe for binding sites to carrageenans

    Energy Technology Data Exchange (ETDEWEB)

    Ramos, Ana P.; Goncalves, Rogeria R.; Serra, Osvaldo A. [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, Ribeirao Preto, Sao Paulo 14040-901 (Brazil); Zaniquelli, Maria Elisabete D. [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, Ribeirao Preto, Sao Paulo 14040-901 (Brazil)], E-mail: medzaniquelli@ffclrp.usp.br; Wong, Kenneth [Laboratorio de Fisico-Quimica, Centro de Pesquisas de Paulinia, Rhodia Brasil, Paulinia, Sao Paulo (Brazil)

    2007-12-15

    Carrageenans, sulfated polysaccharides extracted from red algae, present a coil-helix transition and helix aggregation dependence on the type and concentration of counterions. In this study, we focus attention on a mixed valence counterion system: Eu{sup 3+}/Na{sup +} or K{sup +} with different gel-forming carrageenans: kappa, iota, and kappa-2. Results of stationary and time-dependent luminescence showed to be a suitable tool to probe ion binding to both the negatively charged sulfate group and the hydroxyl groups present in the biopolymer. For lower europium ion concentrations, a single longer decay emission lifetime was detected, which was attributed to the binding of europium ion to the carrageenan sulfate groups. An additional decay ascribed to europium binding to hydroxyl groups was observed above a threshold concentration, and this decay was dependent on the carrageenan charge density. Symmetry of the europium ion microenvironment was estimated by the ratio between the intensities of its emission bands, which has been shown to depend on the concentration of europium ions and on the specificity of the monovalent counterion bound to the carrageenan.

  16. SEPARATION OF EUROPIUM FROM OTHER LANTHANIDE RAE EARTHS BY SOLVENT EXTRACTION

    Science.gov (United States)

    Peppard, D.F.; Horwitz, E.P.; Mason, G.W.

    1963-02-12

    This patent deals with a process of separating europium from other lanthanides present in aqueous hydrochloric or sulfuric acid solutions. The europium is selectively reduced to the divalent state with a divalent chromium salt formed in situ from chromium(III) salt plus zinc amalgam. The other trivalent lanthanides are then extracted away from the divalent europium with a nitrogen-flushed phosphoric acid ester or a phosphonic acid ester. (AEC)

  17. Organophosphate Nerve Agent Detection with Europium Complexes

    Directory of Open Access Journals (Sweden)

    Jake R. Schwierking

    2004-01-01

    Full Text Available We explore the detection of paraoxon, a model compound for nonvolatile organophosphate nerve agents such as VX. The detection utilizes europium complexes with 1,10 phenanthroline and thenoyltrifluoroacetone as sensitizing ligands. Both europium luminescence quenching and luminescence enhancement modalities are involved in the detection, which is simple, rapid, and sensitive. It is adaptable as well to the more volatile fluorophosphate nerve agents. It involves nothing more than visual luminescence observation under sample illumination by an ordinary hand-held ultraviolet lamp.

  18. APW research of europium monochalcogenides. 1

    International Nuclear Information System (INIS)

    Farberovich, O.V.; Vlasov, S.V.

    1981-01-01

    The augmented plane wave method (APW) is used for a theoretical study of the electron properties of europium monochalcogenides. Spin-polarized energy band calculations of the ferromagnetic EuO, EuS, and EuSe explain qualitatively the exchange interactions therein. Based on the APW data in the frame of perturbation theory the Coulomb electron-electron interaction at the 4f shell of europium is taken into account for EuO and EuS. The band structures and the multiplet terms of the f 6 d and 3d 9 4f 8 excited states gives a new interpretation of a known experimental spectra for these compounds. (author)

  19. Sulfur, cobalt and europium activation from the A-bombs in Japan

    International Nuclear Information System (INIS)

    Gritzner, M.L.; Egbert, S.D.; Woolson, W.A.

    1987-01-01

    Comparisons are made between calculations and measurements of in-situ sulfur, cobalt, and europium activation by neutrons at Hiroshima and Nagasaki to check the validity of the neutron sources and transport air-over-ground used in the new Dosimetry System 1986 (DS86). Europium and cobalt are activated by epithermal/thermal neutrons. The sulfur activation has an effective threshold around 2 MeV. Comparisons of sulfur activation at Hiroshima, which necessitate considering the tilt and heading of the cylindrically shaped Little Boy bomb, confirm the high energy neutron portion of the source relevant to sulfur activation. The europium and cobalt activation calculations tend to be higher than the measurements for ground ranges within 300 m and lower than the measurements beyond 700 m. Thus, the cobalt and europium measurements do not validate the source or the transport, embodied in DS87, for those neutrons relevant to europium and cobalt activation. Presently, it is unresolved as to whether the discrepancy can be explained as a problem in the measurements, in their interpretation, or as a problem in the calculations due to the source neutrons and/or their transport from source to the sample site

  20. Soluble dendrimers europium(III) β-diketonate complex for organic memory devices

    International Nuclear Information System (INIS)

    Wang Binbin; Fang Junfeng; Li Bin; You Han; Ma Dongge; Hong Ziruo; Li Wenlian; Su Zhongmin

    2008-01-01

    We report the synthesis of a soluble dendrimers europium(III) complex, tris(dibenzoylmethanato)(1,3,5-tris[2-(2'-pyridyl) benzimidazoly]methylbenzene)-europium(III), and its application in organic electrical bistable memory device. Excellent stability that ensured more than 10 6 write-read-erase-reread cycles has been performed in ambient conditions without current-induced degradation. High-density, low-cost memory, good film-firming property, fascinating thermal and morphological stability allow the application of the dendrimers europium(III) complex as an active medium in non-volatile memory devices

  1. Synthesis of samarium, europium and ytterbium acetylenides

    International Nuclear Information System (INIS)

    Bochkarev, M.N.; Fedorova, E.A.; Glushkova, N.V.; Protchenko, A.V.; Druzhkov , O.N.; Khorshev, S.Ya.

    1995-01-01

    Ethynyl complexes of samarium, europium and ytterbium were prepared by interaction of naphthalinides of metals with acetylene in tetrahydrofuran. The compounds are isolated in the form of dark-coloured pyrophore powders. Data of magnetic measurements suggest that in the course of the reaction Sm(2) is oxidized completely to Sm(3), Yb(2) transforms into Yb(3) partially, whereas europium preserves its initial bivalent state. Hydrolysis of the compounds prepared provides acetylene, ethylene, ethane and hydrogen which indicates the presence of acethylenide Ln 2 C 2 and hydride LnH groupings (Ln = Sm, Eu, Yb). 9 refs., 2 tabs

  2. Preparation of 1 Ci of europium 155 without carrier; Une methode de production d'europium 155 sans entraineur au niveau du curie

    Energy Technology Data Exchange (ETDEWEB)

    Falconi, N; Radicella, R [Commissariat a l' Energie Atomique, Dir. des Materiaux et Combustibles Nucleaires, Saclay (France). Centre d' Etudes Nucleaires

    1968-07-01

    High activity 'point' sources of {sup 155}Eu are used for medical and industrial applications. For this purpose we have studied a method of obtaining I Ci of carrier free {sup 155}Eu, with a solid residue smaller than 5 mg per Ci. In order to separate the {sup 155}Eu from several grams of a {sup 154}Sm enriched target we propose a procedure which is based on the work of Bouissieres and David, Onstott, and Takekoshi et al. The separation is carried out by electrolysis on a mercury cathode followed by purification on ion exchange resin. The yields of the europium separation and target recovery are 80 per cent and 90 per cent respectively. The time required for the procedure is three days. (authors) [French] L'obtention de sources ponctuelles de haute activite d'europium-l55 est interessante tant pour des usages medicaux qu'industriels. Nous avons cherche le moyen de preparer en une seule fois, une solution d'un curie d'europium-155 sans entraineur presentant un extrait sec inferieur a 5 mg par curie. En se basant sur des travaux de Bouissieres et Davis, d'Onstott, et de Takekoshi et coll., nous avons mis au point une methode permettant de separer l'europium-155 de sa cible de samarium enrichi en {sup 154}Sm par une electrolyse sur cathode de mercure suivie d'une purification sur resine echangeuse d'ions. Les rendements chimiques de separation de l'europium et de recuperation de la cible de samarium enrichi sont respectivement de 80 pour cent et 90 pour cent. La duree de l'operation est de 3 jours. (auteurs)

  3. On the existence of europium aluminum oxynitrides with a magnetoplumbite or beta-alumina type structure

    NARCIS (Netherlands)

    Hintzen, H.T.J.M.; Hanssen, R.; Jansen, S.R.; Metselaar, R.

    1999-01-01

    In the literature confusion exists concerning the structure type, the valence of europium, and the amount of nitrogen incorporation of the compound europium aluminum oxynitride. By using X-ray diffraction and luminescence measurements, we show that europium aluminum oxynitride has the

  4. Investigations of white light emitting europium doped zinc oxide nanoparticles

    International Nuclear Information System (INIS)

    Ashtaputre, S S; Nojima, A; Marathe, S K; Matsumura, D; Ohta, T; Tiwari, R; Dey, G K; Kulkarni, S K

    2008-01-01

    Europium doped zinc oxide nanoparticles have been synthesized using a chemical route. The amount of doped europium was varied which shows the changes in the photoluminescence (PL) intensity. The post synthesis annealing effect on the properties of ZnO nanoparticles has also been investigated. In general, PL is broad and a white light is emitted which originates from ZnO and the intra-4f transitions of Eu 3+ ions. The x-ray diffraction patterns do not show any Eu-related peaks for as-synthesized ZnO nanoparticles as well as for annealed samples. X-ray absorption spectroscopy reveals that europium ions are present on the surface of the core of ZnO and inside the shell of zinc hydroxide [Zn(OH 2 )] after annealing

  5. Highly sensitive sorption-luminescence determination of trace europium with preconcentration on silica chemically modified with iminodiacetic acid

    International Nuclear Information System (INIS)

    Voronina, R.D.; Zorov, N.B.

    2007-01-01

    Features of a sorption-luminescence method for the determination of trace europium were studied. The method includes the preliminary sorption of europium at pH 7.1 from solutions with silica chemically modified with iminodiacetic acid, the subsequent treatment of the sorbent with 2-thenoyltrifluoroacetone at pH 8.0, and the measurement of the intensity of luminescence of the surface three-component europium complex at 613 nm. The effect of moisture as the quencher of luminescence of the surface europium complex was studied, and techniques for its removal were proposed. Sorption in the static mode provides the detection limit of europium of 7 x 10 -5 g/ml. The calibration plot is linear in the range of two orders of magnitude of europium concentration in solutions. The relative standard deviation in the determination of 1.5 x 10 -2 μg/ml europium is 5%. In the dynamic mode of sorption from 1000 ml of an analyzed solution with the use of sorption-desorption, the detection limit of europium of 8 x 10 -7 μg/ml was attained [ru

  6. Development of ultraviolet LED devices containing europium (III) complexes in fluorescence layer

    International Nuclear Information System (INIS)

    Iwanaga, Hiroki; Amano, Akio; Aiga, Fumihiko; Harada, Kohichi; Oguchi, Masayuki

    2006-01-01

    Relations between molecular structures of europium complexes and their luminescent properties were investigated. Europium complex with β-diketones and two different phosphine oxides 8 was highly soluble in fluorinated medium, and realized largest fluorescence intensities. The luminous intensity of ultraviolet light emitting diodes devices (LEDs) whose fluorescence layer consists of fluorinated polymer and 8 was over 200 mcd (20 mA). Fluorescence compounds of this type are promising for application in next-generation white LEDs. Moreover, we proposed a novel molecular design of europium complex with asymmetric diphosphine dioxide

  7. Sorption of small amounts of europium(III) on iron(III) hydroxide and oxide

    International Nuclear Information System (INIS)

    Music, S.; Gessner, M.; Wolf, R.H.H.

    1979-01-01

    The sorption of small amounts of europium(III) on iron(III) hydroxide and oxide has been studied as a function of pH. The mechanism of sorption is discussed. Optimum conditions have been found for the preconcentration of small or trace amounts of europium(III) by iron(III) hydroxide and oxide. The influence of complexing agents (EDTA, oxalate, tartrate and 5-sulfosalicylic acid) on the sorption of small amounts of europium(III) on iron(III) oxide has also been studied. (author)

  8. Characterisation of kaolinite and adsorption of europium on kaolinite

    International Nuclear Information System (INIS)

    Olin, M.; Puhakka, E.; Lehikoinen, J.; Puukko, E.; Hakanen, M.; Lindberg, A.

    2007-10-01

    Kaolinite is a common fracture mineral in many crystalline rocks and, thus, a potential sorbent for groundwater solutes. The low cation-exchange capacity makes kaolinite a good mineral to study sorption by inner-sphere complexation of multivalent ions, such as trivalent actinides or their analogues, the trivalent lanthanides. The sorption of europium and americium on kaolinite has been studied previously by Puukko and Hakanen using a natural kaolinite, KGa-1b (from the Clay Minerals Society, USA). This work describes the determination of surface-charging mechanism and surface acidity constants for KGa-1b kaolinite, and adsorption of Eu(III) on both the natural (KGa-1b) and its acid-conditioned form (HKGa). The ionic strength of the background NaNO 3 electrolyte used in these titrations was 0.05 M, 0.1 M and 0.5 M. The surface acidity of kaolinite was explained using the FITEQL software by applying the 1-pK model. The optimized concentration of surface sites was close to a value previously reported for KGa-1b kaolinite. The adsorption modelling of europium was carried out by adopting one surfacecomplexation and one cation-exchange reaction. In the acidic pH range, sorption of europium decreased with increasing ionic strength of the NaNO 3 solution, which is an indication of the dominance of cation exchange or outer-sphere complexation. At the lowest ionic strength, the sorption was reversible. In the 0.1 M and 0.5 M NaNO 3 solutions, the sorption of europium in the basic pH range was only partly reversible, or desorption kinetically slow. The degree of irreversibility increased with increasing pH and ionic strength. A diffuse-layer model was readily fitted on the per-cents sorbed scale (default in FITEQL), but the results were not as good on a Kd scale, especially at circumneutral pH values. In the water analysis of the batch titration of KGa-1b kaolinite, the main observed elements were aluminium and zinc. The concentrations of Al and Zn decreased with p

  9. Magnetic and structural properties of yellow europium oxide compound and Eu(OH)3

    International Nuclear Information System (INIS)

    Lee, Dongwook; Seo, Jiwon; Valladares, Luis de los Santos; Avalos Quispe, O.; Barnes, Crispin H.W.

    2015-01-01

    A new material based on a yellow europium oxide compound was prepared from europium oxide in a high vacuum environment. The structural and magnetic properties of the material were investigated. Owing to the absence of a crystal structure, the material exhibited a disordered magnetic behavior. In a reaction with deionized (DI) water without applied heat, the compound assumed a white color as soon as the DI water reached the powder, and the structure became polycrystalline Eu(OH) 3 . The magnetic properties, such as the thermal hysteresis, disappeared after the reaction with DI water, and the magnetic susceptibility of the yellow oxide compound weakened. The magnetic properties of Eu(OH) 3 were also examined. Although Eu 3+ is present in Eu(OH) 3 , a high magnetic moment due to the crystal field effect was observed. - Graphical abstract: (top left) Optical image of the yellow europium oxide compound. (top right) Optical image of the product of DI water and yellow europium oxide. (bottom) Magnetization curves as a function of temperature measured in various magnetic field. - Highlights: • We prepared a new material based on a yellow europium oxide compound from europium oxide. • We characterized the magnetic properties of the material which exhibits a disordered magnetic behavior such as thermal hysteresis. • The compound turned white (Eu(OH) 3 ) as soon as the DI water reached the powder. • The thermal hysteresis disappeared after the reaction with DI water and the magnetic susceptibility of the yellow oxide compound weakened

  10. Synthesis and luminescence properties for europium oxide nanotubes

    International Nuclear Information System (INIS)

    Mo Zunli; Deng Zhepeng; Guo Ruibin; Fu Qiangang; Feng Chao; Liu Pengwei; Sun Yu

    2012-01-01

    Highlights: ► A novel high temperature sensitive fluorescent CNTs/Eu 2 O 3 nanocomposite was fabricated. ► The nanocomposite showed strong fluorescent emission peaks at around 540 and 580 nm after calcined beyond 620 °C for 4 h. ► The ultrahigh fluorescence intensity of the nanocomposites resulted from a synergetic effect of CNTs and europium oxide. ► We also discovered that CNTs had an effect of fluorescence quenching. - Abstract: A novel high temperature sensitive fluorescent nanocomposite has been successfully synthesized by an economic hydrothermal method using carbon nanotubes (CNTs), europium oxide, and sodium dodecyl benzene sulfonate (SDBS). To our great interest, the nanocomposites show high temperature sensitivity after calcinations at various temperatures, suggesting a synergetic effect of CNTs and europium oxide which leads to ultrahigh fluorescence intensity of europium oxide nanotubes. When the novel high temperature sensitive fluorescent nanocomposites were calcined beyond 620 °C for 4 h, the obtained nanocomposites have a strong emission peak at around 540 and 580 nm, due to the 5 D 0 → 7 F j (j = 0, 1) forced electric dipole transition of Eu 3+ ions. In turn, the emission spectra showed a slight blue shift. The intensity of this photoluminescence (PL) band is remarkably temperature-dependent and promotes strongly beyond 620 °C. This novel feature is attributed to the thermally activated carrier transfer process from nanocrystals and charged intrinsic defects states to Eu 3+ energy levels. The novel high temperature sensitive fluorescent nanocomposite has potential applications in high temperature warning materials, sensors and field emission displays. It is also interesting to discover that CNTs have the effect of fluorescence quenching.

  11. Luminescent properties of europium different-ligand complexes with cyclic. beta. -diketones and diantipyrylalkanes

    Energy Technology Data Exchange (ETDEWEB)

    Ul' yanova, T M; Gerasimenko, G N; Tishchenko, M A; Vitkun, R A [AN Ukrainskoj SSR, Odessa. Fiziko-Khimicheskij Inst.

    1983-03-01

    Using luminescence method different-ligand complexing of europium ions with diantipyrylalkanes and cyclic ..beta..-diketones: 2-acetyl- and 2-benzoyl-1.3-indandions, has been studied. The optimum conditions of the formation of different-ligand complexes and the ratio of components in it are determined. Effect of alien lanthanides and diantipyrylmethane derivatives on the luminescence intensity of europium complexes is clarified. A correlation between the ratio of the luminescence intensity bands of europium complexes and the values of oscillator strengths of supersensitive transitions of neodymium and erbium absorption bands is established.

  12. Extraction of europium (3) ions with stearic acid

    International Nuclear Information System (INIS)

    Lobanov, F.I.; Gladyshchev, V.P.; Nurtaeva, A.K.; Andreeva, N.N.

    1981-01-01

    Extraction of europium (3) in nitric acid solutions with the melts of stearic acid and its mixtures with paraffin at (80+-1) deg C is studied. The constant of stearic acid dimerization in paraffin K 2 =9.6+-0.6 and the constant of stearic acid distribution in the paraffin-water system Ksub(D,HA)=(1.06+-0.07)x10sub(3) are determined. The diagram of europium ion extraction at initial concentrations of metal in the aqueous phase of 10 -4 -10 -3 mol/l is suggested. The compound extracted has the EuA 3 composition with extraction constant of lg Ksub(ex)=-7.58 [ru

  13. Synthesis and spectroscopic behavior of highly luminescent trinuclear europium complexes with tris-β-diketone ligand

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Dunjia, E-mail: dunjiawang@163.com; Pi, Yan; Liu, Hua; Wei, Xianhong; Hu, Yanjun; Zheng, Jing

    2014-11-15

    Highlights: • Synthesis of the tris-β-diketone ligand and its trinuclear europium complexes. • Photoluminescence behavior of trinuclear europium complexes. • Analysis of the Judd–Ofelt intensity parameters (Ω{sub t}), lifetime (τ) and quantum yield (η). - Abstract: A new tris-β-diketone ligand, 2-[4,6-bis-(1-benzoyl-2-oxo-2-phenyl-ethyl)-[1,3,5]triazin-2-yl] -1,3-diphenyl-propane-1,3-dione (H{sub 3}L), and its trinuclear europium complexes, Eu{sub 3}(DBM){sub 6}L (C1), Eu{sub 3}(DBM){sub 6}(Bipy){sub 3}L (C2) and Eu{sub 3}(DBM){sub 6}(Phen){sub 3}L (C3) were synthesized and their spectroscopic behaviors were studied by FT-IR, {sup 1}H NMR, UV–vis and photoluminescence spectroscopic techniques. These europium complexes exhibited the characteristic emission bands that arise from the {sup 5}D{sub 0} → {sup 7}F{sub J} (J = 0–4) transitions of the europium ion in solid state. The Ω{sub 2} and Ω{sub 4} intensity parameters, lifetime (τ) and luminescence quantum yield (η) were calculated according to the emission spectra and luminescence decay curves in solid state. The results indicated that these trinuclear europium complexes displayed a longer lifetime (τ) and higher luminescence quantum efficiency (η), especially complexes C2 (τ = 0.820 ms, η = 46.5%) and C3 (τ = 0.804 ms, η = 47.4%), which due to the effect of two additional europium ion lumophors and the introduction of the third ligands, Bipy or Phen in trinuclear complexes. Their Ω{sub 2} values demonstrated that the europium ion in these complexes is in a highly polarizable chemical environment.

  14. Spectroscopic studies of europium-tetracyclines complexes and their applications in detection of hydrogen peroxide and urea peroxide

    International Nuclear Information System (INIS)

    Grasso, Andrea Nastri

    2010-01-01

    In this work were studied the spectroscopic properties of trivalent europium ion complexed with components of tetracycline family, chlorotetracycline, oxytetracycline and metacycline, in the presence of hydrogen peroxide and urea peroxide. Optical parameters were obtained such as absorption, emission, lifetime and calibration curves were constructed for luminescence spectra. Experiments were carried out with both inorganic compounds and europium-tetracyclines complexes in order to verify possible interferences. Studies for glucose determination were also described using europium-tetracyclines complexes as biosensors. Results show that europium tetracyclines complexes emit a narrow band in the visible region and, in the presence of hydrogen peroxide or urea peroxide there is a greater enhancement in their luminescence and lifetime. Thus, europium-tetracyclines complexes studied can be used as biosensors for hydrogen and urea peroxides determination as a low cost and room temperature method. An indirect method for glucose determination was studied by adding glucose oxidase enzyme in europium-tetracyclines complex in the presence of glucose promoting as product hydrogen peroxide. (author)

  15. On the composition of nonstoichiometric europium monoxide

    International Nuclear Information System (INIS)

    Ignat'eva, N.I.

    1990-01-01

    Consideration is given to results of of investigation into chemical composition, homogeneity region, type of disordering of nonstoichiometric europium monoxide. Precision methods of X-ray diffraction, electron-microscopic, atomic-absorption chemical analysis were used. It is shown that lattice volume reduces with increase of oxygen content in the oxide. For monocrystal of EuO 1.01 composition a=5.146 A. All samples of europium monoxide are characterized by low conductivity. Conductivity value changes by two orders (from 10 -8 to 10 -6 Θ -1 ·cm -1 ) when passing from the sample of stoichiometric composition to maximally disordered one. The disordering is considered according to the type of charged cation vacancies, leading to occurrence of equivalent number of electron defects of positive holes. 4 refs.; 1 tab

  16. Formation of americium and europium humate complexes

    International Nuclear Information System (INIS)

    Minai, Y.; Tominaga, T.; Meguro, Y.

    1991-01-01

    Binding constants of americium and europium with a humic acid were determined to study if complex formation of trivalent actinide-humates affects dissolved species of the actinides in hydrosphere. The purified humic acid was characterized by means of UV-vis, IR, and pH titration, indicating high carboxylate capacity and low aromaticity. Binding constants of americium and europium humates were determined at pH 4.6 and 6.0 by solvent extraction using 241 Am or 152 Eu as a tracer. The binding constants for americium-humate obtained preliminarily suggest that complexes with humic acid are not negligible in speciation of trivalent actinides in hydrosphere. The obtained binding constants were nearly identical with those determined previously by the same procedures, but with humic acids of different origin and compositions. (author)

  17. Sorption of europium (3) by polymer sorbents with grafted heterocyclic nitrogen-containing groupings

    International Nuclear Information System (INIS)

    Bel'tyukova, S.V.; Kravchenko, T.B.; Balamtsarashvili, G.M.; Roska, A.S.

    1990-01-01

    On polymer sorbents (copolymer of styrene-divinylbenzene) with grafted heterocyclic nitrogen-containing functional groupings of tetrazole, triazole and imidazole (sorbents 1,2,3, respectively). It is stated that europium sorption takes place from neutral solutions in presence of organic solvents. Luminescent properties of europium on sorbent are used to develope methods of its determination in high purity lanthanide and yttrium oxides. Europium determination limits consist 7.5·10 -5 μg/ml on 1 and 3 sorbents and 1.5·10 -4 μg/ml on sorbent 2, S p value is 0.089 and 0.075, respectivaly

  18. Atomic absorption spectrophotometry of europium using an enhancing effect of ammonium perchlorate

    International Nuclear Information System (INIS)

    Oguro, Hiroshi

    1976-01-01

    In the atomic absorption spectrophotometry of europium in air-acetylene flame, ammonium perchlorate (NH 4 ClO 4 ) increases the absorption of europium. In the case of 0.5 M NH 4 ClO 4 , the increase is by about 1.5 times. In this paper, a method for eliminating the interferences of many coexisting compounds using an enhancing effect and a method for determining Eu 2 O 3 in La 2 O 3 were investigated. The working conditions using Nippon Jarrell-Ash model AA-1 atomic absorption/flame emission spectrophotometer were as follows; wavelength 4594 A, lamp current 15 mA, burner height 10 mm, air flow-rate 6.51/min, acetylene flow-rate 1.81/min. Though the enhancing or depressing effects of HCl, HNO 3 , HBr and HClO 4 in concentrations below 0.1 M were eliminated by 0.5 M NH 4 ClO 4 , the remarkable depressing effects of H 2 SO 4 and H 3 PO 4 on europium could not be eliminated. The interferences of Na + , K + , Cs + and Al 3+ in the concentration of 200 ppm were not eliminated, but those of other cations including rare earth elements were completely eliminated. Lanthanum in the range of (2000--10000) ppm increased the absorption of europium by about 1.4 times. But the effect of lanthanum in the range of (0--9000) ppm was also eliminated by NH 4 ClO 4 . The calibration curve for europium in the presence of NH 4 ClO 4 was linear in the range of (0--400) ppm with a sensitivity larger by about 1.5 times than that for europium alone. The analytical procedure is as follows. A sample is dissolved in HCl and NH 4 ClO 4 is added. Europium in the sample solution is determined by atomic absorption method using air-acetylene flame. For practical samples, the values obtained were in fair agreement with those by the flame emission method using a nitrous oxide-acetylene flame. The coefficients of variation by the present method were (3.7--2.4)% (Eu 2 O 3 content (1--3)%). (auth.)

  19. Optical and magnetization studies on europium based iron pnictides

    International Nuclear Information System (INIS)

    Zapf, Sina Maria Ute

    2015-01-01

    The investigations carried out in the framework of this thesis mainly concentrate on europium based iron pnictides. These are a peculiar member of the 122 family as they develop at low temperatures (∝20K) an additional magnetic order of the local rare earth moments. Therefore, europium based iron pnictides provide a unique platform to study the interplay of structural, magnetic and electronic effects in high-temperature superconductors. For this challenging purpose, we have employed SQUID magnetometry and Fourier-transform infrared spectroscopy on EuFe 2 (As 1-x P x ) 2 single crystals. By systematic studies of the in- and out-of-plane magnetic properties of a series of single crystals, we derived the complex magnetic phase diagram of europium based iron pnictides, which contains an A-type antiferromagnetic and a re-entrant spin glass phase. Furthermore, we have investigated the magneto-optical properties of EuFe 2 As 2 , revealing a much more complex magnetic detwinning process than expected. These studies demonstrate a remarkable interdependence between magnetic, electronic and structural effects that might be very important to understand the unconventional superconductivity in these fascinating materials.

  20. Optical and magnetization studies on europium based iron pnictides

    Energy Technology Data Exchange (ETDEWEB)

    Zapf, Sina Maria Ute

    2015-07-01

    The investigations carried out in the framework of this thesis mainly concentrate on europium based iron pnictides. These are a peculiar member of the 122 family as they develop at low temperatures (∝20K) an additional magnetic order of the local rare earth moments. Therefore, europium based iron pnictides provide a unique platform to study the interplay of structural, magnetic and electronic effects in high-temperature superconductors. For this challenging purpose, we have employed SQUID magnetometry and Fourier-transform infrared spectroscopy on EuFe{sub 2}(As{sub 1-x}P{sub x}){sub 2} single crystals. By systematic studies of the in- and out-of-plane magnetic properties of a series of single crystals, we derived the complex magnetic phase diagram of europium based iron pnictides, which contains an A-type antiferromagnetic and a re-entrant spin glass phase. Furthermore, we have investigated the magneto-optical properties of EuFe{sub 2}As{sub 2}, revealing a much more complex magnetic detwinning process than expected. These studies demonstrate a remarkable interdependence between magnetic, electronic and structural effects that might be very important to understand the unconventional superconductivity in these fascinating materials.

  1. Magnetic and structural properties of yellow europium oxide compound and Eu(OH){sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Dongwook, E-mail: dongwookleedl324@gmail.com [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom); Seo, Jiwon, E-mail: jiwonseo@yonsei.ac.kr [Department of Physics and IPAP, Yonsei University, Seoul 120-749 (Korea, Republic of); Valladares, Luis de los Santos [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom); Avalos Quispe, O. [Laboratorio de Cerámicos y Nanomateriales, Facultad de Ciencias Físicas, Universidad Nacional Mayor de San Marcos, Ap. Postal 14-0149, Lima, Perú (Peru); Barnes, Crispin H.W. [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom)

    2015-08-15

    A new material based on a yellow europium oxide compound was prepared from europium oxide in a high vacuum environment. The structural and magnetic properties of the material were investigated. Owing to the absence of a crystal structure, the material exhibited a disordered magnetic behavior. In a reaction with deionized (DI) water without applied heat, the compound assumed a white color as soon as the DI water reached the powder, and the structure became polycrystalline Eu(OH){sub 3}. The magnetic properties, such as the thermal hysteresis, disappeared after the reaction with DI water, and the magnetic susceptibility of the yellow oxide compound weakened. The magnetic properties of Eu(OH){sub 3} were also examined. Although Eu{sup 3+} is present in Eu(OH){sub 3}, a high magnetic moment due to the crystal field effect was observed. - Graphical abstract: (top left) Optical image of the yellow europium oxide compound. (top right) Optical image of the product of DI water and yellow europium oxide. (bottom) Magnetization curves as a function of temperature measured in various magnetic field. - Highlights: • We prepared a new material based on a yellow europium oxide compound from europium oxide. • We characterized the magnetic properties of the material which exhibits a disordered magnetic behavior such as thermal hysteresis. • The compound turned white (Eu(OH){sub 3}) as soon as the DI water reached the powder. • The thermal hysteresis disappeared after the reaction with DI water and the magnetic susceptibility of the yellow oxide compound weakened.

  2. 33 CFR 138.40 - Forms.

    Science.gov (United States)

    2010-07-01

    ...) § 138.40 Forms. All forms referred to in this subpart may be obtained from NPFC by requesting them in writing at the address given in § 138.45(a) or by clicking on the Forms link at the NPFC E-COFR Web site... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Forms. 138.40 Section 138.40...

  3. Use of europium ions for SAD phasing of lysozyme at the Cu Kα wavelength

    International Nuclear Information System (INIS)

    Vijayakumar, Balakrishnan; Velmurugan, Devadasan

    2012-01-01

    Europium(III) ions bound to the surface of hen egg-white lysozyme were found to exhibit good anomalous signal facilitating SAD phasing using laboratory-source data and automated model building. The europium ion-binding sites were observed up to the 15σ level. Europium is shown to be a good anomalous scatterer in SAD phasing for solving the structure of biological macromolecules. The large value of the anomalous contribution of europium, f′′ = 11.17 e − , at the Cu Kα wavelength is an advantage in de novo phasing and automated model building. Tetragonal crystals of hen egg-white lysozyme (HEWL) incorporating europium(III) chloride (50 mM) were obtained which diffracted to a resolution of 2.3 Å at a wavelength of 1.54 Å (Cu Kα). The master data set (360° frames) was split and analyzed for anomalous signal-to-noise ratio, multiplicity, completeness, SAD phasing and automated building. The structure solution and model building of the split data sets were carried out using phenix.autosol and phenix.autobuild. The contributions of the Eu ions to SAD phasing using in-house data collection are discussed. This study revealed successful lysozyme phasing by SAD using laboratory-source data involving Eu ions, which are mainly coordinated by the side chains of Asn46, Asp52 and Asp101 together with some water molecules

  4. Silica- and silylated europium-based luminescent hybrids: new analysis tools for biological environments

    International Nuclear Information System (INIS)

    Pereira Duarte, Adriana

    2012-01-01

    The association of the very interesting luminescence properties of the lanthanide chelates with the physicochemical properties of inorganic matrix such as silica is a promising way to obtain new probes or luminescent markers for biology analyses. In this idea, this work focuses on the preparation of new hybrid materials based on the grafting of new europium(III) complexes on silica nanoparticles. These europium complexes were developed in our group using bifunctional ligands containing both complexing and grafting sites. Intrinsic characteristic of the ligands gives us the ability to make a covalent bond between the material surface and the complex. Two different methodologies were used; the first one is the direct grafting reaction involving the complex and silica nanoparticles (i.e. dense or meso-porous particles). The second one is the Stoeber reaction, where the SiO 2 nanoparticles were prepared in presence of the europium complex. The last methodology has an additional difficult, because of the presence of silylated europium complex, it needs a closer control of the physicochemical conditions. The new organic-inorganic hybrid materials, obtained in this work, present an interesting luminescence behavior and this one is depending on the localization of the europium complex, i.e. on the surface or within the nanoparticles. In addition, the obtained hybrids present the nano-metric dimension and the complex is not leachable. Analyses were realized to describe the luminescence properties, beyond surface and structural characteristics. Initial results show that the new hybrids are promising candidates for luminescent bio-markers, particularly for the time-resolved analysis. (author) [fr

  5. Carbamoyl methylphosphine oxide derivatives of adamantane as americium and europium extractants

    International Nuclear Information System (INIS)

    Babain, V.A.; Alyapyshev, M.Yu.; Novakov, I.A.; Orlinson, B.S.; Savel'ev, E.N.; Shokova, Eh.A.; Serebrayannikova, A.E.; Kovalev, V.V.

    2007-01-01

    Adamantane di-1,3-carbamoyl methylphosphine oxide (CMPO) derivatives, where CMPO-groups connect with 1,3-positions of rigid adamantane platform by methylene and ethylene bridges, are synthesized, and their efficiency as extractants of americium(III) and europium(III) from nitric acid solutions is demonstrated. Distribution function of Am 3+ and Eu + during extraction from 3M HNO 3 are measured in the investigation of extraction properties. It is noted that first synthesized adamantane CMPO derivatives are more effective for the extraction of americium(III) and europium(III) from 3MHNO 3 [ru

  6. Luminescent micro- and nanofibers based on novel europium phthalate complex

    Energy Technology Data Exchange (ETDEWEB)

    Enculescu, M., E-mail: mdatcu@infim.ro [National Institute of Materials Physics, Multifunctional Materials and Structures, PO Box MG-7, 77125 Magurele-Bucharest (Romania); Preda, N.; Matei, E.; Enculescu, I. [National Institute of Materials Physics, Multifunctional Materials and Structures, PO Box MG-7, 77125 Magurele-Bucharest (Romania)

    2012-09-14

    We synthesized by wet chemical route a novel europium-potassium phthalate complex Eu{sup 3+}K{sup +}[(COO){sub 2}(C{sub 6}H{sub 4})]{sub 2}. The compound is a white powder insoluble in water. X-ray diffraction evaluation shows that we obtained a new crystalline compound with no traces of the starting materials (potassium hydrogen phthalate and europium chloride). Scanning electron microscopy reveals that the powder consists of fiber-shaped structures with sizes larger than 250 nm in diameter. Energy dispersive X-ray analysis proves that the compound has a 1:1 europium-potassium ratio. Fourier transform infrared spectroscopy confirms the presence of the phthalate in the new compound. Photoluminescence and cathodoluminescence measurements show that the fiber-shaped structures are intensely luminescent with emission bands corresponding to the {sup 5}D{sub 0} {yields} {sup 7}F{sub J} (J = 1-4) Eu (III) ion's transitions in the region between 580 nm and 700 nm, the most intense maximum being observed around 615 nm. Up-converted luminescence with a maximum at 315 nm was recorded. -- Highlights: Black-Right-Pointing-Pointer A new europium-potassium phthalate complex was synthesized by wet chemical route. Black-Right-Pointing-Pointer Fiber-shaped crystalline structures with sizes larger than 250 nm. Black-Right-Pointing-Pointer The most probable structure of the molecule is [C{sub 6}H{sub 4}(COO{sup -}){sub 2}]{sub 2} K{sup +}Eu{sup 3+}. Black-Right-Pointing-Pointer Intense luminescence due to Eu{sup 3+} ions {sup 5}D{sub 0} {yields} {sup 7}F{sub J} transitions. Black-Right-Pointing-Pointer Up-converted luminescence with a maximum at 315 nm was recorded.

  7. Purification and measurement of acid leachable europium in sands as an aid in the study of sediment transport

    International Nuclear Information System (INIS)

    Ditchburn, R.G.; McCabe, W.J.

    1982-05-01

    The use of europium labelled sand as an aid in the study of sediment transport has been suggested. A method for the purification of acid leachable europium is described. The final measurement is made by flame emission spectrometry using a nitrous oxide-acetylene flame. The usefulness of the method is limited by the natural levels of europium which, in the sand studied, was around 0.3 ppm

  8. Excess europium content in Precambrian sedimentary rocks and continental evolution

    Science.gov (United States)

    Jakes, P.; Taylor, S. R.

    1974-01-01

    It is proposed that the europium excess in Precambrian sedimentary rocks, relative to those of younger age, is derived from volcanic rocks of ancient island arcs, which were the source materials for the sediments. Precambrian sedimentary rocks and present-day volcanic rocks of island arcs have similar REE patterns, total REE abundances, and excess Eu, relative to the North American shale composite. The present upper crustal REE pattern, as exemplified by that of sediments, is depleted in Eu, relative to chondrites. This depletion is considered to be a consequence of development of a granodioritic upper crust by partial melting in the lower crust, which selectively retains europium.

  9. Europium enabled luminescent nanoparticles for biomedical applications

    Energy Technology Data Exchange (ETDEWEB)

    Syamchand, S.S., E-mail: syamchand.ss@gmail.com; Sony, G., E-mail: emailtosony@gmail.com

    2015-09-15

    Lanthanide based nanoparticles are receiving great attention ought to their excellent luminescent and magnetic properties and find challenging biomedical applications. Among the luminescent lanthanide NPs, europium based NPs (Eu-NPs) are better candidates for immunoassay and imaging applications. The Eu-NPs have an edge over quantum dots (QDs) by means of their stable luminescence, long fluorescence lifetime, sharp emission peaks with narrow band width, lack of blinking and biocompatibility. This review surveys the synthesis and properties of a variety of Eu-NPs consolidated from different research articles, for their applications in medicine and biology. The exquisite luminescent properties of Eu-NPs are explored for developing biomedical applications such as immunoassay and bioimaging including multimodal imaging. The biomedical applications of Eu-NPs are mostly diagnostic in nature and mainly focus on various key analytes present in biological systems. The luminescent properties of europium enabled NPs are influenced by a number of factors such as the site symmetry, the metal nanoparticles, metal ions, quantum dots, surfactants, morphology of Eu-NPs, crystal defect, phenomena like antenna effect and physical parameters like temperature. Through this review we explore and assimilate all the factors which affect the luminescence in Eu-NPs and coil a new thread of parameters that control the luminescence in Eu-NPs, which would provide further insight in developing Eu-based nanoprobes for future biomedical prospects. - Highlights: • The review describes 14 major factors that influence the luminescence properties of europium enabled luminescent nanoparticles (Eu-NPs). • Surveys different types of europium containing nanoparticles that have been reported for their biomedical applications. • Eu-NPs are conveniently divided into four different categories, based on the type of the substrates involved. The four categories are (1) virgin Eu-substrate based NPs; (2

  10. Europium enabled luminescent nanoparticles for biomedical applications

    International Nuclear Information System (INIS)

    Syamchand, S.S.; Sony, G.

    2015-01-01

    Lanthanide based nanoparticles are receiving great attention ought to their excellent luminescent and magnetic properties and find challenging biomedical applications. Among the luminescent lanthanide NPs, europium based NPs (Eu-NPs) are better candidates for immunoassay and imaging applications. The Eu-NPs have an edge over quantum dots (QDs) by means of their stable luminescence, long fluorescence lifetime, sharp emission peaks with narrow band width, lack of blinking and biocompatibility. This review surveys the synthesis and properties of a variety of Eu-NPs consolidated from different research articles, for their applications in medicine and biology. The exquisite luminescent properties of Eu-NPs are explored for developing biomedical applications such as immunoassay and bioimaging including multimodal imaging. The biomedical applications of Eu-NPs are mostly diagnostic in nature and mainly focus on various key analytes present in biological systems. The luminescent properties of europium enabled NPs are influenced by a number of factors such as the site symmetry, the metal nanoparticles, metal ions, quantum dots, surfactants, morphology of Eu-NPs, crystal defect, phenomena like antenna effect and physical parameters like temperature. Through this review we explore and assimilate all the factors which affect the luminescence in Eu-NPs and coil a new thread of parameters that control the luminescence in Eu-NPs, which would provide further insight in developing Eu-based nanoprobes for future biomedical prospects. - Highlights: • The review describes 14 major factors that influence the luminescence properties of europium enabled luminescent nanoparticles (Eu-NPs). • Surveys different types of europium containing nanoparticles that have been reported for their biomedical applications. • Eu-NPs are conveniently divided into four different categories, based on the type of the substrates involved. The four categories are (1) virgin Eu-substrate based NPs; (2

  11. Synthesis of xerogels with Europium impurities for dosimetric applications

    International Nuclear Information System (INIS)

    Rivera R, C.; Garcia R, F.J.; Yanez L, M. -

    2007-01-01

    The objective of this work is the obtaining xerogels in bundle of SiO 2 with europium impurities to low concentrations, with the objective of exploring their mechanical, optical and emission properties. The obtained xerogels was synthesized by means of the sol-gel technique, using water, TEOS and ethanol to a molar relationship 16:1:4 respectively, the europium was added by oxide via to the precursor solution and to catalyze the hydrolysis condensation reaction, its were added: nitric acid and hydrofluorhydric acid. Later on these mixtures were left to gel by 72 hours and under this same composition, but with different quantities of impurifying material (0.0, 0.01 and 0.05g of europium oxide), the materials were dried in a ramp of controlled temperature, from ambient temperature up to 120 C, some of these thermally tried materials were calcined at 500 and 800 C, being obtained in this way xerogels free of fractures, stable, porous and semi-transparent. The characterization of these materials includes: pH measurements and solutions viscosity during the gelation stage, as well as characterization of their optic properties by means of infrared spectroscopy, UV-vis and emission spectroscopy. The microhardness results show that these materials present smaller values to those corresponding of the corning glass, as well as a growing behavior with regard to the calcination temperatures of the material. (Author)

  12. Fermi Surface and Antiferromagnetism in Europium Metal

    DEFF Research Database (Denmark)

    Andersen, O. Krogh; Loucks, T. L.

    1968-01-01

    of the nearly cubical part of the hole surface at P, and we also discuss the effects of the electron surface at H. Since it is likely that barium and europium have similar Fermi surfaces, we have presented several extremal areas and the corresponding de Haas-van Alphen frequencies in the hope that experimental...

  13. Temperature effects in the valence fluctuation of europium intermetallic compounds

    International Nuclear Information System (INIS)

    Menezes, O.L.T. de; Troper, A.; Gomes, A.A.

    1978-03-01

    A previously reported model for valence fluctuations in europium compound in order to account for thermal occupation effect. Experimental results are critically discussed and new experiments are suggested

  14. A Preliminary Study of Europium Uptake by Yeast Cells. The Case of Kluveromyces Marxianus

    International Nuclear Information System (INIS)

    Anagnostopoulos, V.; Symeopoulos, B.

    2008-01-01

    The objective of the present work is an exploration of a cost effective recovery of lanthanides, either for minimizing the industrial processes losses, or for reasons related to Radioactive Waste Management. Specifically, the uptake of europium from aqueous solutions by Kluveromyces marxianus cells was studied. Moreover, this biotechnological approach turns out to be environmental friendly, considering that cells of Kluveromyces marxianus are readily available as wastes from food fermentation industries. Europium [ 152 Eu+ 154 Eu]-labelled solutions were used providing better accuracy and reproducibility of measurements, mainly in low concentration range. The effect of pH, contact time and europium initial concentration were investigated. Adsorption data were fitted to Langmuir and Freundlich sorption models and Scatchard plots were used to reveal the existence of at least two types of binding sites

  15. Nuclear orientation experiments on the magnetic moments of europium and gadolinium nuclei

    International Nuclear Information System (INIS)

    Berg, F.G. van den.

    1984-01-01

    In this thesis, experimental results on the ground state nuclear magnetic moments of europium and gadolinium isotopes are presented. The nuclear orientation experiments were performed on europium and gadolinium nuclei embedded in several host lattices. Attention is paid to the hyperfine interactions of the ions. Nuclear moments are discussed in the context of nuclear shell model. The theoretical framework is described for nuclear structure and low temperature nuclear orientation. Furthermore, the experimental techniques, the technical arrangement of the orientation apparatus, the methods for radiative detection and the use of nuclear orientation thermometry are described. (Auth.)

  16. White OLED with a single-component europium complex.

    Science.gov (United States)

    Law, Ga-Lai; Wong, Ka-Leung; Tam, Hoi-Lam; Cheah, Kok-Wai; Wong, Wing-Tak

    2009-11-16

    A new direction for white organic light-emitting devices is shown, fabricated from a novel europium complex; this single component contains a double emission center of bluish-green and red, combined to a give a pure white emission (CIE x = 0.34 and y = 0.35).

  17. Extraction of europium with thenoyltrifluoroacetone into alcohol, ketone and ester solvents

    International Nuclear Information System (INIS)

    Akiba, K.; Kanno, T.

    1980-01-01

    The effect of solvent has been studied on the extraction of tris-thenoyltrifluoroacetone (TTA) chelate of europium(III). Donor-active solvents (S) greatly promote the extraction owing to the formation of solvate species EuA 3 .mS (m = 1,2). Linear relations were established between the distribution of ratios of europium (Dsub(Eu)) and the partition constants of TTA (Psub(HA)); log Dsub(Eu) (at a definite pA) = a log Psub(HA) + b, where constants a and b were empirically determined for each series of solvents. The regularity is interpreted in terms of dual roles of solvent as donor and as medium. (author)

  18. Effects of added uranium on the triboluminescent properties of europium dibenzoylmethide triethylammonium

    International Nuclear Information System (INIS)

    Fontenot, Ross S.; Hollerman, William A.; Bhat, Kamala N.; Aggarwal, Mohan D.

    2013-01-01

    The ability of a material to emit light upon fracture is known as triboluminescence. One of the few materials that emits triboluminescence in daylight is europium dibenzoylmethide triethylammonium (EuD 4 TEA). It has been shown that this material is 106% brighter than ZnS:Mn when excited by low speed impacts. In 2011, the authors of this paper found that replacing the traditional europium chloride with europium nitrate and changing the carrier solvent could both significantly affect the triboluminescent emission yield. While these changes provided a significant increase in yield, the emission was still not sufficient to be observed in bright daylight. In order to enhance the effect, a series of materials were added to the EuD 4 TEA to study the effects of “doping” on the triboluminescence yield. Results from this research showed that doping from a small number of materials, such as uranyl acetate, increased emission yield. This paper discusses the research that was completed on effects of the addition of uranyl acetate to EuD 4 TEA could increase the triboluminmescent emission yield. Results show that the added uranium does indeed increase emission yield when it is first synthesized. However, radiation emitted by the uranium also was found to damage the doped EuD 4 TEA, thus reducing the emitted triboluminescence over a period of time. - Highlights: ► Uranium doped europium dibenzoylmethide triethylammonium (EuD 4 TEA) was synthesized. ► Effects of uranium was studied for low velocity ( 4 TEA was determined.

  19. Enantioselective cellular localisation of europium(iii) coordination complexes.

    Science.gov (United States)

    Frawley, Andrew T; Linford, Holly V; Starck, Matthieu; Pal, Robert; Parker, David

    2018-01-28

    The selective mitochondrial localisation of the Λ enantiomer of three different emissive europium(iii) complexes in NIH 3T3 and MCF7 cells contrasts with the behaviour of the Δ enantiomer, for which a predominant lysosomal localisation was observed by confocal microscopy. In each case, cell uptake occurs via macropinocytosis.

  20. Structural and luminescence properties of europium(III)-doped zirconium carbonates and silica-supported Eu3+-doped zirconium carbonate nanoparticles

    International Nuclear Information System (INIS)

    Sivestrini, S.; Riello, P.; Freris, I.; Cristofori, D.; Enrichi, F.; Benedetti, A.

    2010-01-01

    The synthesis, morphology and luminescence properties of europium(III)-doped zirconium carbonates prepared as bulk materials and as silica-supported nanoparticles with differing calcination treatments are reported. Transmission electron microscopy and X-ray diffraction analyses have, respectively, been used to study the morphology and to quantify the atomic amount of europium present in the optically active phases of the variously prepared nanomaterials. Rietveld analysis was used to quantify the constituting phases and to determinate the europium content. Silica particles with an approximate size of 30 nm were coated with 2 nm carbonate nanoparticles, prepared in situ on the surface of the silica core. Luminescence measurements revealed the role of different preparation methods and of europium-doping quantities on the optical properties observed.

  1. Determination of europium content in Li_2SiO_3(Eu) by neutron activation analysis using Am-Be neutron source

    International Nuclear Information System (INIS)

    Naik, Yeshwant; Tapase, Anant Shamrao; Mhatre, Amol; Datrik, Chandrashekhar; Tawade, Nilesh; Kumar, Umesh; Naik, Haladhara

    2016-01-01

    Circulardiscs of Li_2SiO_3 doped with europium were prepared and a new activation procedure for the neutron dose estimation in a breeder blanket of fusion reactor is described. The amount of europium in the disc was determined by neutron activation analysis (NAA) using an isotopic neutron source. The average neutron absorption cross section for the reaction was calculated using neutron distribution of the Am-Be source and available neutron absorption cross section data for the "1"5"1Eu(n,γ)"1"5"2"mEu reaction, which was used for estimation of europium in the pallet. The cross section of the elements varies with neutron energy, and the flux of the neutrons in each energy range seen by the nuclei under investigation also varies. Neutron distribution spectrum of the Am-Be source was worked out prior to NAA and the effective fractional flux for the nuclear reaction considered for the flux estimation was also determined. - Highlights: • Lithium meta-silicate is breeder materials for a fusion reactor. • Europium is used for neutron dose estimation in a breeder blanket. • It is important to determine amount of europium in lithium meta-silicate. • Amount of europium in lithium meta-silicate was determined by neutron activation and off-line gamma spectrometry.

  2. Study of the europium behavior in aqueous media; Estudio sobre el comportamiento del europio en medios acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.; Martinez M, V. [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

    2000-07-01

    Europium as waste can produce a pollution problem in water that is in contact with it, what would has a heavy environmental impacts, because of the possibilities of diffusion of these wastes from their place of confinement or storage until the geo and biosphere. The solution of such problem requires of a lot of knowledge over the behavior of several chemical elements such as europium in aqueous solutions. In this work it was used a low ion force (0.02 M). The data set will allow extrapolate the hydrolytic behavior of europium in too much minors ion force media, such as the ground waters, including in ion force zero.

  3. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  4. The europium and praseodymium hydrolysis in a 2M NaCl environment

    International Nuclear Information System (INIS)

    Jimenez R, M.; Lopez G, H.; Solache R, M.; Rojas H, A.

    1998-01-01

    It was studied the europium and praseodymium hydrolysis in a 2M NaCl ion force environment at 303 K, through two methods: this one extraction with dissolvents (lanthanide-water-NaCl-dibenzoylmethane) in presence of a competitive ligand (diglycolic acid) and that one direct potentiometric titration, of soluble species, followed by a computer refining. The values of one or another techniques of the first hydrolysis constants obtained were similar, which demonstrates that the results are reliable. The set of data obtained on the stability constants of hydrolysis products allowed to draw up the distribution diagrams of chemical species, as europium as praseodymium in aqueous environment. (Author)

  5. Trivalent europium speciation in a room-temperature ionic liquid

    International Nuclear Information System (INIS)

    Mekki, S.

    2006-10-01

    Since the nuclear industry is playing an important role in the power production field, a relevant number of problems have been revealed. Indeed, high-level radioactive long-lived nuclear wastes present a real difficulty for nuclear wastes management. Minor actinides, which compose most of these wastes, will be radioactive for several thousands of years. For eventual disposal deep underground, their reprocessing needs to be optimized. The extraction processes used industrially to separate actinides and lanthanides from other metal species characterizing the spent nuclear fuel produce, nevertheless, enormous quantities of contaminated liquid wastes directly issued from the liquid/liquid extraction step. During the last decade, some room-temperature ionic liquid have been studied and integrated into industrial processes. The interest on this class of solvent came out from their 'green' properties (non volatile, non flammable, recyclable, etc...), but also from the variability of their physico-chemical properties (stability, hydrophobicity, viscosity) as a function of the RTIL chemical composition. Indeed, it has been shown that classical chemical industrial processes could be transferred into those media, even more improved, while a certain number of difficulties arising from using traditional solvent can be avoided. In this respect, it could be promising to investigate the ability to use room-temperature ionic liquid into the spent nuclear fuel reprocessing field. The aim of this thesis is to test the ability of the specific ionic liquid bumimTf 2 N to allow trivalent europium extraction. The choice of this metal is based on the chemical analogy with trivalent minor actinides Curium and Americium which are contributing the greatest part of the long-lived high-level radioactive wastes. Handling these elements needs to be very cautious for the safety and radioprotection aspect. Moreover, europium is a very sensitive luminescent probe to its environment even at the

  6. Ferromagnetic semiconductor-metal transition in heterostructures of electron doped europium monoxide

    Energy Technology Data Exchange (ETDEWEB)

    Stollenwerk, Tobias

    2013-09-15

    In the present work, we develop and solve a self-consistent theory for the description of the simultaneous ferromagnetic semiconductor-metal transition in electron doped Europium monoxide. We investigate two different types of electron doping, Gadolinium impurities and Oxygen vacancies. Besides the conduction band occupation, we can identify low lying spin fluctuations on magnetic impurities as the driving force behind the doping induced enhancement of the Curie temperature. Moreover, we predict the signatures of these magnetic impurities in the spectra of scanning tunneling microscope experiments. By extending the theory to allow for inhomogeneities in one spatial direction, we are able to investigate thin films and heterostructures of Gadolinium doped Europium monoxide. Here, we are able to reproduce the experimentally observed decrease of the Curie temperature with the film thickness. This behavior is attributed to missing coupling partners of the localized 4f moments as well as to an electron depletion at the surface which leads to a reduction of the number of itinerant electrons. By investigating the influence of a metallic substrate onto the phase transition in Gadolinium doped Europium monoxide, we find that the Curie temperature can be increased up to 20%. However, as we show, the underlying mechanism of metal-interface induced charge carrier accumulation is inextricably connected to a suppression of the semiconductor-metal transition.

  7. Ferromagnetic semiconductor-metal transition in heterostructures of electron doped europium monoxide

    International Nuclear Information System (INIS)

    Stollenwerk, Tobias

    2013-09-01

    In the present work, we develop and solve a self-consistent theory for the description of the simultaneous ferromagnetic semiconductor-metal transition in electron doped Europium monoxide. We investigate two different types of electron doping, Gadolinium impurities and Oxygen vacancies. Besides the conduction band occupation, we can identify low lying spin fluctuations on magnetic impurities as the driving force behind the doping induced enhancement of the Curie temperature. Moreover, we predict the signatures of these magnetic impurities in the spectra of scanning tunneling microscope experiments. By extending the theory to allow for inhomogeneities in one spatial direction, we are able to investigate thin films and heterostructures of Gadolinium doped Europium monoxide. Here, we are able to reproduce the experimentally observed decrease of the Curie temperature with the film thickness. This behavior is attributed to missing coupling partners of the localized 4f moments as well as to an electron depletion at the surface which leads to a reduction of the number of itinerant electrons. By investigating the influence of a metallic substrate onto the phase transition in Gadolinium doped Europium monoxide, we find that the Curie temperature can be increased up to 20%. However, as we show, the underlying mechanism of metal-interface induced charge carrier accumulation is inextricably connected to a suppression of the semiconductor-metal transition.

  8. Determination of Europium by fluorescence using pyrrolidinium based task specific ionic liquid

    International Nuclear Information System (INIS)

    Kumar, Satendra; Gayan, Siuli Maji; Sankaran, K.

    2012-01-01

    Determination of lanthanides using fluorescence is a major challenge in aqueous medium due to their poor molar absorptivities and low quantum yield. To overcome these problems, ligand sensitized fluorescence has been widely used for trace level detection of lanthanides in solutions. Recently, ionic liquid a non aqueous medium has been used to observe the fluorescence of lanthanides. In this work we have used pyrrolidinium based ionic liquid for the study of europium fluorescence. The ionic liquid (bmpyr)(BA) was prepared using the metathesis reaction involving 1-butyl,1-methyl pyrrolidinium chloride (bmpyr)(CI). (bmpyr)(Cl) crystals and silver benzoate were added according to their mole equivalents in methanol and stirred for 4 hrs. The filtrate was concentrated using a rotary evaporator, dried for 10 h at room temperature, and then for 40 h at 105℃under reduced pressure. This results in a white crystalline hygroscopic solid which was characterized by FT-lR spectroscopy. The yield of the product was ∼ 95%. Butyl-1, methyl pyrrolidinium bis(trifluoromethanesulfonyl)amide (bmpyr)(TF 2 N) is used for dissolve and dilute (bmpyr)(BA) and fluorescence and life time of Eu 3+ were obtained. For the concentration of Eu 3+ used in this study (2x10 -7 M), the optimum concentration of the sensitizing ionic liquid was found to be 10 -4 M. An enhancement factor of about 32000 was found in this ionic liquid compare to aqueous medium. Fluorescence life time of europium in this ionic liquid is 1100 μs which is ten times more than the life time of europium in aqueous medium (110 μs), indicating a reduction in the rates of non-radiative processes which was provided by the ionic liquid. This study leads to detection of europium in ppb level. (author)

  9. Synthesis of mixed ligand europium complexes: Verification of predicted luminescence intensification

    International Nuclear Information System (INIS)

    Lima, Nathalia B.D.; Silva, Anderson I.S.; Gonçalves, Simone M.C.; Simas, Alfredo M.

    2016-01-01

    Mixed ligand europium complexes are predicted to be more luminescent than what would be expected from their corresponding repeating ligand compounds according to a conjecture recently advanced by our research group; a conjecture that has already been validated for strongly luminescent europium complexes. In this article, we seek to further verify the validity of this conjecture for complexes which are much more symmetric, and which thus display lower levels of luminescence. Accordingly, we synthesized complexes Eu(DBM) 3 (L) 2 , and all novel mixed ligand combinations Eu(DBM) 3 (L,L') with L and L' equal to DBSO, PTSO, and TPPO. The syntheses were carried out via displacement reactions from the starting complex Eu(DBM) 3 (H 2 O) 2 , passing through the intermediates Eu(DBM) 3 (L) 2 and finally, by displacement of L by L', arriving at Eu(DBM) 3 (L,L'). The ligands L obey the following order of displacement TPPO>PTSO>DBSO>H 2 O, which had been previously described by our group. In the present article, we further show that this displacement order could have been predicted by Sparkle/RM1 thermochemical calculations. Subsequently, we determined the radiative decay rates, A rad , for all six compounds by photophysical measurements. As expected, results show that the measured A rad values for all novel mixed ligand complexes are larger than the average of the A rad values for the corresponding repeating ligand coordination compounds. In conclusion, the present article does broaden the scope of our conjecture, which enunciates that an increase in the diversity of ligands around the europium ion tends to intensify the luminescence. - Highlights: • Mixed ligand europium complexes are predicted to be more luminescent than repeating ligand ones. • Radiative decay rates increase with structural coordination asymmetry. • The non-ionic ligands displacement order in substitution reactions is TPPO>PTSO>DBSO>H 2 O. • Sparkle/RM1 correctly predicts the

  10. Temperature dependences in electron-stimulated desorption of neutral europium

    CERN Document Server

    Ageev, V N; Madey, T E

    2003-01-01

    The electron-stimulated desorption (ESD) yield for neutral europium (Eu) atoms from Eu layers adsorbed on oxygen-covered tungsten surfaces has been measured as a function of electron energy, europium coverage and degree of oxidation of tungsten, with an emphasis on effects of substrate temperature. The measurements have been carried out using a time-of-flight method and surface ionization detector. We expand on an earlier report, and compare ESD of multivalent Eu with ESD of monovalent alkali atoms, studied previously. The Eu atom ESD is a complicated function of Eu coverage, electron energy and substrate temperature. In the coverage range 0.05-0.35 monolayer (ML), overlapping resonant-like Eu atom yield peaks are observed at electron energies E sub e of 36 and 41 eV that might be associated with Eu or W shallow core level excitations. Additional resonant-like peaks are seen at E sub e of 54 and 84 eV that are associated with W 5p and 5s level excitations. The Eu atom yield peaks at 36 and 41 eV are seen only...

  11. 7 CFR 800.138 - Conflict of interest.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Conflict of interest. 800.138 Section 800.138 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... Inspection Services § 800.138 Conflict of interest. Official personnel cannot perform or participate in...

  12. Magneto-optical studies of valence instability in europium and terbium phosphors

    Czech Academy of Sciences Publication Activity Database

    Rodrigues, L.C.v.; Hölsä, J.; Brito, H.F.; Maryško, Miroslav; Matos, J.R.; Paturi, P.; Rodrigues, R.V.; Lastusaari, M.

    2016-01-01

    Roč. 170, Feb (2016), 701-706 ISSN 0022-2313 Institutional support: RVO:68378271 Keywords : valence * europium * terbium * oxysulfide and -sulfate * phosphors * paramagnetic susceptibility Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  13. Luminescence properties of europium (III) cryptates trapped in sol-gel glass

    International Nuclear Information System (INIS)

    Zaitoun, M.A.; Kim, T.; Jaradat, Q.M.; Momani, K.; Qaseer, H.A.; El-Qisairi, A.K.; Qudah, A.; Radwan, N.E.

    2008-01-01

    The Lanthanide complexes Eu-2.2.1 and Eu-2.2.2 were synthesized and then incorporated into silica based transparent organic-inorganic hybrid material by the sol-gel method as an example of how doped xerogel materials are emerging as an important means of producing new materials. The produced gels were diagnosed to monitor emission spectra of the luminescent trivalent europium (Eu 3+ ) complexes; emissions were compared to those for gels containing uncomplexed Eu 3+ . Results of the experiments (emission and lifetimes) concerning the coordination sphere composition showed that a cryptand ligand with aromatic groups (short range effect) and the hydrophobic gel host (long range effect) settle efficient action in the antenna effect and isolate the central ion from efficient quenchers, as e.g. water molecules. Each ligand imposed a distinct splitting pattern on the europium emission bands that helps identify them

  14. 29 CFR 102.138 - Definition of meeting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...

  15. 32 CFR 935.138 - Motor bus operation.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Motor bus operation. 935.138 Section 935.138 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND INSULAR REGULATIONS WAKE ISLAND CODE Motor Vehicle Code § 935.138 Motor bus operation. Each person operating a motor...

  16. The Preparation and Thermodynamics of Europium Dicarbide; Preparation et Thermodynamique du Bicarbure d'Europium; Poluchenie i termodinamicheskie svojstva dikarbida evropiya; Preparacion y Termodinamica del Dicarburo de Europio

    Energy Technology Data Exchange (ETDEWEB)

    Gebelt, R. E. [Oklahoma State University, Stillwater, OK (United States); Eick, H. A. [Michigan State University, East Lansing, MI (United States)

    1966-01-15

    Europium dicarbide has been prepared by the reaction of europium metal and graphite in a stainless steel bomb. Chemical analysis indicates an average composition of the product of EuC{sub 1.87{+-}0.07}. X-ray powder diffraction analysis shows the compound to be of body-centred tetragonal symmetry, space group D{sup 17}{sub 4}n-14/mm , with lattice parameters: a{sub 0} = 4.045 A; c{sub 0} = 6.645 A. Vapour phase chromatographic analysis indicates that 98% of the gaseous product of acid hydrolysis of europium dicarbide is the hydrocarbon acetylene. These analytical data, together with the lattice parameters, indicate that europium dicarbide resembles alkaline earth dicarbides more than it resembles the other lanthanon dicarbides. The vaporization of europium dicarbide over the temperature range 1130 to 1600 Degree-Sign K was investigated by the Knudsen effusion method. The effusate was either collected and analysed chemically or observed with a time-of-flight mass spectrometer. Thedata presented here are based predominantly on the massspectro- metric observations since they yielded more reproducible data than the collection technique. Gaseous europium dicarbide and europium, in concentrations of 1 and 99%respectively, were found in the effusate. Instrument limitations prevented determination of the concentration of the gaseous dicarbide as a function of temperature. Calibration of the mass spectrometer with silver permitted the calculation of the pressures corresponding to the observed ion intensities. An empirical equation was fitted to the data for europium by the method of least squares. From the second law of thermodynamics the following values were calculated for the reaction: EuC{sub 2} Rightwards-Harpoon-Over-Leftwards-Harpoon Eu(g) + 2C (graphite); {Delta}H{sup 0}{sub 298} = 51.09{+-}1.42kcal/mole; {Delta}H{sup 0}{sub 298} = 18.43 {+-} 1.75 e.u. Values of the free energy function for EuC{sub 2}(s) were estimated and combined with published data to yield for

  17. Highly specific ''sensing'' of tryptophan by a luminescent europium(III) complex

    Energy Technology Data Exchange (ETDEWEB)

    Stubenrauch, Jan A.; Mevissen, Christian; Schulte, Marie F.; Bochenek, Steffen; Albrecht, Markus [RWTH Univ. Aachen (Germany). Inst. fuer Organische Chemie; Subramanian, Palani S. [Central Salt and Marine Chemicals, Research Institute (CSRI), Gujarat (India)

    2016-07-01

    The europium(III) complex 1-Cl{sub 3} (S,S-2,2{sup '}-(((1,10-phenanthroline-2,9-diyl)bis(methanylylidene))bis (azanylyliden e))bis(3-methylbutanamide)europiumtrichloride) undergoes, only in the presence of the amino acid tryptophan, a change of emission at 615 nm. In the presence of few equivalents of tryptophan, emission of the europium complex is enhanced while it disappears upon addition of large amounts. This behavior can be assigned to displacement of the sensitizing phenanthroline ligand of 1-Cl{sub 2} x Trp in the latter case.

  18. 6 CFR 13.8 - Service of Complaint.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Service of Complaint. 13.8 Section 13.8 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.8 Service of Complaint. (a) Service of a Complaint must be Made by certified or registered mail or by...

  19. Synthesis and characterization of europium aluminophosphate

    International Nuclear Information System (INIS)

    Araujo, A.S.; Diniz, J.C.; Silva, A.O.S.

    1998-01-01

    Full text: Aluminophosphate molecular sieves (ALPO) represents a class of materials formed by AlO 2+ and PO 2- tetrahedra linked together through b the oxygen atom. The incorporation of metal cations, specifically rare earths, in the ALPO matrix, gives rise to generation of new materials that can be used as acid catalysts in chemical processes. In this work, it was synthesized hydrothermally a molecular sieve type Eu-ALPO-11, starting from an hydrated alumina (pseudobohemite), phosphoric acid solution, europium chloride, water, and di-isopropylamine (DIPA) as organic template. The gel of synthesis presented the following composition: 1.0 DIPA: 0.05 Eu 2 O 3 :0.95 Al 2 O 3 : 1.0 P 2 O 5 : 80 H 2 O The hydrogel was autoclaved at 170 deg C for a period of 3 days. After that the obtained solid was filtered, washed, dried and calcined at 500 deg C to remove the template. The sample was characterized by several physico-chemical methods, such a atomic absorption, FT-IR spectroscopy, X-ray diffraction, thermal analysis, scanning electron microscopy. Its spectroscopic properties was investigated by europium luminescence. The physico-chemical characterization of the Eu-ALPO-11 showed very good crystallinity, with AEL structure, and orthorhombic symmetry. Also, the material presents excellent thermal stability, with no structural collapse until 950 deg C. Through the luminescence spectra in the visible region, it was observed that the emission of the Eu 3+ is strongly influenced by the increasing of the 5d0 7f0 transition (Electric Dipole), as compared to the 5d0 7f1 transition (Magnetic Dipole) between the levels of 4f configuration perturbed by the crystalline field. The ED/MD ratio to the as synthesized sample was ca. 2.1, against ca. 1.1 relative to the calcined sample. The FT-IR spectra presented well defined absorption bands relative to Al-O and P-O bonds, of the structural internal tetrahedra (IT) and external links (EL): 1250- 950 cm -1 , symmetric stretching due to

  20. Enthalpies of formation of europium alkoxides: What lessons can be drawn from them

    International Nuclear Information System (INIS)

    Branco, Joaquim B.; Carretas, José M.; Epple, Matthias; Cruz, Adelaide; Pires de Matos, A.; Leal, João Paulo

    2014-01-01

    Highlights: • First time measurement of europium(II) alkoxides enthalpy of formation. • Calculation of alkoxides thermochemical radii and M–O distances in this environment. • Comparison of experimental EXAFS distance with the calculated ones. • Hints on the type of bond existing in these compounds. • Correlation of bond type and possible use as catalysts. - Abstract: The synthesis and characterization of two europium alkoxides, Eu(OCH 3 ) 2 and Eu(OC 2 H 5 ) 2 , were described. For the first time the enthalpies of formation of divalent lanthanide alkoxides were determined by using reaction-solution calorimetry. The values obtained are Δ f H 0 [Eu(OCH 3 ) 2 ,cr] = −850.5 ± 5.0 kJ/mol and Δ f H 0 [Eu(OC 2 H 5 ) 2 ,cr] = −902.5 ± 5.5 kJ/mol, respectively. Since these compounds have a large use as catalysts or catalysts precursors, the first step of the reaction of them with CO 2 was addressed, which permits to have an idea of the kind of bond involved in those compounds. Moreover, insertion of CO 2 in the europium oxygen bond and formation of metal carboxylate complexes, is in both cases presumably bidentate

  1. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    Energy Technology Data Exchange (ETDEWEB)

    Shaorong Liu; Jian Meng (Beijing Research Institute of Chemical Engineering and Metallurgy (China)); Wenhua Liu (General Research Institute for Non-Ferrous Metals (China))

    1992-08-24

    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs.

  2. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    International Nuclear Information System (INIS)

    Shaorong Liu; Jian Meng; Wenhua Liu

    1992-01-01

    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs

  3. Lanthanum and yttrium oxysulfides activated by europium: (Ln1-x Eux)2 O2 S - Synthesis and characterization

    International Nuclear Information System (INIS)

    Luiz, J.M.

    1989-01-01

    The synthesis of lanthanum and yttrium oxysulfides activated by europium were obtained by thermal decomposition of lanthanum and yttrium oxalates doped with europium, under an argon and sulphur atmosphere. The thermal decomposition of these compounds is studied by differential thermal analysis (DTA). The characterization of these oxysulfides were made by chemical analyses, infrared spectroscopy, X-ray diffraction, scanning electron microscopy and emission spectroscopy. (M.V.M.)

  4. The migrant 152Eu as europium humate

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de

  5. Solubility and first hydrolysis constants of europium at different ionic strength and 303 K

    International Nuclear Information System (INIS)

    Ramirez-Garcia, J.J.; Jimenez-Reyes, M.; Lopez-Gonzalez, H.; Autonoma Metropolitana-Iztapalapa Univ., Mexico City; Solache-Rios, M.; Fernandez-Ramirez, E.; Centro Interamericano de Recursos del Agua, Toluca; Rojas-Hernandez, A.

    2003-01-01

    The solubility of europium at 0.02M, 0.1M and 0.7M NaClO 4 ionic strength solutions was determined by a radiometric method and pEu s -pC H diagrams were obtained. Hydrolysis constants were also determined at the same ionic strengths by pH titration and the values found were log *β 1 -7.68±0.11, -8.07±0.10 and -8.20±0.11. The log K sp values were -23.5±0.2, -22.7±0.2 and -21.9±0.2 for 0.02M, 0.1M and 0.7M NaClO 4 ionic strengths, respectively, at 303 K under CO 2 -free conditions and the extrapolated value at zero ionic strength was log K sp 0 = -24.15. The working pC H ranges for the calculation of the hydrolysis constants were selected from the pEu s -pC H diagrams in the region where precipitation of europium oxide or hydroxide was less than 20%. Europium removal from aqueous solutions with zeolites was explored. (author)

  6. Is the stoichiometry of the europium nitrate complexes with neutral organophosphorus extractants be anticipated?

    International Nuclear Information System (INIS)

    Beudaert, Ph.; Lamare, V.; Wipff, G.

    2001-01-01

    Molecular dynamics simulations have been performed in water on europium nitrate complexes with three neutral organophosphorus extractants (TBP, TPPO and CMPO) in order to determine on what criteria it is possible to obtain by simulations the experimental 1:3 stoichiometry in organic solution. This stoichiometry was investigated by progressive saturation of the cation coordination sphere. When the nitrate counter-ions are bidentate, the 1:3 stoichiometry corresponds to the degree of saturation where the interaction energy between europium and water becomes repulsive. Beyond this stoichiometry, complexes with TPPO and CMPO are unstable, although a 1:4 complex with TBP may exist but its formation appears to be energetically unfavored. (author)

  7. Luminescent properties of Europium(III) nitrate with 1,10-phenantroline and cinnamic acid in light - Transforming polymer materials

    Science.gov (United States)

    Kalinovskaya, I. V.; Zadorozhnaya, A. N.

    2018-04-01

    Influence of cinnamic acid on the luminescent properties of the europium(III) nitrate with 1,10-phenantroline in a polymer materials was studied. It was shown that combined use of these rare earth complexes leads to intense luminescence in the 400-700 nm region. Samples containing polymer europium nitrate with 1,10-phenantroline and cinnamic acid at a molar ratio of 1:2,0 had the maximum luminescence intensity and photostability.

  8. Theoretical spectroscopic study of the conjugate microcystin-LR-europium cryptate

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Julio G.; Dutra, Jose Diogo L.; Costa Junior, Nivan B. da; Freire, Ricardo O., E-mail: rfreire@ufs.br [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Quimica; Alves Junior, Severino; Sa, Gilberto F. de [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Quimica Fundamental

    2013-02-15

    In this work, theoretical tools were used to study spectroscopic properties of the conjugate microcystin-LR-europium cryptate. The Sparkle/AM1 model was applied to predict the geometry of the system and the INDO/S-CIS model was used to calculate the excited state energies. Based on the Judd-Ofelt theory, the intensity parameters were predicted and a theoretical model based on the theory of the 4f-4f transitions was applied to calculate energy transfer and backtransfer rates, radiative and non-radiative decay rates, quantum efficiency and quantum yield. A detailed study of the luminescent properties of the conjugate Microcystin-LR-europium cryptate was carried out. The results show that the theoretical quantum yield of luminescence of 23% is in good agreement with the experimental value published. This fact suggests that this theoretical protocol can be used to design new systems in order to improve their luminescence properties. The results suggest that this luminescent system may be a good conjugate for using in assay ELISA for detection by luminescence of the Microcystin-LR in water. (author)

  9. Synthesis, characterization and fluorescence studies of a novel europium complex based sensor

    International Nuclear Information System (INIS)

    Li Bin; Chen Qiuyun; Wang Yachen; Huang Jing; Li Yang

    2010-01-01

    A novel europium(III) complex was synthesized using TTA (α-thenoyltrifluoroacetone) as the first ligand and H 2 bpdc (2,2'-bipyridine-3,3'-dicarboxylate) as the second ligand. Elemental analysis, thermal analysis, IR and UV-vis spectrum and fluorescence spectrum of the europium(III) complex were carried out. A characteristic Eu 3+ fluorescence emission was observed in ethanol-water (1:1) solution, indicating that the complex is stable in solution and the emission of Eu(III) ions was not influenced by the water molecules. The fluorescence emission of the complex was quenched completely by the Co 2+ and Fe 3+ ions, but the quenched emission was recovered in the presence of glycine. Moreover, the Eu 3+ emission was very sensitive to pH, so the complex can be used as pH-dependent fluorescence probe or chemosensors.

  10. Characterization of the europium tetracycline complex as a biomarker for atherosclerosis

    Science.gov (United States)

    Courrol, Lilia C.; da Silva, Mônica N.; Sicchieri, Leticia B.

    2016-04-01

    Atherosclerosis is a narrowing of the arteries caused by an increase of atheromatous plaque: material formed by macrophage cells containing cholesterol and fatty acids, calcium and a variable amount of fibrous connective tissue. The elation between vulnerable plaques and cardiovascular events can be determined using plaque biomarkers. In this work, atherosclerotic plaques stained with different molar ratios of europium, in a potential plaque biomarker, europium tetracycline complex, were studied by fluorescence microscopy. The tetracycline antibiotic used was chlortetracycline. The growth of atherosclerotic plaque was followed during 60 days in New Zealand rabbits divided in two groups: an experimental group (EG), with nine animals and a control group (CG) with three animals. The animals in the EG received a diet with 1% of cholesterol and the animals of GC received a normal diet. The aortic arch of the animals with 60 days were cut in the vertical plane in 6 μm thick slices, which were mounted on glass slides and stained with hematoxylin an eosin and europium chlortetracycline complex (EuCTc). The fluorescence images were obtained exciting the EuCTc absorption band with a filter cube D (BP 355 - 425) and the emission was collected with a LP 470 suppression filter. Light intensity, detector gain and acquisition time were fixed for comparisons. The 20× magnified images were collected with 12 bit (or 4096 gray tones) resolution. The mean value of gray scale for each molar ratio of EuCTc was different, indicating that the complex interacts with the components of atherosclerotic plaque and the best molar ratio was 1.5 EuCTc. These results indicate the potential use of the EuCTc biomarker for atherosclerotic plaque characterization.

  11. Statistical nuclear properties and synthesis of 138La

    Directory of Open Access Journals (Sweden)

    Kheswa B. V.

    2015-01-01

    Full Text Available The synthesis of the neutron deficient 138La nucleus has been a puzzle for a long time. It has not been clear whether it is produced through photodisintegration processes or neutrino induced reactions due to unavailability of experimental data for nuclear level densities and γ strength functions of 138,139La nuclei. In the present work these nuclear properties have been measured and are used to investigate the synthesis of 138La. The results support the neutrino interactions as a dominant production process for 138La.

  12. Study on Europium-Doped Hydroxyapatite Nanoparticles by Fourier Transform Infrared Spectroscopy and Their Antimicrobial Properties

    Directory of Open Access Journals (Sweden)

    Simona-Liliana Iconaru

    2013-01-01

    Full Text Available Fourier transform infrared spectroscopy (FT-IR analysis was conducted on europium-doped hydroxyapatite, Ca10-xEux(PO46(OH2 nanocrystalline powders (Eu:HAp with 0≤xEu≤0.2. Antimicrobial studies were also performed for the first time on Eu:HAp. The antimicrobial properties of Eu:HAp nanoparticles with 0≤xEu≤0.2 on Gram-negative (E. coli ATCC 25922, Pseudomonas aeruginosa 1397 and Gram-positive (Staphylococcus aureus 0364, Enterococcus faecalis ATCC 29212 bacteria systems and a species of fungus (Candida albicans ATCC 10231 were reported. Our study demonstrates that the antimicrobial activity of Eu:HAp nanoparticles is dependent on the europium concentration.

  13. Europium determination in oxide and oxysulfide luminophors and their wastes by the method of direct and derivative spectrophotometry

    International Nuclear Information System (INIS)

    Mishchenko, V.T.; Aleksandrova, N.N.

    1989-01-01

    Spectrophotometric methods for europium determination in luminophors are proposed. Application of standard and derivative spectrophotometry allows one to determine europium in oxide and oxysulfide luminophors, their wastes and raffinates produced during waste reprocessing quite accurately and reliably. When determining Eu 2 O 3 (Eu 2 O 2 S) mass shares within 4-8 % limits absolute deviation from the mean result makes up to more than ± 0.2 %, relative standard deviation does not exceed 0.02

  14. Stability constants of the Europium complexes with the chloride ions

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.; Rojas H, A.

    2000-01-01

    The stability constants of lanthanides complexes with chloride ions which were determined at the same ionic force but in different media, are significantly different. It does not exist a systematic study over these stability constants. The purpose of this work is to determine the stability constants of the europium complexes with chloride ions at 303 K, by the solvents extraction method. (Author)

  15. Sorption of europium by Haro river sand in aqueous solution

    International Nuclear Information System (INIS)

    Syed Moosa Hasany; Syed Javaid Khurshid

    1997-01-01

    The sorption of Eu(III) on Haro river sand has been investigated. Influences include composition of the sorptive medium, the concentration of sorbent and sorbate, and shaking time. Haro river sand can be exploited for the preconcentration and removal of europium from very dilute solutions, for the decontamination and treatment of radioactive waste water and effluents from nuclear installations. (Author)

  16. Characteristics of transfer of europium ions from phosphoric acid solution into the CaSO4·O.5H2O solid phase

    International Nuclear Information System (INIS)

    Berdonosova, D.G.; Burlakova, E.V.; Yasenkova, M.A.; Ivanov, L.N.; Melikhov, I.V.

    1989-01-01

    The mechanism of formation of the precipitated CaSO 4 ·0.5H 2 O phase was studied in detail; the precipitation was performed at 80 degree, equimolar solutions of Ca(H 2 PO 4 ) 2 and H 2 SO 4 in phosphoric acid of 38% concentration being used. The availability of detailed information on the mechanism of formation of CaSO 4 ·0.5H 2 O precipitates determined the choice of conditions of study of capture of rare earths. In particular, H 3 PO 4 of 38% P 2 O 5 concentration was used as the medium of formation of the calcium sulfate precipitate. Europium was chosen as the rare earth. Its behavior in the liquid and solid phases was studied by radiometric and luminescence methods. The radionuclide 152 Eu is convenient as a radioactive tracer while luminescence of europium is structure-sensitive; therefore, europium is often used in physicochemical investigations as a luminescent probe. It follows from the data that most of the europium captured by the precipitate during coagulation of the ultramicrocrystals is retained firmly by the solid phase. Therefore, in order to diminish capture of europium (and other rare earths) by the precipitate coagulation of the latter should be prevented

  17. Mass spectrometric investigation of fluorated europium β-diketonates

    International Nuclear Information System (INIS)

    Khomenko, V.S.; Lozinskij, M.O.; Fialkov, Yu.A.; Rasshinina, T.A.; Suboch, V.P.; AN Ukrainskoj SSR, Kiev. Inst. Organicheskoj Khimii)

    1983-01-01

    Ternary complexes of europium with two organic lidands - fluorated β-diketone and organic base - in the aqueous phase at electron shock are investigated; regroupings that take place in them are established. Mass-spectrometric investigation has shown that complexes with β-diketones, containing in oxygen atom in a fluorated radical, eliminate stable molecules of difluorophosgen, CoF 2 . For the complexes studied under the above conditions the Co molecule elimination is also typical which is accompanied by the formation of ions with a metal-carbon bond

  18. Molecular interactions of Leucoagaricus naucinus with uranium(VI) and europium(III)

    Energy Technology Data Exchange (ETDEWEB)

    Wollenberg, Anne; Raff, Johannes [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Biogeochemistry; Guenther, A. [Helmholtz Institute Freiberg for Resource Technology, Freiberg (Germany)

    2017-06-01

    With regard to a molecular understanding of the interaction of fungal mycelium with radionuclides and its possible application for precautionary radiation protection and bio-remediation, the binding mechanism of the radionuclide uranium and the metal europium, as surrogate for trivalent actinides, where investigated with different starting conditions by the living fungal cells of Leucoagaricus naucinus.

  19. Molecular interactions of Leucoagaricus naucinus with uranium(VI) and europium(III)

    International Nuclear Information System (INIS)

    Wollenberg, Anne; Raff, Johannes

    2017-01-01

    With regard to a molecular understanding of the interaction of fungal mycelium with radionuclides and its possible application for precautionary radiation protection and bio-remediation, the binding mechanism of the radionuclide uranium and the metal europium, as surrogate for trivalent actinides, where investigated with different starting conditions by the living fungal cells of Leucoagaricus naucinus.

  20. Synthesis and characterization of highly triboluminescent doped europium tetrakis compounds

    International Nuclear Information System (INIS)

    Fontenot, Ross S.; Hollerman, William A.; Bhat, Kamala N.; Aggarwal, Mohan D.

    2012-01-01

    One of the most intriguing properties involving crystals is their ability to emit light when fractured. While this property was discovered over 200 years ago, no one has ever been able to come up with a complete theory that can predict the physical principles associated with triboluminescence. However, this has not stopped scientists from coming up with various uses for these materials. One such application is to use these materials as the active element for smart impact sensors that can warn of catastrophic impacts. If these sensors are to become a reality however, the material must emit a bright light when fractured. One of the brightest triboluminescent materials found thus far is europium dibenzoylmethide triethylammonium (EuD 4 TEA). This material was discovered by Hurt in 1966 and is bright enough to be seen in daylight. In 2011, the authors discovered that synthesizing EuD 4 TEA using europium nitrate instead of chloride significantly increased the triboluminescence yield and made the synthesis much easier and more consistent. However, to date, there are few investigations into the effects of dopants on the triboluminescence of EuD 4 TEA. This paper reports the investigation of the effects of various dopants on: (1) The triboluminescent light yield, (2) Crystal size and structure, (3) Synthesis time, and (4) Prompt decay time. Results show that inclusion of dopants during synthesis increases the triboluminescence emission of EuD 4 TEA by 55%, significantly reduces the synthesis time, and controls the decay time. All of these properties can be useful for constructing the first prototype of a customized impact sensor. - Highlights: ► Doped europium dibenzoylmethide triethylammonium (EuD 4 TEA) was synthesized. ► Effects of dopants was studied from EuD 4 TEA during low velocity (<10 m/s) impacts. ► The triboluminescent light yield, decay time, and synthesis time were measured. ► A specially-built drop tower was developed to measure triboluminescence

  1. Time-resolved laser fluorescence spectroscopy of organic ligands by europium: Fluorescence quenching and lifetime properties

    Science.gov (United States)

    Nouhi, A.; Hajjoul, H.; Redon, R.; Gagné, J. P.; Mounier, S.

    2018-03-01

    Time-resolved Laser Fluorescence Spectroscopy (TRLFS) has proved its usefulness in the fields of biophysics, life science and geochemistry to characterize the fluorescence probe molecule with its chemical environment. The purpose of this study is to demonstrate the applicability of this powerful technique combined with Steady-State (S-S) measurements. A multi-mode factor analysis, in particular CP/PARAFAC, was used to analyze the interaction between Europium (Eu) and Humic substances (HSs) extracted from Saint Lawrence Estuary in Canada. The Saint Lawrence system is a semi-enclosed water stream with connections to the Atlantic Ocean and is an excellent natural laboratory. CP/PARAFAC applied to fluorescence S-S data allows introspecting ligands-metal interactions and the one-site 1:1 modeling gives information about the stability constants. From the spectral signatures and decay lifetimes data given by TRLFS, one can deduce the fluorescence quenching which modifies the fluorescence and discuss its mechanisms. Results indicated a relatively strong binding ability between europium and humic substances samples (Log K value varies from 3.38 to 5.08 at pH 7.00). Using the Stern-Volmer plot, it has been concluded that static and dynamic quenching takes places in the case of salicylic acid and europium interaction while for HSs interaction only a static quenching is observed.

  2. Bioenvironmental aspects of europium and rhodium: a selected bibliography

    International Nuclear Information System (INIS)

    Fore, C.S.; Carrier, R.F.; Talmage, S.S.; Fielden, J.M.; Daniel, E.W.

    1983-09-01

    This bibliography of 428 abstracted references represents a summary of the domestic and foreign literature relevant to the biological and environmental aspects of europium and rhodium. The collected data are organized by current NAEG interests - research highlighting inventory and distribution of the radionulcides, ecological studies covering terrestrial and aquatic systems, and biological studies in both man and animals. Studies that focus directly on research conducted at specific sites (e.g., the Nevada Test Site) are emphasized throughout the bibliography

  3. Electron-induced desorption of europium atoms from oxidized tungsten surface: concentration dependence of low-energy peak

    CERN Document Server

    Davydov, S Y

    2002-01-01

    One discusses nature of electron induced desorption of Eu sup 0 europium atoms under E sub e irradiating electron low-energies (approx 30 eV) and peculiarities of yield dependence of Eu sup 0 atoms on their concentration at oxidized tungsten surface. Primary act of vacancy origination in europium adatom inner 5p-shell turned to be the determining stage. Evaluations have shown that just the first of two possible scenarios of ionization (electron intra-atomic to Eu adatom external quasi-level or realise of knocked out electron into vacuum) leads to Eu sup 0 desorption. One determined concentration threshold for yield of Eu sup 0 atoms

  4. Sorption of Europium in zirconium silicate

    International Nuclear Information System (INIS)

    Garcia R, G.

    2004-01-01

    Some minerals have the property of sipping radioactive metals in solution, that it takes advantage to manufacture contention barriers that are placed in the repositories of nuclear wastes. The more recent investigations are focused in the development of new technologies guided to the sorption of alpha emissors on minerals which avoid their dispersion in the environment. In an effort to contribute to the understanding of this type of properties, some studies of sorption of Europium III are presented like homologous of the americium, on the surface of zirconium silicate (ZrSiO 4 ). In this work the results of sorption experiences are presented as well as the interpretation of the phenomena of the formation of species in the surface of the zirconium silicate. (Author)

  5. Metal plasmon enhanced europium complex luminescence

    International Nuclear Information System (INIS)

    Liu Feng; Aldea, Gabriela; Nunzi, Jean-Michel

    2010-01-01

    The plasmon enhanced luminescence of a rare-earth complex Tris(6, 6, 7, 7, 8, 8, 8-heptafluoro-2, 2-dimethyl-3, 5-octanedionato) europium (Eu(fod) 3 ) was investigated. A polyvinyl alcohol (PVA) thin film was successfully adopted as a spacer to separate the Eu complex from the silver island film (SIF), and five-fold enhancement of the radiative decay rate of the Eu complex on SIF was demonstrated based on the luminescence intensity and lifetime measurement. Investigation of the distance dependent luminescence indicates that 7 nm is an optimal distance for SIF enhanced Eu luminescence. Plasmon enhanced rare-earth luminescence based on an organic film spacer would find potential applications in plasmon enhanced organic light emitting diode (OLED) devices.

  6. Determination of the hydrolysis constants of Europium (III), in ion strength media 4, 5 and 6 M NaClO4 at 303 K

    International Nuclear Information System (INIS)

    Alvarado B, A.; Jimenez R, M.; Solache R, M.

    1999-01-01

    This work was made with the purpose to complete information about the hydrolysis constants of Europium (III) in high ion strength media. So it was determined at a ion forces media 4, 5 and 6 M of sodium perchlorate at 303 K. The method used was the potentiometric with the aid of the Super quad computer program. In high ion strength media, the measurements of p H do not correspond directly to negative logarithm of the concentration of hydrogen ions, by this it is necessary to calibrate the electrode in these conditions. The Europium was hydrolized at pC H values greater 6 in all cases. The potentiometric method used under the described experimental conditions is adequate to determine the hydrolysis constants of Europium (III). According to the results and diagrams of chemical species of Europium obtained we can conclude that the hydrolysis constants, differ by its distribution but not in its identity. (Author)

  7. Improved efficiency of organic light-emitting diodes based on a europium complex by fluorescent dye

    Energy Technology Data Exchange (ETDEWEB)

    You Han [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of Chinese Academy of Sciences, Changchun 130022 (China); Fang Junfeng [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of Chinese Academy of Sciences, Changchun 130022 (China); Gao Jia [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of Chinese Academy of Sciences, Changchun 130022 (China); Ma Dongge [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of Chinese Academy of Sciences, Changchun 130022 (China)]. E-mail: mdg1014@ciac.jl.cn

    2007-01-15

    Improved efficiency of organic light-emitting diodes (OLEDs) based on europium complexes have been realized by using a fluorescent dye 4-(dicyanomethylene)-2-t-butyl-6 (1,1,7,7-tetramethyljulolidyl-9-enyl))-4H-pyran (DCJTB) doping .The luminous efficiency of the devices with a fluorescent dye in the emissive layer was found to improve two times of that in devices without fluorescent dye. The devices showed pure red light, which is the characteristic emission of trivalent europium ion with a full-width at half-maximum of 3 nm.The maximum brightness and luminous efficiency reached 1200 cd/m{sup 2} at 23 V and 7.3 cd/A (2.0 lm/w), respectively, at a current density of 0.35 mA/cm{sup 2}.

  8. Determination of the first hydrolysis constant of Europium (III) in 3 M of ionic strength

    International Nuclear Information System (INIS)

    Ramirez B, M.E.

    1994-01-01

    The first hydrolysis constant of Eu 3+ has been determined at 303 K and 3 M (NaCl) ionic strength. A solvent extraction method was used, the extractant was dibenzoylmethane in benzene and di glycolate anion in the aqueous phase provided competitive complexation. The tracer solution was 152m1 Eu (III) in water. The radioactive solution of europium was obtained by neutron irradiation of europium nitrate solutions at pH 3.0, in a TRIGA Mark III nuclear reactor at a neutron flux of 1 x 10 13 cm -2 s -1 . The half life of the produced isotope, 152m1 Eu (9.3 h), was verified by means of a Ge H detector and no interfering radiations were observed in the spectra. (Author)

  9. 33 CFR 138.150 - Service of process.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Service of process. 138.150... Pollution (Vessels) § 138.150 Service of process. (a) When executing the forms required by this subpart... as its agent for service of process for purposes of this subpart and for receipt of notices of...

  10. Studies on effect of europium concentration on the photoemission of laser ablated Y2O3:Eu based nano-phosphors

    International Nuclear Information System (INIS)

    Nissamudeen, K.M.; Krishnan, Renju R.; Rajan, Geo; Gopchandran, K.G.

    2007-01-01

    Full text: Phosphors are essential materials in display applications. Oxide-based phosphors are likely to emerge as the potential choice for the FED red phosphor. Among those oxide-based phosphors, there has been significant research interest in the development of Y 2 O 3 :Eu thin films as one of the most promising oxide based red phosphor systems. Yttrium oxide mixed with europium exhibit strong UV and cathode-ray-excited luminescence that are useful in lamp and display applications. Dielectric Y 2 O 3 film has recently attracted much attention for its potential application as an electric insulation layer in electroluminescent devices and high-density dynamic random access memory gate dielectrics because of its high band gap (5.8 eV) and large dielectric constant (14 to 18). Another important application of Y 2 O 3 has been in luminescent displays as a host material for rare-earth ions, specifically europium, in order to get emission of red light. In the present study thin films were deposited under a vacuum of 10 -6 mbar on fused amorphous quartz substrates using a Q-switched Nd: YAG laser, 532 nm, pulse width 9 n sec, and repetition frequency of 10 Hz, with sintered Y 2 O 3 pellets having different europium concentration as target material. Attempts were made to understand the effect of europium concentration and annealing process on the photoemission properties of the films. A europium concentration of 8 wt% and an annealing temperature of 1173 K were found to be optimum conditions for maximum photoemission. The dependence of structure and morphology of the films on the photoemission intensity are described with XRD patterns and images obtained from AFM and SEM studies

  11. Test of zircon materials for sorption of europium

    International Nuclear Information System (INIS)

    Ordonez R, E.; Fernandez V, S.M.; Garcia R, G.

    2003-01-01

    In previous works it has already been made notice that some phosphates have the property of sipping radioactive metals in solution, what takes advantage to fabricate reactive barriers that are placed in the repositories of nuclear wastes. In our laboratory it has been obtained to the zirconium silicate (ZrSiO 4 ) and the alpha zirconium hydrogen phosphate (Zr(HPO 4 ) 2H 2 0) starting from sea sand in an easy and economic way. With the interest of knowing if these compounds can be used in contention barriers the evaluation of their surface properties it is made and of europium sorption. (Author)

  12. Electronic structure and superconductivity of europium

    International Nuclear Information System (INIS)

    Nixon, Lane W.; Papaconstantopoulos, D.A.

    2010-01-01

    We have calculated the electronic structure of Eu for the bcc, hcp, and fcc crystal structures for volumes near equilibrium up to a calculated 90 GPa pressure using the augmented-plane-wave method in the local-density approximation. The frozen-core approximation was used with a semi-empirical shift of the f-states energies in the radial Schroedinger equation to move the occupied 4f valence states below the Γ 1 energy and into the core. This shift of the highly localized f-states yields the correct europium phase ordering with lattice parameters and bulk moduli in good agreement with experimental data. The calculated superconductivity properties under pressure for the bcc and hcp structures are also found to agree with and follow a T c trend similar to recent measurement by Debessai et al.

  13. Mass spectrometric investigation of fluorated europium. beta. -diketonates. [Electrons

    Energy Technology Data Exchange (ETDEWEB)

    Khomenko, V.S.; Lozinskij, M.O.; Fialkov, Yu.A.; Rasshinina, T.A.; Suboch, V.P. (AN Belorusskoj SSR, Minsk. Inst. Fiziki; AN Ukrainskoj SSR, Kiev. Inst. Organicheskoj Khimii)

    Ternary complexes of europium with two organic ligands - fluorated ..beta..-diketone and organic base - in the aqueous phase at electron shock are investigated; regroupings that take place in them are established. Mass-spectrometric investigation has shown that complexes with ..beta..-diketones, containing in oxygen atom in a fluorated radical, eliminate stable molecules of difluorophosgen, CoF/sub 2/. For the complexes studied under the above conditions the Co molecule elimination is also typical which is accompanied by the formation of ions with a metal-carbon bond.

  14. Europium sorption on zirconia at elevated temperatures: experimental study and modeling

    International Nuclear Information System (INIS)

    Eglizaud, N.; Catalette, H.

    2005-01-01

    Full text of publication follows: Direct disposal of spent nuclear fuel in deep underground repository is being considered by several countries. The waste package maintains an elevated temperature for thousands of years. As sorption is one of the main phenomenon limiting the dispersion of radionuclides in the environment, it has to be studied at elevated temperatures. Zirconia is an oxide produced by cladding oxidation which is suspected in the near field of a nuclear repository. It then could possibly be in contact with waste elements as Europium (III), the sorption of which is therefore studied on zirconia. Experiments were performed by the batch method at a solid/liquid ratio of 10 g.L-1. The sorption edges were recorded in the pH-range from 2 to 10 at 2.10 -5 mol.L -1 Eu(NO 3 ) 3 (I = 0.1 mol.L -1 KNO 3 ). An over-pressure device in an autoclave with an incorporated filtering system allowed the experiments, carbonate free, at 25 deg. C, 50 deg. C, 80 deg. C, 120 deg. C and 150 deg. C and in situ pH measurements. Filtrates were analyzed by the ICP-AES method. Sorption isotherms show an increase in the sorption phenomenon when the temperature raises. The half sorption pH decreases from 7 at 25 deg. C to 3,6 at 150 deg. C. The distribution coefficients that were obtained at elevated temperatures enriched the databases of integrated performance assessment codes. Raw data were modeled with the surface complexation theory using the double layer model (DLM). Several possible surface complexes were examined and discussed, taking into account aqueous hydrolyzed and precipitated species of Europium. A good agreement between experimental values and modeled isotherms was found at all studied temperatures. Results were consistent with a bidentate complex formed by Europium (III) on the zirconia surface. Associated formation constants were then determined with the geochemical computer code CHESS. (authors)

  15. Particle-hole states in 138Ba

    International Nuclear Information System (INIS)

    Bondarenko, V.A.; Khitrov, V.A.; Popov, Yu.P.; Brant, S.; Paar, V.; Simicic, L.

    1995-01-01

    The thermal-neutron-capture gamma rays and γγ-coincidences were measured by means of Ge detectors. Using primary and secondary (n, γ) data, the level scheme of 138 Ba was established with 63 levels up to an excitation energy of 5 MeV. The level energies and (d, p) transfer data were compared with model predictions of the interacting boson-fermion-fermion model. As shown, this model provides a basic understanding of the neutron particle-hole states of 138 Ba in the energy range of 3.5-5.0 MeV. ((orig.))

  16. ULTRAVIOLET TRANSITIONS IN EUROPIUM STUDIED WITH A FREQUENCY-DOUBLED CW RING DYE-LASER

    NARCIS (Netherlands)

    Eliel, E.R.; Hogervorst, W.; van Leeuwen, K.A.H.; Post, B.H.

    1981-01-01

    High resolution laser spectroscopy has been applied to the study of three ultraviolet transitions in Europium at λ = 294.8, 295.1 and 295.8 nm. The tunable narrowband UV has been generated by intracavity frequency doubling in a cw ring dye laser using a temperate tuned, Brewster angled ADA crystal.

  17. Detection of Molecular Chirality by Induced Resonance Raman Optical Activity in Europium Complexes

    Czech Academy of Sciences Publication Activity Database

    Yamamoto, Shigeki; Bouř, Petr

    2012-01-01

    Roč. 51, č. 44 (2012), s. 11058-11061 ISSN 1433-7851 R&D Projects: GA MŠk(CZ) LH11033; GA ČR GAP208/11/0105 Institutional support: RVO:61388963 Keywords : europium * complexes * raman optical activity * resonance Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 13.734, year: 2012

  18. Effect of temperature on the extraction of europium (III) bymixtures of neutral phosphoro-organic extractants from nitrate solutions

    International Nuclear Information System (INIS)

    Milchlin, E.B.; Khmuran, M.A.; Mikhailichenko, A.I.

    1986-01-01

    A study has been made of the distribution of microquantities of europium (III) on extraction with neutral phosphoorganic compounds-tri-n-butyl phosphate (TBP), diisooctylmethyl phosphonate (DIOMP),trialkylphosphine oxide with dissimilar radicals (PODR), or mixtures thereof-from a solution of 2 mole/liter NH 4 NO 3 and 0.01 mole/liter HNO 3 , in the temperature range 20-60 0 C. A temperature rise results in a decrease of the distribution coefficients of the europium on extraction by all of the extractants tested and their mixtures, and also in a reduction of the synergistic effect in extraction by mixtures of the extractants. Based on an investigation of the temperature dependences of the distribution constants of europium nitrate upon extraction by TBP, DIOMP, PODR, or their mixtures, values have been determined for the enthalpy, free energy, and entropy of extraction. It is shown that the enthalpy (-ΔH) increases in the order TBP< DIOMP< PODR. In an extraction with mixed extractants, the enthalpy has a value intermediate between those with the individual extractants. The entropy of extraction (-ΔS) increases in the reverse order PODR< DIOMP< TBP

  19. In vivo toxicity studies of europium hydroxide nanorods in mice

    International Nuclear Information System (INIS)

    Patra, Chitta Ranjan; Abdel Moneim, Soha S.; Wang, Enfeng; Dutta, Shamit; Patra, Sujata; Eshed, Michal; Mukherjee, Priyabrata; Gedanken, Aharon; Shah, Vijay H.; Mukhopadhyay, Debabrata

    2009-01-01

    Lanthanide nanoparticles and nanorods have been widely used for diagnostic and therapeutic applications in biomedical nanotechnology due to their fluorescence and pro-angiogenic properties to endothelial cells, respectively. Recently, we have demonstrated that europium (III) hydroxide [Eu III (OH) 3 ] nanorods, synthesized by the microwave technique and characterized by several physico-chemical techniques, can be used as pro-angiogenic agents which introduce future therapeutic treatment strategies for severe ischemic heart/limb disease, and peripheral ischemic disease. The toxicity of these inorganic nanorods to endothelial cells was supported by several in vitro assays. To determine the in vivo toxicity, these nanorods were administered to mice through intraperitoneal injection (IP) everyday over a period of seven days in a dose dependent (1.25 to 125 mg kg -1 day -1 ) and time dependent manner (8-60 days). Bio-distribution of europium elements in different organs was analyzed by inductively coupled plasma mass spectrometry (ICPMS). Short-term (S-T) and long-term (L-T) toxicity studies (mice euthanized on days 8 and 60 for S-T and L-T, respectively) show normal blood hematology and serum clinical chemistry with the exception of a slight elevation of liver enzymes. Histological examination of nanorod-treated vital organs (liver, kidney, spleen and lungs) showed no or only mild histological changes that indicate mild toxicity at the higher dose of nanorods.

  20. Electroplex emission from a layer of a mixture of a europium complex and tris(8-quinolinolato) aluminum

    Science.gov (United States)

    Cao, Hong; Gao, Xicun; Huang, Chun-Hui

    2000-07-01

    With a europium complex, tris(α-thenoyltrifluoroacetonato) bis(triphenylphosphine oxide) europium (Eu(TTA) 3(TPPO) 2), as the light-emitting layer, N, N'-diphenyl- N, N'-di( m-tolyl)-benzidine (TPD) as the hole transport layer and tris(8-quinolinolato) aluminum (ALQ) as the electron transport layer, the triple-layer electroluminescent (EL) device emits red light characteristic of Eu 3+ emission. However, as the mixture of Eu(TTA) 3(TPPO) 2 and ALQ is co-evaporated as the light-emitting layer to form a bilayer EL device, a new wide-banded emission peaked at c. 640 nm was obtained. This emission is neither from ALQ nor from the europium complex. The photoluminescence (PL) of the thin film on quartz substrate evaporated from one mixed solid powder of Eu(TTA) 3(TPPO) 2 and ALQ is composed of distinct PL emissions of Eu(TTA) 3(TPPO) 2 and ALQ, denying an exciplex formation mechanism. It is impossible to form a host-guest system. We propose that the EL emission peaked at c. 640 nm is from an electroplex route: a transition between the lowest unoccupied molecular orbital (LUMO) of Eu(TTA) 3(TPPO) 2 and the highest occupied molecular orbital (HOMO) of ALQ.

  1. 22 CFR 138.300 - Professional and technical services.

    Science.gov (United States)

    2010-04-01

    ... and analysis directly applying any professional or technical discipline. For example, drafting or a... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.300... Activities by Other Than Own Employees § 138.300 Professional and technical services. (a) The prohibition on...

  2. Crystal agglomeration of europium oxalate in reaction crystallization using double-jet semi-batch reactor

    International Nuclear Information System (INIS)

    Kim, Woo-Sik; Kim, Woon-Soo; Kim, Kwang-Seok; Kim, Joon-Soo; Ward, Michael D.

    2004-01-01

    The particle agglomeration of europium oxalate was investigated in a double-jet semi-batch reactor over a wide range of operating variables, including the agitation speed, reactant feed rate, and reactant concentration. The size of the agglomerates was directly dictated by the particle collision and supersaturation promoting agglomeration and the fluid shear force inhibiting agglomeration. Thus, with a longer feeding time and higher feed concentration for the reaction crystallization, the mean particle size increased, while the corresponding total particle population decreased due to the enhanced chance of particle agglomeration, resulting from a longer residence time and higher supersaturation in the reactor. Agitation was found to exhibit a rather complicated influence on particle agglomeration. Although both particle collision and turbulent fluid shear were promoted by an increase in the mixing intensity, the crystal agglomeration of europium oxalate was maximized at around 500 rpm of agitation speed due to an optimized balance between particle aggregation and breakage

  3. Resonance ionization spectroscopy of Europium The first application of the PISA at ISOLDE-RILIS

    CERN Document Server

    AUTHOR|(CDS)2099873; Marsh, Bruce Alan

    The following work has been carried out at the radioactive ion beam facility ISOLDE at CERN. A compact atomic beam unit named PISA (Photo Ionization Spectroscopy Apparatus) has been implemented as a recent addition to the laboratory of the Resonance Ionization Laser Ion Source (RILIS). The scope of this thesis work was to demonstrate different applications of the PISA, using the existing and highly developed laser setup of the RILIS installation. In a demonstration of the suitability of PISA for ionization scheme development, a new ionization scheme for Europium has been developed. This resulted in the observation of several new autoionizing states and Rydberg series. Through the analysis of the observed Rydberg resonances a refined value of $45734.33(3)(3)$ cm$^{-1}$ for the ionization potential of the europium atom has been determined. In addition this thesis reports on the feasibility of the use of the PISA as a RILIS performance monitoring device during laser ion source operations. Finally the present wor...

  4. Spectroscopic studies of europium-tetracyclines complexes and their applications in detection of hydrogen peroxide and urea peroxide; Estudos espectroscopicos dos complexos europio-tetraciclinas e suas aplicacoes na detecao de peroxido de hidrogenio e peroxido de ureia

    Energy Technology Data Exchange (ETDEWEB)

    Grasso, Andrea Nastri

    2010-07-01

    In this work were studied the spectroscopic properties of trivalent europium ion complexed with components of tetracycline family, chlorotetracycline, oxytetracycline and metacycline, in the presence of hydrogen peroxide and urea peroxide. Optical parameters were obtained such as absorption, emission, lifetime and calibration curves were constructed for luminescence spectra. Experiments were carried out with both inorganic compounds and europium-tetracyclines complexes in order to verify possible interferences. Studies for glucose determination were also described using europium-tetracyclines complexes as biosensors. Results show that europium tetracyclines complexes emit a narrow band in the visible region and, in the presence of hydrogen peroxide or urea peroxide there is a greater enhancement in their luminescence and lifetime. Thus, europium-tetracyclines complexes studied can be used as biosensors for hydrogen and urea peroxides determination as a low cost and room temperature method. An indirect method for glucose determination was studied by adding glucose oxidase enzyme in europium-tetracyclines complex in the presence of glucose promoting as product hydrogen peroxide. (author)

  5. 22 CFR 138.205 - Professional and technical services.

    Science.gov (United States)

    2010-04-01

    ..., drafting of a legal document accompanying a bid or proposal by a lawyer is allowable. Similarly, technical... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.205... Activities by Own Employees § 138.205 Professional and technical services. (a) The prohibition on the use of...

  6. Europium-doped calcium titanate: Optical and structural evaluations

    Energy Technology Data Exchange (ETDEWEB)

    Mazzo, Tatiana Martelli; Pinatti, Ivo Mateus [INCTMN, LIEC, Departamento de Química, Universidade Federal de São Carlos, P.O. Box 676, 13565-905 São Carlos, SP (Brazil); Macario, Leilane Roberta [INCTMN, LIEC, Instituto de Química, Universidade Estadual Paulista, P.O. Box 355, 14800-900 Araraquara, SP (Brazil); Avansi, Waldir [Centro de Ciências Exatas e de Tecnologia, Departamento de Física, Universidade Federal de São Carlos, Jardim Guanabara, 13565-905 São Carlos, SP (Brazil); Moreira, Mario Lucio [Instituto de Física e Matemática, Universidade Federal de Pelotas, P.O. Box 354, Campus do Capão do Leão, 96001-970 Pelotas, RS (Brazil); Rosa, Ieda Lucia Viana, E-mail: ilvrosa@ufscar.br [INCTMN, LIEC, Departamento de Química, Universidade Federal de São Carlos, P.O. Box 676, 13565-905 São Carlos, SP (Brazil); Mastelaro, Valmor Roberto [Instituto de Física de São Carlos, Departamento de Física e Ciência dos Materiais, Universidade de São Paulo, P.O. Box 369, Av Trabalhador São Carlense 400, 13560-970 São Carlos, SP (Brazil); Varela, José Arana; Longo, Elson [INCTMN, LIEC, Instituto de Química, Universidade Estadual Paulista, P.O. Box 355, 14800-900 Araraquara, SP (Brazil)

    2014-02-05

    Highlights: • CaTiO{sub 3}:Eu{sup 3+} were obtained using low temperatures and very short reactional times. • The Eu{sup 3+} changes the local order–disorder of the [TiO{sub 6}] and [CaO{sub 12}] clusters. • Lifetime decay curves reveal two sites of symmetry of the Eu{sup 3+} in the CT matrix. • CaTiO{sub 3}:Eu{sup 3+} exhibit the strongest luminescent intensity and pure red color. -- Abstract: Pure Calcium Titanate (CT-pure) and Europium doped Calcium Titanate Ca{sub 1−x}Eu{sub x}TiO{sub 3} (x = 0.5%, 1.0% and 2.0% molar ratio of Eu{sup 3+} ions) powders were synthesized by hydrothermal microwave method (HTMW) at 140 °C for 8 min. The HTMW method appears to be an efficient method to prepare the luminescence materials using low temperatures and very short reactional times. In addition it is possible to determine specific correlations imposed by TiCl{sub 4} replacement by titanium isopropoxide [Ti(OC{sub 3}H{sub 7}){sub 4}] changing the reaction character and resulting in two different options of europium doping CT syntesis. To evaluate the influence of the structural order–disorder among the reactions and different properties of these materials, the following techniques were used for characterization. XANES spectroscopy that revealed that the introduction of Eu{sup 3+} ions into the CT lattice induces to significant changes in the local order–disorder around both, [TiO{sub 6}] and [CaO{sub 12}], complex clusters. PL spectra show Eu{sup 3+} emission lines ascribed to the Eu{sup 3+} transitions from {sup 5}D{sub 0} excited states to {sup 7}F{sub J} (J = 0, 1–4) fundamental states in CT:Eu{sup 3+} powders excited at 350 and 394 nm.

  7. Structural and optical analysis on europium doped AZrO{sub 3} (A=Ba, Ca, Sr) phosphor for display devices application

    Energy Technology Data Exchange (ETDEWEB)

    Dubey, Vikas, E-mail: jsvikasdubey@gmail.com [Department of Physics, Bhilai Institute of Technology Raipur, 493661 (India); Tiwari, Neha [Department of Physics, Govt. Model Science College, Jabalpur (India)

    2016-05-06

    Behavior displayed by europium doped AZrO{sub 3} phosphor which was synthesized by solid state reaction method. For synthesis of BaZrO{sub 3}, SrZrO{sub 3} and CaZrO{sub 3} phosphor with fixed concentration of europium ion was calcination at 1000°C and sintered at 1300°C following intermediate grinding. Synthesized sample was characterized by X-ray diffraction analysis and crystallite sized was calculated by Scherer’s formula. From PL spectra of prepared phosphors shows intense emission centred at 612nm (red emission) with high intensity for SrZrO{sub 3}:Eu{sup 3+}. For europium doped BaZrO{sub 3} and CaZrO{sub 3} (613nm) phosphor shows less intense PL spectra as compared to SrZrO{sub 3}:Eu{sup 3+}. The strong emission peak of AZrO{sub 3}:Eu{sup 3+} phosphor is due to forced electric dipole transition of {sup 5}D{sub 0} to {sup 7}F{sub 2} centered at 612 and 613nm. It is characteristic red emission for europium ion. The excitation spectra of AZrO{sub 3}:Eu{sup 3+} phosphor mainly consists of the charge transfer and (CTB) of Eu{sup 3+} located in 200–350 nm centred at 254nm. The present phosphors can act as single host for red light emission in display devices. The CIE coordinates were calculated by Spectrophotometric method using the spectral energy distribution of the AZrO{sub 3}:Eu{sup 3+} sample.

  8. Europium(III) chelate-dyed nanoparticles as donors in a homogeneous proximity-based immunoassay for estradiol

    International Nuclear Information System (INIS)

    Kokko, Leena; Sandberg, Kaisa; Loevgren, Timo; Soukka, Tero

    2004-01-01

    Nanoparticles containing thousands of fluorescent europium(III) chelates have a very high specific activity compared to traditional lanthanide chelate labels. It can be assumed that if these particles are used in a homogeneous assay as donors, multiple chelates can excite a single acceptor in turns and the energy transfer to the acceptor is increased. The principle was employed in an immunoassay using luminescent resonance energy transfer from a long lifetime europium(III) chelate-dyed nanoparticle to a short lifetime, near-infrared fluorescent molecule. Due to energy transfer fluorescence lifetime of the sensitised emission was prolonged and fluorescence could be measured using a time-resolved detection. A competitive homogeneous immunoassay for estradiol was created using 92 nm europium(III) chelate-dyed nanoparticle coated with 17β-estradiol specific recombinant antibody Fab fragments as a donor and estradiol conjugated with near-infrared dye AlexaFluor 680 as an acceptor. The density of Fab fragments on the surface of the particle influenced the sensitivity of the immunoassay. The optimal Fab density was reached when the entire surface of the particle participated in the energy transfer, but the areas where the energy was transferred to a single acceptor, did not overlap. We were able to detect estradiol concentrations down to 70 pmol l -1 (3xSD of a standard containing 0 nmol l -1 of E2) using a 96-well platform. In this study we demonstrated that nanoparticles containing lanthanide chelates could be used as efficient donors in homogeneous assays

  9. Silencing of microRNA-138-5p promotes IL-1β-induced cartilage degradation in human chondrocytes by targeting FOXC1: miR-138 promotes cartilage degradation.

    Science.gov (United States)

    Yuan, Y; Zhang, G Q; Chai, W; Ni, M; Xu, C; Chen, J Y

    2016-10-01

    Osteoarthritis (OA) is characterised by articular cartilage degradation. MicroRNAs (miRNAs) have been identified in the development of OA. The purpose of our study was to explore the functional role and underlying mechanism of miR-138-5p in interleukin-1 beta (IL-1β)-induced extracellular matrix (ECM) degradation of OA cartilage. Human articular cartilage was obtained from patients with and without OA, and chondrocytes were isolated and stimulated by IL-1β. The expression levels of miR-138-5p in cartilage and chondrocytes were both determined. After transfection with miR-138-5p mimics, allele-specific oligonucleotide (ASO)-miR-138-5p, or their negative controls, the messenger RNA (mRNA) levels of aggrecan (ACAN), collagen type II and alpha 1 (COL2A1), the protein levels of glycosaminoglycans (GAGs), and both the mRNA and protein levels of matrix metalloproteinase (MMP)-13 were evaluated. Luciferase reporter assay, quantitative real-time polymerase chain reaction (qRT-PCR), and Western blot were performed to explore whether Forkhead Box C1 (FOCX1) was a target of miR-138-5p. Further, we co-transfected OA chondrocytes with miR-138-5p mimics and pcDNA3.1 (+)-FOXC1 and then stimulated with IL-1β to determine whether miR-138-5p-mediated IL-1β-induced cartilage matrix degradation resulted from targeting FOXC1. MiR-138-5p was significantly increased in OA cartilage and in chondrocytes in response to IL-1β-stimulation. Overexpression of miR-138-5p significantly increased the IL-1β-induced downregulation of COL2A1, ACAN, and GAGs, and increased the IL-1β-induced over expression of MMP-13.We found that FOXC1 is directly regulated by miR-138-5p. Additionally, co-transfection with miR-138-5p mimics and pcDNA3.1 (+)-FOXC1 resulted in higher levels of COL2A1, ACAN, and GAGs, but lower levels of MMP-13. miR-138-5p promotes IL-1β-induced cartilage degradation in human chondrocytes, possibly by targeting FOXC1.Cite this article: Y. Yuan, G. Q. Zhang, W. Chai,M. Ni, C. Xu, J

  10. 33 CFR 138.20 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... financial responsibility referred to in § 138.10(a): claim, claimant, damages, discharge, exclusive economic... POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION FINANCIAL RESPONSIBILITY FOR WATER POLLUTION (VESSELS) AND OPA 90 LIMITS OF LIABILITY (VESSELS AND DEEPWATER PORTS) Financial Responsibility for Water...

  11. Structural and photocatalytic properties of iron- and europium-doped TiO2 nanoparticles obtained under hydrothermal conditions

    International Nuclear Information System (INIS)

    Diamandescu, L.; Vasiliu, F.; Tarabasanu-Mihaila, D.; Feder, M.; Vlaicu, A.M.; Teodorescu, C.M.; Macovei, D.; Enculescu, I.; Parvulescu, V.; Vasile, E.

    2008-01-01

    Iron- and europium-doped (≤1 at.%) TiO 2 nanoparticles powders have been synthesized by a hydrothermal route at 200 deg. C, starting with TiCl 4 , FeCl 3 .6H 2 O and EuCl 3 .6H 2 O. The structure, morphology and optical peculiarities were investigated by means of X-ray diffraction (XRD), transmission electron microscopy (TEM), extended X-ray absorption fine structure (EXAFS), Moessbauer spectroscopy and UV-vis measurements. The photocatalytic performance was analysed in the photodegradation reaction of phenol. Rietveld refinements of XRD patterns reveal that the as-prepared samples consist in iron- and europium-doped TiO 2 in the tetragonal anatase structural shape, with particle size as low as 15 nm. By means of Moessbauer spectroscopy on both 57 Fe and 151 Eu isotopes as well as by EXAFS analyses, the presence of Fe 3+ and/or Eu 3+ ions in the nanosized powders has been evidenced. It was found that iron and europium ions can substitute for titanium in the anatase structure. From the UV-vis reflection spectra, by using the transformed Kubelka-Munk functions, the band gap energy (E g ) of the hydrothermal samples has been determined in comparison with that of Degussa P-25 photocatalyst. A decrease of E g from 2.9 eV found for Degussa photocatalyst to 2.8 eV for the titania doped with 1 at.% Fe has been evidenced, indicating a valuable absorption shift (∼20 nm) towards visible light region. However, the best photocatalytic activity in the photodegradation reaction of phenol was evidenced for the hydrothermal sample, TiO 2 : 1 at.% Fe, 0.5 at.% Eu, in both UV and visible light regions. The photocatalytic activities of iron-doped and iron-europium-codoped samples are high and practically the same only in visible light. The photocatalytic properties in correlation with the structural and optical peculiarities of the hydrothermal samples are discussed

  12. 7 CFR 400.138 - Procedures for salary offset; methods of collection.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Procedures for salary offset; methods of collection. 400.138 Section 400.138 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL... Management-Regulations for the 1986 and Succeeding Crop Years § 400.138 Procedures for salary offset; methods...

  13. Characterization of photoluminescent europium doped yttrium oxide thin-films prepared by metallorganic chemical vapor deposition

    International Nuclear Information System (INIS)

    McKittrick, J.; Bacalski, C.F.; Hirata, G.A.; Hubbard, K.M.; Pattillo, S.G.; Salazar, K.V.; Trkula, M.

    1998-01-01

    Europium doped yttrium oxide, (Y 1-x Eu x ) 2 O 3 , thin-films were deposited on silicon and sapphire substrates by metallorganic chemical vapor deposition (MOCVD). The films were grown in a MOCVD chamber reacting yttrium and europium tris(2,2,6,6-tetramethyl-3,5,-heptanedionates) precursors in an oxygen atmosphere at low pressures (5 Torr) and low substrate temperatures (500--700 C). The films deposited at 500 C were flat and composed of nanocrystalline regions of cubic Y 2 O 3 , grown in a textured [100] or [110] orientation to the substrate surface. Films deposited at 600 C developed from the flat, nanocrystalline morphology into a plate-like growth morphology oriented in the [111] with increasing deposition time. Monoclinic Y 2 O 3 :Eu 3+ was observed in x-ray diffraction for deposition temperatures ≥600 C on both (111) Si and (001) sapphire substrates. This was also confirmed by the photoluminescent emission spectra

  14. The enthalpies of formation of neutral and charged components of saturated vapor over europium dichloride

    International Nuclear Information System (INIS)

    Pogrebnoj, A.M.; Kudin, L.S.

    2003-01-01

    Composition of saturated vapor over europium dichloride was studied by the method of high-temperature mass spectrometry in the temperature range of 1154 - 1267 K. For neutral components of the vapor, represented by monomer and dimer molecules, partial pressures were determined. Enthalpies of sublimation of europium dichloride Δ s H 0 (298 K) as monomers (338 ± 9) and dimers (407 ± 20 kJ/mol) were calculated. Equilibrium constants of ion-molecular and ion-ionic reactions were measured, their enthalpies being ascertained. Enthalpies of formation of molecules and ions Δ f H 0 (298 K) were calculated: -486 ± 11 (EuCl 2 ), -1242 ± 22 (Eu 2 Cl 4 ), 1 ± 12 (Eu 2 Cl 2 + ), -347 ± 20 (Eu 2 Cl 3 + ), -1111 ± 42 (Eu 3 Cl 5 + ), -975 ± 20 (EuCl 3 - ), -1309 ± 17(EuCl 4 - ), -1734 ± 20 (Eu 2 Cl 5 - ) kJ/mol [ru

  15. Incorporation of europium III complex into nanoparticles and films obtained by the Sol-Gel methodology

    Directory of Open Access Journals (Sweden)

    Faley Jean de Sousa

    2010-03-01

    Full Text Available The sol-gel process is very effective for the preparation of new materials with potential applications in optics, sensors, catalyst supports, coatings, and specialty inorganic polymers that can be used as hosts for the accommodation of organic molecules. The low temperature employed in the process is the main advantage of this methodology. In this work, the europium (III complex with 1,10-phenantroline was prepared, and this luminescent complex was incorporated into silica nanoparticles and films by the sol-gel process. The nanoparticles were obtained by the modified Stöber methodology. The films were obtained by the dip-coating technique, at different deposition rates and numbers of layers. The nanoparticles and films were characterized by photoluminescence, thermal analysis, and Raman and infrared spectroscopies. Characterization revealed that the europium (III complex was not affected upon incorporation into the nanoparticles and films, opening a new field for the application of these materials.

  16. Preparation and luminescence of silica aerogel composites containing an europium (III) phenanthroline nitrate complex

    Energy Technology Data Exchange (ETDEWEB)

    Gutzov, Stoyan, E-mail: sgutzov@chem.uni-sofia.bg [University of Sofia “St. Kliment Ohridski”, Department of Physical Chemistry, J. Bourchier Blvd. 1, 1164 Sofia (Bulgaria); Danchova, Nina; Kirilova, Rada; Petrov, Vesselin [University of Sofia “St. Kliment Ohridski”, Department of Physical Chemistry, J. Bourchier Blvd. 1, 1164 Sofia (Bulgaria); Yordanova, Stanislava [University of Sofia “St. Kliment Ohridski”, Department of Organic Chemistry, J. Bourchier Blvd. 1, 1164 Sofia (Bulgaria)

    2017-03-15

    A simple two step procedure for the functionalization of hydrophobic silica aerogel microgranules with europium ions and/or 1,10 - phenanthroline is demonstrated. The activation procedure is based on soaking aerogels in a europium nitrate solution, followed by functionalization with 1,10 – phenanthroline. The functionalized materials display strong red or blue emission at UV-excitation, coming from the formation of [Eu(phen){sub 2}](NO{sub 3}){sub 3} or Si(IV)– 1,10-phenathroline complexes in the porous system of the aerogels. The most probable site symmetry of the europium cation is C{sub 2v} confirmed by luminescence spectra analysis. Room temperature diffuse reflectance spectra and excitation/luminescence spectra are used to describe the optical properties of the hybrid composites. Excitation spectra prove an efficient energy transfer between 1,10 – phenanthroline and the Eu{sup 3+} ion. - Graphical abstract: An effective activation procedure for functionalization of silica aerogel granules with [Eu(phen){sub 2}](NO{sub 3}){sub 3} and/or 1,10 – phenanthroline /phen/ has been demonstrated in order to obtain red or blue emitting materials. Luminescence spectra (excitation at 355 nm) of functionalized aerogel granules: 1 – SiO{sub 2}:0.18phen; 2 – [Eu(phen){sub 2}](NO{sub 3}){sub 3}; 3– SiO{sub 2}:0.007Eu(phen){sub 2}(NO{sub 3}){sub 3}. The Eu{sup 3+} f-f {sup 5}D{sub 0} →{sup 7}F {sub 0,1,2,3,4} emission transitions are denoted as 0-0, 0-1, 0-2, 0-3, 0-4. The most probable site symmetry of Eu3{sup +} ion is C{sub 2v}.

  17. Synthesis and structural characterization of an unusual heterometallic europium(III) amidinate complex

    International Nuclear Information System (INIS)

    Sroor, Farid M.; Hrib, Cristian G.; Hilfert, Liane; Edelmann, Frank T.

    2015-01-01

    The reaction of EuI_2(THF)_2 with 3 equiv. of the recently discovered lithium-cyclopropylethinylamidinate Li[c-C_3H_5-C≡C-C(NCy)_2] (1) (Cy = cyclohexyl) unexpectedly afforded the heterometallic europium(III) amidinate complex [{c-C_3H_5-C≡C-C(NCy)_2}Li{c-C_3H_5-C≡C-C(NCy)_2}_2Eu(μ-I)_2Li(THF)_2] (2) in the form of bright yellow, air- and moisture-sensitive crystals. An X-ray diffraction study of 2 revealed several unusual structural features. It comprises a double ''ate'' complex of the tentative trivalent europium(III) bis(cyclopropylethinylamidinate) derivative [c-C_3H_5-C≡C-C(NCy)_2]_2Eu"I"I"II. ''Ate'' complex formation occurred not only through retention of one equiv. of lithium iodide but also through addition of one equiv. of Li[c-C_3H_5-C≡C-C(NCy)_2]. The Li atom in the iodo-bridged Eu(μ-I)_2Li(THF)_2 part of the molecule is tetrahedrally coordinated, whereas the second lithium atom is only tricoordinate through the presence of a rare monodentate (dangling) amidinate ligand. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. Thermal expansion studies on europium titanate (Eu2TiO5)

    International Nuclear Information System (INIS)

    Panneerselvam, G.; Subramanian, G.G.S.; Antony, M.P.

    2008-01-01

    The lattice thermal expansion characteristics of europium titanate (Eu 2 TiO 5 ) have been studied by measuring the lattice parameter by high temperature X-ray diffraction technique (HT-XRD) in the temperature range 298-1573K. Percentage linear thermal expansion and mean linear thermal expansion coefficients were computed from the lattice parameter data. The percentage linear thermal expansion in the temperature range 298-1573 K along a, b and c axes are 1.05, 1.15 and 0.95 respectively. (author)

  19. 7 CFR 1956.138 - Processing.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) DEBT SETTLEMENT Debt Settlement-Community and Business Programs § 1956.138 Processing... this subpart. (d) Appeal rights. In accordance with Subpart B of Part 1900 of this chapter, the debtor...

  20. Internal-standard method for the determination of uranium, thorium, lanthanum and europium in carbonaceous shale and monazite by epithermal neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Shuenn-Gang; Tsai, Hui-Tuh; Wu, Shaw-Chii [Institute of Nuclear Energy Research, Lung-Tan (Taiwan, Republic of China)

    1981-10-03

    An internal-standard method was applied for the determination of uranium, thorium, lanthanum and europium is carbonaceous shale samples and monazite sand by epithermal neutron activation analysis using gold as an internal standard element. The samples were irradiated in a zero-power reactor at the Institute of Nuclear Energy Research and measured with a high-resolution Ge(Li) detector. The detection limit is 0.1 ppm for uranium and europium, 1 ppm for thorium, 5 ppm for lanthanum, and the realative error of all elements is within +-2.6%.

  1. Absolute densities in exoplanetary systems. Photodynamical modelling of Kepler-138.

    Science.gov (United States)

    Almenara, J. M.; Díaz, R. F.; Dorn, C.; Bonfils, X.; Udry, S.

    2018-04-01

    In favourable conditions, the density of transiting planets in multiple systems can be determined from photometry data alone. Dynamical information can be extracted from light curves, providing modelling is done self-consistently, i.e. using a photodynamical model, which simulates the individual photometric observations instead of the more generally used transit times. We apply this methodology to the Kepler-138 planetary system. The derived planetary bulk densities are a factor of two more precise than previous determinations, and we find a discrepancy in the stellar bulk density with respect to a previous study. This leads, in turn, to a discrepancy in the determination of masses and radii of the star and the planets. In particular, we find that interior planet, Kepler-138 b, has a size in between Mars and the Earth. Given our mass and density estimates, we characterize the planetary interiors using a generalized Bayesian inference model. This model allows us to quantify for interior degeneracy and calculate confidence regions of interior parameters such as thicknesses of the core, the mantle, and ocean and gas layers. We find that Kepler-138 b and Kepler-138 d have significantly thick volatile layers, and that the gas layer of Kepler-138 b is likely enriched. On the other hand, Kepler-138 c can be purely rocky.

  2. Systematic investigation and in vitro biocompatibility studies on mesoporous europium doped hydroxyapatite

    OpenAIRE

    Popa Cristina; Ciobanu Carmen; Iconaru Simona; Stan Miruna; Dinischiotu Anca; Negrila Constantin; Motelica-Heino Mikael; Guegan Regis; Predoi Daniela

    2014-01-01

    International audience; This paper reports a systematic investigation on europium doped hydroxyapatite (Eu:HAp). In this work, a set of complementary techniques Fourier Transform Infrared spectroscopy (FTIR), X-ray photoelectron spectroscopy (XPS), transmission electron microscopy (TEM) and, Brunauer-Emmett-Teller (BET) technique was used to allowing a proper understanding of Eu:HAp. The XPS analysis confirmed the substitution of Ca ions by Eu ions in Eu:HAp samples. Eu:HAp and pure HAp show ...

  3. 29 CFR 780.138 - Application of the general principles.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Application of the general principles. 780.138 Section 780.138 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR... principles. Some examples will serve to illustrate the above principles. Employees of a fruit grower who dry...

  4. Comparison of infrared-excited up-converting phosphors and europium nanoparticles as labels in a two-site immunoassay

    International Nuclear Information System (INIS)

    Ukonaho, Telle; Rantanen, Terhi; Jaemsen, Laura; Kuningas, Katri; Paekkilae, Henna; Loevgren, Timo; Soukka, Tero

    2007-01-01

    Research in the field of immunoassays and labels used in the detection has been recently focused on particulate reporters, which possess very high specific activity that excludes the label as a sensitivity limiting factor. However, the large size and shape of the particulate labels may produce additional problems to immunoassay performance. The aim of this work was to study with two identical non-competitive two-site immunoassays whether up-converting phosphor (UCP) particles are comparable in performance with europium(III) chelate-dyed nanoparticles as particulate labels. In addition we strived to verify the common assumption of the photostability of up-converting phosphor particles supporting their potential applicability in imaging. Detection limits in two-site immunoassay for free prostate-specific antigen (free-PSA) were 0.53 ng L -1 and 1.3 ng L -1 using two different up-converting phosphors and 0.16 ng L -1 using europium(III) nanoparticle. Large size distribution and non-specific binding of up-converting phosphor particles caused assay variation in low analyte concentrations and limited the analytical detection limit. The non-specific binding was the major factor limiting the analytical sensitivity of the immunoassay. The results suggests the need for nanoscaled and uniformely sized UCP-particles to increace the sensitivity and applicability of up-converting phosphor particles. Anti-Stokes photoluminescence of up-converting phosphor particles did not photobleach when measured repeatedly, on the contrary, the time-resolved fluorescence of europium nanoparticles photobleached relatively rapidly

  5. Flow Cytometry Assessment of In Vitro Generated CD138+ Human Plasma Cells

    Directory of Open Access Journals (Sweden)

    Rayelle Itoua Maïga

    2014-01-01

    Full Text Available The in vitro CD40-CD154 interaction promotes human B lymphocytes differentiation into plasma cells. Currently, CD138 is the hallmark marker enabling the detection of human plasma cells, both in vitro and in vivo; its presence can be monitored by flow cytometry using a specific antibody. We have developed a culture system allowing for the differentiation of memory B lymphocytes. In order to detect the newly formed plasma cells, we have compared their staining using five anti-CD138 monoclonal antibodies (mAbs. As a reference, we also tested human cell lines, peripheral blood mononuclear cells, and bone marrow samples. The five anti-CD138 mAbs stained RPMI-8226 cells (>98% with variable stain index (SI. The highest SI was obtained with B-A38 mAb while the lowest SI was obtained with DL-101 and 1D4 mAbs. However, the anti-CD138 mAbs were not showing equivalent CD138+ cells frequencies within the generated plasma cells. B-A38, B-B4, and MI-15 were similar (15–25% while DL-101 mAb stained a higher proportion of CD138-positive cells (38–42%. DL-101 and B-A38 mAbs stained similar populations in bone marrow samples but differed in their capacity to bind to CD138high and CD138lo cell lines. In conclusion, such cellular fluctuations suggest heterogeneity in human plasma cell populations and/or in CD138 molecules.

  6. Red light emission from europium doped zinc sodium bismuth borate glasses

    Science.gov (United States)

    Hegde, Vinod; Viswanath, C. S. Dwaraka; Upadhyaya, Vyasa; Mahato, K. K.; Kamath, Sudha D.

    2017-12-01

    Zinc sodium bismuth borate (ZNBB) glasses doped with different concentrations of europium were prepared by conventional melt quenching method and characterized through the measurements of density, refractive index, X-ray diffraction (XRD), Fourier Transform Infrared (FTIR) spectra, optical absorption, luminescence and radiative lifetimes. FTIR spectra showed seven characteristic peaks of bismuth and borate functional groups in the range of 400-1600 cm-1. The optical band gap and bonding parameters have been calculated from absorption spectra. Photoluminescence spectra recorded in the visible region with 394 nm excitation are used to calculate the Judd-Ofelt (JO) intensity parameters (Ω2 and Ω4). The JO intensity parameters have been used to calculate the radiative parameters such as branching ratio (β), stimulated emission cross-section (σse), transition probability (A) for the fluorescent level of 5D0→7F2. Decay rates through single exponential are used to calculate the lifetime (τm) of the meta-stable state 5D0 of (Eu3+ ion) these glasses. The radiative parameters measured for all these glasses show 0.7 mol% europium doped zinc sodium bismuth borate glass 5D0→7F2 transition has the potential for red laser applications. The quality of the colour emitted by the present glasses are estimated quantitatively by CIE chromaticity coordinates, which confirms the suitability of these glasses as a red emitting material for field emission technologies and LEDs.

  7. A Smart Europium-Ruthenium Complex as Anticancer Prodrug: Controllable Drug Release and Real-Time Monitoring under Different Light Excitations.

    Science.gov (United States)

    Li, Hongguang; Xie, Chen; Lan, Rongfeng; Zha, Shuai; Chan, Chi-Fai; Wong, Wing-Yan; Ho, Ka-Lok; Chan, Brandon Dow; Luo, Yuxia; Zhang, Jing-Xiang; Law, Ga-Lai; Tai, William C S; Bünzli, Jean-Claude G; Wong, Ka-Leung

    2017-11-09

    A unique, dual-function, photoactivatable anticancer prodrug, RuEuL, has been tailored that features a ruthenium(II) complex linked to a cyclen-europium chelate via a π-conjugated bridge. Under irradiation at 488 nm, the dark-inactive prodrug undergoes photodissociation, releasing the DNA-damaging ruthenium species. Under evaluation-window irradiation (λ irr = one-photon 350 nm or two-photon 700 nm), the drug delivery process can be quantitatively monitored in real-time because of the long-lived red europium emission. Linear relationships between released drug concentration and ESI-MS or luminescence responses are established. Finally, the efficiency of the new prodrug is demonstrated both in vitro RuEuL anticancer prodrug over some existing ones and open the way for decisive improvements in multipurpose prodrugs.

  8. Different-ligand coordination europium compounds with dibenzoylmethane, nitrate-group, and hexamethylphosphotriamide

    International Nuclear Information System (INIS)

    Karasev, V.E.; Botova, I.N.

    1988-01-01

    Some different-ligand europium complexes with dibenzoylmethane (DBM), hexamethylphosphotriamide (HMPA) and NO 3 -group of composition: Eu(NO 3 ) 3 x3HMPAx2H 2 O, Eu(NO 3 ) 2 xDBMx2HMPA, EuNO 3 x(DBM) 2 x2HMPA and Eu(DBM) 3 xHMPA are synthesized. Individuality of each complex is confirmed by methods of chemical, IR spectroscopic, luminescent, thermogravimetric analyses. Integral intensities of luminescence of synthesized complexes are measured, their excitation spectra in the crystal state at 77 K in the 200-600 nm range are studied

  9. Rapid screening of oxytetracycline residue in catfish muscle by dispersive liquid-liquid microextraction and europium-sensitized luminescence

    Science.gov (United States)

    Oxytetracycline (OTC) residue in catfish muscle was screened by dispersive liquid-liquid microextraction (DLLME) and europium-sensitized luminescence (ESL). After extraction in EDTA, HCl, and acetonitrile, cleanup was carried out by DLLME, and ESL was measured at microgram = 385 nm and wavelength = ...

  10. Influence of biofilms on migration of uranium, americium and europium in the environment; Einfluss von Biofilmen auf das Migrationsverhalten von Uran, Americium und Europium in der Umwelt

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-07-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  11. Luminescence variations in europium-doped silicon-substituted hydroxyapatite nanobiophosphor via three different methods

    Energy Technology Data Exchange (ETDEWEB)

    Thang, Cao Xuan; Pham, Vuong-Hung, E-mail: vuong.phamhung@hust.edu.vn

    2015-07-15

    Highlights: • Europium doped silicon-substituted hydroxyapatite was synthesized by wet chemical synthesis method. • Morphology of nanoparticles depended on the synthesized method. • Photoluminescence intensity of the sample increases with the increasing of Si substitutions, Eu dopants and thermal annealing. - Abstract: This paper reports the first attempt for the synthesis of europium-doped Si-substituted hydroxyapatite (HA) nanostructure to achieve strong and stable luminescence of nanobiophosphor, particularly, by addition of different Eu dopants, Si substitutions, and application of optimum annealing temperatures of up to 1000 °C. The nanobiophosphor was synthesized by the coprecipitation, microwave, and hydrothermal methods. The nanoparticles demonstrated a nanowire to a spindle-like morphology, which was dependent on the method of synthesis. The photoluminescence (PL) intensity of the sample increases with the increase in Si substitutions and Eu dopants. The luminescent nanoparticles also showed the typical luminescence of Eu{sup 3+} centered at 610 nm, which was more efficient for the annealed Eu-doped Si-HA nanoparticles than for the as-synthesized nanoparticles. Among the different synthesis methods, the hydrothermal method reveals the best light emission represented by high PL intensity and narrow PL spectra. These results suggest the potential application of Eu-doped Si-HA in stable and biocompatible nanophosphors for light emission and nanomedicine.

  12. The europium(II) oxide halides Eu{sub 2}OBr{sub 2} and Eu{sub 2}OI{sub 2}; Die Europium(II)-Oxidhalogenide Eu{sub 2}OBr{sub 2} und Eu{sub 2}OI{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Rudolph, Daniel; Schleid, Thomas [Stuttgart Univ. (Germany). Inst. fuer Anorganische Chemie

    2017-07-01

    The syntheses and crystal structures of the two isotypic europium(II) oxide halides Eu{sub 2}OBr{sub 2} and Eu{sub 2}OI{sub 2} are reported. They crystallize orthorhombically in the space group Ibam (Z=4; Eu{sub 2}OBr{sub 2}: a=709.86(5), b=1200.34(9), c=628.71(4) pm; Eu{sub 2}OI{sub 2}: a=739.78(5), b=1295.13(9), c=644.82(4) pm). The unit cell parameters presented here, and thus the interatomic distances of Eu{sub 2}OI{sub 2}, are significantly smaller than the ones reported in the literature, which is explained by the substitution of europium with larger barium cations due to the synthesis route described in the early study. Central building blocks of both crystal structures are trans-edge-connected [OEu{sub 4}]{sup 6+} tetrahedra forming straight {sup 1}{sub ∞}{[OEu"e_4_/_2]"2"+} chains running parallel to the [001] direction. Bundled like a hexagonal rod packing, their interaction is achieved by Br{sup -} or I{sup -} anions for charge compensation.

  13. First-Principles Investigations on Europium Monoxide

    KAUST Repository

    Wang, Hao

    2011-05-01

    Europium monoxide is both an insulator and a Heisenberg ferromagnet (Tc=69 K). In the present thesis, the author has investigated the electronic structure of different types of EuO by density functional theory. The on-site Coulomb interaction of the localized Eu 4f and 5d electrons, which is wrongly treated in the standard generalized gradient approximation method, is found to be crucial to obtain the correct insulating ground state as observed in experiments. Our results show that the ferromagnetism is stable under pressure, both hydrostatic and uniaxial. For both types of pressure an insulator-metal transition is demonstrated. Moreover, the experimentally observed insulator-metal transition in oxygen deficient and gadolinium-doped EuO is reproduced in our calculations for impurity concentrations of 6.25% and 25%. Furthermore, a 10- layer EuO thin film is theoretically predicted to be an insulator with a narrow band gap of around 0.08 eV, while the Si/EuO interface shows metallic properties with the Si and O 2p as well as Eu 5d bands crossing the Fermi level.

  14. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    Science.gov (United States)

    Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan; Abdallah, Basem M.; Ditzel, Nicholas; Nossent, Anne Yael; Bak, Mads; Kauppinen, Sakari; Kassem, Moustapha

    2011-01-01

    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators of diverse biological processes by mediating translational repression or mRNA degradation of their target genes. Here, we show that miRNA-138 (miR-138) modulates osteogenic differentiation of hMSCs. miRNA array profiling and further validation by quantitative RT-PCR (qRT-PCR) revealed that miR-138 was down-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore, overexpression of miR-138 reduced ectopic bone formation in vivo by 85%, and conversely, in vivo bone formation was enhanced by 60% when miR-138 was antagonized. Target prediction analysis and experimental validation by luciferase 3′ UTR reporter assay confirmed focal adhesion kinase, a kinase playing a central role in promoting osteoblast differentiation, as a bona fide target of miR-138. We show that miR-138 attenuates bone formation in vivo, at least in part by inhibiting the focal adhesion kinase signaling pathway. Our findings suggest that pharmacological inhibition of miR-138 by antimiR-138 could represent a therapeutic strategy for enhancing bone formation in vivo. PMID:21444814

  15. Europium (III) PVC membrane sensor based on N-pyridine-2-carboxamido-8-aminoquinoline as a sensing material

    International Nuclear Information System (INIS)

    Zamani, Hassan Ali; Kamjoo, Rahman; Mohammadhosseini, Majid; Zaferoni, Mojdeh; Rafati, Zynab; Ganjali, Mohammad Reza; Faridbod, Farnoush; Meghdadi, Soraia

    2012-01-01

    Conductometric study in acetonitrile solution shows the selectivity of PCQ toward europium ion. Therefore, a new europium PVC membrane electrode was prepared based on N-pyridine-2-carboxamido-8-aminoquinoline (PCQ) as an ion carrier. The electrode has a wide concentration range from 1.0 × 10 −2 and 1.0 × 10 −6 mol L −1 , Nernstian slope of 19.8 ± 0.3 mV per decade and a detection limit of 6.4 × 10 −7 mol L −1 . The potentiometric response is pH independent in the range of 2.4–7.4. The proposed sensor has a relatively fast response time less than 10 s and it can be used for at least 2 months without any considerable divergence in its potentials. The proposed electrode revealed good selectivity toward europium ion in comparison with variety of other metal ions. The practical utility of the electrodes has been demonstrated by their use as indicator electrodes in the potentiometric titration of Eu 3+ ions with EDTA and for determination of Eu 3+ ion concentration in mixtures of two and three different ions. - Highlights: ► A new ion carrier is introduced to preparation of a selective sensor for Eu 3+ ions. ► This technique is very simple and it's not necessary to use sophisticated equipment. ► The novelty of this work is the high affinity of the ionophore toward the Eu 3+ ions. ► The sensor is superior to the formerly reported Eu 3+ sensors in terms of selectivity.

  16. Application of a room temperature ionic liquid for nuclear spent fuel reprocessing: speciation of trivalent europium and solvatation effects; Application d'un liquide ionique basse temperature pour les procedes de separation: speciation de l'europium trivalent et effets solvatation

    Energy Technology Data Exchange (ETDEWEB)

    Moutiers, G.; Mekki, S. [CEA Saclay, Dept. de Physico-Chimie, Service de Chimie Physique, 91 - Gif sur Yvette (France); Billard, I. [IN2P3/CNRS, 69 - Villeurbanne (France)

    2007-07-01

    One of the solutions proposed for the optimization of the long term storage and conditioning of spent nuclear fuel is to separate actinide and lanthanide both from each other and from other less radioactive metallic species. The industrial proposed processes, based on liquid liquid extraction steps, involve solvents with non negligible vapour pressure and may generate contaminated liquid wastes that will have to be reprocessed. During the last decade, some room-temperature ionic liquids have been studied and integrated into industrial processes. The interest on this class of solvent came out from their 'green' properties (non volatile, non flammable, recyclable, etc...), but also from the variability of their physico-chemical properties (stability, hydrophobicity, viscosity) as a function of the RTIL chemical composition. Indeed, it has been shown that classical chemical industrial processes could be transferred into those media, even more improved, while a certain number of difficulties arising from using traditional solvent can be avoided. In this respect, it could be promising to investigate the ability to use room temperature ionic liquid into the spent nuclear fuel reprocessing field. The aim of this this study is to test the ability of the specific ionic liquid bumimTf{sub 2}N to allow trivalent europium extraction. The choice of this metal is based on the chemical analogy with trivalent minor actinides Curium and Americium which are contributing the greatest part of the long-lived high level radioactive wastes. Handling these elements needs to be very cautious for the safety and radioprotection aspect. Moreover, europium is a very sensitive luminescent probe to its environment even at the microscopic scale. The report is structured with four parts. In a first chapter, we present the main physico-chemical properties of an imidazolium-based ionic liquid family, and then we choose the ionic liquid bumimTf{sub 2}N for the whole thesis and start with

  17. Application of a room temperature ionic liquid for nuclear spent fuel reprocessing: speciation of trivalent europium and solvatation effects

    International Nuclear Information System (INIS)

    Moutiers, G.; Mekki, S.; Billard, I.

    2007-01-01

    One of the solutions proposed for the optimization of the long term storage and conditioning of spent nuclear fuel is to separate actinide and lanthanide both from each other and from other less radioactive metallic species. The industrial proposed processes, based on liquid liquid extraction steps, involve solvents with non negligible vapour pressure and may generate contaminated liquid wastes that will have to be reprocessed. During the last decade, some room-temperature ionic liquids have been studied and integrated into industrial processes. The interest on this class of solvent came out from their 'green' properties (non volatile, non flammable, recyclable, etc...), but also from the variability of their physico-chemical properties (stability, hydrophobicity, viscosity) as a function of the RTIL chemical composition. Indeed, it has been shown that classical chemical industrial processes could be transferred into those media, even more improved, while a certain number of difficulties arising from using traditional solvent can be avoided. In this respect, it could be promising to investigate the ability to use room temperature ionic liquid into the spent nuclear fuel reprocessing field. The aim of this this study is to test the ability of the specific ionic liquid bumimTf 2 N to allow trivalent europium extraction. The choice of this metal is based on the chemical analogy with trivalent minor actinides Curium and Americium which are contributing the greatest part of the long-lived high level radioactive wastes. Handling these elements needs to be very cautious for the safety and radioprotection aspect. Moreover, europium is a very sensitive luminescent probe to its environment even at the microscopic scale. The report is structured with four parts. In a first chapter, we present the main physico-chemical properties of an imidazolium-based ionic liquid family, and then we choose the ionic liquid bumimTf 2 N for the whole thesis and start with the electrochemical

  18. Chloride, bromide and iodide scintillators with europium

    Science.gov (United States)

    Zhuravleva, Mariya; Yang, Kan

    2016-09-27

    A halide scintillator material is disclosed where the halide may comprise chloride, bromide or iodide. The material is single-crystalline and has a composition of the general formula ABX.sub.3 where A is an alkali, B is an alkali earth and X is a halide which general composition was investigated. In particular, crystals of the formula ACa.sub.1-yEu.sub.yI.sub.3 where A=K, Rb and Cs were formed as well as crystals of the formula CsA.sub.1-yEu.sub.yX.sub.3 (where A=Ca, Sr, Ba, or a combination thereof and X=Cl, Br or I or a combination thereof) with divalent Europium doping where 0.ltoreq.y.ltoreq.1, and more particularly Eu doping has been studied at one to ten mol %. The disclosed scintillator materials are suitable for making scintillation detectors used in applications such as medical imaging and homeland security.

  19. Gamma-induced radiation polymerization of kaolin composite for sorption of lanthanum, europium and uranium ions from low-grade monazite leachate

    International Nuclear Information System (INIS)

    Metwally, S.S.; Hassan, R.S.; El-Masry, E.H.; Borai, E.H.

    2018-01-01

    Gamma radiation polymerization method was used for the modification of kaolin to produce (poly acrylamide-acrylic acid)-Kaolin (PAM-AA-K). Monazite ore is one of the main resources of uranium and lanthanide elements, therefore, this work focused on sorption of uranium, lanthanum and europium ions from low grade monazite leachate. The removal percent for Eu 3+ , La 3+ and UO 2 2+ are 94.6, 91.6 and 73.4%, respectively. Monolayer capacity of Eu 3+ , La 3+ and UO 2 2+ were found to be 54.64, 45.87 and 37.59 mg/g, respectively. The sorption mechanism of lanthanum and europium ions on PAM-AA-K composite mainly takes place as Ln(OH) 2+ , and for uranium as uranyl ion, UO 2 2+ . (author)

  20. Surface-imprinted nanofilaments for europium-amplified luminescent detection of fluoroquinolone antibiotics.

    Science.gov (United States)

    Zdunek, Jolanta; Benito-Peña, Elena; Linares, Ana; Falcimaigne-Cordin, Aude; Orellana, Guillermo; Haupt, Karsten; Moreno-Bondi, María C

    2013-07-29

    The development and characterization of novel, molecularly imprinted polymer nanofilament-based optical sensors for the analysis of enrofloxacin, an antibiotic widely used for human and veterinary applications, is reported. The polymers were prepared by nanomolding in porous alumina by using enrofloxacin as the template. The antibiotic was covalently immobilized on to the pore walls of the alumina by using different spacers, and the prepolymerization mixture was cast in the pores and the polymer synthesized anchored onto a glass support through UV polymerization. Various parameters affecting polymer selectivity were evaluated to achieve optimal recognition, namely, the spacer arm length and the binding solvent. The results of morphological characterization, binding kinetics, and selectivity of the optimized polymer material for ENR and its derivatives are reported. For sensing purposes, the nanofilaments were incubated in solutions of the target molecule in acetonitrile/HEPES buffer (100 mM, pH 7.5, 50:50, v/v) for 20 min followed by incubation in a 10 mM solution of europium(III) ions to generate a europium(III)-enrofloxacin complex on the polymer surface. The detection event was based on the luminescence of the rare-earth ion (λexc=340 nm; λem=612 nm) that results from energy transfer from the antibiotic excited state to the metal-ion emitting excited state. The limit of detection of the enrofloxacin antibiotic was found to be 0.58 μM. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Influence of the organic coating and calcium ions on the sorption of europium on a silica gel

    International Nuclear Information System (INIS)

    Fleury, C.; Barbot, C.; Pieri, J.; Durand, J.P.; Goudard, F.

    1999-01-01

    Humic substances, ubiquitous polyelectrolyte and polydisperse macromolecules, have a great affinity towards heavy metals and radionuclides. It is important to understand the role of these substances in the migration of contaminants that could be accidentialy released from radioactive waste repositories. The migration of these radionuclides is also governed by different influent parameters like pH, flow rate, ionic strength and presence of competing cations. Lab experiments have been undertaken, they allowed us to confirm that the behaviour and dispersion of europium (used as analog of actinides) depends on the presence of humic acids. If the latter are bound to mineral surfaces, they immobilize the radionuclides. On the other hand, if they are in a suspended form, they are able to decrease the influence of some parameters (pH, flow rate or ionic strength) and stabilize europium onto the mineral surfaces. The presence of calcium cations tends to increase the migration of Eu at lower flow rates and at most alcaline pH. (orig.)

  2. Preparation of 1 Ci of europium 155 without carrier

    International Nuclear Information System (INIS)

    Falconi, N.; Radicella, R.

    1968-01-01

    High activity 'point' sources of 155 Eu are used for medical and industrial applications. For this purpose we have studied a method of obtaining I Ci of carrier free 155 Eu, with a solid residue smaller than 5 mg per Ci. In order to separate the 155 Eu from several grams of a 154 Sm enriched target we propose a procedure which is based on the work of Bouissieres and David, Onstott, and Takekoshi et al. The separation is carried out by electrolysis on a mercury cathode followed by purification on ion exchange resin. The yields of the europium separation and target recovery are 80 per cent and 90 per cent respectively. The time required for the procedure is three days. (authors) [fr

  3. A microwave-assisted solution combustion synthesis to produce europium-doped calcium phosphate nanowhiskers for bioimaging applications.

    Science.gov (United States)

    Wagner, Darcy E; Eisenmann, Kathryn M; Nestor-Kalinoski, Andrea L; Bhaduri, Sarit B

    2013-09-01

    Biocompatible nanoparticles possessing fluorescent properties offer attractive possibilities for multifunctional bioimaging and/or drug and gene delivery applications. Many of the limitations with current imaging systems center on the properties of the optical probes in relation to equipment technical capabilities. Here we introduce a novel high aspect ratio and highly crystalline europium-doped calcium phosphate nanowhisker produced using a simple microwave-assisted solution combustion synthesis method for use as a multifunctional bioimaging probe. X-ray diffraction confirmed the material phase as europium-doped hydroxyapatite. Fluorescence emission and excitation spectra and their corresponding peaks were identified using spectrofluorimetry and validated with fluorescence, confocal and multiphoton microscopy. The nanowhiskers were found to exhibit red and far red wavelength fluorescence under ultraviolet excitation with an optimal peak emission of 696 nm achieved with a 350 nm excitation. Relatively narrow emission bands were observed, which may permit their use in multicolor imaging applications. Confocal and multiphoton microscopy confirmed that the nanoparticles provide sufficient intensity to be utilized in imaging applications. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  4. Highly Sensitive Luminescence Assessment of Bile Acid Using a Balofloxacin-Europium(III) Probe in Micellar Medium

    International Nuclear Information System (INIS)

    Cai, Huan; Zhao, Fang; Si, Hailin; Zhang, Shuaishuai; Wang, Chunchun; Qi, Peirong

    2012-01-01

    A novel and simple method of luminescence enhancement effect for the determination of trace amounts of bile acid was proposed. The procedure was based on the luminescence intensity of the balofloxacin-europium(III) complex that could be strongly enhanced by bile acid in the presence of sodium dodecyl benzene sulfonate (SDBS). Under the optimum conditions, the enhanced luminescence intensity of the system exhibited a good linear relationship with the bile acid concentration in the range 5.0 Χ 10 -9 - 7.0 Χ 10 -7 mol L -1 with a detection limit of 1.3 Χ 10 -9 mol L.1 (3σ). The relative standard deviation (RSD) was 1.7% (n = 11) for 5.0 Χ 10 -8 mol L -1 bile acid. The applicability of the method to the determination of bile acid was demonstrated by investigating the effect of potential interferences and by analyzing human serum and urine samples. The possible enhancement mechanism of luminescence intensity in balofloxacin-europium(III)-bile acid-SDBS system was also discussed briefly

  5. Europium (III) PVC membrane sensor based on N-pyridine-2-carboxamido-8-aminoquinoline as a sensing material

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Kamjoo, Rahman [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Mohammadhosseini, Majid [Department of Chemistry, Faculty of Basic Sciences, Shahrood Branch, Islamic Azad University, Shahrood (Iran, Islamic Republic of); Zaferoni, Mojdeh; Rafati, Zynab [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Faridbod, Farnoush [Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Meghdadi, Soraia [Department of Chemistry, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of)

    2012-04-01

    Conductometric study in acetonitrile solution shows the selectivity of PCQ toward europium ion. Therefore, a new europium PVC membrane electrode was prepared based on N-pyridine-2-carboxamido-8-aminoquinoline (PCQ) as an ion carrier. The electrode has a wide concentration range from 1.0 Multiplication-Sign 10{sup -2} and 1.0 Multiplication-Sign 10{sup -6} mol L{sup -1}, Nernstian slope of 19.8 {+-} 0.3 mV per decade and a detection limit of 6.4 Multiplication-Sign 10{sup -7} mol L{sup -1}. The potentiometric response is pH independent in the range of 2.4-7.4. The proposed sensor has a relatively fast response time less than 10 s and it can be used for at least 2 months without any considerable divergence in its potentials. The proposed electrode revealed good selectivity toward europium ion in comparison with variety of other metal ions. The practical utility of the electrodes has been demonstrated by their use as indicator electrodes in the potentiometric titration of Eu{sup 3+} ions with EDTA and for determination of Eu{sup 3+} ion concentration in mixtures of two and three different ions. - Highlights: Black-Right-Pointing-Pointer A new ion carrier is introduced to preparation of a selective sensor for Eu{sup 3+} ions. Black-Right-Pointing-Pointer This technique is very simple and it's not necessary to use sophisticated equipment. Black-Right-Pointing-Pointer The novelty of this work is the high affinity of the ionophore toward the Eu{sup 3+} ions. Black-Right-Pointing-Pointer The sensor is superior to the formerly reported Eu{sup 3+} sensors in terms of selectivity.

  6. RNF138 joins the HR team

    DEFF Research Database (Denmark)

    Bekker-Jensen, Simon; Mailand, Niels

    2015-01-01

    Two studies show that the E3 ubiquitin ligase RNF138 is recruited to DNA double-strand break sites, where it ubiquitylates key repair factors to promote DNA-end resection and homologous recombination. These findings add insights into the multilayered regulatory mechanisms underlying DNA double-st...

  7. Complete genome sequence of an attenuated Sparfloxacin resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    Through selection of resistance to sparfloxacin, an attenuated Streptococcus agalactiae strain 138spar was obtained from its virulent parent strain S. agalactiae 138P. The full genome of S. agalactiae 138spar is 1,838,126 bp. The availability of this genome will allow comparative genomics to identi...

  8. Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

    DEFF Research Database (Denmark)

    Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.

    2006-01-01

    on the delayed disease status. However, the results demonstrate a high incidence of a single amino acid polymorphism (cysteine 138) in HIV-1 Nef. The allelic frequency of cysteine 138 between the delayed disease progression group and the progressor group was found to be statistically significant (P = 0.......0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased...... viral replication (Premkumar DR, et al. AIDS Res Hum Retroviruses 1996; 12(4): 337-45). A sequence database search for comparative mutations revealed a high frequency of cysteine 138 in patients with reported SP AIDS...

  9. Determination of the theoretical feasibility for the transmutation of europium isotopes from high flux isotope reactor control cylinders

    International Nuclear Information System (INIS)

    Elam, K.R.; Reich, W.J.

    1995-09-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) is a 100 MWth light-water research reactor designed and built in the 1960s primarily for the production of transuranic isotopes. The HFIR is equipped with two concentric cylindrical blade assemblies, known as control cylinders, that are used to control reactor power. These control cylinders, which become highly radioactive from neutron exposure, are periodically replaced as part of the normal operation of the reactor. The highly radioactive region of the control cylinders is composed of europium oxide in an aluminum matrix. The spent HFIR control cylinders have historically been emplaced in the ORNL Waste Area Grouping (WAG) 6. The control cylinders pose a potential radiological hazard due to the long lived radiotoxic europium isotopes 152 Eu, 154 Eu, and 155 Eu. In a 1991 health evaluation of WAG 6 (ERD 1991) it was shown that these cylinders were a major component of the total radioactivity in WAG 6 and posed a potential exposure hazard to the public in some of the postulated assessment scenarios. These health evaluations, though preliminary and conservative in nature, illustrate the incentive to investigate methods for permanent destruction of the europium radionuclides. When the cost of removing the control cylinders from WAG 6, performing chemical separations and irradiating the material in HFIR are factored in, the option of leaving the control cylinders in place for decay must be considered. Other options, such as construction of an engineered barrier around the disposal silos to reduce the chance of migration, should also be analyzed

  10. Determination for Enterobacter cloacae based on a europium ternary complex labeled DNA probe

    Science.gov (United States)

    He, Hui; Niu, Cheng-Gang; Zeng, Guang-Ming; Ruan, Min; Qin, Pin-Zhu; Liu, Jing

    2011-11-01

    The fast detection and accurate diagnosis of the prevalent pathogenic bacteria is very important for the treatment of disease. Nowadays, fluorescence techniques are important tools for diagnosis. A two-probe tandem DNA hybridization assay was designed for the detection of Enterobacter cloacae based on time-resolved fluorescence. In this work, the authors synthesized a novel europium ternary complex Eu(TTA) 3(5-NH 2-phen) with intense luminescence, high fluorescence quantum yield and long lifetime before. We developed a method based on this europium complex for the specific detection of original extracted DNA from E. cloacae. In the hybridization assay format, the reporter probe was labeled with Eu(TTA) 3(5-NH 2-phen) on the 5'-terminus, and the capture probe capture probe was covalent immobilized on the surface of the glutaraldehyde treated glass slides. The original extracted DNA of samples was directly used without any DNA purification and amplification. The detection was conducted by monitoring the fluorescence intensity from the glass surface after DNA hybridization. The detection limit of the DNA was 5 × 10 -10 mol L -1. The results of the present work proved that this new approach was easy to operate with high sensitivity and specificity. It could be conducted as a powerful tool for the detection of pathogen microorganisms in the environment.

  11. Europium-doped amorphous calcium phosphate porous nanospheres: preparation and application as luminescent drug carriers

    Directory of Open Access Journals (Sweden)

    Zhang Kui-Hua

    2011-01-01

    Full Text Available Abstract Calcium phosphate is the most important inorganic constituent of biological tissues, and synthetic calcium phosphate has been widely used as biomaterials. In this study, a facile method has been developed for the fabrication of amorphous calcium phosphate (ACP/polylactide-block-monomethoxy(polyethyleneglycol hybrid nanoparticles and ACP porous nanospheres. Europium-doping is performed to enable photoluminescence (PL function of ACP porous nanospheres. A high specific surface area of the europium-doped ACP (Eu3+:ACP porous nanospheres is achieved (126.7 m2/g. PL properties of Eu3+:ACP porous nanospheres are investigated, and the most intense peak at 612 nm is observed at 5 mol% Eu3+ doping. In vitro cytotoxicity experiments indicate that the as-prepared Eu3+:ACP porous nanospheres are biocompatible. In vitro drug release experiments indicate that the ibuprofen-loaded Eu3+:ACP porous nanospheres show a slow and sustained drug release in simulated body fluid. We have found that the cumulative amount of released drug has a linear relationship with the natural logarithm of release time (ln(t. The Eu3+:ACP porous nanospheres are bioactive, and can transform to hydroxyapatite during drug release. The PL properties of drug-loaded nanocarriers before and after drug release are also investigated.

  12. Synthesis and luminescence properties of europium and terbium complexes with pyridine- or bipyridine-linked oligothiophene ligand

    International Nuclear Information System (INIS)

    Liu Ping; Huang Mingsheng; Pan Wanzhang; Zhang Yamin; Hu Jianhua; Deng Wenji

    2006-01-01

    With an aim to develop novel luminescence materials, europium and terbium complexes of 2,5-(2-thiophene)-pyridine (TPY) and 5,5'-bis(5-(2,2'-bithiophene))-2,2'-bipyridine (B2TBPY) were synthesized, and their luminescence properties studied. The complexes exhibit ligand-sensitized emission, which is typical of Eu(III) and Tb(III) ions

  13. Liquid crystal europium(III) β-diketonato complex with 5,5'-di(heptadecyl)-2,2'-bipyridine

    International Nuclear Information System (INIS)

    Knyazev, A.A.; Lobkov, V.S.; Galyametdinov, Yu.G.

    2004-01-01

    Liquid crystal europium(III) complex containing β-diketone and 5,5-di(heptadecyl)-2,2'-bipyridine as ligands was prepared in ethanol solution and was isolated as a yellow precipitate with 62% yield. The product was characterized by data of elementary analysis, thermography, IR spectroscopy and luminescence spectra. Temperatures of crystal-mesophase and mesophase-isotropic liquid phase transitions amount to 95 and 130 Deg C respectively [ru

  14. Spectroscopic properties of trivalent Europium in various composites with an eulytin structure. Internship report

    International Nuclear Information System (INIS)

    Raynal, Francoise

    1975-01-01

    Eulytin is a bismuth orthosilicate and eulytin compounds revealed to be interesting matrix materials which can be used as medium gain laser materials. This research report is thus a contribution for a better knowledge of this material. Different eulytin compounds doped with lanthanide ions have been used to study the cationic polyhedron (by using structural probes such as the trivalent Europium in spectroscopy, or the trivalent gadolinium in electronic paramagnetic resonance) and the anionic polyhedron

  15. Luminescent amine sensor based on europium(III) chelate.

    Science.gov (United States)

    Petrochenkova, Nataliya V; Mirochnik, Anatolii G; Emelina, Tatyana B; Sergeev, Alexander A; Leonov, Andrei A; Voznesenskii, Sergey S

    2018-07-05

    The effect of methylamine vapor on luminescence of Eu(III) tris-benzoylacetonate (I) immobilized in thin-layer chromatography plates has been investigated. It has been revealed that interaction of I with analyte vapor results in increase of the intensity of Eu(III) luminescence. The mechanism of the effect of methylamine vapors on intensification of the Eu(III) luminescence has been suggested using the data of IR spectroscopy and quantum chemistry calculations. The mechanism of luminescence sensitization consists in bonding of an analyte molecule with a water molecule into the coordination sphere of Eu(III). As a result, the bond of a water molecule with the luminescence centre weakens, rigid structural fragment including europium ion, water and methylamine molecules forms. The presence of such fragment must naturally promote decrease of influence of OH-vibrations on luminescence of the complex I. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. The mercury-richest europium amalgam Eu{sub 10}Hg{sub 55}

    Energy Technology Data Exchange (ETDEWEB)

    Tambornino, Frank; Hoch, Constantin [Department of Chemistry, Ludwig-Maximilians-Universitaet Muenchen (Germany)

    2015-03-15

    The mercury-richest europium amalgam Eu{sub 10}Hg{sub 55} was synthesized by isothermal electrocrystallization from a solution of EuI{sub 3}.8DMF in DMF on a reactive mercury cathode. The crystal structure shows remarkable complexity and polar metal-metal bonding. Closely related to the structures of mercury-rich amalgams A{sub 11-x}Hg{sub 55+x} (A = Na, Ca, Sr), it shows underoccupied Hg positions along [00z]. Eu{sub 10}Hg{sub 55} can be described as hettotype structure of the Gd{sub 14}Ag{sub 51} structure type. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. Positive parity states and some electromagnetic transition properties of even-odd europium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Yazar, Harun Resit, E-mail: yazar@nevsehir.edu.tr [Nevsehir University, Faculty of Art and Science (Turkey)

    2013-06-15

    The positive-parity low-spin states of even-odd Europium isotopes ({sup 151-155}Eu) were studied within the framework of the interacting boson-fermion model. The calculated positive low-spin state energy spectra of the odd Eu isotope were found to agree quite well with the experimental data. The B(E2) values were also calculated and it was found that the calculated positive-parity low-spin state energy spectra of the odd-A Eu isotopes agree quite well with the experimental data.

  18. Investigation of the influence of silver and tin on the luminescence of trivalent europium ions in glass

    International Nuclear Information System (INIS)

    Jimenez, J.A.; Lysenko, S.; Liu, H.; Fachini, E.; Cabrera, C.R.

    2010-01-01

    Europium-doped aluminophosphate glasses prepared by the melt-quenching technique have been studied by photoluminescence (PL) and X-ray photoelectron spectroscopy (XPS). The effects of silver and tin doping, and of further thermal processing on Eu 3+ ions luminescence have been assessed. For the glass system containing only europium, Eu 3+ PL observed under UV excitation is suggested to occur through energy transfer from the excited glass host. After silver and tin doping, an enhanced UV excited Eu 3+ PL has been indicated to occur essentially due to radiative energy transfer from isolated Ag + ions and/or two fold-coordinated Sn centers. Since thermal processing of the material leads to a quenching effect on Eu 3+ PL and Ag nanoparticles (NPs) formation due to reduction of silver ions by tin, XPS was employed in order to investigate the possibility for Eu 3+ →Eu 2+ reduction during HT as a potential source of the PL decrease. The data points towards Ag NPs as main responsible for the observed weakening of Eu 3+ PL.

  19. Spectroscopic studies of 2-thenoyltrifluoro acetonate of uranyl salts doped with europium

    International Nuclear Information System (INIS)

    Nakagawa, F.T.; Luiz, J.E.M. de Sa; Felinto, M.C.F.C.; Brito, H.F.; Teotonio, E.E.S.

    2006-01-01

    Uranyl compounds present a great potential as luminescence materials. Some examples of applications are: in laser technology, cathode ray tube, X-rays diagnostic. In this work it was studied the synthesis, characterization and spectroscopic properties study of uranyl 2-thenoyl trifluoroacetonate and uranyl 2- thenoyl trifluoroacetonate doped with europium. The compounds were synthesized and characterized by infrared absorption spectroscopy, thermal analysis, scanning electronic microscopy, and electronic spectroscopy of emission and excitation. The Eu 3+ ion acted as an effective luminescent probe, however the process of energy transfer from UO 2 2+ to Eu 3+ ion has not been efficient. (author)

  20. Determination of micro amounts of samarium and europium by analogue derivative spectrophotometry

    International Nuclear Information System (INIS)

    Ishii, H.; Satoh, K.

    1982-01-01

    Derivative spectrophotometry using the analogue differentiation circuit was applied to the determination of samarium and europium at ppm levels. By measuring the second or the fourth derivative spectra of the characteristic absorption bands of both the rare earth ions around 400 nm, they can be determined directly and selectively in the presence of large amounts of most other rare earths without any prior separation. Further, aptly selecting conditions for the measurement of the derivative spectra, the simultaneous determination of both the rare earth elements was feasible. The principle and the characteristics of analogue derivative spectrophotometry are also described. (orig.) [de

  1. Red polymer light-emitting devices based on an oxadiazole-functionalized europium(III) complex

    International Nuclear Information System (INIS)

    Liu, Yu; Wang, Yafei; Li, Chun; Huang, Ying; Dang, Dongfeng; Zhu, Meixiang; Zhu, Weiguo; Cao, Yong

    2014-01-01

    A novel tris(dibenzoylmethanato)[5-(2-(4-tert-butylbenzenyl)-5-benzenyl-1,3, 4-oxadiazole-4′)-1,10-phenanthroline]europium(III) [Eu(DBM) 3 (BuOXD-Phen)] containing an electron-transporting oxadiazole-functionalized phenanthroline ligand was synthesized and characterized. Its UV–vis absorption and photoluminescence (PL), as well as the electroluminescence (EL) in polymer light-emitting devices (PLEDs) were investigated. The double-layer PLEDs with a configuration of ITO/PEDOT:PSS (50 nm)/PVK (40 nm)/PFO:PBD (30%):Eu(DBM) 3 (BuOXD-Phen) (1–8 wt %) (80 nm)/Ba (4 nm)/Al (150 nm) were fabricated. Saturated red Eu 3+ ion emission, based on the 5 D 0 → 7 F 2 transition, is centered at a wavelength of 614 nm with a full width at half maximum (FWHM) of 10 nm. The highest external quantum efficiency (QE ext ) of 1.26% at current density of 1.65 mA cm −2 , with a maximum brightness of 568 cd m −2 at 137.8 mA cm −2 was achieved from the device at 1 wt % dopant concentration. - Highlights: • An oxadiazole-functionalized europium(III) complex of Eu(DBM) 3 (BuOXD-Phen) was presented. • The optophysical properties of Eu(DBM) 3 (BuOXD-Phen) were investigated. • Saturated red emission was observed in the PLEDs. • An external quantum efficiency of 1.26% was obtained in these devices

  2. Chloride, bromide and iodide scintillators with europium doping

    Science.gov (United States)

    Zhuravleva, Mariya; Yang, Kan

    2014-08-26

    A halide scintillator material is disclosed where the halide may comprise chloride, bromide or iodide. The material is single-crystalline and has a composition of the general formula ABX.sub.3 where A is an alkali, B is an alkali earth and X is a halide which general composition was investigated. In particular, crystals of the formula ACa.sub.1-yEu.sub.yI.sub.3 where A=K, Rb and Cs were formed as well as crystals of the formula CsA.sub.1-yEu.sub.yX.sub.3 (where A=Ca, Sr, Ba, or a combination thereof and X=Cl, Br or I or a combination thereof) with divalent Europium doping where 0.ltoreq.y.ltoreq.1, and more particularly Eu doping has been studied at one to ten mol %. The disclosed scintillator materials are suitable for making scintillation detectors used in applications such as medical imaging and homeland security.

  3. Ferromagnetic semiconductor-metal transition in heterostructures of europium monoxide

    Energy Technology Data Exchange (ETDEWEB)

    Stollenwerk, Tobias; Kroha, Johann [Physikalisches Institut der Universitaet Bonn (Germany)

    2012-07-01

    Experiments on thin films of electron doped europium monoxide show a simultaneous ferromagnetic semiconductor-metal transition which goes along with a huge drop in resistivity over several orders of magnitude. Therefore, this material is a very promising candidate for spintronics applications. We have developed a theory which correctly predicts the simultaneous phase transition in thin films of electron doped EuO and the increase of the Curie temperature T{sub C} with doping concentration. The origin of the increased T{sub C} lies in the enhanced RKKY interaction between the localized 4f moments of the Eu atoms. Therefore, the phase transition is controlled by the population of the conduction band. We investigate the influence of film thickness and interface effects on the population of the conduction band and on the magnetic and electronic properties of the EuO film.

  4. Influence of biofilms on migration of uranium, americium and europium in the environment

    International Nuclear Information System (INIS)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-01-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  5. 11 CFR 100.138 - Sale of food and beverages by vendor.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Sale of food and beverages by vendor. 100.138...) Exceptions to Expenditures § 100.138 Sale of food and beverages by vendor. The sale of any food or beverage..., is not an expenditure, provided that the charge is at least equal to the cost of such food or...

  6. 33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...

  7. Novel europium (III)-gatifloxacin complex structure with dual functionality for pH sensing and metal recognition in aqueous environment

    Science.gov (United States)

    Chen, Muhua; Zheng, Yuhui; Gao, Jinwei; Wang, Qianming

    2016-10-01

    A new type of Eu(III)-gatifloxacin complex with characteristic red luminescence has been prepared. Due to the presence of ionization effect linked to the organic chromophore, the molecular fluorescent sensor demonstrated variable pH-sensitive absorption and emission curves. The red emission derived from europium ions was strong during pH range 8-10. Between pH = 7 and 4, the europium emission remained relatively stable and fluorescence signals of gatifloxacin has been improved substantially. Under acidic conditions (pH = 1 to 3), the dramatic changes in the emission colors (from red, yellow to green) were clearly observed. Moreover, the excitation wavelength can be extended into the visible light range (Ex = 411 nm) by using the concentration effect experiment. Importantly, it gave turn-off emissions in the presence of Cu2+ or Fe3+ and the detection limits were determined to be 6.5 μM for Cu2+ and 6.2 μM for Fe3+ respectively.

  8. Galvanic interactions of HE15 /MDN138 & HE15 /MDN250 alloys in natural seawater

    Science.gov (United States)

    Parthiban, G. T.; Subramanian, G.; Muthuraman, K.; Ramakrishna Rao, P.

    2017-06-01

    HE15 is a heat treatable high strength alloy with excellent machinability find wide applications in aerospace and defence industries. In view of their excellent mechanical properties, workability, machinability, heat treatment characteristics and good resistance to general and stress corrosion cracking, MDN138 & MDN250 have been widely used in petrochemical, nuclear and aerospace industries. The galvanic corrosion behaviour of the metal combinations HE15 /MDN138 and HE15 /MDN250, with 1:1 area ratio, has been studied in natural seawater using the open well facility of CECRI's Offshore Platform at Tuticorin for a year. The open circuit potentials of MDN138, MDN250 and HE15 of the individual metal, the galvanic potential and galvanic current of the couples HE15 /MDN138 and HE15 /MDN250 were periodically monitored throughout the study period. The calcareous deposits on MDN138 and MDN250 in galvanic contact with HE15 were analyzed using XRD. The electrochemical behaviors of MDN138, MDN250 and HE15 in seawater have been studied using an electrochemical work station. The surface characteristics of MDN138 and MDN250 in galvanic contact with HE15 have been examined with scanning electron microscope. The results of the study reveal that HE15 offered required amount of protection to MDN138 & MDN250.

  9. Luminescent sensing of organophosphates using europium(III) containing imprinted polymers prepared by RAFT polymerization

    International Nuclear Information System (INIS)

    Southard, Glen E.; Van Houten, Kelly A.; Ott, Edward W.; Murray, George M.

    2007-01-01

    Molecularly imprinted polymers capable of sensing organophosphorous compounds by luminescence have been prepared by reversible addition fragmentation chain transfer (RAFT) polymerization. The polymer contained a dithiobenzoate substituted tris(β-diketonate) europium(III) complex which served as a polymerization substrate and as a luminescent binding site for pinacolyl methylphosphonate (PMP), the hydrolysis product of the nerve agent Soman. The resultant polymer allowed quantitation of PMP in the low ppb range with minimal interference from similar compounds. Polymers were characterized by luminescence spectroscopy and scanning electron microscopy

  10. A novel photoluminescent and photochromic europium complex

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A ternary europium complex of 4-aminobutyric acid (ABA) with 1,10-phenanthroline (phen) [Eu2(ABA)4 (phen)4](phen)4(ClO4)6 was synthesized and characterized by X-ray single crystal diffraction. The result shows that 4-aminobutyric acid exists in zwitterion form in the binuclear complex and that the carboxylates coordinate with Eu3+ ion in bidentate bridging and tridentate chelating-bridging modes. There are two types of phen molecules, one is coordinated and the other is uncoordinated. When excited by YAG: Nd laser with 355 nm light, the title complex can emit strong red fluorescence, and its high-resolution emission spectrum was recorded at 77 K. The Eu3+ ion site is in low symmetry, which is in agreement with the result of X-ray single crystal diffraction analysis. When irradiated with a mercury lamp, the aqueous solution of the title complex can perform photochromism with the color change from colorless to green and the green color can fade away in the dark. The photochromic response time is related to the concentration and pH of the solution, the temperature and the light intensity.

  11. 9 CFR 3.138 - Primary conveyances (motor vehicle, rail, air, and marine).

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Primary conveyances (motor vehicle, rail, air, and marine). 3.138 Section 3.138 Animals and Animal Products ANIMAL AND PLANT HEALTH... (motor vehicle, rail, air, and marine). (a) The animal cargo space of primary conveyances used in...

  12. miR-138 protects cardiomyocytes from hypoxia-induced apoptosis via MLK3/JNK/c-jun pathway

    Energy Technology Data Exchange (ETDEWEB)

    He, Siyi; Liu, Peng; Jian, Zhao; Li, Jingwei; Zhu, Yun; Feng, Zezhou; Xiao, Yingbin, E-mail: xiaoyb@vip.sina.com

    2013-11-29

    Highlights: •First time to find miR-138 is up-regulated in hypoxic cardiomyocytes. •First time to find miR-138 targets MLK3 and regulates JNK/c-jun pathway. •Rare myocardial biopsy of patients with CHD were collected. •Both silence and overexpression of miR-138 were implemented. •Various methods were used to detect cell function. -- Abstract: Cardiomyocytes experience a series of complex endogenous regulatory mechanisms against apoptosis induced by chronic hypoxia. MicroRNAs are a class of endogenous small non-coding RNAs that regulate cellular pathophysiological processes. Recently, microRNA-138 (miR-138) has been found related to hypoxia, and beneficial for cell proliferation. Therefore, we intend to study the role of miR-138 in hypoxic cardiomyocytes and the main mechanism. Myocardial samples of patients with congenital heart disease (CHD) were collected to test miR-138 expression. Agomir or antagomir of miR-138 was transfected into H9C2 cells to investigate its effect on cell apoptosis. Higher miR-138 expression was observed in patients with cyanotic CHD, and its expression gradually increased with prolonged hypoxia time in H9C2 cells. Using MTT and LDH assays, cell growth was significantly greater in the agomir group than in the negative control (NC) group, while antagomir decreased cell survival. Dual luciferase reporter gene and Western-blot results confirmed MLK3 was a direct target of miR-138. It was found that miR-138 attenuated hypoxia-induced apoptosis using TUNEL, Hoechst staining and Annexin V-PE/7-AAD flow cytometry analysis. We further detected expression of apoptosis-related proteins. In the agomir group, the level of pro-apoptotic proteins such as cleaved-caspase-3, cleaved-PARP and Bad significantly reduced, while Bcl-2 and Bcl-2/Bax ratio increased. Opposite changes were observed in the antagomir group. Downstream targets of MLK3, JNK and c-jun, were also suppressed by miR-138. Our study demonstrates that up-regulation of miR-138 plays

  13. Study of Polymeric Luminescent Blend (PC/PMMA) Doped with Europium Complex under Gamma-Iradiation

    International Nuclear Information System (INIS)

    Parra, D. F.

    2006-01-01

    Spectroscopic properties of blends formed by bisphenol-A polycarbonate (PC) and poly(methyl methacrylate) (PMMA) doped with europium in organic complex were studied. Polymeric luminescent blends are potential materials for many applications; however, little information has been reported concerning the stability under thermal and radiation conditions. Luminescent films were synthesized from europium thenoyltrifluoroacetonate at different concentrations doped in PC/PMMA blends. Films produced of the luminescent polymer blend were irradiated in a 60 C o source. Their luminescent properties, in the solid state, as well as, the thermal oxidative resistance after gamma irradiation was investigated. These systems were characterized by elemental analysis, thermogravimetry (TGA), differential scanning calorimetry (DSC) and infrared spectroscopy (FTIR). Based on TGA data, the thermal stability of PC/PMMA:(tta)3 system is higher than the polymer blend. The DSC results indicated that those new systems are chemically stables. The emission spectra of the Eu 3 +-tta complex doped in the PC/PMMA recorded at 298 and 77 K exhibited the characteristic bands arising from the 5 D 0 →7 F J transitions (J = 0-6). The luminescence intensity decreases with increasing of precursor concentration in the doped polymer obtained by chemical reaction. This result is different from that of samples obtained by physical method in melting doping. The blend was irradiated under ionizing radiation of 60 C o source. After irradiation of the luminescent films the physical properties of luminescence, thermal and oxidative stability were evaluated.(Fapesp and Cnpq financial support)

  14. The condition for electroplex emission from an europium complex doped poly( N-vinylcarbazole)

    Science.gov (United States)

    Zhang, T.; Xu, Z.; Qian, L.; Tao, D. L.; Teng, F.; Gao, X.; Xu, X. R.

    2005-10-01

    Spectral characteristics of photoluminescence (PL) and electroluminescence (EL) of poly( N-vinylcarbazole) (PVK) matrices doped with a novel europium complex Eu(aspirin) 3phen were investigated. A red-shift and broadening were observed in the EL spectra but not in the PL ones. However, neither red-shift nor broadening were observed in the EL spectra of PVK doped with a similar complex with the same ligand, terbium complex (Tb(aspirin) 3phen). This result suggests the formation of electroplexes in blend systems, which is likely due to inefficient energy transfer from host molecules to dopant molecules.

  15. The different-ligand complexing of europium with complexones and β-diketones in micellar solution

    International Nuclear Information System (INIS)

    Svetlova, I.E.; Dobrynina, N.A.; Smirnova, N.S.; Martynenko, L.I.; Evseev, A.M.; Savitskij, A.P.

    1989-01-01

    Method of pH-metric titration with mathematical simulation was used to study the effect of nonionic surfactant (polyoxyethyleneoctylphenyl este) on stability of europium complexes with cyclohexanediaminetetraacetic and ethylenediaminetetraacetic acids. Optimal conditions for ternary complex formation in the system Eu 3+ -complexone-β-diketone at pH 7.0-9.0 were found. Complex-compositions were determined and their stability constants were calculated. It is shown that complex stability decreases by several orders in micellar solutions, tecause β-diketone introduction to the solution decreases thermodynamic stability of complexes

  16. First principles description of the insulator-metal transition in europium monoxide

    KAUST Repository

    Wang, Hao

    2012-02-01

    Europium monoxide, EuO, is a ferromagnetic insulator. Its electronic structure under pressure and doping is investigated by means of density functional theory. We employ spin polarized electronic structure calculations including onsite electron-electron interaction for the localized Eu 4f and 5d electrons. Our results show that under pressure the ferromagnetism is stable, both for hydrostatic and uniaxial pressure, while the compound undergoes an insulator-metal transition. The insulator-metal transition in O deficient and Gd doped EuO is reproduced for an impurity concentration of 6.25%. A 10 monolayer thick EuO(1 0 0) thin film is predicted to be an insulator with a narrow band gap of 0.08 eV. © 2011 Elsevier B.V. All rights reserved.

  17. Structural and decay properties of Z = 132, 138 superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Rather, Asloob A.; Ikram, M.; Usmani, A.A. [Aligarh Muslim University, Department of Physics, Aligarh (India); Kumar, Bharat; Patra, S.K. [Institute of Physics, Bhubaneswar (India); Homi Bhabha National Institute, Mumbai, Anushakti Nagar (India)

    2016-12-15

    In this paper, we analyze the structural properties of Z = 132 and Z = 138 superheavy nuclei within the ambit of axially deformed relativistic mean-field framework with NL3* parametrization and calculate the total binding energies, radii, quadrupole deformation parameter, separation energies, density distributions. We also investigate the phenomenon of shape coexistence by performing the calculations for prolate, oblate and spherical configurations. For clear presentation of nucleon distributions, the two-dimensional contour representation of individual nucleon density and total matter density has been made. Further, a competition between possible decay modes such as α-decay, β-decay and spontaneous fission of the isotopic chain of superheavy nuclei with Z = 132 within the range 312 ≤ A ≤ 392 and 318 ≤ A ≤ 398 for Z = 138 is systematically analyzed within self-consistent relativistic mean-field model. From our analysis, we inferred that the α-decay and spontaneous fission are the principal modes of decay in majority of the isotopes of superheavy nuclei under investigation apart from β-decay as dominant mode of decay in {sup 318-322}138 isotopes. (orig.)

  18. The europium and praseodymium hydrolysis in a 2M NaCl environment; La hidrolisis del europio y del praseodimio en un medio 2M de NaCl

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez R, M.; Lopez G, H.; Solache R, M.; Rojas H, A. [Instituto Nacional de Investigaciones Nucleares, Departamento de quimica, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    1998-07-01

    It was studied the europium and praseodymium hydrolysis in a 2M NaCl ion force environment at 303 K, through two methods: this one extraction with dissolvents (lanthanide-water-NaCl-dibenzoylmethane) in presence of a competitive ligand (diglycolic acid) and that one direct potentiometric titration, of soluble species, followed by a computer refining. The values of one or another techniques of the first hydrolysis constants obtained were similar, which demonstrates that the results are reliable. The set of data obtained on the stability constants of hydrolysis products allowed to draw up the distribution diagrams of chemical species, as europium as praseodymium in aqueous environment. (Author)

  19. 33 CFR 138.240 - Procedure for calculating limit of liability adjustments for inflation.

    Science.gov (United States)

    2010-07-01

    ... of liability adjustments for inflation. 138.240 Section 138.240 Navigation and Navigable Waters COAST... calculating limit of liability adjustments for inflation. (a) Formula for calculating a cumulative percent... later than every three years from the year the limits of liability were last adjusted for inflation, the...

  20. Spectroscopic investigation on europium doped heavy metal borate glasses for red luminescent application

    Energy Technology Data Exchange (ETDEWEB)

    Hegde, Vinod; Wagh, Akshatha; Kamath, Sudha D. [Manipal University, Department of Physics, Manipal Institute of Technology, Manipal (India); Hegde, Hemanth [Manipal University, Department of Chemistry, Manipal Institute of Technology, Manipal (India); Vishwanath, C.S.D. [Sri Venkateswara University, Department of Physics, Tirupati (India)

    2017-05-15

    The present study explores a new borate family glasses based on 10ZnO-5Na{sub 2}O-10Bi{sub 2}O{sub 3}-(75 - x) B{sub 2}O{sub 3}-xEu{sub 2}O{sub 3} (x = 0, 0.1, 0.5, 1, 1.5, 2, 3 mol%) composition, synthesized by rapid melt quench technique. Prepared glasses were subjected to the density and refractive index measurements and their values were used to calculate other physical properties of the glass matrix as a function of Eu{sup 3+} concentration. XRD confirmed amorphous nature of the glasses. FTIR spectra in the absorption mode were recorded in the 400-4000 cm{sup -1} region to identify different functional groups in the glass matrix. Deconvoluted FTIR spectra showed increase in BO{sub 4} units with rise in europium content which confirmed the 'network strengthener' role of europium ions by creating bridging oxygens (BOs). Optical properties were investigated for their luminescence behavior through various spectroscopic techniques such as UV-Vis-NIR absorption, excitation, emission, decay profiles, and color measurements at room temperature. Lasing properties of the glasses like total radiative life time, branching ratio, emission cross section, and optical gain were obtained from the calculated Judd-Ofelt (Ω{sub 2},Ω{sub 4}) intensity parameters. From the measured values of emission, cross sections, branching ratios, life times, strong photoluminescence features, and CIE chromaticity coordinates, 0.5 mol% of Eu{sup 3+} ions doped ZnNaBiB glasses showed optimum performance and are potential candidate for red light generation at 613 nm. (orig.)

  1. 40 CFR 86.138-96 - Hot soak test.

    Science.gov (United States)

    2010-07-01

    ....138-96 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... preparation for the hot soak test. (2) Gaseous-fueled vehicles. Since gaseous-fueled vehicles are not required.... (iii) Fresh impingers shall be installed in the methanol sample collection system immediately prior to...

  2. Effects of added dibutyl phosphate on the luminescent properties of europium tetrakis dibenzoylmethide triethylammonium

    International Nuclear Information System (INIS)

    Fontenot, Ross S.; Bhat, Kamala N.; Owens, Constance A.; Hollerman, William A.; Aggarwal, Mohan D.

    2015-01-01

    Since 2003, the authors have been pushing the boundaries on a special type of functional material, i.e., a material that gives off light when it is stressed, strained, and/or fractured. This unique class of materials has been proposed for the active element of impact sensors, earthquake detectors, and stress sensors. However, in order for this concept to go from the lab to real world applications, the light emission from these functional materials must be bright such that inexpensive light detectors can be used. One of the brightest materials found thus far is europium tetrakis dibenzoylmethide triethylammonium (EuD 4 TEA). This material has an emission so bright that it can be observed in daylight. In 2013, the authors discovered that the addition of dimethyl methylphosphonate (DMMP) increased the light emission two fold. As a result, a search for similar compounds was conducted to determine if the emission can be increased further. This paper explores the effects of dibutyl phosphate (DBP) on EuD 4 TEA. The effects of DBP on the triboluminescence, photoluminescence, and crystal structure of EuD 4 TEA will be determined. This paper will show that DBP has an even greater effect on the properties of EuD 4 TEA than DMMP. - Highlights: • Synthesized europium tetrakis dibenzoylmethide triethylammonium. • Six fold increase in the light yield was detected. • Effects of dibutyl phosphate on the triboluminescence on EuD 4 TEA were determined. • Effects of dibutyl phosphate on the photoluminescence of EuD 4 TEA were determined

  3. Effects of added dibutyl phosphate on the luminescent properties of europium tetrakis dibenzoylmethide triethylammonium

    Energy Technology Data Exchange (ETDEWEB)

    Fontenot, Ross S., E-mail: rsfontenot@hotmail.com [Alabama A and M University, Department of Physics, Chemistry, and Mathematics, P.O. Box 1268, Normal, AL 35762 (United States); University of Louisiana at Lafayette, Department of Physics, P.O. Box 44210, Lafayette, LA 70504 (United States); Bhat, Kamala N.; Owens, Constance A. [Alabama A and M University, Department of Physics, Chemistry, and Mathematics, P.O. Box 1268, Normal, AL 35762 (United States); Hollerman, William A. [University of Louisiana at Lafayette, Department of Physics, P.O. Box 44210, Lafayette, LA 70504 (United States); Aggarwal, Mohan D. [Alabama A and M University, Department of Physics, Chemistry, and Mathematics, P.O. Box 1268, Normal, AL 35762 (United States)

    2015-02-15

    Since 2003, the authors have been pushing the boundaries on a special type of functional material, i.e., a material that gives off light when it is stressed, strained, and/or fractured. This unique class of materials has been proposed for the active element of impact sensors, earthquake detectors, and stress sensors. However, in order for this concept to go from the lab to real world applications, the light emission from these functional materials must be bright such that inexpensive light detectors can be used. One of the brightest materials found thus far is europium tetrakis dibenzoylmethide triethylammonium (EuD{sub 4}TEA). This material has an emission so bright that it can be observed in daylight. In 2013, the authors discovered that the addition of dimethyl methylphosphonate (DMMP) increased the light emission two fold. As a result, a search for similar compounds was conducted to determine if the emission can be increased further. This paper explores the effects of dibutyl phosphate (DBP) on EuD{sub 4}TEA. The effects of DBP on the triboluminescence, photoluminescence, and crystal structure of EuD{sub 4}TEA will be determined. This paper will show that DBP has an even greater effect on the properties of EuD{sub 4}TEA than DMMP. - Highlights: • Synthesized europium tetrakis dibenzoylmethide triethylammonium. • Six fold increase in the light yield was detected. • Effects of dibutyl phosphate on the triboluminescence on EuD{sub 4}TEA were determined. • Effects of dibutyl phosphate on the photoluminescence of EuD{sub 4}TEA were determined.

  4. MicroRNA-138 is a potential regulator of memory performance in humans

    Directory of Open Access Journals (Sweden)

    Julia eSchröder

    2014-07-01

    Full Text Available Genetic factors underlie a substantial proportion of individual differences in cognitive functions in humans, including processes related to episodic and working memory. While genetic association studies have proposed several candidate memory genes, these currently explain only a minor fraction of the phenotypic variance. Here, we performed genome-wide screening on 13 episodic and working memory phenotypes in 1,318 participants of the Berlin Aging Study II aged 60 years or older. The analyses highlight a number of novel single nucleotide polymorphisms (SNPs associated with memory performance, including one located in a putative regulatory region of microRNA (miRNA hsa-mir-138-5p (rs9882688, P-value = 7.8x10-9. Expression quantitative trait locus analyses on next-generation RNA-sequencing data revealed that rs9882688 genotypes show a significant correlation with the expression levels of this miRNA in 309 human lymphoblastoid cell lines (P-value = 5x10-4. In silico modeling of other top-ranking GWAS signals identified an additional memory-associated SNP in the 3' untranslated region (3'UTR of DCP1B, a gene encoding a core component of the mRNA decapping complex in humans, predicted to interfere with hsa-mir-138-5p binding. This prediction was confirmed in vitro by luciferase assays showing differential binding of hsa-mir-138-5p to 3'UTR reporter constructs in two human cell lines (HEK293: P-value = 0.0470; SH-SY5Y: P-value = 0.0866. Finally, expression profiling of hsa-mir-138-5p and DCP1B mRNA in human post-mortem brain tissue revealed that both molecules are expressed simultaneously in frontal cortex and hippocampus, suggesting that the proposed interaction between hsa-mir-138-5p and DCP1B may also take place in vivo. In summary, by combining unbiased genome-wide screening with extensive in silico modeling, in vitro functional assays, and gene expression profiling, our study identified miRNA-138 as a potential molecular regulator of human memory

  5. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    DEFF Research Database (Denmark)

    Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan

    2011-01-01

    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators......-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore...

  6. Simple preparation of fluorescent composite films based on cerium and europium doped LaF3 nanoparticles

    Science.gov (United States)

    Secco, Henrique de L.; Ferreira, Fabio F.; Péres, Laura O.

    2018-03-01

    The combination of materials to form hybrids with unique properties, different from those of the isolated components, is a strategy used to prepare functional materials with improved properties aiming to allow their application in specific fields. The doping of lanthanum fluoride with other rare earth elements is used to obtain luminescent particles, which may be useful to the manufacturing of electronic devices' displays and biological markers, for instance. The application of the powder of nanoparticles has limitations in some fields; to overcome this, the powder may be incorporated in a suitable polymeric matrix. In this work, lanthanum fluoride nanoparticles, undoped and doped with cerium and europium, were synthesized through the co-precipitation method in aqueous solution. Aiming the formation of solid state films, composites of nanoparticles in an elastomeric matrix, the nitrile rubber (NBR), were prepared. The flexibility and the transparency of the matrix in the regions of interest are advantages for the application of the luminescent composites. The composites were applied as films using the casting and the spin coating techniques and luminescent materials were obtained in the samples doped with europium and cerium. Scanning electron microscopy images showed an adequate dispersion of the particles in the matrix in both film formation techniques. Aggregates of the particles were detected in the samples which may affect the uniformity of the emission of the composites.

  7. New coordination compounds of europium (3) with fluorated β-diketones and their use as lanthanide shift reagents

    International Nuclear Information System (INIS)

    Goryushko, A.G.; Davidenko, N.K.; Kudryavtseva, L.S.; Lozinskij, M.O.; Lugina, L.N.; Fialkov, Yu.A.

    1980-01-01

    Altogether five coordination compounds of europium (3) of the composition EuL 3 , wherein HL is a fluorinated beta-diketone containing in its fluorinated linear or cyclic radical a heteroatom, such as oxygen, have been obtained. The hygroscopicity of the obtained tris-beta-ketones has been tested. Their activity as lanthanide shifting agents for NMR spectroscopy purposes has been analyzed and the stability constants of their monoadducts with ethyl acetate have been determined [ru

  8. Spectral-luminescent investigation of polymers doped with europium trisphenoyltrifluoroacetonate compound with 1,10-phenanthroline

    International Nuclear Information System (INIS)

    Karasev, V.E.; Mirochnik, A.G.; Shchelokov, R.N.

    1983-01-01

    Spectral-luminescent characteristics of europium tristhenoyltrifluoroacetonate with 1.10-phenanthpoline in polystyrepe and polyvinyl chloride are investigated. E 4 (TTA) 3 phen during introduction into polymers preserves its composition and structure. Weak temperature dependence of half-Width of luminescent lines qualitatively different from the case of crystal chelate is characteristic for polymers doped with E 4 (TTA) 3 xphen. Investigation into temperature dependence of E 4 3+ luminescent intensity in chelate doped polymers proves the conclusion on weakening processes of excitation energy relaxation by vibration constituents of close and far environment during chelate introduction into polymers

  9. A microemulsion preparation of nanoparticles of europium in silica with luminescence enhancement using silver

    International Nuclear Information System (INIS)

    Ma Zhiya; Dosev, Dosi; Kennedy, Ian M

    2009-01-01

    A facile one-pot microemulsion method has been developed for the synthesis of spherical silver core-silica shell (Ag-SiO 2 ) nanoparticles with europium chelates doped in the shell through a silane agent. The method is significantly more straightforward than other extant methods. Measurements of the luminescent emissions from the Ag-SiO 2 nanoparticles, in comparison with control silica nanoparticles without silver cores, showed that the presence of the silver cores can increase the fluorescence intensity approximately 24-fold and decrease the luminescence lifetime. This enhancement offers a potential increase in overall particle detectability with increased fluorophore photostability.

  10. 15 CFR 13.8 - Opportunity to comment on proposed Federal financial assistance and direct Federal development.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Opportunity to comment on proposed Federal financial assistance and direct Federal development. 13.8 Section 13.8 Commerce and Foreign Trade Office of the Secretary of Commerce INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF COMMERCE PROGRAMS AND ACTIVITIES § 13.8 Opportunity to comment on...

  11. 7 CFR 457.138 - Grape crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... types, in the county for which a premium rate is provided by the actuarial documents: (a) In which you... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.138 Grape crop insurance... avoirdupois. Type. A category of grapes (one or more varieties) identified as a type in the Special Provisions...

  12. Tuning Eu"3"+ emission in europium sesquioxide films by changing the crystalline phase

    International Nuclear Information System (INIS)

    Mariscal, A.; Quesada, A.; Camps, I.; Palomares, F.J.; Fernández, J.F.; Serna, R.

    2016-01-01

    Highlights: • PLD production of high quality europium sesquioxide (Eu_2O_3) films. • The deposition of Al_2O_3 capping and/or buffer layers modifies the crystallization for Eu_2O_3 films upon annealing. • The formation of cubic or monoclinic phases can be favored. • Eu"3"+ emission tuning is achieved as a consequence of crystal field effects. - Abstract: We report the growth of europium sesquioxide (Eu_2O_3) thin films by pulsed laser deposition (PLD) in vacuum at room temperature from a pure Eu_2O_3 ceramic bulk target. The films were deposited in different configurations formed by adding capping and/or buffer layers of amorphous aluminum oxide (a-Al_2O_3). The optical properties, refractive index and extinction coefficient of the as deposited Eu_2O_3 layers were obtained. X-ray photoelectron spectroscopy (XPS) measurements were done to assess its chemical composition. Post-deposition annealing was performed at 500 °C and 850 °C in air in order to achieve the formation of crystalline films and to accomplish photoluminescence emission. According to the analysis of X-ray diffraction (XRD) spectra, cubic and monoclinic phases were formed. It is found that the relative amount of the phases is related to the different film configurations, showing that the control over the crystallization phase can be realized by adequately designing the structures. All the films showed photoluminescence emission peaks (under excitation at 355 nm) that are attributed to the intra 4f-transitions of Eu"3"+ ions. The emission spectral shape depends on the crystalline phase of the Eu_2O_3 layer. Specifically, changes in the hypersensitive "5D_0 → "7F_2 emission confirm the strong influence of the crystal field effect on the Eu"3"+ energy levels.

  13. The Magnetic Response of Europium Implanted in Cerium and in Platinum as Investigated by the PAC-Method

    International Nuclear Information System (INIS)

    Zeitz, W.-D.; Unterricker, S.; Schneider, F.; Samokhvalov, V.; Potzger, K.; Weber, A.; Dietrich, M.

    2004-01-01

    The magnetic response of europium in γ-cerium and in platinum was studied by applying the perturbed angular correlation spectroscopy. The probe nuclei were 147 Eu(11/2 - ) and 149 Eu(11/2 - ). The response in γ-Ce was determined by the electronic S = J = 7/2 ground state of divalent Eu. In Pt, on the other hand, Eu is trivalent (J = 0 ground state). Here the magnetic contributions originate from Van Vleck terms of the whole multiplet system.

  14. Post-irradiation characterization of PH13-8Mo martensitic stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Jong, M.; Schmalz, F.; Rensman, J.W. [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands); Luzginova, N.V., E-mail: luzginova@nrg.eu [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands); Wouters, O.; Hegeman, J.B.J.; Laan, J.G. van der [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands)

    2011-10-01

    The irradiation response of PH13-8Mo stainless steel was measured up to 2.5 dpa at 200 and 300 deg. C irradiation temperatures. The PH13-8Mo, a martensitic precipitation-hardened steel, was produced by Hot Isostatic Pressing at 1030 deg. C. The fatigue tests (high cycle fatigue and fatigue crack propagation) showed a test temperature dependency but no irradiation effects. Tensile tests showed irradiation hardening (yield stress increase) of approximately 37% for 200 deg. C irradiated material tested at 60 deg. C and approximately 32% for 300 deg. C irradiated material tested at 60 deg. C. This contradicts the shift in reference temperature (T{sub 0}) measured in toughness tests (Master Curve approach), where the {Delta}T{sub 0} for 300 deg. C irradiated is approximately 170 deg. C and the {Delta}T{sub 0} for the 200 deg. C irradiated is approximately 160 deg. C. This means that the irradiation hardening of PH13-8Mo steel is not suitable to predict the shift in the reference temperature for the Master Curve approach.

  15. Trace electrochemical analysis of Europium, Ytterbium, and Cerium at their joint presence in solution

    Directory of Open Access Journals (Sweden)

    Rema Matakova

    2012-03-01

    Full Text Available In the course of several decades at the department of analytical chemistry and chemistry of rare elements there were studied the electrode processes with participation of rare-earth metals (REM in accordance with the long awaiting problem of the development of rare-metal and rare-earth branch of non-ferrous metallurgy of Kazakhstan. With the aim of express and highly sensitive analytical control of raw materials and final product of rare-earth industry there were developed the methods of inversion-voltamperometric determination of low concentrations of europium, ytterbium and cerium under the conditions of their individual and combined presence in the solution.

  16. Spectroscopic studies of an europium(III) tris-β-diketonate complex bearing a pyrazolylpyridine ligand

    International Nuclear Information System (INIS)

    Moreira dos Santos, Antonio; Coelho, Ana C.; Almeida Paz, Filipe A.; Rocha, Joao; Goncalves, Isabel S.; Carlos, Luis D.

    2008-01-01

    A new europium(III) complex, Eu(BTA) 3 (ethyl[3-(2-pyridyl)-1-pyrazolyl]acetate) (where BTA: 1-benzoyl-3,3,3-trifluoroacetonate), was synthesised by simple ligand exchange with the solvent adduct Eu(BTA) 3 (H 2 O) 2 . The compound was characterised by elemental analysis, thermogravimetry, FTIR, FT Raman and photoluminescence spectroscopies. A significant increase of the 5 D 0 lifetime of the complex, relative to the value found for the water-coordinated adduct (from 0.657 ± 0.001 to 0.835 ± 0.002 ms), and a larger contribution of the ligand levels to the excitation spectrum indicate a better photoluminescence performance for the former complex

  17. Temperature dependence of the luminescence lifetime of a europium complex immobilized in different polymer matrices

    Energy Technology Data Exchange (ETDEWEB)

    Basu, Bharathi Bai J. [Surface Engineering Division, National Aerospace Laboratories, Bangalore 560017 (India)], E-mail: bharathi@css.nal.res.in; Vasantharajan, N. [Surface Engineering Division, National Aerospace Laboratories, Bangalore 560017 (India)

    2008-10-15

    The temperature dependence of the luminescence lifetime of temperature sensor films based on europium (III) thenoyltrifluoroacetonate (EuTTA) as sensor dye in various polymer matrices such as polystyrene (PS), polymethylmethacrylate (PMMA), polyurethane (PU) and model airplane dope was studied and compared. The luminescence lifetime of EuTTA was found to depend on the polymer matrix. The temperature sensitivity of lifetime was maximum for EuTTA-PS coating in the temperature range of 10-60 deg. C. The effect of concentration of the sensor dye in the polymer on the lifetime and temperature sensitivity was also studied.

  18. Magnesium ionophore II as an extraction agent for trivalent europium and americium

    Energy Technology Data Exchange (ETDEWEB)

    Makrlik, Emanuel [Czech Univ. of Life Sciences, Prague (Czech Republic). Faculty of Environmental Sciences; Vanura, Petr [Univ. of Chemistry and Technology, Prague (Czech Republic). Dept. of Analytical Chemistry

    2016-11-01

    Solvent extraction of microamounts of trivalent europium and americium into nitrobenzene by using a mixture of hydrogen dicarbollylcobaltate (H{sup +}B{sup -}) and magnesium ionophore II (L) was studied. The equilibrium data were explained assuming that the species HL{sup +}, HL{sup +}{sub 2}, ML{sup 3+}{sub 2}, and ML{sup 3+}{sub 3} (M{sup 3+} = Eu{sup 3+}, Am{sup 3+}; L=magnesium, ionophore II) are extracted into the nitrobenzene phase. Extraction and stability constants of the cationic complex species in nitrobenzene saturated with water were determined and discussed. From the experimental results it is evident that this effective magnesium ionophore II receptor for the Eu{sup 3+} and Am{sup 3+} cations could be considered as a potential extraction agent for nuclear waste treatment.

  19. Synthesis and characterization of barium titanate, doped with europium and neodymium; Sintese e caracterizacao de titanato de bario, dopados com europio e neodimio

    Energy Technology Data Exchange (ETDEWEB)

    Sousa, Fernanda L.C.; Cabral, Alciney M.; Silva, Ademir O.; Oliveiro, Joao B.L., E-mail: nanda_louise@yahoo.com.br [Universidade Federal do Rio Grande do Norte (UFRN), Natal (Brazil). Instituto de Quimica

    2013-07-01

    This work aims at synthesize and characterize mixed oxides in Barium Titanium matrix in doping with Neodymium and Europium analyzing thermogravimetric curves, characteristic bands at infrared region of the polymer complex, which are intermediates to mixed oxides, and identify the formation thereof, and the crystallinity using XRD analysis.

  20. Characterization of deamidation at Asn138 in L-chain of recombinant humanized Fab expressed from Pichia pastoris.

    Science.gov (United States)

    Ohkuri, Takatoshi; Murase, Eri; Sun, Shu-Lan; Sugitani, Jun; Ueda, Tadashi

    2013-10-01

    A method was previously established for evaluating Asn deamidation by matrix-assisted laser desorption/ionization time of flight-mass spectrometry using endoproteinase Asp-N. In this study, we demonstrated that this method could be applied to the identification of the deamidation site of the humanized fragment antigen-binding (Fab). First, a system for expressing humanized Fab from methylotrophic yeast Pichia pastoris was constructed, resulting in the preparation of ∼30 mg of the purified humanized Fab from 1 l culture. Analysis of the L-chain derived from recombinant humanized Fab that was heated at pH 7 and 100°C for 1 h showed the deamidation at Asn138 in the constant region. Then, we prepared L-N138D Fab and L-N138A Fab and examined their properties. The circular dichroism (CD) spectrum of the L-N138D Fab was partially different from that of the wild-type Fab. The measurement of the thermostability showed that L-N138D caused a significant decrease in the thermostability of Fab. On the other hand, the CD spectrum and thermostability of L-N138A Fab showed the same behaviour as the wild-type Fab. Thus, it was suggested that the introduction of a negative charge at position 138 in the L-chain by the deamidation significantly affected the stability of humanized Fab.

  1. Europium and samarium doped calcium sulfide thin films grown by PLD

    International Nuclear Information System (INIS)

    Christoulakis, S.; Suchea, M; Katsarakis, N.; Koudoumas, E

    2007-01-01

    Europium and samarium doped calcium sulfide thin films (CaS:Eu,Sm) with different thickness were prepared by the pulsed laser deposition technique using sintered targets. A typical homemade deposition chamber and XeCl excimer laser (308 nm) were employed and the films were deposited in helium atmosphere onto silicon and corning glass substrates. Structural investigations carried out by X-ray diffraction and atomic force microscopy showed a strong influence of the deposition parameters on the film properties. The films grown had an amorphous or polycrystalline structure depending on growth temperature and the number of pulses used, the same parameters affecting the film roughness, the grain shape and dimensions, the film thickness and the optical transmittance. This work indicates that pulsed laser deposition can be a suitable technique for the preparation of CaS:Eu,Sm thin films, the film characteristics being controlled by the growth conditions

  2. 40 CFR 63.138 - Process wastewater provisions-performance standards for treatment processes managing Group 1...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process wastewater provisions-performance standards for treatment processes managing Group 1 wastewater streams and/or residuals removed from Group 1 wastewater streams. 63.138 Section 63.138 Protection of Environment ENVIRONMENTAL...

  3. Chemiluminescence determination of tetracyclines using Fenton system in the presence europium(III) ions

    International Nuclear Information System (INIS)

    Kaczmarek, Malgorzata; Lis, Stefan

    2009-01-01

    A new simple chemiluminescent method for the determination of chlortetracycline (Chlor-TC), oxytetracycline (Oxy-TC) and doxycycline (Doxy-TC) is described. This method is based on the europium(III) emission as a result of the energy transfer process from the excited product of the tetracyclines oxidation to the uncomplexed Eu(III). Under the optimum conditions, calibration graphs were obtained for 4 x 10 -7 to 2 x 10 -5 mol L -1 of Chlor-TC; 2 x 10 -7 to 2 x 10 -5 mol L -1 of Oxy-TC and 1 x 10 -7 to 3 x 10 -5 mol L -1 of Doxy-TC. The method was successfully applied to the determination of these drugs in pharmaceutical and veterinary formulation and honey.

  4. Sorption of Europium in zirconium silicate; Sorcion de Europio en silicato de circonio

    Energy Technology Data Exchange (ETDEWEB)

    Garcia R, G. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Some minerals have the property of sipping radioactive metals in solution, that it takes advantage to manufacture contention barriers that are placed in the repositories of nuclear wastes. The more recent investigations are focused in the development of new technologies guided to the sorption of alpha emissors on minerals which avoid their dispersion in the environment. In an effort to contribute to the understanding of this type of properties, some studies of sorption of Europium III are presented like homologous of the americium, on the surface of zirconium silicate (ZrSiO{sub 4}). In this work the results of sorption experiences are presented as well as the interpretation of the phenomena of the formation of species in the surface of the zirconium silicate. (Author)

  5. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

    Directory of Open Access Journals (Sweden)

    Maurilo Monteiro Terra

    1990-01-01

    Full Text Available Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. Todos os outros porta-enxertos apresentaram desempenho inferior.A long term experiment was conducted at Monte Alegre do Sul, State of São Paulo, Brazil, to study the behaviour of wine grape cultivar IAC 138-22 Máximo on five rootstocks: RR 101 14, 'Golia', "Ripária do Traviú', IAC 313 and IAC 572 The yields of eight consecutive annual harvests (from 1974 to 1981 were analysed. The results indicated that IAC 572 was the best rootstock. IAC 313 can also be used but with fair results. "Ripária do Traviú', RR 101-14 and 'Golia' are not recommended as rootstocks for IAC 138-22. Considering the row spacing (2 x 1m which allows 5,000 plants/ha, the difference between average yields of the best and the worst rootstock was 8,475kg/ha of grapes, a considerable figure for the grape grower.

  6. Modified magnetic and optical properties of manganese nanoparticles incorporated europium doped magnesium borotellurite glass

    Energy Technology Data Exchange (ETDEWEB)

    Aziz, Siti Maisarah; Sahar, M.R., E-mail: mrahim057@gmail.com; Ghoshal, S.K.

    2017-02-01

    This paper reports the modified optical and magnetic properties of europium (Eu{sup 3+}) ions doped and Manganese nanoparticles (NPs) embedded Magnesium Borotellurite glass synthesized via melt quenching method. The influence of varying Mn NPs concentrations on the magnetic, absorption and emission properties of such glass samples are determined. Stables, transparent and amorphous glasses are obtained. The observed modification of the electronic polarizability is interpreted in terms of the generation of non-bridging oxygen (NBO) and bridging oxygen (BO) in the amorphous network. TEM images manifested the growth of Mn NPs with average diameter 11±1 nm. High-resolution TEM reveals that the lattice spacing of manganese nanoparticles is 0.308 nm at (112) plane. The emission spectra revealed four prominent peaks centered at 587 nm, 610 nm, 651 nm and 700 nm assigned to the transition from {sup 5}D{sub 0} →{sup 7}F{sub J} (J=1, 2, 3, 4) states of Eu{sup 3+} ion. A significant drop in the luminescence intensity due to the incorporation of Mn NPs is ascribed to the enhanced energy transfer from the Eu{sup 3+} ion to NPs. Prepared glass systems exhibited paramagnetic behavior. - Highlights: • The europium doped magnesium borotellurite glasses embedded Mn NPs prepared using the conventional melt-quenching method. • The TEM result reveals the size of Mn NPs while its planar spacing has been determined by HRTEM. • The luminescence properties of TeO{sub 2}–B{sub 2}O{sub 3}–MgO–Eu{sub 2}O{sub 3}–Mn{sub 3}O{sub 4} glasses have been investigated as effect of Mn NPs content. • The magnetization measurement of glass sample is carried out using vibrating sample magnetometer (VSM)

  7. Design of portable electrocardiogram device using DSO138

    Science.gov (United States)

    Abuzairi, Tomy; Matondang, Josef Stevanus; Purnamaningsih, Retno Wigajatri; Basari, Ratnasari, Anita

    2018-02-01

    Cardiovascular disease has been one of the leading causes of sudden cardiac deaths in many countries, covering Indonesia. Electrocardiogram (ECG) is a medical test to detect cardiac abnormalities by measuring the electrical activity generated by the heart, as the heart contracts. By using ECG, we can observe anomaly at the time of heart abnormalities. In this paper, design of portable ECG device is presented. The portable ECG device was designed to easily use in the village clinic or houses, due to the small size device and other benefits. The device was designed by using four units: (1) ECG electrode; (2) ECG analog front-end; (3) DSO138; and (4) battery. To create a simple electrode system in the portable ECG, 1-lead ECG with two electrodes were applied. The analog front-end circuitry consists of three integrated circuits, an instrumentation amplifier AD820AN, a low noise operational amplifier OPA134, and a low offset operational amplifier TL082. Digital ECG data were transformed to graphical data on DSO138. The results show that the portable ECG is successfully read the signal from 1-lead ECG system.

  8. Chemical states and electronic properties of the interface between aluminium and a photoluminescent conjugated copolymer containing europium complex

    International Nuclear Information System (INIS)

    Cai, Q.J.; Ling, Q.D.; Li, S.; Zhu, F.R.; Huang, Wei; Kang, E.T.; Neoh, K.G.

    2004-01-01

    The chemical states and electronic properties of the interface between thermally evaporated aluminium and a photoluminescent conjugated copolymer containing 9,9'-dihexylfluorene and europium complex-chelated benzoate units in the main chain (PF6-Eu(dbm) 2 phen) were studied in situ by X-ray photoelectron spectroscopy (XPS) and ultraviolet photoelectron spectroscopy (UPS). The changes in C 1s, Eu 3d, N 1s, and Al 2p core-level lineshapes with progressive deposition of aluminium atoms were carefully monitored. Aluminium was found to interact with the conjugated backbone of the copolymer to form the Al carbide, Al-O-C complex, and Al(III)-N chelate at the interface. In addition, the europium ions were reduced to the metallic state by the deposited aluminium atoms, which were oxidized and chelated by the 1,10-phenanthroline ligands (phen). The changes in chemical states at the interface suggest that the intramolecular energy transfer process in this copolymer had been affected. Moreover, aluminium also interacted with the bulk-adsorbed oxygen, which migrates to the surface in response to the deposition of aluminium atoms, to form a layer of metal oxides. On the other hand, the evolution of the UPS spectra suggests that the π-states of the conjugated system were affected and an unfavorable dipole layer was induced by the deposited aluminium atoms

  9. Spectrochemical study of europium and neodymium complexes with 3-(3'-trifluoromethoxy-2',2',3',3'-tetrafluoropropionyl)camphor and bisheterocycles

    International Nuclear Information System (INIS)

    Khomenko, V.S.; Pavich, T.A.; Lozonskij, M.O.; Fialkov, Yu.A.; AN Ukrainskoj SSR, Kiev. Inst. Organicheskoj Khimii)

    1987-01-01

    Methods of mass-spectrometry, luminescent specroscopy and thermogravimetry are used to study decomposition ways, structure and volatility of mixed europium and neodymium complexes with fluorated organic ligands and bisheterocycles. It is shown that complexes containing an oxygen atom in a fluorated ligand elimination of difluorophosgene and tetrafluoroethylene molecules takes place. The addition of a bisheterocyclic ligand to a triligand complex makes the averaged bond in the complex more covalent and increase its volatility

  10. Crystal growth and characterization of europium doped lithium strontium iodide scintillator as an ionizing radiation detector

    Science.gov (United States)

    Uba, Samuel

    High performance detectors used in the detection of ionizing radiation is critical to nuclear nonproliferation applications and other radiation detectors applications. In this research we grew and tested Europium doped Lithium Strontium Iodide compound. A mixture of lithium iodide, strontium iodide and europium iodide was used as the starting materials for this research. Congruent melting and freezing temperature of the synthesized compound was determined by differential scanning calorimetry (DSC) using a Setaram Labsys Evo DSC-DTA instrument. The melting temperatures were recorded at 390.35°C, 407.59°C and freezing temperature was recorded at 322.84°C from a graph of heat flow plotted against temperature. The synthesized material was used as the charge for the vertical Bridgeman growth, and a 6.5 cm and 7.7cm length boule were grown in a multi-zone transparent Mullen furnace. A scintillating detector of thickness 2.53mm was fabricated by mechanical lapping in mineral oil, and scintillating response and timing were obtained to a cesium source using CS-137 isotope. An energy resolution (FWHM over peak position) of 12.1% was observed for the 662keV full absorption peak. Optical absorption in the UV-Vis wavelength range was recorded for the grown crystal using a U-2900 UV/VIS Spectrophotometer. Absorption peaks were recorded at 194nm, 273nm, and 344nm from the absorbance spectrum, various optical parameters such as absorption coefficient, extinction coefficient, refractive index, and optical loss were derived. The optical band gap energy was calculated using Tauc relation expression at 1.79eV.

  11. Mitochondria Targetable Time-Gated Luminescence Probe for Singlet Oxygen Based on a β-Diketonate-Europium Complex.

    Science.gov (United States)

    Sun, Jingyan; Song, Bo; Ye, Zhiqiang; Yuan, Jingli

    2015-12-21

    Singlet oxygen ((1)O2) plays a key role in the photodynamic therapy (PDT) technique of neoplastic diseases. In this work, by using a 9,10-dimethyl-2-anthryl-containing β-diketone, 1,1,1,2,2-pentafluoro-5-(9',10'-dimethyl-2'-anthryl)-3,5-pentanedione (Hpfdap), as a (1)O2-recognition ligand, a novel β-diketonate-europium(III) complex that can act as a luminescence probe for (1)O2, [Eu(pfdap)3(tpy)] (tpy = 2,2',2″-terpyridine), has been designed and synthesized for the time-gated luminescence detection of (1)O2 in living cells. The complex is weakly luminescent due to the quenching effect of 9,10-dimethyl-2-anthryl groups. After reaction with (1)O2, accompanied by the formation of endoperoxides of 9,10-dimethyl-2-anthryl groups, the luminescence quenching disappears, so that the long-lived luminescence of the europium(III) complex is switched on. The complex showed highly selective luminescence response to (1)O2 with a remarkable luminescence enhancement. Combined with the time-gated luminescence imaging technique, the complex was successfully used as a luminescent probe for the monitoring of the time-dependent generation of (1)O2 in 5-aminolevulinic acid (a PDT drug) loaded HepG2 cells during the photodynamic process. In addition, by coloading the complex and a mitochondrial indicator, Mito-Tracker Green, into HepG2 cells, the specific localization of [Eu(pfdap)3(tpy)] molecules in mitochondria of HepG2 cells was demonstrated by confocal fluorescence imaging measurements.

  12. Nature of the concentration thresholds of europium atom yield from the oxidized tungsten surface under electron stimulated desorption

    CERN Document Server

    Davydov, S Y

    2002-01-01

    The nature of the electron-stimulated desorption (ESD) of the europium atoms by the E sub e irradiating electrons energies, equal to 50 and 80 eV, as well as peculiarities of the Eu atoms yield dependence on their concentration on the oxidized tungsten surface are discussed. It is shown, that the ESD originates by the electron transition from the interval 5p- or 5s shell of the tungsten surface atom onto the oxygen external unfilled 2p-level

  13. 42 CFR 480.138 - Disclosure for other specified purposes.

    Science.gov (United States)

    2010-10-01

    ...) General requirements for disclosure. Except as specified in paragraph (b) of this section, the following... information is necessary to protect against a substantial risk to the public health. (3) Disclosure to the... 42 Public Health 4 2010-10-01 2010-10-01 false Disclosure for other specified purposes. 480.138...

  14. Preparation and fluorescent recognition properties for fluoride of a nanostructured covalently bonded europium hybrid material

    Institute of Scientific and Technical Information of China (English)

    余旭东; 李景印; 李亚娟; 耿丽君; 甄小丽; 于涛

    2015-01-01

    A novel covalently bonded Eu3+-based silica hybrid material was designed and its spectrophotometric anion sensing prop-erty was studied. The fluorescent receptor (europium complex) was covalently grafted to the silica matrix via a sol-gel approach. FTIR, UV-vis spectra, scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD) and photoluminescent spectra were characterized, and the results revealed that the hybrid material with nanosphere structure displayed excellent photophysical property. In addition, the selective anion sensing property of the hybrid material was studied by UV-vis and fluorescence spectra. The results showed that the hybrid material exhibited a smart response with fluoride anions.

  15. Radioiodine therapy in management of thyroid carcinoma - A review of 138 patients

    International Nuclear Information System (INIS)

    Hossain, A.S.; Hossain, S.; Hafiz, N.; Taslima, D.A.; Rashid, H.

    2001-01-01

    Differentiated thyroid carcinomas are being treated by using a widely accepted protocol of surgery and radioiodine therapy followed by supplementation of thyroid hormones in the Nuclear Medicine Centre (NMC), Dhaka Medical College Hospital (DMCH) since 1990. In the present study 138 patients(Male-54, Female-84) with differentiated thyroid cancers received radioiodine therapy for ablation of residual thyroid tissue with a dose of 2.77-3.7 GBq (75-100 mCi), for lymph node metastases 5.55-6.5 GBq(150-175mCi), for lung metastases 5.55 GBq(150 mCi) and for bony metastases 7.4 GBq (200 mCi). Among 138 patients papillary carcinoma was observed in 94 cases (68%; Male-42, Female-52), follicular type was found in 30 cases (22%; Male-8, Female-22) and mixed type in 14 patients (10%, Male-4, Female-10). Single dose of 2.77-3.7 GBq(75-100 mCi) of radioiodine was received by all 138 patients. Among the unablated patients 62 received double doses totalling 9.25 GBq (250 mCi), 44 received three doses 12.95 GBq (350 mCi) and one patient received 8 doses 33.3 GBq (900 mCi). Out of 138 patients single dose ablated 76 cases and 62 remain unablated. Multiple doses ablated 28 patients and 34 still remain unablated and is under follow up. The success and failure in management of patients with differentiated thyroid cancer over 8 years period have been discussed here revealing a satisfactory outcome. (author)

  16. Semaphorin 4C Protects against Allergic Inflammation: Requirement of Regulatory CD138+ Plasma Cells.

    Science.gov (United States)

    Xue, Di; Kaufman, Gabriel N; Dembele, Marieme; Beland, Marianne; Massoud, Amir H; Mindt, Barbara C; Fiter, Ryan; Fixman, Elizabeth D; Martin, James G; Friedel, Roland H; Divangahi, Maziar; Fritz, Jörg H; Mazer, Bruce D

    2017-01-01

    The regulatory properties of B cells have been studied in autoimmune diseases; however, their role in allergic diseases is poorly understood. We demonstrate that Semaphorin 4C (Sema4C), an axonal guidance molecule, plays a crucial role in B cell regulatory function. Mice deficient in Sema4C exhibited increased airway inflammation after allergen exposure, with massive eosinophilic lung infiltrates and increased Th2 cytokines. This phenotype was reproduced by mixed bone marrow chimeric mice with Sema4C deficient only in B cells, indicating that B lymphocytes were the key cells affected by the absence of Sema4C expression in allergic inflammation. We determined that Sema4C-deficient CD19 + CD138 + cells exhibited decreased IL-10 and increased IL-4 expression in vivo and in vitro. Adoptive transfer of Sema4c -/- CD19 + CD138 + cells induced marked pulmonary inflammation, eosinophilia, and increased bronchoalveolar lavage fluid IL-4 and IL-5, whereas adoptive transfer of wild-type CD19 + CD138 + IL-10 + cells dramatically decreased allergic airway inflammation in wild-type and Sema4c -/- mice. This study identifies a novel pathway by which Th2-mediated immune responses are regulated. It highlights the importance of plasma cells as regulatory cells in allergic inflammation and suggests that CD138 + B cells contribute to cytokine balance and are important for maintenance of immune homeostasis in allergic airways disease. Furthermore, we demonstrate that Sema4C is critical for optimal regulatory cytokine production in CD138 + B cells. Copyright © 2016 by The American Association of Immunologists, Inc.

  17. RBS and RNRA studies on sorption of europium by apatite

    Energy Technology Data Exchange (ETDEWEB)

    Ohnuki, Toshihiko; Kozai, Naofumi; Isobe, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murakami, Takashi; Yamamoto, Shunya; Aoki, Yasushi; Naramoto, Hiroshi

    1997-03-01

    The sorption mechanism of europium, alternative of trivalent TRU has been studied based on the depth profiles of elements obtained by Rutherford Backscattering Spectroscopy (RBS) and Resonant Nuclear Reaction Analysis (RNRA). The positive peak for Eu and the negative peak for Ca were observed in the subtracted RBS spectra of the apatites on which Eu was sorbed from that of the fresh apatite. This indicates that Eu was sorbed on apatite, while a fraction of Ca was released from apatite. The peak height for Eu in the RBS spectrum of the apatite obtained at 75degC was higher than that of the apatite at 40degC. The depth profile of hydrogen of the apatite on which Eu was sorbed was similar to that of the fresh apatite. The concentration of Eu in the solution decreased with increasing temperature. On the contrary, the concentration of Ca increased with increasing temperature. Thus, it is concluded that a fraction of Eu is exchanged for Ca in the structure of apatite. (author)

  18. Synthesis, Structure, and Luminescent Properties of Europium-Doped Hydroxyapatite Nanocrystalline Powders

    Directory of Open Access Journals (Sweden)

    Carmen Steluta Ciobanu

    2012-01-01

    Full Text Available The luminescent europium-doped hydroxyapatite (Eu:HAp, Ca10−xEux(PO46(OH2 with 0≤x≤0.2 nanocrystalline powders was synthesized by coprecipitation. The structural, morphological, and textural properties were well characterized by X-ray diffraction, scanning electron microscopy, and transmission electron microscopy. The vibrational studies were performed by Fourier transform infrared, Raman, and photoluminescence spectroscopies. The X-ray diffraction analysis revealed that hydroxyapatite is the unique crystalline constituent of all the samples, indicating that Eu has been successfully inserted into the HAp lattice. Eu doping inhibits HAp crystallization, leading to a decrease of the average crystallite size from around 20 nm in the undoped sample to around 7 nm in the sample with the highest Eu concentration. Furthermore, the samples show the characteristic 5D0→7F0 transition observed at 578 nm related to Eu3+ ions distributed on Ca2+ sites of the apatitic structure.

  19. Synthesis, Structure, and Luminescent Properties of Europium-Doped Hydroxyapatite Nanocrystalline Powders

    International Nuclear Information System (INIS)

    Ciobanu, C.S.; Iconaru, S.L.; Predoi, D.; Massuyeau, F.; Constantin, L.V.; Costescu, A.

    2012-01-01

    The luminescent europium-doped hydroxyapatite (Eu:HAp, Ca 10-x Eu x (PO 4 ) 6 (OH) 2 ) with 0>x>0.2 nanocrystalline powders was synthesized by coprecipitation. The structural, morphological, and textural properties were well characterized by X-ray diffraction, scanning electron microscopy, and transmission electron microscopy. The vibrational studies were performed by Fourier transform infrared, Raman, and photoluminescence spectroscopies. The X-ray diffraction analysis revealed that hydroxyapatite is the unique crystalline constituent of all the samples, indicating that Eu has been successfully inserted into the HAp lattice. Eu doping inhibits HAp crystallization, leading to a decrease of the average crystallite size from around 20 nm in the undoped sample to around 7 nm in the sample with the highest Eu concentration. Furthermore, the samples show the characteristic 5 D 0 → 7 F 0 transition observed at 578 nm related to Eu 3+ ions distributed on Ca 2+ sites of the apatitic structure

  20. Fluorescence properties of europium and samarium. beta. -diketonates and their use in fluorometry

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

    1981-01-01

    Several europium and samarium ..beta..-diketonates (tta, ntfa, bfa) complexed with 1, 10-phenanthroline, or with trioctylphosphine oxide (topo) were synthesized. The fluorescence properties of these compounds in benzene or hexane have been studied. Absorption and fluorescence spectra, fluorescence quantum yield, fluorescence sensitivity index (F.S.I.), and fluorescence lifetime were measured. From the measurement of fluorescence lifetime of the ..beta..-diketonates, the velocity of radiative process (k sub(f)/phi sub(f)) has almost the same value for benzene and hexane solvent. The red fluorescence (Em. max. : 619 nm) of Eu(III) in these chelates is attributed to transitions from /sup 5/D/sub 0/ ..-->.. /sup 7/F/sub 2/ levels of this ion, and the three-band spectrum (Em. max. : 569 nm, 606 nm, 650 nm) indicates the transitions from the /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(5/2), /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(7/2), and /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(9/2) levels of Sm(III), respectively. These spectra are not changed by any solvents and ligands. From the results, the fluorescence of the ..beta..-diketonates in organic solvent has been attributed to m* ..-->.. m luminescence transition. The complexes of Eu(III) and Sm(III) show radiative transition within orbitals, composed exclusively of 4f orbitals of rare earth ions (m* ..-->.. m radiative transition). Fluorinated ligands show better sensitivity than unfluorinated ligands, and the best sensitivity is obtained with TTA-phen system, and/or TTA-topo system for the spectrofluorometric determination of the two metals. In the case of Eu determination, 619 nm emission wavelength is used (the determinable range : 0.2 -- 10 ppb Eu), and in the case of Sm determination, 650 nm emission wavelength is adopted (the determinable range : 0.1 -- 1 ppm Sm), because of much higher sensitivity than the other two peaks (569, 606 nm) without interference from europium complex.

  1. Assessment of bone marrow plasma cell infiltrates in multiple myeloma: the added value of CD138 immunohistochemistry

    Science.gov (United States)

    Al-Quran, Samer Z.; Yang, Lijun; Magill, James M.; Braylan, Raul C.; Douglas-Nikitin, Vonda K.

    2012-01-01

    Summary Assessment of bone marrow involvement by malignant plasma cells is an important element in the diagnosis and follow-up of patients with multiple myeloma and other plasma cell dyscrasias. Microscope-based differential counts of bone marrow aspirates are used as the primary method to evaluate bone marrow plasma cell percentages. However, multiple myeloma is often a focal process, a fact that impacts the accuracy and reliability of the results of bone marrow plasma cell percentages obtained by differential counts of bone marrow aspirate smears. Moreover, the interobserver and intraobserver reproducibility of counting bone marrow plasma cells microscopically has not been adequately tested. CD138 allows excellent assessment of plasma cell numbers and distribution in bone marrow biopsies. We compared estimates of plasma cell percentages in bone marrow aspirates and in hematoxylin-eosin– and CD138-stained bone marrow biopsy sections (CD138 sections) in 79 bone marrows from patients with multiple myeloma. There was a notable discrepancy in bone marrow plasma cell percentages using the different methods of observation. In particular, there was a relatively poor concordance of plasma cell percentage estimation between aspirate smears and CD138 sections. Estimates of plasma cell percentage using CD138 sections demonstrated the highest interobserver concordance. This observation was supported by computer-assisted image analysis. In addition, CD138 expression highlighted patterns of plasma cell infiltration indicative of neoplasia even in the absence of plasmacytosis. We conclude that examination of CD138 sections should be considered for routine use in the estimation of plasma cell load in the bone marrow. PMID:17714757

  2. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

    OpenAIRE

    Maurilo Monteiro Terra; Erasmo José Paioli Pires; Sônia Maria Bonilha Marcondes Coelho; Ilene Ribeiro da Silva Passos; Rui Ribeiro dos Santos; Celso Valdevino Pommer; André Camargo Pereira da Silva; Ivan José Antunes Ribeiro

    1990-01-01

    Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo) de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. T...

  3. Chemiluminescence determination of tetracyclines using Fenton system in the presence europium(III) ions

    Energy Technology Data Exchange (ETDEWEB)

    Kaczmarek, Malgorzata [Department of Rare Earths, Faculty of Chemistry, Adam Mickiewicz University, Grunwaldzka 6, 60 - 780 Poznan (Poland); Lis, Stefan [Department of Rare Earths, Faculty of Chemistry, Adam Mickiewicz University, Grunwaldzka 6, 60 - 780 Poznan (Poland)

    2009-04-20

    A new simple chemiluminescent method for the determination of chlortetracycline (Chlor-TC), oxytetracycline (Oxy-TC) and doxycycline (Doxy-TC) is described. This method is based on the europium(III) emission as a result of the energy transfer process from the excited product of the tetracyclines oxidation to the uncomplexed Eu(III). Under the optimum conditions, calibration graphs were obtained for 4 x 10{sup -7} to 2 x 10{sup -5} mol L{sup -1} of Chlor-TC; 2 x 10{sup -7} to 2 x 10{sup -5} mol L{sup -1} of Oxy-TC and 1 x 10{sup -7} to 3 x 10{sup -5} mol L{sup -1} of Doxy-TC. The method was successfully applied to the determination of these drugs in pharmaceutical and veterinary formulation and honey.

  4. Stability constants of the Europium complexes with the chloride ions; Constantes de estabilidad de los complejos del europio con los iones cloruro

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez R, M.; Solache R, M.; Rojas H, A. [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

    2000-07-01

    The stability constants of lanthanides complexes with chloride ions which were determined at the same ionic force but in different media, are significantly different. It does not exist a systematic study over these stability constants. The purpose of this work is to determine the stability constants of the europium complexes with chloride ions at 303 K, by the solvents extraction method. (Author)

  5. Effects of Mo Content on Microstructure and Mechanical Property of PH13-8Mo Martensitic Precipitation-Hardened Stainless Steel

    Science.gov (United States)

    Yubing, Pei; Tianjian, Wang; Zhenhuan, Gao; Hua, Fan; Gongxian, Yang

    This paper introduces the effects of Mo content on microstructure and mechanical property of PH13-8Mo martensitic precipitation-hardened stainless steel which is used for LP last stage blade in steam turbine. Thermodynamic software Thermo-Calc has been used to calculate precipitation temperature and the mass fraction of precipitated phases in PH13-8Mo steel with different Mo content. The result shows that when the mass of Mo is below 0.6wt.%, chi-phase mu-phase and sigma-phase could disappear. The microstructure and mechanical property of high Mo PH13-8Mo (Mo=0.57wt.%) and low Mo PH13-8Mo (Mo=2.15wt.%)have been investigated in different heat treatments. The investigations reveal that austenitizing temperature decrease with the reduce of Mo content, so the optimum solution temperature for low Mo PH13-8Mo is lower than that for high Mo PH13-8Mo.The influence of solution temperature on grain size is weakened with the increase of Mo content, Mo rich carbides could retard coarsening of grain. An enormous amount of nano-size uniformly distributed β-NiAl particles are found in both kinds of steels using transmission electron microscopy, they are the most important strengthening phase in PH13-8Mo.

  6. Radiotracer study of sorption of europium on Gorleben sand from aqueous solutions containing humic substances

    International Nuclear Information System (INIS)

    Benes, P.; Stamberg, K.; Siroky, L.; Mizera, J.

    2002-01-01

    The sorption of trace europium, as a trivalent actinide homologue, was studied in the system Gorleben sand - aqueous solution with the aim to elucidate its mechanism. Radiotracer method ( 152/154 Eu) and batch experiments were used. Simultaneously, the distribution of humic substances present in, or added to the system was measured. The evaluation of the sorption was complicated by the adsorption of Eu on the walls of polyethylene vials used for the experiments, which was rather high and had to be taken into consideration. It has been found that Eu sorption on Gorleben sand increases from pH 2 to pH 5-7 and then it decreases. The decrease is due to the complexation of Eu with humic substances leached from Gorleben sand at pH>7. The position of the sorption maximum depends on the composition of the solution and on the liquid-to-solid ratio. It is shifted to lower pH values in the presence of added humic acid (HA), which enhances Eu sorption at low PH values and suppresses it at pH values higher than 5. The regions of the enhancing/suppressing effects coincidence with the high/low adsorption of HA on Gorleben sand, respectively. The increasing ionic strength (from 0.01 to 0.1) and europium concentration (3.4 x 10 -8 to 9.3 x 10 -7 mol/l) suppress the relative sorption (expressed in %) at low pH values and enhance it at pH>6-8. Addition of carbonates (5 x 10 -3 mol/l) supports Eu sorption at pH>7.5 so that no decrease with pH is observed till pH 9. Alkaline leaching of the sand significantly changes most of the effects found. These results were qualitatively interpreted and conclusions were drawn on the mechanism of the sorption. (author)

  7. Determination of the hydrolysis constants of Europium (III), in ion strength media 4, 5 and 6 M NaClO{sub 4} at 303 K; Determinacion de las constantes de hidrolisis del Europio (III), en medios de fuerza ionica 4, 5 y 6 M de NaClO{sub 4} a 303 K

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado B, A.; Jimenez R, M.; Solache R, M. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    1999-07-01

    This work was made with the purpose to complete information about the hydrolysis constants of Europium (III) in high ion strength media. So it was determined at a ion forces media 4, 5 and 6 M of sodium perchlorate at 303 K. The method used was the potentiometric with the aid of the Super quad computer program. In high ion strength media, the measurements of p H do not correspond directly to negative logarithm of the concentration of hydrogen ions, by this it is necessary to calibrate the electrode in these conditions. The Europium was hydrolized at pC{sub H} values greater 6 in all cases. The potentiometric method used under the described experimental conditions is adequate to determine the hydrolysis constants of Europium (III). According to the results and diagrams of chemical species of Europium obtained we can conclude that the hydrolysis constants, differ by its distribution but not in its identity. (Author)

  8. Effect of miR-138 on the antioxidant function of lens epithelial cells affected by age-related cataracts

    Directory of Open Access Journals (Sweden)

    Bo Lu

    2018-03-01

    Full Text Available AIM: To investigate the effects and mechanism of miR-138 in mediating the antioxidant function of lens epithelial cells affected by age-related cataracts. METHODS: Real-time quantitative PCR(RT-qPCRwas used to detect miR-138 expression in the anterior lens capsules of healthy people, the anterior lens capsules of patients with age-related cataracts, and human epithelial cell line(SRA01/04cells exposed to oxidative stress. A 2', 7'-dichloro-fluorescein diacetate(DCFH-DAprobe was used to measure the levels of endogenous reactive oxygen species(ROSin human lens epithelial cells(hLECsexposed to 400μmol/L H2O2 for 1h. SRA01/04 cells were transfected with either miR-138 mimics, mimic controls, miR-138 inhibitors or inhibitor controls. After 72h, these cells were exposed to 400μmol/L H2O2 for 1h, then p53 and Bax mRNA expression were measured using RT-qPCR. Expression of p53 and Bax protein were also measured by western blotting analysis. Finally, cell viability was assessed using an MTS assay. RESULTS: Compared to the control group, expression of miR-138 in the anterior lens capsules of age-related cataract patients and in SRA01/04 cells exposed to oxidative stress significantly increased(PPPPCONCLUSION: The expression of miR-138 is upregulated in the anterior lens capsules of age-related cataract patients. MiR-138 decreases the anti-oxidative stress capacity of lens epithelial cells by upregulating p53 and Bax, while inhibiting cell proliferation and repair. This finding suggests that miR-138 may play a key role in the development of age-related cataracts.

  9. MiR-138 promotes smooth muscle cells proliferation and migration in db/db mice through down-regulation of SIRT1

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Juan [Department of Gynecology, Changzhou Maternity and Children Health Hospital, Changzhou, Jiangsu 213003 (China); Li, Li; Yun, Hui-fang [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China); Han, Ye-shan, E-mail: yeshanhan123@163.com [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China)

    2015-08-07

    Background: Diabetic vascular smooth muscle cells (VSMCs) exhibit significantly increased rates of proliferation and migration, which was the most common pathological change in atherosclerosis. In addition, the study about the role for miRNAs in the regulation of VSMC proliferation is just beginning to emerge and additional miRNAs involved in VSMC proliferation modulation should be identified. Methods: The expression of miR-138 and SIRT1 were examined in SMCs separated from db/db mice and in SMC lines C-12511 exposed to high glucose with qRT-PCR and western blot. The regulation of miR-138 on the expression of SMCs was detected with luciferase report assay. VSMCs proliferation and migration assays were performed to examine the effect of miR-138 inhibitor on VSMCs proliferation and migration. Results: We discovered that higher mRNA level of miR-138 and reduced expression of SIRT1 were observed in SMCs separated from db/db mice and in SMC lines C-12511. Moreover, luciferase report assay showed that the activity of SIRT1 3′-UTR was highly increased by miR-138 inhibitor and reduced by miR-138 mimic. In addition, we examined that the up-regulation of NF-κB induced by high glucose in SMCs was reversed by resveratrol and miR-138 inhibitor. MTT and migration assays showed that miR-138 inhibitor attenuated the proliferation and migration of smooth muscle cells. Conclusion: In this study, we revealed that miR-138 might promote proliferation and migration of SMC in db/db mice through suppressing the expression of SIRT1. - Highlights: • Higher mRNA level of miR-138 was observed in SMCs from db/db mice. • The mRNA and protein level of SIRT1 in SMCs from db/db mice were greatly reduced. • miR-138 could regulate the expression of SIRT1 in SMCs. • SIRT1 overexpression reversed the up-regulation of acetylized p65 and NF-κB induced by high glucose. • MiR-138 inhibitor reversed VSMCs proliferation and migration induced by high glucose.

  10. Europium(II)heptaphosphide EuP/sub 7/

    Energy Technology Data Exchange (ETDEWEB)

    von Schnering, H G; Wittmann, M

    1980-07-01

    The novel polyphosphide, EuP/sub 7/, was prepared under controlled conditions by reaction of the elements in salt melts at 750-800 K. EuP/sub 7/ forms black prismatic crystals not attacked by dilute mineral acids and bases. The thermal decomposition yields EuP/sub 3/ at 700 K and in further steps EuP/sub 2/, Eu/sub 3/P/sub 4/ and EuP, respectively. According to the crystal structure as well as the electrical, optical and magnetic properties, EuP/sub 7/ is a semiconductor (Esub(G) = 0.9 eV; Esub(G) (vert) = 1.1 eV) with divalent europium (..mu.. = 7.55 B.M.). The compound crystallizes in the monoclinic space group P 2/sub 1//n with a = 1148.8(7) pm, b = 570.0(3) pm, c = 1061.0(6) pm, and ..beta.. = 106.08/sup 0/(5); (X-ray diffraction data; 1479 hkl; R = 0.031). The P-atoms are connected ((P-P) = 218.0-223.5 pm) to a 2-dimensional infinite polyanionic structure 2sub(infinity)(P/sub 7//sup 2 -/) with homonuclear 3-bonded and 2-bonded P-atoms in the ratio 5 : 2. The polyanionic network contains P/sub 6/-rings (chair conformation) as well as P/sub 8/-rings and P/sub 10/-rings. The Eu-atoms are bonded to 9 P-atoms (1,4,4-polyhedra) with bond distances ranging from 306.6 to 326.6 pm. The Eu-atoms complete the tetrahedral environment of the P-atoms.

  11. Efficacy of the semiempirical sparkle model as compared to ECP ab-initio calculations for the prediction of ligand field parameters of europium (III) complexes

    International Nuclear Information System (INIS)

    Freire, Ricardo O.; Rocha, Gerd B.; Albuquerque, Rodrigo Q.; Simas, Alfredo M.

    2005-01-01

    The second version of the sparkle model for the calculation of lanthanide complexes (SMLC II) as well as ab-initio calculations (HF/STO-3G and HF/3-21G) have been used to calculate the geometries of a series of europium (III) complexes with different coordination numbers (CN=7, 8 and 9), ligating atoms (O and N) and ligands (mono, bi and polydentate). The so-called ligand field parameters, Bqk's, have been calculated from both SMLC II and ab-initio optimized structures and compared to the ones calculated from crystallographic data. The results show that the SMLC II model represents a significant improvement over the previous version (SMLC) and has given good results when compared to ab-initio methods, which demand a much higher computational effort. Indeed, ab-initio methods take around a hundred times more computing time than SMLC. As such, our results indicate that our sparkle model can be a very useful and a fast tool when applied to the prediction of both ground state geometries and ligand field parameters of europium (III) complexes

  12. Test of zircon materials for sorption of europium; Pruebas de materiales circoniferos para sorcion de europio

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Fernandez V, S.M.; Garcia R, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2003-07-01

    In previous works it has already been made notice that some phosphates have the property of sipping radioactive metals in solution, what takes advantage to fabricate reactive barriers that are placed in the repositories of nuclear wastes. In our laboratory it has been obtained to the zirconium silicate (ZrSiO{sub 4}) and the alpha zirconium hydrogen phosphate (Zr(HPO{sub 4}) 2H{sub 2}0) starting from sea sand in an easy and economic way. With the interest of knowing if these compounds can be used in contention barriers the evaluation of their surface properties it is made and of europium sorption. (Author)

  13. Solid-phase synthesis of compounds of europium and terbium with nitrogen-containing heterocyclic compounds under mechanical activation

    International Nuclear Information System (INIS)

    Kalinovskaya, I.V.; Karasev, V.E.

    2000-01-01

    Effect of solvents and parameters of mechanical treatment on basic regularities of synthesis of rare earth compounds with nitrogen-containing heterocyclic compounds is studied. It is shown that interaction on europium (3) and terbium (3) nitrates with nitrogen-containing heterocyclic compounds leads to formation of compounds of Ln(NO 3 )·2D composition, where Ln=Eu, Tb; D=2,2-dipyridyl, 1,10-phenanthroline, diphenylguanidine. Effect of conditions of mechanical treatment and different additions on process and yield of products is studied. Compounds prepared are characterized by the methods of chemical element analysis, IR spectroscopy and luminescent spectroscopy [ru

  14. 14 CFR 91.138 - Temporary flight restrictions in national disaster areas in the State of Hawaii.

    Science.gov (United States)

    2010-01-01

    ... disaster areas in the State of Hawaii. 91.138 Section 91.138 Aeronautics and Space FEDERAL AVIATION... areas in the State of Hawaii. (a) When the Administrator has determined, pursuant to a request and justification provided by the Governor of the State of Hawaii, or the Governor's designee, that an inhabited...

  15. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from diseased Nile tilapia

    Science.gov (United States)

    Streptococcus agalactiae strain 138P was isolated from the kidney of diseased Nile tilapia in Idaho during a 2007 streptococcal disease outbreak. The full genome of S. agalactiae 138P is 1,838,716 bp. The availability of this genome will allow comparative genomics to identify genes for antigen disco...

  16. Europium-Doped Lanthanum Hafnate Nanoparticles: Structure, Photoluminescence, and Radioluminescence

    Science.gov (United States)

    Wahid, Kareem; Pokhrel, Madhab; Mao, Yuanbing

    Due to their novel physical properties, nanostructured phosphors are of interest for radiation-based imaging and therapeutics. Herein, the structural and luminescent properties of europium-doped lanthanum hafnate (La2Hf2O7:xmol%Eu3+, x = 0 - 35) nanoparticles are investigated for use as scintillators. X-ray diffraction, Raman spectroscopy, and scanning electron microscopy confirm samples prepared through a combined co-precipitation and low-temperature molten salt synthetic process homogenously form spherical nanocrystals of 36 nm in the ordered pyrochlore phase. Ultraviolet and X-ray excitation of these samples induce strong red emissions in the 580 - 590 and 612 - 630 nm range corresponding to the 5D0->7 F1 magnetic dipole and 5D0->7 F2 electric dipole transitions of Eu3+. Optical response and quantum yield are optimized at 5% Eu3+; a proposed trade-off between quenching mechanisms (defect-states/cross-relaxation) and dopant concentration is discussed. Owing to their high density, large effective atomic number, and bright luminescence, these La2Hf2O7:xmol%Eu3+ nanoparticles warrant further investigation for scintillator applications. The authors thank the support from the Defense Threat Reduction Agency of the U.S. Department of Defense (award #HDTRA1- 10-1-0114).

  17. Removal of cobalt and europium radioisotopes using activated carbon prepared from apricot stones

    International Nuclear Information System (INIS)

    Daifullah, A.A.M.; Moloukhia, H.

    2002-01-01

    the phenomena of cobalt and europium sorption by activated carbon from aqueous solution was studied. Activated carbon prepared from locally available agricultural wastes; apricot stones; was used. The prepared carbon was characterized using different techniques. The chemical nature of the surface of the activated carbon was also studied. Experimental studies were conducted to evaluate and optimize the various process variables i.e. equilibrium time, carbon dose, solution ph and the presence of competitive. Optimal conditions for the sorption of the radioisotopes have been identified. The sorption isotherm of Freundlich was the best fitting for the concentration range studied. Interference of oxalic acid, EDTA and phenol molecules were discussed. Percentages desorption of both acid, EDTA and phenol using bi-distilled water and IMHCI was determined. The data suggest the possible use of activated carbon of apricot stone (ACAS) for the concentration of these cations

  18. Fluorometric determination of samarium and europium in rare earth minerals with. beta. -diketoneternary complex

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

    1981-07-01

    This communication reported the optimum conditions for the fluorometric determination of these ions, and the method was adopted in the simultaneous determination of samarium and europium in xenotime and monazite minerals. From the experimental results on the effect of diverse ions and the extraction pH of the aqueous phase, it became clear that TTA-TOPO hexane method was the best system for the determination of samarium and europium because of the highest fluorescence sensitivity of the ternary complex, and also because the lower extraction pH eliminated the effect of diverse ions. Moreover, the very high detection limit (2 ppb) of Sm was achieved by the use of a red sensitive photomultiplier. Which was used at 644 nm, and that of Eu (0.02 ppb) at 614 nm. The procedure was established as follows: The rare earth minerals (xenotime, monazite) sample was treated with hot conc. H/sub 2/SO/sub 4/ and twice precipitated with 0.5 mol dm/sup -3/ oxalic acid (pH was adjusted to 2.0 -- 2.2). Then the precipitate was filtered and ignited to give the rare earth oxide. Fifty milligrams of the oxide was dissolved in HCl and diluted with water in order to obtain the solution containing 5 ..mu..g cm/sup -3/ rare earth oxide. An aliquot of the solution ((1.0 -- 3.0) cm/sup 3/) was adjusted to pH 5.5 with sodium acetate and shaken with 1 x 10/sup -4/ mol dm/sup -3/ TTA- 2 x 10/sup -2/ mol dm/sup -3/ TOPO hexane solution. Then the fluorescence intensity of the organic layer was measured at 644 nm for Sm and 614 nm for Eu. In this procedure, the recovery of Sm and Eu was found to be about 96%. Xenotime contained 0.70% of Sm and 0.004% of Eu, and monazite contained 1.84% of Sm and 0.003% of Eu.

  19. Tuning Eu{sup 3+} emission in europium sesquioxide films by changing the crystalline phase

    Energy Technology Data Exchange (ETDEWEB)

    Mariscal, A., E-mail: antonio.mariscal@csic.es [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain); Quesada, A. [Ceramics for Smart Systems Group, Instituto de Cerámica y Vidrio, C/ Kelsen 5, 28049 Madrid (Spain); Camps, I. [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain); Palomares, F.J. [Instituto de Ciencia de Materiales de Madrid, C/ Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Fernández, J.F. [Ceramics for Smart Systems Group, Instituto de Cerámica y Vidrio, C/ Kelsen 5, 28049 Madrid (Spain); Serna, R. [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain)

    2016-06-30

    Highlights: • PLD production of high quality europium sesquioxide (Eu{sub 2}O{sub 3}) films. • The deposition of Al{sub 2}O{sub 3} capping and/or buffer layers modifies the crystallization for Eu{sub 2}O{sub 3} films upon annealing. • The formation of cubic or monoclinic phases can be favored. • Eu{sup 3+} emission tuning is achieved as a consequence of crystal field effects. - Abstract: We report the growth of europium sesquioxide (Eu{sub 2}O{sub 3}) thin films by pulsed laser deposition (PLD) in vacuum at room temperature from a pure Eu{sub 2}O{sub 3} ceramic bulk target. The films were deposited in different configurations formed by adding capping and/or buffer layers of amorphous aluminum oxide (a-Al{sub 2}O{sub 3}). The optical properties, refractive index and extinction coefficient of the as deposited Eu{sub 2}O{sub 3} layers were obtained. X-ray photoelectron spectroscopy (XPS) measurements were done to assess its chemical composition. Post-deposition annealing was performed at 500 °C and 850 °C in air in order to achieve the formation of crystalline films and to accomplish photoluminescence emission. According to the analysis of X-ray diffraction (XRD) spectra, cubic and monoclinic phases were formed. It is found that the relative amount of the phases is related to the different film configurations, showing that the control over the crystallization phase can be realized by adequately designing the structures. All the films showed photoluminescence emission peaks (under excitation at 355 nm) that are attributed to the intra 4f-transitions of Eu{sup 3+} ions. The emission spectral shape depends on the crystalline phase of the Eu{sub 2}O{sub 3} layer. Specifically, changes in the hypersensitive {sup 5}D{sub 0} → {sup 7}F{sub 2} emission confirm the strong influence of the crystal field effect on the Eu{sup 3+} energy levels.

  20. Study of relaxation processes and uniaxial anisotropy in the Europium Gallium Garnet epitaxial films

    International Nuclear Information System (INIS)

    Mukhopadhyay, P.

    1987-04-01

    We report here the magnetic properties of Europium-Gallium Garnet LPE films of the type Eu x Y 3-x Fe 5-y Ga y O 12 (where O< x<1.2 and 1< y<1.1). The mechanism by which the magnetic moments relax in Eu or Sm Garnets is still not fully understood. We have made studies on Eu-Ga garnet films and explain some of the results observed in these films. Pb and Pt ions are always found as impurities in our films. Pb ions contribute to the anisotropy in the film. Most of the experimental results can be explained with the three sub lattice model. The shape of the FMR line width shows strong sensitivity towards the surface impurities. (author). 18 refs, 6 figs, 1 tab

  1. Emission tunability and local environment in europium-doped OH{sup −}-free calcium aluminosilicate glasses for artificial lighting applications

    Energy Technology Data Exchange (ETDEWEB)

    Farias, Aline M.; Sandrini, Marcelo; Viana, José Renato M.; Baesso, Mauro L.; Bento, Antônio C.; Rohling, Jurandir H. [Departamento de Física, Universidade Estadual de Maringá, Av Colombo, 5790, 87020-900, Maringá, PR (Brazil); Guyot, Yannick [Laboratoire de Physico–Chimie des Matériaux Luminescents, Université de Lyon, Université Claude Bernard Lyon 1, Villeurbanne, UMR 5620 CNRS 69622 (France); De Ligny, Dominique [Department of Materials Science and Engineering, University of Erlangen Nürnberg, Martens str. 5, 91058, Erlangen (Germany); Nunes, Luiz Antônio O. [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador São-Carlense400, 13566-590, São Carlos, SP (Brazil); Gandra, Flávio G. [Instituto de Física Gleb Wataghin, Universidade Estadual de Campinas, 13083-859, Campinas, SP (Brazil); Sampaio, Juraci A. [Lab Ciências Físicas, Universidade Estadual Norte Fluminense, 28013-602, Campos Dos Goytacazes, RJ (Brazil); Lima, Sandro M.; Andrade, Luis Humberto C. [Grupo de Espectroscopia Óptica e Fototérmica, Universidade Estadual de Mato Grosso do Sul-UEMS, Dourados, MS, C. P. 351, CEP 79804-970 (Brazil); and others

    2015-04-15

    The relationship between emission tunability and the local environment of europium ions in OH{sup −}-free calcium aluminosilicate glasses was investigated, focusing on the development of devices for artificial lighting. Significant conversion of Eu{sup 3+} to Eu{sup 2+} was obtained by means of melting the glasses under a vacuum atmosphere and controlling the silica content, resulting in broad, intense, and tunable luminescence ranging from blue to red. Electron spin resonance and X-ray absorption near edge structure measurements enabled correlation of the luminescence behavior of the material with the Eu{sup 2+}/Eu{sup 3+} concentration ratio and changes in the surrounding ions' crystal field. The coordinates of the CIE 1931 chromaticity diagram were calculated from the spectra, and the contour maps showed that the light emitted from Eu{sup 2+} presented broad bands and enhanced color tuning, ranging from reddish-orange to blue. The results showed that these Eu doped glasses can be used for tunable white lighting by combining matrix composition and the adjustment of the pumping wavelength. - Highlights: • Eu{sup 2+}-doped OH{sup −} free calcium aluminosilicate glass as a new source for white lighting. • Correlation between emission tunability and local environment of europium ions. • Significant reduction of Eu{sup 3+} to Eu{sup 2+} by melting the glasses under vacuum atmosphere. • Broad, intense and tunable luminescence ranging from blue to red.

  2. The NK-1 Receptor Antagonist L-732,138 Induces Apoptosis and Counteracts Substance P-Related Mitogenesis in Human Melanoma Cell Lines

    Directory of Open Access Journals (Sweden)

    Miguel Muñoz

    2010-04-01

    Full Text Available It has been recently demonstrated that substance P (SP and neurokinin-1 (NK-1 receptor antagonists induce cell proliferation and cell inhibition in human melanoma cells, respectively. However, the antitumor action of the NK-1 receptor antagonist L-732,138 on such cells is unknown. The aim of this study was to demonstrate an antitumor action of L-732,138 against three human melanoma cell lines (COLO 858, MEL HO, COLO 679. We found that L-732,138 elicits cell growth inhibition in a concentration dependent manner in the melanoma cells studied. Moreover, L-732,138 blocks SP mitogen stimulation. The specific antitumor action of L-732,138 occurred through the NK-1 receptor and melanoma cell death was by apoptosis. These findings indicate that the NK-1 receptor antagonist L-732,138 could be a new antitumor agent in the treatment of human melanoma.

  3. The NK-1 Receptor Antagonist L-732,138 Induces Apoptosis and Counteracts Substance P-Related Mitogenesis in Human Melanoma Cell Lines

    Energy Technology Data Exchange (ETDEWEB)

    Muñoz, Miguel, E-mail: mmunoz@cica.es; Rosso, Marisa; González-Ortega, Ana [Research Laboratory on Neuropeptides, Virgen del Rocío University Hospital, Sevilla (Spain); Coveñas, Rafael [Institute of Neurosciences of Castilla y León (INCYL), Laboratory of Neuroanatomy of the Peptidergic Systems (Laboratory 14), Salamanca (Spain)

    2010-04-20

    It has been recently demonstrated that substance P (SP) and neurokinin-1 (NK-1) receptor antagonists induce cell proliferation and cell inhibition in human melanoma cells, respectively. However, the antitumor action of the NK-1 receptor antagonist L-732,138 on such cells is unknown. The aim of this study was to demonstrate an antitumor action of L-732,138 against three human melanoma cell lines (COLO 858, MEL HO, COLO 679). We found that L-732,138 elicits cell growth inhibition in a concentration dependent manner in the melanoma cells studied. Moreover, L-732,138 blocks SP mitogen stimulation. The specific antitumor action of L-732,138 occurred through the NK-1 receptor and melanoma cell death was by apoptosis. These findings indicate that the NK-1 receptor antagonist L-732,138 could be a new antitumor agent in the treatment of human melanoma.

  4. Luminescence behavior of the dibenzoyl methane europium(III) complexes in sol-gel derived host materials

    International Nuclear Information System (INIS)

    Wang Feng; Fan Xianping; Wang Minquan; Zhang Xianghua

    2005-01-01

    The luminescence behavior of the dibenzoyl methane europium(III) complexes (Eu(DBM) 3 ) in sol-gel derived host materials have been investigated. The steady-state excitation and emission spectra and the time-resolved spectra of the 1% EuCl 3 and 3% DBM co-doped gel indicated an efficient ligand-to-metal energy transfer. The Eu(DBM) 3 complexes in the gel showed longer 5 D 0 lifetimes in comparison with Eu(DBM) 3 .3H 2 O complexes. The luminescence intensity of the 1% EuCl 3 and 3% DBM co-doped gel decreased continuously with increasing temperature and time of heat treatment, which indicated the gradual decomposition of the Eu(DBM) 3 complexes in the gel during heat treatment

  5. Isotopic exchange between 232Th and 234Th using ion exchange resins and its application for the radiochemical separation of thorium and europium

    International Nuclear Information System (INIS)

    Sepulveda Munita, C.J.A.; Atalla, L.T.

    1980-01-01

    The determination of thorium via the measurement of 233 Th activity (obtained by irradiating natural thorium with neutrons) may suffer the interference of various radioisotopes which may be also formed during irradiation, if their parent isotopes are present in the sample. Taking into account this possibility, another technique was chosen for the determination of thorium, based on isotopic exchange associated with ionic exchange. Conditions for the isotopic exchange between 234 Th in solution and 232 Th in the resin were optimized. It was verified that the behaviour of 233 Th and 234 Th is the same regarding isotopic exchange with 232 Th. 234 Th was chosen for the experiments since it has a longer half-life (24.1 days) than 233 Th (22.3 min), thus facilitating the performance of the work. As the major objective of this work is to separate thorium and europium isotopes, the behaviour of 152-154 Eu was studied in the same system used for thorium, envisaging a minimum retention of these radioisotopes in the resin. In order to establish the best conditions for separating 234-Th and 152/154-Eu, the following parameters were considered: the thorium concentration in the solution; the hydrochloric acid concentration in solution; the concentration of other elements in solution; the degree of cross-linking of the resin; the flow rate of the solution through the column. The other elements added to the elutant solution were: uranium, molybdenum, lanthanum, europium, ytterbium, bromine, cobalt, barium, manganese, indium, cesium and selenium. Europium was added so to dilute the 152/154-Eu tracer and avoid the retention of the latter in the resin. The other elements were added because they give rise to radioisotopes which interfere in the activation analysis of thorium when 233-Th activity is used and, the separation of these elements from thorium will also be subsequently studied by the method used in the present work. (C.L.B.) [pt

  6. Spectral characteristics of europium-doped lead iodide

    International Nuclear Information System (INIS)

    Novosad, I.S.; Novosad, S.S.

    2013-01-01

    Optical absorption and x-ray luminescence spectra and thermally stimulated luminescence curves of a PbI 2 :EuCl 3 crystal grown by the Stockbarger method were investigated in the temperature range 85-295 K. It was presumed based on results of EPR spectral studies that the europium ions in this material existed in the divalent state and replaced matrix cations. An intense broad non-elementary band at 780 nm in addition to a weak band with a maximum in the range 512-520 nm were observed in the PbI 2 :Eu 2+ x-ray luminescence spectrum at 85 K. The intensity of the long-wavelength emission increased slightly upon increasing the crystal temperature from 85 to 130 K and was quenched in several stages upon increasing the temperature further to 220 K. The maximum shifted to 740 nm. It was proposed based on an analysis of the obtained data and results of a study of the luminescence properties of PbI 2 and PbI 2 :Mn 2+ crystals that the non-elementary emission band of the PbI 2 :Eu 2+ crystal at 780 nm could be represented as a superposition of three individual Gaussian bands with maxima near 715, 740, and 800 nm that were due to centers characteristic of the matrix and additional centers that were formed by Eu ions through association with intrinsic and dopant oxygen-containing defects, respectively. Doping PbI 2 with Eu 2+ ions did not affect the spectrum of matrix trapping levels. The nature of emission and trapping centers and luminescence excitation mechanisms of PbI 2 :Eu 2+ were discussed. (authors)

  7. Down-regulation of human cytomegalovirus UL138, a novel latency ...

    Indian Academy of Sciences (India)

    2013-07-12

    Jul 12, 2013 ... observed a 74.6% decrease in luciferase activity and a 46.2% decrease in HCMV UL138 protein expression. Our .... Trizol agent (Takara, Dalian, China), according to the man- ... hybrid primer and polyA structure were found in the se- quence. ..... resolution profiling and analysis of viral and host small RNAs.

  8. NMR and luminescence spectroscopy study of formation of mixed β-diketonate europium complexes

    International Nuclear Information System (INIS)

    Kavun, V.Ya.; Kalinovskaya, I.V.; Karasev, V.E.; Chernyshov, B.N.; Steblevskaya, N.I.

    1987-01-01

    Methods of NMR ('H, 19 F) and luminescent spectroscopy were applied to study ligand substitution in Eu(β-dik) 3 phen-CDCl 3 -(β-dik)' systems, where β-dik-acetylacetone (AA) and hexafluoroacetyl-acetone (HFAA), phen-1.10-phenathroline at different mole ratio (m) of competing ligands (m=AA/HFAA). Formation of mixed Eu(AA) 2 (HFAA)phen and Eu(AA)(HFAA) 2 phen complexes is proved; calculation of the stark structure of 5 D 0 - 7 F j (j=0,1,2) transitions in low-temperature luminescence spectra is conducted for these complexes. It is stated that at minimum HFAA concentration in the solution the latter replaces AA from europium coordination sphere. It is shown that depending on the value in substitution of acidoligands proceeds successfully by the equations Eu(AA) 3 phen+(NHFAA) n → Eu(AA) 3-n → (HFAA) n phen+(NAA) n ; (n=1,2,3)

  9. Europium-activated phosphors containing oxides of rare-earth and group-IIIB metals and method of making the same

    Science.gov (United States)

    Comanzo, Holly Ann; Setlur, Anant Achyut; Srivastava, Alok Mani; Manivannan, Venkatesan

    2004-07-13

    Europium-activated phosphors comprise oxides of at least a rare-earth metal selected from the group consisting of gadolinium, yttrium, lanthanum, and combinations thereof and at least a Group-IIIB metal selected from the group consisting of aluminum, gallium, indium, and combinations thereof. A method for making such phosphors comprises adding at least a halide of at least one of the selected Group-IIIB metals in a starting mixture. The method further comprises firing the starting mixture in an oxygen-containing atmosphere. The phosphors produced by such a method exhibit improved absorption in the UV wavelength range and improved quantum efficiency.

  10. Exploration of spectroscopic properties of solvated tris(thenoyltrifluoroacetonate)(2,2′-bipyridine)europium(III)red hybrid organic complex for solution processed OLEDs and displays

    International Nuclear Information System (INIS)

    Chitnis, Dipti; Thejokalyani, N.; Dhoble, S.J.

    2017-01-01

    In order to explore the spectroscopic properties of a novel europium activated hybrid organic tris(thenoyltrifluoroacetonate)(2,2′-bipyridine)europium(III), Eu(TTA) 3 bipy phosphor in various solvents at different pH and molar concentrations, UV–vis optical absorption and photoluminescence spectra were carried out. With a variation in the solvent from basic (chloroform, toluene, tetrahydrofuran) to acidic (acetic acid, formic acid) media, staggering differences in optical absorptions and optical densities were noticed with hypsochromic shift in the absorption peaks. The optical density was found to be maximum for the complex with pH= 7.0 and the intensity as well as optical density gradually decreased when pH is lowered to 6.0 or raised to 8.0 (at an interval of 0.5), proving that the complex is pH sensitive. It's optical energy gap and stokes shift values in various organic solvents were also calculated on the basis of Lippert-Mataga plot. The exploration of spectroscopic properties of solvated Eu(TTA) 3 bipy complex demonstrates its prospective for solution processed OLEDs and display devices. - Graphical abstract: Pictorial depiction of photoluminescence in solvated Eu(TTA) 3 bipy complex under UV light.

  11. Chemical species of europium (III) in ionic force media 0.02M, 0.1M, and 0.7M NaClO4 at 298 K

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.

    2000-01-01

    In order to know the effects of the controlled or accidental liberation of the europium in the environment, it is necessary to know its chemical behavior in found conditions in oceans, ground and surface water. The behavior of this element in these environments can be controlled mainly by the hydrolysis and its interaction with inorganic and organic ions. (Author)

  12. Extracellular proteases from Streptomyces phaeopurpureus ExPro138 inhibit spore adhesion, germination and appressorium formation in Colletotrichum coccodes.

    Science.gov (United States)

    Palaniyandi, S A; Yang, S H; Suh, J-W

    2013-07-01

    To study the antifungal mechanism of proteases from Streptomyces phaeopurpureus strain ExPro138 towards Colletotrichum coccodes and to evaluate its utilization as biofungicide. We screened proteolytic Streptomyces strains from the yam rhizosphere with antifungal activity. Forty proteolytic Streptomyces were isolated, among which eleven isolates showed gelatinolytic activity and antagonistic activity on C. coccodes. Of the 11 isolates, protease preparation from an isolate designated ExPro138 showed antifungal activity. 16S rDNA sequence analysis of the strain showed 99% similarity with Streptomyces phaeopurepureus (EU841588.1). Zymography analysis of the ExPro138 culture filtrate revealed that the strain produced several extracellular proteases. The protease preparation inhibited spore germination, spore adhesion to polystyrene surface and appressorium formation. Microscopic study of the interaction between ExPro138 and C. coccodes revealed that ExPro138 was mycoparasitic on C. coccodes. The protease preparation also reduced anthracnose incidence on tomato fruits compared with untreated control. This study demonstrates possibility of utilizing antifungal proteases derived from antagonistic microbes as biofungicide. Microbial proteases having the ability to inhibit spore adhesion and appressorium formation could be used to suppress infection establishment by foliar fungal pathogens at the initial stages of the infection process. Journal of Applied Microbiology © 2013 The Society for Applied Microbiology.

  13. Study of the influence of humic acids (in solution or bound to a silica gel) on the migration of europium in a porous medium. Comparison with inorganic colloids

    International Nuclear Information System (INIS)

    Fleury, Ch.

    1998-01-01

    After having been reprocessed, radioactive wastes are stored in conditions which depend on the toxicity of the radioelements. In particular, for the actinides, the packaging has to be sure for several thousands years. In the case of a defective storage, phenomena which favour or diminish the migration of radioelements in the environment have to be identified. In water, organic or inorganic colloids able to bind radioelements can migrate. Among these colloids, are found the humic acids (HA), macromolecules (poly-electrolytes and poly-dispersed) known for their affinity towards some radioelements. These HA are either present on a soluble state or bound to mineral supports. Humic acids have then been studied in these two states and their influence on the europium migration in dynamical system have been observed (ion exchange and affinity chromatography). When HA are bound by covalent bonds to silica gel, they strongly retain the radioelement, whatever be the conditions of pH, flow rate or ionic strength, and either if phosphate ions are present. The study of HA in solution has shown that, on the one hand the formation of a Eu-HA complex alters the adsorption of the radioelement on sand and that the influence of the humic acids on the europium retention is superior to those of the inorganic colloids (silicon oxide, bentonite). On the other hand, the study has revealed that a solution containing HA desorbs almost entirely the europium beforehand bound to the sand. This desorption depends on the pH and on the flow rate but not on the presence of competitive ions as for instance phosphate ions. (O.M.)

  14. Effect of the ion force on the hydrolysis constants and of the solubility product of Europium

    International Nuclear Information System (INIS)

    Jimenez R, M.; Ramirez G, J.J.; Solache R, M.; Rojas H, A.

    2003-01-01

    A study on the behavior of the first hydrolysis constant β Eu,H l-0 and the constant of the solubility product Kps of the europium in front of the changes of the ion force: 0. 02 M, 0.1 M, 0.7M, 2M, 3M and 4M of sodium perchlorate, at 303 K. Experimentally the potentiometry and also radioactivity measures its were used. The specific interaction of ions theory (SIT) of Bronsted-Guggenheim-Scatchard allows the extrapolation of the values to infinite dilution and the results were: log β Eu,H l-0 = -7 36 and log K sp l-0 = -24. 68. A discussion of the group of results with the data of the literature is presented. (Author)

  15. Europium concentration effect on characteristics and luminescent properties of hydroxyapatite nanocrystalline powders

    Science.gov (United States)

    Nikolaev, Anton; Kolesnikov, Ilya; Frank-Kamenetskaya, Olga; Kuz'mina, Maria

    2017-12-01

    Series of Eu-apatites were synthesized by precipitation from aqueous solutions with the Eu/Ca atomic ratio from 0.5% to 5% at T = 90 °C. Resulting precipitates were studied using different experimental techniques including X-ray powder diffraction, infrared and raman spectroscopy, scanning elecrton microscopy, EDX and photoluminescent spectroscopy. Eu-doped Ca-deficit nanosized non-stoichiometric hydroxyapatite with high water content has been obtained throughout the experiment. Europium content in the synthesized apatites reaches 0.24 apfu (Eu/Ca = 2.5%). Relations between Eu content is the solution and precipitate have been established. It was shown that Eu-monacite starts to precipitate as secondary phase at Eu/Ca ratio in starting solution 1% or higher. Maximum luminescence is observed in apatite with ∼2% Eu/Ca ratio (which equals to ∼0.2 apfu and corresponds to 3% Eu/Ca ratio in the starting solution). As an important and brand-new result, apatite with 2% Eu/Ca ratio can be considered as the most appropriate material for the producing biolabels for luminescent research in medicine and biology.

  16. On the complexing of phosphoric acid vinyl esters with praseodymium (3) and europium (3) nitrates in acetonitrile

    International Nuclear Information System (INIS)

    Goryushko, A.G.; Gololobov, Yu.G.; Boldeskul, A.E.; Oganesyan, A.S.; Yartsev, V.G.

    1990-01-01

    By the methods of electron, IR and PMR spectroscopy interaction of vinyl esters of phosphoric acid with praseodymium (3) and europium (3) nitrates in acetonitrile solutions has been studied. It is shown that the character of metal-ligand interaction is determined by chemical nature of the ligands: for a compound of ionic structure partially covalent bond is formed, and for a compound of betaine structure the interaction has mainly dipole character. Addition of molecule with betaine structure to praseodymium nitrate causes a change in geometry of Pr 3+ close surrounding and increase in its coordination number. The possibility of formation of the complex with metal-ligand ratio equal to 1:3 is shown

  17. Europium resonance parameters from neutron capture and transmission measurements in the energy range 0.01–200 eV

    International Nuclear Information System (INIS)

    Leinweber, G.; Barry, D.P.; Burke, J.A.; Rapp, M.J.; Block, R.C.; Danon, Y.; Geuther, J.A.; Saglime III, F.J.

    2014-01-01

    Highlights: • Metal samples were sealed and imaged with X-rays to determine sample uniformity. • Eleven new resonances were identified below 100 eV. • The resonance regions of 151 Eu and 153 Eu have been extended from 100 to 200 eV. • The thermal total cross section for 151 Eu was measured, up (9 ± 3)% from ENDF/B-VII.1. • Radiation widths were assigned for all resonances from experimental data. - Abstract: Europium is a good absorber of neutrons suitable for use as a nuclear reactor control material. It is also a fission product in the low-yield tail at the high end of the fission fragment mass distribution. Measurements have been made of the stable isotopes with natural and enriched samples. The linear electron accelerator center (LINAC) at the Rensselaer Polytechnic Institute (RPI) was used to explore neutron interactions with europium in the energy region from 0.01 to 200 eV. Neutron capture and transmission measurements were performed by the time-of-flight technique. Two transmission measurements were performed at flight paths of 15 and 25 m with 6 Li glass scintillation detectors. The neutron capture measurements were performed at a flight path of 25 m with a 16-segment sodium iodide multiplicity detector. Resonance parameters were extracted from the data using the multilevel R-matrix Bayesian code SAMMY. A table of resonance parameters and their uncertainties is presented. To prevent air oxidation metal samples were sealed in airtight aluminum cans in an inert environment. Metal samples of natural europium, 47.8 atom% 151 Eu, 52.2 atom% 153 Eu, as well as metal samples enriched to 98.77 atom% 153 Eu were measured. The measured neutron capture resonance integral for 153 Eu is (9.9 ± 0.4)% larger than ENDF/B-VII.1. The capture resonance integral for 151 Eu is (7 ± 1)% larger than ENDF/B-VII.1. Another significant finding from these measurements was a significant increase in thermal total cross section for 151 Eu, up (9 ± 3)% from ENDF/B-VII.1

  18. Ligand effect on the performance of organic light-emitting diodes based on europium complexes

    International Nuclear Information System (INIS)

    Fang Junfeng; You Han; Gao Jia; Lu Wu; Ma Dongge

    2007-01-01

    A series of europium complexes were synthesized and their electroluminescent (EL) characteristics were studied. It was found by comparison that the different substituted groups, such as methyl, chlorine, and nitryl, on ligand 1,10-phenanthroline affect significantly the EL performance of devices based on these complexes. The more methyl-substituted groups on ligand 1,10-phenanthroline led to higher device efficiency. A chlorine-substituted group showed the approximate EL performance as two methyl-substituted groups, whereas a nitryl substituent reduced significantly the EL luminous efficiency. However, β-diketonate ligand TTA and DBM exhibited similar EL performance. The improved EL luminous efficiency by proper substituted groups on the 1,10-phenanthroline was attributed to the reduction of the energy loss caused by light hydrogen atom vibration, as well as concentration quenching caused by intermolecular interaction, and the match of energy level between the ligand and Eu 3+

  19. Synergistic extraction of europium(III) in ammonium ionic liquid

    International Nuclear Information System (INIS)

    Rout, Alok; Venkatesan, K.A.; Antony, M.P.

    2016-01-01

    Room temperature ionic liquids have been receiving increased attention for possible applications in the area of nuclear fuel reprocessing and waste management due to their fascinating properties such as good ionicity, high solvation capability, properties tunable etc. Most of the studies in the literature on the extraction of metal ions with molecular extractants dissolved in ionic liquid diluents are making use of the hydrophobic ionic liquids containing imidazolium cations such as the 1-alkyl-3-methylimidazolium ion. From an environmental point of view, such ionic liquids are not suitable as the primary mode of the metal extraction is by cation exchange mechanism wherein ionic liquid cation is lost to the aqueous phase leading to aqueous contamination and issue of recyclability of organic phase. However, there are some hydrophobic ionic liquids such as trioctylmethylammonium chloride ((N 1888 )(Cl)), and trihexyl(tetradecyl)phoshonium chloride (Cyphos IL 101) that exhibit no cation exchange in the aqueous phase during extraction. In this context, the extraction behavior of europium(III) using a neutral extractant, octyl, phenyl-N.N-diisobutylmethylcarbamoylphophinoxide (CMPO) and/or an acidic extractant bis(ethylhexyl)phosphoric acid (D2EHPA) dissolved in the ammonium ionic liquid diluent, trioctylmethylammonium bis(trifluoromethanesulfonyl)imide, (N 1888 )(NTf 2 ). The extraction behavior of CMPO (or D2EHPA)/(N 1888 )((Tf 2 ) system was investigated as a function of different extraction parameters such as feed acidity, extractant concentration, equilibration time etc.

  20. Exploration of spectroscopic properties of solvated tris(thenoyltrifluoroacetonate)(2,2′-bipyridine)europium(III)red hybrid organic complex for solution processed OLEDs and displays

    Energy Technology Data Exchange (ETDEWEB)

    Chitnis, Dipti [Department of Physics, RTM Nagpur University, Nagpur 440033 (India); Thejokalyani, N., E-mail: thejokalyani@rediffmail.com [Department of Applied Physics, Laxminarayan Institute of Technology, Nagpur 440033 (India); Dhoble, S.J. [Department of Physics, RTM Nagpur University, Nagpur 440033 (India)

    2017-05-15

    In order to explore the spectroscopic properties of a novel europium activated hybrid organic tris(thenoyltrifluoroacetonate)(2,2′-bipyridine)europium(III), Eu(TTA){sub 3}bipy phosphor in various solvents at different pH and molar concentrations, UV–vis optical absorption and photoluminescence spectra were carried out. With a variation in the solvent from basic (chloroform, toluene, tetrahydrofuran) to acidic (acetic acid, formic acid) media, staggering differences in optical absorptions and optical densities were noticed with hypsochromic shift in the absorption peaks. The optical density was found to be maximum for the complex with pH= 7.0 and the intensity as well as optical density gradually decreased when pH is lowered to 6.0 or raised to 8.0 (at an interval of 0.5), proving that the complex is pH sensitive. It's optical energy gap and stokes shift values in various organic solvents were also calculated on the basis of Lippert-Mataga plot. The exploration of spectroscopic properties of solvated Eu(TTA){sub 3}bipy complex demonstrates its prospective for solution processed OLEDs and display devices. - Graphical abstract: Pictorial depiction of photoluminescence in solvated Eu(TTA){sub 3}bipy complex under UV light.

  1. Highly luminescent pure-red-emitting fluorinated β-diketonate europium(III) complex for full solution-processed OLEDs

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Joao P. [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Serviço de Medicina Nuclear, SESARAM E.P.E., Avenida Luís de Camões 57, Funchal 9004-514, Madeira (Portugal); Martín-Ramos, Pablo [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Higher Technical School of Telecommunications Engineering, Universidad de Valladolid, Campus Miguel Delibes, Paseo Belén 15, Valladolid 47011 (Spain); Coya, Carmen, E-mail: carmen.coya@urjc.es [Escuela Superior de Ciencias Experimentales y Tecnología (ESCET), Universidad Rey Juan Carlos, Madrid 28933 (Spain); Silva, Manuela Ramos [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Eusebio, M. Ermelinda S. [Chemistry Department, Faculdade de Ciências e Tecnologia, Universidade de Coimbra, Coimbra P-3004-535 (Portugal); Andrés, Alicia de [Instituto de Ciencia de Materiales de Madrid, Consejo Superior de Investigaciones Científicas (CSIC), Cantoblanco, Madrid 28049 (Spain); Álvarez, Ángel L. [Escuela Superior de Ciencias Experimentales y Tecnología (ESCET), Universidad Rey Juan Carlos, Madrid 28933 (Spain); Martín-Gil, Jesús [Advanced Materials Laboratory, ETSIIAA, Universidad de Valladolid, Avenida de Madrid 44, Palencia 34004 (Spain)

    2015-03-15

    Current manufacturing technologies for OLEDs involve the use of expensive high vacuum techniques and call for thermal stability requirements which are not fulfilled by many materials. These problems disappear when the OLED films are deposited directly from solution. In this study, we have designed, synthesized and characterized a novel octacoordinated complex, Tris(1-(4-chlorophenyl)-4,4,4-trifluoro-1, 3-butanedionate)mono(bathophenanthroline) europium(III), to be used as a “complex-only” emissive layer in wet-processed OLEDs. Upon excitation in the UV region, very efficient energy transfer from the ligands to Eu{sup 3+} takes place, giving rise to intense red emission with very high monochromaticity (R=19), both in powder and as a thin film. The decay times of 754 µs (powder) and 620 µs (thin film) are comparable to those of the most efficient Eu{sup 3+} β-diketonate complexes reported to date. The same energy transfer leading to saturated red and narrow emission is also observed in the OLED device (glass/ITO/PEDOT:PSS/[Eu(cbtfa){sub 3}(bath)]/Ca/Al) when biased at >5.2 V. Its high quantum efficiency (∼60%), good thermal stability up to 200 °C and adequate thin film forming properties make this material a promising chromophore for cost-effective OLEDs. - Highlights: • A highly fluorinated europium(III) octacoordinated complex, [Eu(cbtfa)3(bath)], has been synthesized and its structure elucidated by single crystal X-ray diffraction. • The chosen coordination environment is well-suited for sensitizing the luminescence of the Eu{sup 3+} ion, achieving very efficient energy transfer from the organic ligands (excited in the UV region) to the rare earth ion, leading to highly efficient (Q∼60% in crystalline powder and Q∼50% in thin film) and saturated red photoluminescence. • The material has also been integrated into a single active layer, full solution-processed OLED, with ITO/PEDOT:PSS/[Eu(cbtfa)3(bath)]/ Ca/Al structure.

  2. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.138 Can roads be built in roadless and wild areas? Under 25 CFR part 265 no roads can be...

  3. Synthesis and luminescence properties of two novel europium (III) perchlorate complexes with bis(benzylsulfinyl)methane and 1,10-phenanthroline

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wen-Xian, E-mail: nmglwx@163.com [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China); Guo, Feng [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China); Zheng, Yu-Shan [Inner Mongolia Autonomous Region Product Quality Inspection Institute, Hohhot 010010 (China); Cao, Xiao-Fang; Feng, Shu-Yan; Bai, Juan; Xin, Xiao-Dong [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China)

    2014-09-15

    Two novel binary and ternary Europium (III) perchlorate complexes were synthesized. The binary complex was prepared with bis(benzylsulfinyl)methane as ligand, and the ternary complex was with bis(benzylsulfinyl)methane as first ligand and 1,10-Phenanthroline as second ligand. They were characterized by element analysis, molar conductivity, coordination titration analysis, IR, TG-DSC, {sup 1}HNMR and UV spectra. The results indicated that the composition of binary and ternary complexes was EuL{sub 2.5}·(ClO{sub 4}){sub 3}·3H{sub 2}O and Eu{sub 2}L{sub 4}·phen·(ClO{sub 4}){sub 6}·12H{sub 2}O (L=C{sub 6}H{sub 5}CH{sub 2}SOCH{sub 2}SOCH{sub 2}C{sub 6}H{sub 5}), respectively. The fluorescent spectra illustrated that the complexes displayed characteristic Europium (III) ion fluorescence in solid state, indicating the ligands favored energy transfer to the excitation state energy level of it. The strongest characteristic fluorescence emission intensity of the ternary system was 1.87 times as strong as that of the binary system. The fluorescent quantum yields of the Eu (III) ternary and binary complexes were also calculated. Additionally, the phosphorescence spectra and the luminescence mechanisms of the complexes were studied and explained. - Highlights: • Two rare earth complexes are new. And they are stabilized. • The intensities of the two rare earth complexes were all stronger and the lifetimes were longer. • The introduction of the second organic ligand1,10-Phenanthroline enhanced the fluorescence intensity. • The fluorescent quantum yields of two complexes being calculated are both very high.

  4. Quadrupole splitting and Eu partial lattice dynamics in europium orthophosphate EuPO {sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Klobes, B., E-mail: b.klobes@fz-juelich.de [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany); Arinicheva, Y., E-mail: y.arinicheva@fz-juelich.de; Neumeier, S., E-mail: s.neumeier@fz-juelich.de [Forschungszentrum Jülich GmbH, Institute of Energy and Climate Research (IEK-6) Nuclear Waste Management and Reactor Safety (Germany); Simon, R. E., E-mail: r.simon@fz-juelich.de; Jafari, A., E-mail: a.jafari@fz-juelich.de [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany); Bosbach, D., E-mail: d.bosbach@fz-juelich.de [Forschungszentrum Jülich GmbH, Institute of Energy and Climate Research (IEK-6) Nuclear Waste Management and Reactor Safety (Germany); Hermann, R. P., E-mail: hermannrp@ornl.gov [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany)

    2016-12-15

    Hyperfine interactions in europium orthophosphate EuPO{sub 4} were investigated using {sup 151}Eu Mössbauer spectroscopy from 6 to 300 K. The value of the quadrupole splitting and the asymmetry parameter were refined and further substantiated by nuclear forward scattering data obtained at room temperature. The temperature dependence of the relative absorption was modeled with an Eu specific Debye temperature of 221(1) K. Eu partial lattice dynamics were probed by means of nuclear inelastic scattering and the mean force constant, the Lamb-Mössbauer factor, the internal energy, the vibrational entropy, the average phonon group velocity were calculated using the extracted density of phonon states. In general, Eu specific vibrations are characterized by rather small phonon energies and contribute strongly to the total entropy of the system. Although there is no classical Debye like behavior at low vibrational energies, the average phonon group velocity can be reasonably approximated using a linear fit.

  5. Characterization of an azo-calix[4]arene-based optical sensor for Europium (III) ions

    International Nuclear Information System (INIS)

    Echabaane, M.; Rouis, A.; Bonnamour, I.; Ouada, H. Ben

    2012-01-01

    Selective and sensitive optical sensor membranes (optodes) were elaborated to detect cations in aqueous solutions. The sensing films are based on chromogenic calix[4]arene derivatives. The optode membranes were studied using UV/Vis absorption spectroscopy measurements. The sensitivity of the optode has been tested for Pb 2+ , Cd 2+ , Mg 2+ and Eu 3+ ions at pH 6.8. The results showed a good selectivity response towards Eu 3+ . Low selectivity coefficients were observed for Cd 2+ and Mg 2+ where Pb 2+ can be considered as interfering ions. The characteristics of this optode such as response time, regeneration, reproducibility and lifetime are discussed. - Highlights: ► We report optical sensing studies of chromogenic calixarene derivatives. ► We investigate optical interaction between azo-calix[4]arene and Eu 3+ . ► We study sensitivity and selectivity of optode films. ► We describe characteristics of optode films for determination of europium traces.

  6. Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

    DEFF Research Database (Denmark)

    Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.

    2006-01-01

    .0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased......-1 isolates from patients in a long-term non-progressor (LTNP) cohort and a slow-progressor (SP) cohort (n = 11) was analysed and compared with isolates from a control patient group of progressors (n = 18). Most of the patients with delayed disease progression had extensive medical records, providing...... an insight into the LTNP disease profile and allowing for the stratification of patients based on their CD4 cell decline. RESULTS: In sequences from nine patients, most of the functional domains of HIV-1 Nef appeared intact, and no major deletions were observed to possibly account for an effect...

  7. Synthesis and electroluminescence properties of europium (III) complexes with new second ligands

    International Nuclear Information System (INIS)

    Liu Ze; Wen Fushan; Li Wenlian

    2005-01-01

    Two novel second ligands, 9,9-Di-(4-methoxyphenyl)-9-H-4,5-' (OMe-Spiro-DF) and 9,9-Di-(2-(4-(4-butyloxy)phenyl)-5-phenyl-1,3,4-oxadiazolyl)-phenyl-9-H-4, 5-Diazafluorene (OXD-Spiro-DF), were successfully prepared. Europium complexes, Eu(DBM) 3 (OMe-Spiro-DF) and Eu(DBM) 3 (OXD-Spiro-DF) (DBM=dibenzolylmethane) based on the two ligands were designed and synthesized. For a double-layer device with configuration of indium tin oxide (ITO)/N, N'-diphenyl-N,N'-bis(3-methylphenyl)-1,1'-biphenyl-4,4'-diamine (TPD)/Eu(DBM) 3 (OXD-Spiro-DF) or Eu(DBM) 3 (OMe-Spiro-DF)/Mg/Ag, compared with the device based on complex Eu(DBM) 3 (OMe-Spiro-DF), the brightness and electroluminescent (EL) efficiency of device based on complex Eu(DBM) 3 (OXD-Spiro-DF) with oxadiazole-functionalized ligand OXD-Spiro-DF are significantly improved due to the improvement of electron-transporting ability. A maximum brightness of 154 cd/m 2 was obtained at 17 V in the complex Eu(DBM) 3 (OXD-Spiro-DF), about four times brighter than the corresponding complex Eu(DBM) 3 (OMe-Spiro-DF)

  8. Características de las fallas en alimentadores de 13,8 kV del sistema soterrado de La Habana;Characteristic of 13,8 kV feeders faults of the Havana underground system

    Directory of Open Access Journals (Sweden)

    Boris Alba - Valle

    2011-06-01

    Full Text Available El sistema soterrado de La Habana enfrenta problemas de continuas fallas en sus alimentadores de 13,8 kV. En este trabajo se determinan las características de estas averías, en el período comprendido entre los años 2007 y 2009, y se proponen algunas medidas objetivas con el fin de contribuir a su disminución. La investigación se basó fundamentalmente en el estudio de la base de datos de los alimentadores de 13,8 kV proporcionada por el departamento técnico de la Unidad Empresarial Básica (UEB Soterrada y en el uso de herramientas estadísticas digitales. Como resultado se pudo constatar que las fallas son más frecuentes en los alimentadores de la subestación de Tallapiedra producto de la humedad en cables y empalmes con aislamiento de PILC (papel impregnado en aceite y con cubierta de plomo, dispuestos por tierra muerta. Finalmente, las medidas propuestas tuvieron un impacto positivo en la disminución de estas fallas, en un período inferior a un año.The Havana underground system has problems of continuous faults in their 13,8 kV feeders. In this article the characteristics of these mishaps in the period of 2007 to 2009 are determined and purpose some objective measurements with the end of contributing to their decrease. The investigation was fundamentally based on the study of the 13,8 kV feeders database proportioned by the technical department of the Underground Basic Managerial Unit (UEB and the use of digital statistical tools. As a result, it was verified that the faults occur with more frequency in the Tallapiedra substation feeders, due to the humidity in cables and connections with PILC isolation (impregnated in oil and lead covered paper, prepared for undergrounding directly in the earth. Finally, the proposed measures had a positive impact in the decrease of these faults, in a period less than to a year.

  9. 340nm UV LED excitation in time-resolved fluorescence system for europium-based immunoassays detection

    DEFF Research Database (Denmark)

    Rodenko, Olga; Fodgaard, Henrik; Tidemand-Lichtenberg, Peter

    2017-01-01

    In immunoassay analyzers for in-vitro diagnostics, Xenon flash lamps have been widely used as excitation light sources. Recent advancements in UV LED technology and its advantages over the flash lamps such as smaller footprint, better wall-plug efficiency, narrow emission spectrum......, and no significant afterglow, have made them attractive light sources for gated detection systems. In this paper, we report on the implementation of a 340 nm UV LED based time-resolved fluorescence system based on europium chelate as a fluorescent marker. The system performance was tested with the immunoassay based...... on the cardiac marker, TnI. The same signal-to-noise ratio as for the flash lamp based system was obtained, operating the LED below specified maximum current. The background counts of the system and its main contributors were measured and analyzed. The background of the system of the LED based unit was improved...

  10. Neutron cross section evaluations of europium isotopes in 1 keV - 30 MeV energy range. Format - validation - comparison; Evaluation de sections efficaces pour des neutrons incidents sur des isotopes d'europium aux energies 1 keV - 30 MeV. Format - validation - comparaison

    Energy Technology Data Exchange (ETDEWEB)

    Dossantos-Uzarralde, P.; Le Luel, C.; Bauge, E. [CEA Bruyeres le Chatel, 91 (France). Dept. de Physique Theorique et Appliquee

    2004-07-01

    This paper presents neutron cross section evaluations of Europium isotopes. The cross sections are evaluated in 1 keV - 30 MeV energy range for the isotopes {sup 146}Eu, {sup 147}Eu, {sup 148}Eu, {sup 149}Eu, {sup 150}Eu, {sup 151}Eu, {sup 152}Eu, {sup 153}Eu, {sup 154}Eu in their ground state. This evaluation includes cross section productions of the long life isomeric states. Special attention is put on the options used for the description of the files written in ENDF-6 format. The final issue is a proposal of a new breed of ENDF-6 formatted neutron activation file. (authors)

  11. Ubiquitin Ligase RNF138 Promotes Episodic Ataxia Type 2-Associated Aberrant Degradation of Human Cav2.1 (P/Q-Type) Calcium Channels.

    Science.gov (United States)

    Fu, Ssu-Ju; Jeng, Chung-Jiuan; Ma, Chia-Hao; Peng, Yi-Jheng; Lee, Chi-Ming; Fang, Ya-Ching; Lee, Yi-Ching; Tang, Sung-Chun; Hu, Meng-Chun; Tang, Chih-Yung

    2017-03-01

    Voltage-gated Ca V 2.1 channels comprise a pore-forming α 1A subunit with auxiliary α 2 δ and β subunits. Ca V 2.1 channels play an essential role in regulating synaptic signaling. Mutations in the human gene encoding the Ca V 2.1 subunit are associated with the cerebellar disease episodic ataxia type 2 (EA2). Several EA2-causing mutants exhibit impaired protein stability and exert dominant-negative suppression of Ca V 2.1 wild-type (WT) protein expression via aberrant proteasomal degradation. Here, we set out to delineate the protein degradation mechanism of human Ca V 2.1 subunit by identifying RNF138, an E3 ubiquitin ligase, as a novel Ca V 2.1-binding partner. In neurons, RNF138 and Ca V 2.1 coexist in the same protein complex and display notable subcellular colocalization at presynaptic and postsynaptic regions. Overexpression of RNF138 promotes polyubiquitination and accelerates protein turnover of Ca V 2.1. Disrupting endogenous RNF138 function with a mutant (RNF138-H36E) or shRNA infection significantly upregulates the Ca V 2.1 protein level and enhances Ca V 2.1 protein stability. Disrupting endogenous RNF138 function also effectively rescues the defective protein expression of EA2 mutants, as well as fully reversing EA2 mutant-induced excessive proteasomal degradation of Ca V 2.1 WT subunits. RNF138-H36E coexpression only partially restores the dominant-negative effect of EA2 mutants on Ca V 2.1 WT functional expression, which can be attributed to defective membrane trafficking of Ca V 2.1 WT in the presence of EA2 mutants. We propose that RNF138 plays a critical role in the homeostatic regulation of Ca V 2.1 protein level and functional expression and that RNF138 serves as the primary E3 ubiquitin ligase promoting EA2-associated aberrant degradation of human Ca V 2.1 subunits. SIGNIFICANCE STATEMENT Loss-of-function mutations in the human Ca V 2.1 subunit are linked to episodic ataxia type 2 (EA2), a dominantly inherited disease characterized by

  12. Long non-coding RNA TUG1 promotes cervical cancer progression by regulating the miR-138-5p-SIRT1 axis.

    Science.gov (United States)

    Zhu, Jie; Shi, Huirong; Liu, Huina; Wang, Xiaojuan; Li, Fengmei

    2017-09-12

    Increasing evidences showed that long non-coding RNAs (lncRNAs) play vital roles in tumor progression. Recent studies indicated that lncRNA TUG1 was upregulated and promoted tumor processes in several cancers. However, the expression and underlying mechanism of TUG1 in cervical cancer remain unclear. In the present study, we found that TUG1 expression was upregulated in cervical cancer tissues and correlated with advanced clinical features and poor overall survival. TUG1 knockdown suppressed cervical cancer cell growth and metastasis in vitro and tumor growth in vivo . In addition, our results indicated that TUG1 could act as an endogenous sponge by directly binding to miR-138-5p and suppressed miR-138-5p expression. Furthermore, we found that TUG1 could reverse the inhibitory effect of miR-138-5p on cervical cancer cells processes, which might be involved in the activation of SIRT1, a target gene of miR-138-5p, and activation of Wnt/β-catenin signaling pathway. Taken together, we elucidated that TUG1 might promote cervical cancer malignant progression via miR-138-5p-SIRT1-Wnt/β-catenin signaling pathway axis.

  13. Efficient red organic electroluminescent devices based on trivalent europium complex obtained by designing the device structure with stepwise energy levels

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Liang; Jiang, Yunlong; Cui, Rongzhen; Li, Yanan; Zhao, Xuesen; Deng, Ruiping; Zhang, Hongjie, E-mail: hongjie@ciac.ac.cn

    2016-02-15

    In this study, we aim to further enhance the electroluminescence (EL) performances of trivalent europium complex Eu(TTA){sub 3}phen (TTA=thenoyltrifluoroacetone and phen=1,10-phenanthroline) by designing the device structure with stepwise energy levels. The widely used bipolar material 2,6-bis(3-(9H-carbazol-9-yl)phenyl)pyridine (26DCzPPy) was chosen as host material, while the doping concentration of Eu(TTA){sub 3}phen was optimized to be 4%. To facilitate the injection and transport of holes, MoO{sub 3} anode modification layer and 4,4′,4′′-Tris(carbazole-9-yl)triphenylamine (TcTa) hole transport layer were inserted in sequence. Efficient pure red emission with suppressed efficiency roll-off was obtained attributed to the reduction of accumulation holes, the broadening of recombination zone, and the improved balance of holes and electrons on Eu(TTA){sub 3}phen molecules. Finally, the device with 3 nm MoO{sub 3} and 5 nm TcTa obtained the highest brightness of 3278 cd/m{sup 2}, current efficiency of 12.45 cd/A, power efficiency of 11.50 lm/W, and external quantum efficiency of 6.60%. Such a device design strategy helps to improve the EL performances of emitters with low-lying energy levels and provides a chance to simplify device fabrication processes. - Highlights: • Electroluminescent performances of europium complex were further improved. • Device structure with stepwise energy levels was designed. • Better carriers' balance was realized by improving the injection and transport of holes. • The selection of bipolar host caused the broadening of recombination zone.

  14. 42 CFR 137.138 - Once the Indian Tribe's final offer has been accepted or deemed accepted by operation of law...

    Science.gov (United States)

    2010-10-01

    ... accepted or deemed accepted by operation of law, what is the next step? 137.138 Section 137.138 Public... final offer has been accepted or deemed accepted by operation of law, what is the next step? After the... the acceptance or the deemed acceptance. Rejection of Final Offers ...

  15. Analysis on metallogenetic geological and physicochemical conditions in uranium deposit No.138

    International Nuclear Information System (INIS)

    Tang Qitao

    1996-01-01

    The uranium deposit No.138 is of Mesozoic volcano-sedimentary transformation type. This paper discusses such geological conditions as source of uranium, stratigraphy and lithology, lithofacies and paleogeography, paleoclimate, structure and reworking-regeneration, and such physicochemical conditions as uranium adsorbent and reductant, effective porosity, chemical compositions, pH and Eh of rocks in the deposit

  16. Computational Investigation on the Spectroscopic Properties of Thiophene Based Europium β-Diketonate Complexes.

    Science.gov (United States)

    Greco, Claudio; Moro, Giorgio; Bertini, Luca; Biczysko, Malgorzata; Barone, Vincenzo; Cosentino, Ugo

    2014-02-11

    The adiabatic transition energies from the lowest triplet states of four Europium tris β-diketonate/phenantroline complexes have been determined in vacuo and in dicholomethane solution by the ΔSCF approach at the density functional theory level, using the PBE1PBE and the CAM-B3LYP hybrid functionals. The calculated adiabatic transition energies have been compared with the experimental 0-0 transitions of each complex determined from phosphorescence spectra of the corresponding Gd(3+) complexes and followed by direct comparison between simulated and experimental spectra line shapes. For compound 1, the Eu(TTA)3Phen system, triplet states other than the lowest one and conformational isomers other than the one present in the crystallographic structure have been considered. In the crystallographic structure, this compound presents three quasi-degenerate low energy triplet states, differing for the TTA ligand where the two unpaired electrons are localized and showing close adiabatic transition energies. For compound 1, the lowest triplet states of the four investigated conformational isomers show similar characteristics and close adiabatic transition energies. On the basis of these results, an investigation of compounds 2-4 (Eu(Br-TTA)3Phen, Eu(DTDK)3Phen, and Eu(MeT-TTA)3) has been performed by considering only the isomer present in the crystallographic structure and only the lowest triplet state of each compound. For compounds 1-3, the energies of the lowest triplet states calculated by both functionals in solution including zero-point energy corrections well reproduce the experimental trends as well as the values of the adiabatic transition energies: CAM-B3LYP, the best performing functional, provides energies of the lowest triplet state with deviations from experiments lower than 1200 cm(-1). Also, the calculated vibrationally resolved phosphorescence spectra and UV-vis absorptions well reproduce the main features of their experimental counterparts. Significant

  17. 25 CFR 224.138 - What must the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical...

    Science.gov (United States)

    2010-04-01

    ... noncompliance with the TERA or a Federal law has caused imminent jeopardy to a physical trust asset. ... caused imminent jeopardy to a physical trust asset? 224.138 Section 224.138 Indians BUREAU OF INDIAN... the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical trust asset? If...

  18. Study of sorption mechanisms of europium(3) and uranium(6) ions on clays : impact of silicates; Etude des mecanismes de retention des ions U(6) et Eu(3) sur les argiles: influence des silicates

    Energy Technology Data Exchange (ETDEWEB)

    Kowal-Fouchard, A

    2002-11-01

    Bentonite clay has been selected as a potential buffer or backfill material in a number of disposal programmes for high level waste. In order to enhance the thermodynamic database of sorption phenomena at the solid-water interface, we have investigated sorption mechanisms of europium(III) and uranium(VI) ions onto montmorillonite and bentonite. Thermodynamic data were obtained for different ions concentrations, different background electrolytes and different ionic strengths. The structural identification of the surface complexes and sorption sites was carried out using two spectroscopies, XPS and TRLIFS, while sorption edges were performed using batch experiments. However, clays are complex minerals and in order to understand these sorption mechanisms we have studied europium(III) and uranium(VI) retention on a silica and an alumina because these solids are often considered as basic components of clays. The comparison of structural results shows that europium ions are significantly sorbed on permanently charged sites of clay until pH 7. But this ion is also sorbed on {identical_to}SiOH and {identical_to}AlOH sites of montmorillonite at pH higher than 6. Uranyl ions sorption on montmorillonite is mainly explained by retention of three complexes on {identical_to}SiOH sites. Moreover, we have shown that nitrate ions and dissolved silicates affect on uranium(VI) sorption mechanisms onto alumina. Nevertheless, uranyl ions sorption on montmorillonite and bentonite only decreases with increasing carbonate concentration. Finally, all the sorption edges were then modeled using these results and a surface complexation model (2 pK and constant capacitance models). (author)

  19. Direct or photostimulated luminescence after X-Ray irradiation of divalent europium in alkaline earth compounds containing some halides; Luminescence directe ou photostimulee apres irradiation X de l'europium divalent dans des familles de composes alcalino-terreux comportant un halogene

    Energy Technology Data Exchange (ETDEWEB)

    Merigou, C

    1990-10-15

    With a view for digitizing of radiological images, the luminescent properties of divalent europium in diverse halogen compounds involving strontium or barium have been studied. In halogen-rich compounds (MCl{sub 2}, M{sub 4}OCl{sub 6}, M{sub 5}SiO{sub 4}Cl{sub 6},... where M is Sr or Ba), the thermal extinction of the emission begins only above 300 K. High densities of coloured spots have been produced with X-ray irradiation. The combining of these 2 features has led to the obtention of high yields for argon laser stimulated luminescence in the case of Sr{sub 5}SiO{sub 4}Cl{sub 5}Br:Eu halogen silicate. Although these yields are high they stay below that of BaXF:Eu which is usually used in photon-stimulated screens.

  20. Photoluminescent study of Polycarbonate (PC) and Poly(9-vinylcarbazole) (PVK) doped films with europium complex

    International Nuclear Information System (INIS)

    Forster, Pedro Lima

    2010-01-01

    Polymers doped with rare earth complexes are advantaged in film production for many applications in the luminescent field. In this study luminescent polymer obtained from polycarbonate (PC) and poly(9-vinylcarbazole) films doped with diaquatris(thenoyltrifluoroacetonate)europium(III) complex [Eu(tta) 3 (H 2 0) 2 ] were prepared and their calorimetric and luminescent properties in the solid state are reported. The thermal behavior was investigated by differential scanning calorimetry (OSC) and thermogravimetry analysis (TGA). Due of the addition of rare earth Eu(tta) 3 (H 2 0) 2 ] into PC and PVK matrices, changes were observed in the thermal behavior concerning the glass transition and thermal stability. Characteristic broadened narrow bands arising from the 5 D 0 -→ 7 F J transitions (J = 0-4) of Eu 3+ ion indicate the incorporation of the Eu 3+ ions into those polymers. The luminescent films show enhancement emission intensity with an increase in the rare earth concentration in polymeric matrix accompanied by decrease in thermal stability. (author)

  1. Use of dispersive liquid-liquid microextraction for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium

    International Nuclear Information System (INIS)

    Mallah, M.H.; Atomic Energy Organization of Iran, Tehran; Shemirani, F.; Ghannadi Maragheh, M.

    2008-01-01

    A new preconcentration method of dispersive liquid-liquid microextraction (DLLME) was developed for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium. DLLME technique was successfully used as a sample preparation method. In this preconcentration method, an appropriate mixture of extraction solvent, disperser solvent was injected rapidly into an aqueous solution containing Sm, Eu, Gd and Dy after complex formation using chelating reagent of the 1-(2-pyridylazo)-2-naphthol (PAN). After phase separation, 0.5 mL of the settled phase containing enriched analytes was determined by inductively coupled plasma optical emission spectrometry (ICP-OES). The main factors affected the preconcentration of Sm, Eu, Gd and Dy were extraction and dispersive solvent type and their volume, extraction time, volume of chelating agent (PAN), centrifuge speed and drying temperature of the samples. Under the best operating condition simultaneous preconcentration factors of 80, 100, 103 and 78 were obtained for Sm, Eu, Gd and Dy, respectively. (author)

  2. A case study of energy transfer mechanism from uranium to europium in ZnAl2O4 spinel host by photoluminescence spectroscopy

    Science.gov (United States)

    Kumar, Mithlesh; Mohapatra, M.

    2016-04-01

    Zinc aluminate (ZAO), a member of spinel class of inorganic compounds has been of much interest of late due to its wide range of use in catalysis, optical, electronic and ceramic industries. When doped with several lanthanides, this material has proved to be a potential host matrix for phosphors. As lanthanides suffer from poor (direct) excitation and emission cross sections, the use of a co-dopant ion can help to circumvent this and extract better emission from a lanthanide doped ZAO system. In this connection, energy transfer mechanism from uranium to europium in the ZAO host was investigated by photoluminescence spectroscopic technique. It was seen that uranium gets stabilized in the hexavalent state as UO66 - (octahedral uranate) where as the lanthanide ion, Eu is stabilized in its trivalent state in the ZAO host. In the co-doped system, an efficient energy transfer pathway from the uranate to europium ion was observed. Based upon emission and life time data a suitable mechanism was proposed for the energy transfer (quenching) process. It was proposed that after excitation by photons, the uranate ions transfer their energy to nearby 5D1 level of Eu3 + ions which non-radiatively de-excites to the corresponding lower levels of 5D0. Further this 5D0 level decays in a radiative mode to the 7F manifold giving the characteristic emission profile of trivalent Eu. It was proposed that both static and dynamic types of energy transfer mechanism were responsible for this process.

  3. 75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116

    Science.gov (United States)

    2010-09-09

    ... Guide 1.38, ``Quality Assurance Requirements for Packaging, Shipping, Receiving, Storage, and Handling....116, ``Quality Assurance Requirements for Installation, Inspection, and Testing of Mechanical... Development Branch, Division of Engineering, Office of Nuclear Regulatory Research, U.S. Nuclear Regulatory...

  4. Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1992-01-01

    The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

  5. Mean-field potential approach for thermodynamic properties of lanthanide: Europium as a prototype

    Science.gov (United States)

    Kumar, Priyank; Bhatt, N. K.; Vyas, P. R.; Gohel, V. B.

    2018-03-01

    In the present paper, a simple conjunction scheme [mean-field potential (MFP) + local pseudopotential] is used to study the thermodynamic properties of divalent lanthanide europium (Eu) at extreme environment. Present study has been carried out due to the fact that divalent nature of Eu arises because of stable half-filled 4f-shell at ambient condition, which has great influence on the thermodynamic properties at extreme environment. Due to such electronic structure, it is different from remaining lanthanides having incomplete 4f-shell. The presently computed results of thermodynamic properties of Eu are in good agreement with the experimental results. Looking to such success, it seems that the concept of MFP approach is successful to account contribution due to nuclear motion to the total Helmholtz free energy at finite temperatures and pressure-induced inter-band transfer of electrons for condensed state of matter. The local pseudopotential is used to evaluate cold energy and hence MFP accounts the s-p-d-f hybridization properly. Looking to the reliability and transferability along with its computational and conceptual simplicity, we would like to extend the present scheme for the study of thermodynamic properties of remaining lanthanides and actinides at extreme environment.

  6. Determination of piroxicam in pharmaceutical formulations and urine samples using europium-sensitized luminescence

    Energy Technology Data Exchange (ETDEWEB)

    Al-Kindy, Salma M.Z. [Department of Chemistry, College of Science, P.O. Box 36, Al-Khod 123, Sultan Qaboos University (Oman)], E-mail: alkindy@squ.edu.om; Suliman, Fakhr Eldin O.; Al-Wishahi, Aisha A.; Al-Lawati, Haidar A.J.; Aoudia, Muhammed [Department of Chemistry, College of Science, P.O. Box 36, Al-Khod 123, Sultan Qaboos University (Oman)

    2007-12-15

    A simple, selective and sensitive luminescence method for the assay of piroxicam (PX) in aqueous solution is developed. The method is based on the luminescence sensitization of europium (Eu{sup 3+}) by formation of ternary complex with PX in the presence of TOPO and Tween-80 as surfactant. The signal for Eu-PX-TOPO is monitored at {lambda}{sub ex}=359 nm and {lambda}{sub em}=615 nm. Optimum conditions for the formation of the complex in sequential injection analysis (SIA) were 0.01 M Tris buffer, pH 7.5, TOPO 5.0x10{sup -5} M, Tween-80 0.15% and 1.5 mM of Eu{sup 3+}, which allows the determination of 100-1000 ppb of PX with limit of detection (LOD) of 29 ppb. The relative standard deviations of the method range between 0.5% and 3.9% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assay of PX in pharmaceutical formulations and in urine samples. Average recoveries of 100.8{+-}1.7% was obtained in tablet, whereas a recovery of 97.5{+-}2.0% was obtained for the total PX (PX+hydoxy-PX) in urine sample.

  7. Determination of piroxicam in pharmaceutical formulations and urine samples using europium-sensitized luminescence

    International Nuclear Information System (INIS)

    Al-Kindy, Salma M.Z.; Suliman, Fakhr Eldin O.; Al-Wishahi, Aisha A.; Al-Lawati, Haidar A.J.; Aoudia, Muhammed

    2007-01-01

    A simple, selective and sensitive luminescence method for the assay of piroxicam (PX) in aqueous solution is developed. The method is based on the luminescence sensitization of europium (Eu 3+ ) by formation of ternary complex with PX in the presence of TOPO and Tween-80 as surfactant. The signal for Eu-PX-TOPO is monitored at λ ex =359 nm and λ em =615 nm. Optimum conditions for the formation of the complex in sequential injection analysis (SIA) were 0.01 M Tris buffer, pH 7.5, TOPO 5.0x10 -5 M, Tween-80 0.15% and 1.5 mM of Eu 3+ , which allows the determination of 100-1000 ppb of PX with limit of detection (LOD) of 29 ppb. The relative standard deviations of the method range between 0.5% and 3.9% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assay of PX in pharmaceutical formulations and in urine samples. Average recoveries of 100.8±1.7% was obtained in tablet, whereas a recovery of 97.5±2.0% was obtained for the total PX (PX+hydoxy-PX) in urine sample

  8. Complete genome sequence of an attenuated Sparfloxacin-resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    The complete genome of a sparfloxacin-resistant Streptococcus agalactiae vaccine strain 138spar is 1,838,126 bp in size. The genome has 1892 coding sequences and 82 RNAs. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipeline. The publishing of this genome will allo...

  9. The K2-138 System: A Near-resonant Chain of Five Sub-Neptune Planets Discovered by Citizen Scientists

    DEFF Research Database (Denmark)

    Christiansen, Jessie L.; Crossfield, Ian J. M.; Barentsen, Geert

    2018-01-01

    K2-138 is a moderately bright (V = 12.2, K = 10.3) main-sequence K star observed in Campaign 12 of the NASA K2 mission. It hosts five small (1.6-3.3 R⊕) transiting planets in a compact architecture. The periods of the five planets are 2.35, 3.56, 5.40, 8.26, and 12.76 days, forming an unbroken...... chain of near 3:2 resonances. Although we do not detect the predicted 2-5 minute transit timing variations (TTVs) with the K2 timing precision, they may be observable by higher-cadence observations with, for example, Spitzer or CHEOPS. The planets are amenable to mass measurement by precision radial...... velocity measurements, and therefore K2-138 could represent a new benchmark system for comparing radial velocity and TTV masses. K2-138 is the first exoplanet discovery by citizen scientists participating in the Exoplanet Explorers project on the Zooniverse platform....

  10. Inorganic ion exchanger based on tin/titanium mixed oxide doped with europium to be used in radioactive waste

    International Nuclear Information System (INIS)

    Paganini, Paula P.; Felinto, Maria Claudia F.C.; Kodaira, Claudia A.; Brito, Hermi F.

    2009-01-01

    This work presents the results of synthesis and characterization of an inorganic ion exchanger based on tin/titanium mixed oxides doped with europium (SnO 2 /TiO 2 :Eu 3+ ) to be used in environmental field. The adsorption study of nickel was realized in this exchanger to recover the nickel metal which is in thorium-nickel alloys used as electrode of discharge lamps. The studied exchanger was synthesized by neutralization of tin chloride (IV) and titanium chloride (III) mixed solution and characterized by thermogravimetric measurement (TG), Differential Scanning Calorimetry (DSC), X-Ray Powder Diffraction (XRD), Infrared Spectroscopy (IR) and Scanning Electron Microscopy (SEM). The adsorption study showed that these inorganic ion exchangers are good materials to recovery nickel with high weight distribution ratios (Dw Ni 2+ ) and percent adsorption. (author)

  11. Clinical characteristics of 138 Chinese female patients with idiopathic hypogonadotropic hypogonadism

    Directory of Open Access Journals (Sweden)

    Rui-yi Tang

    2017-11-01

    Full Text Available Objective: To evaluate the clinical features of Chinese women with idiopathic hypogonadotropic hypogonadism (IHH. Methods: We retrospectively reviewed the clinical characteristics, laboratory and imaging findings, therapeutic management and fertility outcomes of 138 women with IHH. All patients had been treated and followed up at an academic medical centre during 1990–2016. Results: Among the 138 patients, 82 patients (59.4% were diagnosed with normosmic IHH and 56 patients (40.6% were diagnosed with Kallmann syndrome (KS. The patients with IHH experienced occasional menses (4.3%, spontaneous thelarche (45.7% or spontaneous pubarche (50.7%. Women with thelarche had a higher percentage of pubarche (P < 0.001 and higher gonadotropin concentrations (P < 0.01. Olfactory bulb/sulci abnormalities were found during the magnetic resonance imaging (MRI of all patients with KS. Most patients with IHH had osteopenia and low bone age. Among the 16 women who received gonadotropin-releasing hormone treatment, ovulation induction or assisted reproductive technology, the clinical pregnancy rate was 81.3% and the live birth rate was 68.8%. Conclusions: The present study revealed that the phenotypic spectrum of women with IHH is broader than typical primary amenorrhoea with no secondary sexual development, including occasional menses, spontaneous thelarche or pubarche. MRI of the olfactory system can facilitate the diagnosis of KS. Pregnancy can be achieved after receiving appropriate treatment.

  12. Spin-dependent γ softness or triaxiality in even-even 132-138Nd nuclei

    Science.gov (United States)

    Chai, Qing-Zhen; Wang, Hua-Lei; Yang, Qiong; Liu, Min-Liang

    2015-02-01

    The properties of γ instability in rapidly rotating even-even 132-138Nd isotopes have been investigated using the pairing-deformation self-consistent total-Routhian-surface calculations in a deformation space of (β2, γ, β4). It is found that even-even 134-138Nd nuclei exhibit triaxiality in both ground and excited states, even up to high-spin states. The lightest isotope possesses a well-deformed prolate shape without a γ deformation component. The current numerical results are compared with previous calculations and available observables such as quadrupole deformation β2 and the feature of γ-band levels, showing basically a general agreement with the observed trend of γ correlations (e.g. the pattern of the odd-even energy staggering of the γ band). The existing differences between theory and experiment are analyzed and discussed briefly. Supported by National Natural Science Foundation of China (10805040,11175217), Foundation and Advanced Technology Research Program of Henan Province(132300410125) and S & T Research Key Program of Henan Province Education Department (13A140667)

  13. The "11K" gene family members sf68, sf95 and sf138 modulate transmissibility and insecticidal properties of Spodoptera frugiperda multiple nucleopolyhedrovirus.

    Science.gov (United States)

    Beperet, Inés; Simón, Oihane; Williams, Trevor; López-Ferber, Miguel; Caballero, Primitivo

    2015-05-01

    The "11K" gene family is notable for having homologs in both baculoviruses and entomopoxviruses and is classified as either type 145 or type 150, according to their similarity with the ac145 or ac150 genes of Autographa californica multiple nucleopolyhedrovirus (AcMNPV). One homolog of ac145 (sf138) and two homologs of ac150 (sf68 and sf95) are present in Spodoptera frugiperda multiple nucleopolyhedrovirus (SfMNPV). Recombinant bacmids lacking sf68, sf95 or sf138 (Sf68null, Sf95null and Sf138null, respectively) and the respective repair bacmids were generated from a bacmid comprising the complete virus genome. Occlusion bodies (OBs) of the Sf138null virus were ∼15-fold less orally infective to insects, which was attributed to a 100-fold reduction in ODV infectious titer. Inoculation of insects with Sf138null OBs in mixtures with an optical brightener failed to restore the pathogenicity of Sf138null OBs to that of the parental virus, indicating that the effects of sf138 deletion on OB pathogenicity were unlikely to involve an interaction with the gut peritrophic matrix. In contrast, deletion of sf68 and sf95 resulted in a slower speed-of-kill by 9h, and a concurrent increase in the yield of OBs. Phylogenetic analysis indicated that sf68 and sf95 were not generated after a duplication event of an ancestral gene homologous to the ac150 gene. We conclude that type 145 genes modulate the primary infection process of the virus, whereas type 150 genes appear to have a role in spreading systemic infection within the insect. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. Extraction of uranium(6), transuranium elements and europium by bidentate neutral phosphorus- and phosphorus-nitrogen-containing reagents with substituent in methylene bridge

    International Nuclear Information System (INIS)

    Kochetkova, N.E.; Kojro, O.Eh.; Nesterova, N.P.; Medved', T.Ya.; Chmutova, M.K.; Myasoedov, B.F.; Kabachnik, M.I.

    1986-01-01

    The influence of substituents in methylene bridge on solubility, extractivity and selectivity of bidentate neutral phosphorus- and phosphorus-nitrogen-containing reagents in the process of U(6), TUE, Eu extraction has been studied. It is ascertained that hydrogen substitution in the bridge of tetraphenylmethylenediphosphine dioxide (1) causes a decrease in the extractivity of reagent as to TPE, uranium (6) and europium. There is no visible regular relation between basicity and extractivity of substituted reagents. Hydrogen substitution in the bridge of diphenyl[diethylcarbamoylmethyl]phosphine oxide (2) causes a decrease in extractivity of the reagent as to TPE, uranium (6) and europium. In contrast to monodentate neutral reagents, when bidentate neutral reagents are used, sometimes no increase in the reagent extractivity with an increase in its basicity is observed. When fragments restricting the conformation mobility of bidentate reagent molecule are introduced in it (here substituents in methylene bridge), it may result in the violation of the regularity, since of all the factors affecting the reagent extractivity the spatial factor may become the prevailing one. On hydrogen substitution in the bridge of 1 separation factors of practically all (with few exceptions) studied pairs of elements increase. Hydrogen substitution in the bridge of 2 causes an increase in separation factor of U (6) /Am pair and it does not affect the separation factor of Am/Eu pair. Hydrogen substitution in the bridge of 1 and 2 does not result in the preparation of more efficient and considerably more selective reagents for extractive isolation and separation of the elements, but some of the substituted reagents (Cl-substituted 1, for instance) may turn out useful for the element separation

  15. Thermoluminescence of europium-doped zinc oxide exposed to beta particle irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Iriqui R, J. L.; Cruz V, C. [Universidad de Sonora, Departamento de Investigacion en Polimeros y Materiales, Apdo. Postal 130, 83000 Hermosillo, Sonora (Mexico); Bernal, R. [Universidad de Sonora, Departamento de Investigacion en Fisica, Apdo. Postal 5-088, 83000 Hermosillo, Sonora (Mexico); Castano, V. M., E-mail: jorgeiriqui@gimmunison.com [UNAM, Instituto de Fisica, Centro de Fisica Aplicada y Tecnologia Avanzada, Apdo. Postal 1-1010, 76000 Queretaro, Qro. (Mexico)

    2015-10-15

    Full text: Zn O is a promising material for a range of optoelectronics applications, due to its direct wide band gap (E{sub g} ∼3.3 eV at 300 K) and large exciton binding energy (60 MeV). Its applications include UV light emitters, varistors, surface acoustic wave devices, piezoelectric transducers, and chemical and gas sensing. Rare-earth activation of phosphors has long been seen as an effective process since coupling energy into the rare-earth-ion site, either by ionization, charge exchange or a resonance energy process, results in light production. It is reported that Europium modifies the response thermoluminescence (Tl) for pure zinc oxide, when is irradiated with X-ray, created a peak at 365 degrees C. In this work, Zn O:Eu phosphors were synthesized by a chemical method. Some samples were exposed to beta particle irradiation for doses ranging from 1 up to 100 Gy. Tl response as a function of dose is linear throughout the studied dose range. The glow curve exhibits three maxima, centered at 176, 279 and 340 degrees C. The reusability studies obtained after ten repeated cycles of annealing irradiation readout for the Zn O:Eu shows that the variation in the Tl response is ten percent and tends to stabilization. The results indicate that these new Zn O:Eu phosphors are promising detectors and dosimeters for beta radiation. The structural and morphological characterization was carried out by X-ray diffraction and scanning electron microscopy, respectively. (Author)

  16. Band structures in near spherical 138Ce

    Science.gov (United States)

    Bhattacharjee, T.; Chanda, S.; Bhattacharyya, S.; Basu, S. K.; Bhowmik, R. K.; Das, J. J.; Pramanik, U. Datta; Ghugre, S. S.; Madhavan, N.; Mukherjee, A.; Mukherjee, G.; Muralithar, S.; Singh, R. P.

    2009-06-01

    The high spin states of N=80138Ce have been populated in the fusion evaporation reaction 130Te( 12C, 4n) 138Ce at E=65 MeV. The γ transitions belonging to various band structures were detected and characterized using an array of five Clover Germanium detectors. The level scheme has been established up to a maximum spin and excitation energy of 23 ℏ and 9511.3 keV, respectively, by including 53 new transitions. The negative parity ΔI=1 band, developed on the 6536.3 keV 15 level, has been conjectured to be a magnetic rotation band following a semiclassical analysis and comparing the systematics of similar bands in the neighboring nuclei. The said band is proposed to have a four quasiparticle configuration of [πgh]⊗[. Other band structures are interpreted in terms of multi-quasiparticle configurations, based on Total Routhian Surface (TRS) calculations. For the low and medium spin states, a shell model calculation using a realistic two body interaction has been performed using the code OXBASH.

  17. A search for long-lived radionuclides produced by fast-neutron irradiations of copper, silver, europium, terbium, and hafnium

    International Nuclear Information System (INIS)

    Meadows, J.W.; Smith, D.L.; Ikeda, Y.; Konno, C.

    1990-01-01

    Identical sample packets, each containing samples of elemental copper, silver, europium, terbium, and hafnium, as well as titanium, iron and nickel as dosimeters, have been irradiated in three distinct accelerator neutron fields (at Argonne National Laboratory and Los Alamos National Laboratory in the U.S.A., and Japan Atomic Energy Research Institute, Tokai, Japan) as part of an interlaboratory research collaboration to search for the production of long-lived radionuclides for fusion waste disposal applications. This paper is a progress report on this project. To date, we have detected the following activities, and have obtained preliminary experimental cross section values for several of these: Ag-106m,108m,110m; Eu-150m,152g,154; Tb-158,160; and Hf-175,178m2,179m2,181. (author). 11 refs, 1 fig., 4 tabs

  18. The effect of organics on the sorption of strontium, caesium, iodine, neptunium, uranium and europium by glacial sand

    International Nuclear Information System (INIS)

    Haigh, D.; Higgo, J.J.W.; Williams, G.M.; Hooker, P.J.; Ross, C.A.M.; Falck, W.E.; Allen, M.A.; Warwick, P.

    1991-01-01

    This study has been undertaken within the Commission of the European Communities MIRAGE II program on the determination of radionuclides in the geosphere. Preliminary batch sorption experiments have been carried out to study the behaviour of strontium, caesium, iodine, europium and uranium in a glacial sand-groundwater system. The effect of (i) the presence or absence of natural organic material and (ii) the addition of increasing quantities of EDTA or acetate on the distribution ratios was determined. In some cases speciation modelling was used as an aid to designing the experiments and interpreting the results. The aim of this work was to select suitable tracers for use in field experiments at Drigg. Cumbria and the results are intended to aid the design of future experiments rather than to provide a complete analysis of the radionuclide-organic interactions. 11 tabs., 49 refs

  19. Photoluminescent behaviors of several kinds of europium ternary complexes doped in PMMA

    International Nuclear Information System (INIS)

    Liu, H.-G.; Lee, Yong-Ill; Park, Seongtae; Jang, Kiwan; Kim, Sang Su

    2004-01-01

    Four kinds of europium ternary complexes; Eu(DBM) 3 phen, Eu(DBM) 3 (DB-bpy), Eu(DBM) 3 (DN-bpy) and Eu(DBM) 3 biq (DBM, phen, DB-bpy, DN-bpy and biq refer to Dibenzoylmethane, 1,10-phenanthroline, 4,4'-Di-tert-butyl-2,2'-dipyridyl, 4,4'-Dinonyl-2,2'-dipyridyl and 2,2'-Biquinoline, respectively), were doped in poly(methyl methacrylate) (PMMA) matrix. The luminescence properties of the composites were investigated by emission spectroscopy and lifetime measurements. It was found that the composites formed by the three complexes, Eu(DBM) 3 phen, Eu(DBM) 3 (DB-bpy), and Eu(DBM) 3 (DN-bpy), exhibit strong luminescence and similar emission spectral characteristics to Eu(III). Whereas, Eu(DBM) 3 biq shows large differences in its luminescence spectrum compared to those of other complexes. The luminescence was very weak and broad. The emission spectral features of Eu(III) in the Eu(DBM) 3 biq/PMMA systems change with the molar ratios of the complex and PMMA. The lifetime of 5 D 0 level of Eu(III) in Eu(DBM) 3 biq/PMMA systems is shorter than those in the other systems. The luminescence intensity of Eu(III) in Eu(DBM) 3 biq/PMMA systems decreases gradually when exposed to UV-light while the broad emission band becomes stronger

  20. Effects of europium polyoxometalate encapsulated in silica nanoparticles (nanocarriers) in soil invertebrates

    Energy Technology Data Exchange (ETDEWEB)

    Bicho, Rita C., E-mail: ritabicho@ua.pt; Soares, Amadeu M.V.M. [Universidade de Aveiro, Departamento de Biologia & CESAM (Portugal); Nogueira, Helena I.S. [Universidade de Aveiro, Departamento de Química & CICECO (Portugal); Amorim, Mónica J.B. [Universidade de Aveiro, Departamento de Biologia & CESAM (Portugal)

    2016-12-15

    Polyoxometalates (POMs) are metal oxo clusters that have been investigated for several applications in material sciences, catalysis, and biomedicine; these gained increasing interest in the field of nanotechnology as nanocarriers for drug delivery. Associated to the increasing applications, there is the need for information regarding the effects on the environment of these compounds, which is completely absent in the literature. In the present study, the effects of europium polyoxometalates encapsulated into silica nanoparticles (Eu-POM/SiO{sub 2} NPs) were assessed on the soil representative Enchytraeus crypticus. The individual materials were also assessed (Eu-POMs and SiO{sub 2} NPs). Toxicity was evaluated in various test media with increasing complexity: water, soil/water extracts, and soil. Toxicity was only observed for Eu-POM/SiO{sub 2} NPs and in the presence of soil components. Despite the fact that effects were observed for concentrations higher than current predicted environmental concentration (PEC), attention should be given to the growing use of these compounds. The present study shows the importance of assessing the effects in soil media, also compared to water. Moreover, results of “no effect” are critically needed and often unpublished. The present study can contribute to the improvement of the OECD guidelines for safety of manufactured nanomaterials on environmental toxicity in the soil compartment providing an improved test alternative.

  1. Effects of europium polyoxometalate encapsulated in silica nanoparticles (nanocarriers) in soil invertebrates

    International Nuclear Information System (INIS)

    Bicho, Rita C.; Soares, Amadeu M.V.M.; Nogueira, Helena I.S.; Amorim, Mónica J.B.

    2016-01-01

    Polyoxometalates (POMs) are metal oxo clusters that have been investigated for several applications in material sciences, catalysis, and biomedicine; these gained increasing interest in the field of nanotechnology as nanocarriers for drug delivery. Associated to the increasing applications, there is the need for information regarding the effects on the environment of these compounds, which is completely absent in the literature. In the present study, the effects of europium polyoxometalates encapsulated into silica nanoparticles (Eu-POM/SiO 2 NPs) were assessed on the soil representative Enchytraeus crypticus. The individual materials were also assessed (Eu-POMs and SiO 2 NPs). Toxicity was evaluated in various test media with increasing complexity: water, soil/water extracts, and soil. Toxicity was only observed for Eu-POM/SiO 2 NPs and in the presence of soil components. Despite the fact that effects were observed for concentrations higher than current predicted environmental concentration (PEC), attention should be given to the growing use of these compounds. The present study shows the importance of assessing the effects in soil media, also compared to water. Moreover, results of “no effect” are critically needed and often unpublished. The present study can contribute to the improvement of the OECD guidelines for safety of manufactured nanomaterials on environmental toxicity in the soil compartment providing an improved test alternative.

  2. Sol-gel approach to the novel organic-inorganic hybrid composite films with ternary europium complex covalently bonded with silica matrix

    International Nuclear Information System (INIS)

    Dong Dewen; Yang Yongsheng; Jiang Bingzheng

    2006-01-01

    Novel organic-inorganic hybrid composite films with ternary lanthanide complex covalently bonded with silica matrix were prepared in situ via co-ordination of N-(3-propyltriethoxysilane)-4-carboxyphthalimide (TAT) and 1,10-phenanthroline (Phen) with europium ion (Eu 3+ ) during a sol-gel approach and characterized by the means of spectrofluorimeter, phosphorimeter and infrared spectrophotometer (FTIR). The resulting transparent films showed improved photophysical properties, i.e. increased luminescence intensity and longer luminescence lifetime, compared with the corresponding binary composite films without Phen. All the results revealed that the intense luminescence of the composite film was attributed to the efficient energy transfer from ligands, especially Phen, to chelated Eu 3+ and the reduced non-radiation through the rigid silica matrix and 'site isolation'

  3. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss; Estudio de las interacciones de protones de 13,8 geV/c con los nucleos pesados de emusiones

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Aleixandre, J L

    1967-07-01

    145 stars with N{sub h}>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c {pi}- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs.

  4. Synthesis and characterization of phosphors based on calcium and magnesium silicates doped with europium and dysprosium

    International Nuclear Information System (INIS)

    Misso, Agatha Matos

    2016-01-01

    Ca and Mg silicates based phosphors were prepared by sol-gel method combined with the molten salts process. The gel of silica was obtained from Na 2 SiO 3 solution by using europium, dysprosium, calcium and magnesium chloride solutions. Therefore, those chlorides were homogeneously dispersed into the gel. The obtained gel was dried and heat treated to 900° C for 1h to allow the fusion of the present salts. Then it was water washed until negative test for Cl - , and dried. The reduction of the europium to Eu 2+ was performed under atmosphere of 5% of H 2 and 95% of Ar to 900° C for 3h, to reach CaMgSi 2 O 6 :Eu 2+ and CaMgSi 2 O 6 :Eu 2+ :Dy 3+ phosphors. Diopside was identified as main crystalline phase and quartz, as secondary phase from XRD (X-ray diffraction) patterns. SEM (scanning electron microscopy) micrographs, of the samples showed needles, spheres, leaves and rods of particles and agglomerates. Thermal analysis (TGA-DTGA) curves revealed that the crystallization temperature of CaMgSi 2 O 6 :Eu 2+ lies around 765° C. Photoluminescence spectroscopy of the phosphors was studied based on interconfigurational 4f N → 4f N-1 5d transition of Eu 2+ ion. The spectra of excitation showed 4f N → 4f N-1 5d transition of Eu 2+ ion broad band, related to the ligand to metal charge transfer transition (LMCT) O 2- (2p) → Eu 3+ in the 250 nm region, when the emission is monitored at 583,5 nm. It also presents the 4f ↔ 4f transitions of Eu 3+ ion bands, showing the 7 F 0 → 5 L 6 transition at 393 nm. From emission spectra with excitation monitored at 393 nm, it can be observed fine peaks between 570 and 750 nm which are characteristics of 5 D 0 → 7 F J (J = 0 - 5) transition of Eu 3+ ion, indicating that the Eu 3+ ion occupies a site with center of inversion. Finally, the obtained results indicate that the developed method is suitable to synthesize CaMgSi 2 O 6 :Eu 2+ and CaMgSi 2 O 6 :Eu 2+ :Dy 3+ phosphors, as it has been proposed. (author)

  5. 28 CFR 0.138 - Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco...

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco, Firearms, and Explosives, Bureau of Prisons, Federal... Administrative Matters § 0.138 Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of...

  6. TGFβ1-induced down-regulation of microRNA-138 contributes to epithelial-mesenchymal transition in primary lung cancer cells.

    Science.gov (United States)

    Zhang, Fang; Li, Tiepeng; Han, Lu; Qin, Peng; Wu, Zhao; Xu, Benling; Gao, Quanli; Song, Yongping

    2018-02-19

    The existence of cancer stem cells within the tumor could lead to cancer therapy resistance. TGFβ1 is considered as one of the most powerful players in the generation of CSCs through induction of epithelial-mesenchymal transition in different types of cancer including lung cancer, however, the detailed mechanisms by which TGFβ1 contribute to EMT induction and CSC maintenance remains unclear. Here, we showed primary lung cancer cells treated by TGFβ1 exhibit mesenchymal features, including morphology and expression of mesenchymal marker in a time-dependent manner. We also observed long-term TGFβ1 exposure leads to an enrichment of a sub-population of CD44 + CD90 + cells which represent CSCs in lung cancer cells. Moreover, the differential expression microRNAs between CSCs and non-CSCs were identified using next-generation sequencing to screen key miRNAs which might contribute to TGFβ1-induced EMT and CSCs generation. Among those differentially expressed miRNAs, the expression of microRNA-138 was time-dependently down-regulated by TGFβ1 treatment. We further demonstrated primary lung cancer cells, in which we knockdown the expression of miR-138, exhibit mesenchymal phenotypes and stem cell properties. Taken together, these findings indicate TGFβ1-induced down-regulation of microRNA-138 contributes to EMT in primary lung cancer cells, and suggest that miR-138 might serve as a potential therapeutic target. Copyright © 2018 Elsevier Inc. All rights reserved.

  7. Damage recovery and optical activity in europium implanted wide gap oxides

    International Nuclear Information System (INIS)

    Alves, E.; Marques, C.; Franco, N.; Alves, L.C.; Peres, M.; Soares, M.J.; Monteiro, T.

    2010-01-01

    In this study we compare and discuss the defects and optical behaviour of sapphire and magnesium oxide single crystals implanted at room temperature with different fluences (1 x 10 15 -1 x 10 16 cm -2 ) of europium ions. Rutherford backscattering channelling shows that for fluences above 5 x 10 15 cm -2 the surface disorder level in the Al-sublattice reaches the random level. Implantation damage recovers fast for annealing in oxidizing atmosphere but even for the highest fluence we recover almost completely all the damage after annealing at 1300 o C, independently of the annealing environment (reducing or oxidizing). Annealing above 1000 o C promotes the formation of Eu 2 O 3 in the samples with higher concentration of Eu. The optical activation of the rare earth ions at room temperature was observed after annealing at 800 o C by photoluminescence and ionoluminescence. In Al 2 O 3 lattice the highest intensity line of the Eu 3+ ions corresponds to the forced electric dipole 5 D 0 → 7 F 2 transition that occurs ∼616 nm. For the MgO samples the Eu 3+ optical activation was also achieved after implantation with different fluences. Here, the lanthanide recombination is dominated by the magnetic dipole 5 D 0 → 7 F 1 transition near by 590 nm commonly observed for samples were Eu 3+ is placed in a high symmetry local site. The results clearly demonstrate the possibility to get Eu incorporated in optical active regular lattice sites in wide gap oxides.

  8. Natural radioactive nuclides 138La and 176Lu in rare earth ore samples

    International Nuclear Information System (INIS)

    Zhang Weiping; Shen Jianfeng; Lu Zhaolun; Jiang Rangrong

    1993-01-01

    The contents of 1 '3 8 La and 176 Lu in some rare earth mines have been measured with a HPGE γ spectrometer. The measurements show that the contents of 138 La and 176 Lu in one rare earth mine are remarkably different from those in the other and they do not display a proportional relation, and that the contents of 40 K in this mine are very low

  9. Europium(III) complex-functionalized magnetic nanoparticle as a chemosensor for ultrasensitive detection and removal of copper(II) from aqueous solution.

    Science.gov (United States)

    Liu, Jing; Zuo, Wei; Zhang, Wei; Liu, Jian; Wang, Zhiyi; Yang, Zhengyin; Wang, Baodui

    2014-10-07

    Ultrasensitive, accurate detection and separation of heavy metal ions is very important in environmental monitoring and biological detection. In this paper, a highly sensitive and specific detection method for Cu(2+) based on the fluorescence quenching of a europium(III) hybrid magnetic nanoprobe is presented. This nanoprobe can detect Cu(2+) over a wide pH range (5.0-10.0) with a detection limit as low as 0.1 nM and it can be used for detecting Cu(2+) in living cells. After the magnetic separation, the Cu(2+) concentration decreased to 1.18 ppm, which is less than the US EPA drinking water standard (1.3 ppm), and more than 70% Cu(2+) could be removed when the amount of nanocomposite 1 reached 1 mg.

  10. Synthesis of red fluorescent graphene quantum dot-europium complex composites as a viable bio imaging platform

    International Nuclear Information System (INIS)

    Liu, Yanting; Fan, Louzhen; Zhou, Shixin; Fan, Hong

    2016-01-01

    We have prepared graphene quantum dot-europium(III) complex composites by noncovalently connecting chelating ligands dibenzoylmethane (DBM) and 1,10-phenanthroline (Phen) with graphene quantum dots (GQDs) first, followed by coordination to Eu(III). The resulting composites are well water-soluble and display red fluorescence of high color purity. The composites were characterized by transmission electron microscopy, X-ray photoelectron spectroscopy and X-ray diffraction. Aqueous solutions of the composites under 365 nm excitation display fluorescence with a peak at 613 nm and a quantum yield as high as 15.5 %. The good water solubility and stable photoluminescence make the composites very different from other Eu(III)-based coordination complexes. The composites are cell viable and can be used to label both the cell membrane and the cytoplasm of MCF-7 cells. They are also shown to act as bioprobes for in-vivo localization of tumorous tissue. In our perception, such composites are expected to possess wide scope because of the many functionalizations that are possible with GQDs. (author)

  11. A functional screen implicates microRNA-138-dependent regulation of the depalmitoylation enzyme APT1 in dendritic spine morphogenesis

    DEFF Research Database (Denmark)

    Siegel, Gabriele; Obernosterer, Gregor; Fiore, Roberto

    2009-01-01

    of acyl protein thioesterase 1 (APT1), an enzyme regulating the palmitoylation status of proteins that are known to function at the synapse, including the alpha(13) subunits of G proteins (Galpha(13)). RNA-interference-mediated knockdown of APT1 and the expression of membrane-localized Galpha(13) both...... suppress spine enlargement caused by inhibition of miR-138, suggesting that APT1-regulated depalmitoylation of Galpha(13) might be an important downstream event of miR-138 function. Our results uncover a previously unknown miRNA-dependent mechanism in neurons and demonstrate a previously unrecognized...

  12. 340nm UV LED excitation in time-resolved fluorescence system for europium-based immunoassays detection

    Science.gov (United States)

    Rodenko, Olga; Fodgaard, Henrik; Tidemand-Lichtenberg, Peter; Pedersen, Christian

    2017-02-01

    In immunoassay analyzers for in-vitro diagnostics, Xenon flash lamps have been widely used as excitation light sources. Recent advancements in UV LED technology and its advantages over the flash lamps such as smaller footprint, better wall-plug efficiency, narrow emission spectrum, and no significant afterglow, have made them attractive light sources for gated detection systems. In this paper, we report on the implementation of a 340 nm UV LED based time-resolved fluorescence system based on europium chelate as a fluorescent marker. The system performance was tested with the immunoassay based on the cardiac marker, TnI. The same signal-to-noise ratio as for the flash lamp based system was obtained, operating the LED below specified maximum current. The background counts of the system and its main contributors were measured and analyzed. The background of the system of the LED based unit was improved by 39% compared to that of the Xenon flash lamp based unit, due to the LEDs narrower emission spectrum and longer pulse width. Key parameters of the LED system are discussed to further optimize the signal-to-noise ratio and signal-to-background, and hence the sensitivity of the instrument.

  13. Simultaneous analysis of free and humic acid complexed europium and gadolinium species by CE-ICP-MS

    International Nuclear Information System (INIS)

    Kautenburger, R.; Nowotka, K.; Beck, H.P.

    2005-01-01

    Full text of publication follows: For the long-term safety assessment of waste repositories, detailed information about geo-chemical behaviour of radioactive and toxic metal ions under environmental conditions (geological matrix and aquifer systems) is necessary. It includes knowledge about the mechanism of relevant geochemical reactions, as well as thermodynamic and kinetic data. Several previous studies have shown that humic acid can play an important role in the immobilisation or mobilization of metal ions due to complexation and colloid formation. In this project we investigate the complexation behaviour of humic acid (purified Aldrich humic acid) and its influence on the migration of the lanthanides europium and gadolinium (homologues of the actinides americium and curium) in the the ternary system consisting of these heavy metals, humic acid and kaolinite (KGa-1b) as geological model system under conditions close to nature. Capillary electrophoresis (CE, Beckman Coulter P/ACE MDQ), with its excellent separation performance, was coupled to Inductively Coupled Plasma Mass Spectrometry (ICP-MS, VG Elemental Plasma Quad 3) to obtain a high sensitivity for the determination of the rare earth elements europium (Eu 3+ ) and gadolinium (Gd 3+ ) and their complexes with humic acid. Additionally, the used humic acid was halogenated with iodine as ICP-MS marker. A fused-silica capillary was flexibly fitted into a MicroMist 50 μl nebulizer with a Cinnabar cyclonic spray chamber. The chamber was chilled to a temperature of 4 deg. C for best sensitivity. 200 ppb of caesium were added to the CE separation buffer to observe the capillary flow. A make-up fluid including 4 ppb Ho as an internal standard was combined with the flow from the capillary within the interface to obtain a fluid throughput high enough to maintain a continuous nebulization. Very low detection limits were achieved, 100 ppt for 153 Eu and 125 ppt for 158 Gd. With this optimized CE-ICP-MS coupling

  14. Influence of a low calcium and phosphorus diet on the anabolic effect of human parathyroid hormone (1-38) in female rats

    DEFF Research Database (Denmark)

    Steiner, P.D.; Forrer, R.; Kneissel, Michaela

    2001-01-01

    Parathyroid hormone (PTH) or synthetic N-terminal PTH fragments administered intermittently have been established as anabolic agents in animal and human bones. In the present study, the influence of a low calcium diet on the anabolic effect of human PTH(1-38) [hPTH(1-38)] was investigated. Forty......-eight 10-week-old female Sprague-Dawley rats were randomly assigned to a diet with a low calcium content (LCa) or a diet with the recommended amount of calcium (RCa). After an adaptation period of 15 days, the rats were randomly assigned to hPTH(1-38) treatment (+LCa/+RCa) or vehicle only (-LCa....../-RCa) for an additional 14 days. Total bone mineral density (BMD) values of several bones were determined using quantitative computed tomography and from ratios of ash weight to volume. Biomechanical competence of the fourth lumbar vertebrae and of the right femora was assessed. An anabolic effect could be detected...

  15. Promiscuity of MCMV immunoevasin of NKG2D: m138/fcr-1 down-modulates RAE-1epsilon in addition to MULT-1 and H60.

    Science.gov (United States)

    Arapović, Jurica; Lenac Rovis, Tihana; Reddy, Anil Butchi; Krmpotić, Astrid; Jonjić, Stipan

    2009-11-01

    Both human and mouse cytomegalovirus (CMV) encode proteins that inhibit the activation of NK cells by down-regulating the cellular ligands for activating NK cell receptor, NKG2D. MCMV proteins m145, m152 and m155 interfere with the expression of all known NKG2D ligands, MULT-1, RAE-1 family members and H60, respectively, whereas m138 affects the expression of MULT-1 and H60. Here we show that m152 affects the maturation of newly synthesized RAE-1 molecules, but is not sufficient to prevent surface expression of RAE-1varepsilon. We have identified m138 as a main inhibitor of the surface expression of RAE-1varepsilon. In contrast to m152, m138 affects the surface-resident protein leading to its endocytosis, which can be prevented by a dynamin inhibitor. Moreover, we demonstrated that m138 does not need other viral proteins to down-modulate the expression of RAE-1varepsilon.

  16. Propuesta del programaS-GeMS para el análisis estadístico espacial de fallas en alimentadores soterrados de 13,8 kV; PropodedS-GEMS program for statistical analysis of failure space of 13.8 kV underground feeders

    Directory of Open Access Journals (Sweden)

    Boris Alba Valle

    2011-06-01

    Full Text Available Actualmente, el sistema soterrado de Ciudad de La Habana, carece de herramientas gráficas de trabajo con lascuales poder visualizar zonas con alta incidencia de fallas en alimentadores de 13,8 kV y que permitan tomardecisiones certeras en cuanto a los tramos de alimentadores a reparar o sustituir por su deterioro. En este trabajo sepropone el uso de los programas S-GeMS (Stanford Geostatistical Modeling Software y Autocad comoherramientas para el análisis estadístico espacial de la cantidad de fallas. Se realiza, en lo fundamental, el estudiode toda la documentación referente a las aplicaciones del programa S-GeMS y la Base de Datos de la cantidad defallas del 2007 al 2009, de los alimentadores de 13,8 kV perteneciente a la Unidad Empresarial Básica (UEBSoterrada. Finalmente se muestran, a modo de ejemplo, los resultados obtenidos con su aplicación al determinarsela dirección preferencial de distribución de la cantidad de fallas.   Nowadays, the Havana City underground system, lacks of graphical working tools which not only allow to visualizehigh faults incidence areas in 13,8 kV feeders but also make good decisions in reference to the feeder sections to berepaired or substituted due to their impairment. The use of S-GeMS (Stanford Geostatistical Modeling Software andAutocad programs as tools for the spatial statistic analysis of faults quantity is proposed in this article. The study ofthe whole documentation related to the S-GeMS program applications is carried out as well as the UndergroundManagement Basic Unit (UEB 13,8 kV feeders faults quantity database from 2007 to 2009. Finally, the results afterdetermining the faults quantity distribution preferential address with the program application are shown, as anexample.

  17. Propuesta del programa S-GeMS para el análisis estadístico espacial de fallas en alimentadores soterrados de 13,8 kV;PropodedS-GEMS program for statistical analysis of failure space of 13.8 kV underground feeders

    Directory of Open Access Journals (Sweden)

    Boris Alba - Valle

    2011-06-01

    Full Text Available Actualmente, el sistema soterrado de Ciudad de La Habana, carece de herramientas gráficas de trabajo con lascuales poder visualizar zonas con alta incidencia de fallas en alimentadores de 13,8 kV y que permitan tomardecisiones certeras en cuanto a los tramos de alimentadores a reparar o sustituir por su deterioro. En este trabajo sepropone el uso de los programas S-GeMS (Stanford Geostatistical Modeling Software y Autocad comoherramientas para el análisis estadístico espacial de la cantidad de fallas. Se realiza, en lo fundamental, el estudiode toda la documentación referente a las aplicaciones del programa S-GeMS y la Base de Datos de la cantidad defallas del 2007 al 2009, de los alimentadores de 13,8 kV perteneciente a la Unidad Empresarial Básica (UEBSoterrada. Finalmente se muestran, a modo de ejemplo, los resultados obtenidos con su aplicación al determinarsela dirección preferencial de distribución de la cantidad de fallas.Nowadays, the Havana City underground system, lacks of graphical working tools which not only allow to visualizehigh faults incidence areas in 13,8 kV feeders but also make good decisions in reference to the feeder sections to berepaired or substituted due to their impairment. The use of S-GeMS (Stanford Geostatistical Modeling Software andAutocad programs as tools for the spatial statistic analysis of faults quantity is proposed in this article. The study ofthe whole documentation related to the S-GeMS program applications is carried out as well as the UndergroundManagement Basic Unit (UEB 13,8 kV feeders faults quantity database from 2007 to 2009. Finally, the results afterdetermining the faults quantity distribution preferential address with the program application are shown, as anexample.

  18. Free radical scavenging activity and neuroprotective potentials of D138, one Cu(II)/Zn(II) Schiff-base complex derived from N,N'-bis(2-hydroxynaphthylmethylidene)-1,3-propanediamine.

    Science.gov (United States)

    Wang, Che; Cai, Zheng-Xu; You, Zhong-Lu; Guo, Hui-Shu; Shang, De-Jing; Wang, Xiao-Ling; Zhang, Liang; Ma, Li-Jie; Tan, Jun; Le, Wei-Dong; Li, Song

    2014-09-01

    There is increasing evidence that free radicals play an important role in neuronal damages induced by diabetes mellitus or cerebral ischemia insults. Antioxidants with free radical scavenging activities have been shown to be beneficial and neuroprotective for these pathological conditions. Here, we report free radical scavenging activity and neuroprotective potential of D138, one copper(II)/zinc(II) Schiff-base complex derived from N,N'-2(2-hydroxynaphthylmethylidene)-1,3-propanediamine. The data from three in vitro assays, 2,2-diphenyl-1-picrylhydrazyl assay, nitro blue tetrazolium assay and hydroxyl radical scavenging assay, indicated that D138 presented a potent free radical scavenging activity. The neuroprotective and antioxidative effects of D138 were further evaluated in vivo using bilateral common carotid artery occlusion (BCCAO) mouse model and streptozotocin (STZ) diabetic mouse model. Our results indicated that treatment of D138 significantly ameliorated the hippocampal neuronal damage and the oxidative stress levels in these animal models. Moreover, D138 also reversed the behavioral deficiencies induced by BCCAO or STZ, as assessed by Y-maze test and fear conditioning test. In conclusion, all these findings support that D138 exerts free radical scavenging and neuroprotective activities and has the potentials to be a potent therapeutic candidate for brain oxidative damage induced by cerebral ischemia or diabetes mellitus.

  19. Two ternary mixed-anion chlorides with divalent europium: Eu{sub 2}H{sub 3}Cl and Eu{sub 7}F{sub 12}Cl{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Reckeweg, Olaf [Baker Laboratory, Department of Chemistry and Chemical Biology, Cornell University, Ithaca, NY 14853-1301 (United States); Institut fuer Anorganische Chemie, Universitaet Stuttgart, Pfaffenwaldring 55, 70569 Stuttgart (Germany); DiSalvo, Francis J. [Baker Laboratory, Department of Chemistry and Chemical Biology, Cornell University, Ithaca, NY 14853-1301 (United States); Wolf, Sarah; Schleid, Thomas [Institut fuer Anorganische Chemie, Universitaet Stuttgart, Pfaffenwaldring 55, 70569 Stuttgart (Germany)

    2014-06-15

    Dark ruby-red, transparent, triangular plate-shaped single crystals of Eu{sub 2}H{sub 3}Cl and colorless, transparent, needle-shaped single crystals of Eu{sub 7}F{sub 12}Cl{sub 2} were obtained by solid-state reactions of Eu, NaH, NaCl, and Na (2:4:1:2 molar ratio) or Eu, EuCl{sub 3}, and LiF (1:1:4 molar ratio), respectively, in silica-jacketed tantalum ampoules at 900 C for 13 h. Eu{sub 2}H{sub 3}Cl crystallizes isotypically to Ba{sub 2}H{sub 3}X (X = Cl, Br, I) in the trigonal space group P anti 3m1 (no. 164) with lattice parameters a = 409.67(4) and c = 696.18(7) pm, whereas Eu{sub 7}F{sub 12}Cl{sub 2} crystallizes isotypically to Ba{sub 7}F{sub 12}Cl{sub 2} or Sr{sub 7}H{sub 12}Cl{sub 2} in the hexagonal space group P anti 6 (no. 174) with lattice parameters a = 1002.31(5) and c = 392.54(2) pm. Both compounds contain Eu{sup 2+} cations with coordination numbers as high as nine (Eu{sub 7}F{sub 12}Cl{sub 2}) and ten (Eu{sub 2}H{sub 3}Cl) with respect to the halide anions (F{sup -} or H{sup -} and Cl{sup -}). The structural results are corroborated by EUTAX and MAPLE calculations on both ternary mixed-anion europium(II) chlorides in comparison to these for related binary and ternary compounds with divalent europium. (Copyright copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. Fluorimetric study of the interaction between nicotinamide adenine dinucleotide phosphate and tetracycline-europium complex and its application

    International Nuclear Information System (INIS)

    Peng Qian; Hou Faju; Ge Xiaoxia; Jiang Chongqiu; Gong Shubo

    2005-01-01

    A new spectrofluorimetric method was developed for the determination of trace amount of nicotinamide adenine dinucleotide phosphate (NADP). Using europium (Eu 3+ )-tetracycline (TC) complex as a fluorescent probe, in the buffer solution of pH 7.60. NADP can remarkably enhance the fluorescence intensity of the Eu 3+ -TC complex at λ = 612 nm and the enhanced fluorescence intensity of Eu 3+ ion is in proportion to the concentration of NADP. Optimum conditions for the determination of NADP were also investigated. The dynamic range for the determination of NADP is 4.4 x 10 -7 to 2.2 x 10 -6 mol l -1 with detection limit of 6.9 x 10 -8 mol l -1 . This method is simple, practical and relatively free interference from coexisting substances and can be successfully applied to determination of NADP in synthetic water samples and in serum samples. Moreover, the enhancement mechanisms of the fluorescence intensity in the Eu 3+ -TC system and the Eu 3+ -TC-NADP system have been also discussed

  1. Different photoluminescent properties of binary and ternary europium chelates doped in PMMA

    International Nuclear Information System (INIS)

    Liu Hongguo; Park, Seongtae; Jang, Kiwan; Zhang Wansong; Seo, Hyo-Jin; Lee, Yong-Ill

    2003-01-01

    Two kinds of europium-β-diketone chelates, binary Eu(DBM) 3 and ternary Eu(DBM) 3 phen were doped in poly(methyl methacrylate) (PMMA). These chelates show very different photoluminescent (PL) behaviors: the hypersensitive 5 D 0 → 7 F 2 emission bands of Eu(DBM) 3 phen change slightly with the molar ratios, while those of Eu(DBM) 3 change obviously and regularly with the molar ratios. The results of the luminescent lifetimes of 5 D 0 levels show that the binary chelate exists as two kinds of species in the doped systems, and the lifetimes and contents of each species change with the molar ratios, while the ternary chelate exists as one kind of species in the doped systems. X-ray diffraction (XRD) patterns of the binary chelate doped systems give some diffraction peaks that are different from those of pure chelate and change with the molar ratios, indicating new kinds of crystal structures formed, and consequently, the first coordination sphere of Eu 3+ ion changes; while those of the ternary chelate doped systems just show amorphous diffraction halos of the host, indicating that the ternary chelate exist in an amorphous state and disperse well in the host. The FTIR spectra of PMMA also change gradually with increasing the molar ratios of the doped two kinds of chelates, and the XRD patterns show that the amorphous halos of PMMA in the doped systems are different from those of pure PMMA and change with the molar ratios, too, suggesting the interaction between the guest and the host

  2. Chemical Abundances of M-Dwarfs from the Apogee Survey. I. The Exoplanet Hosting Stars Kepler-138 and Kepler-186

    Energy Technology Data Exchange (ETDEWEB)

    Souto, D.; Cunha, K. [Observatório Nacional, Rua General José Cristino, 77, 20921-400 São Cristóvão, Rio de Janeiro, RJ (Brazil); García-Hernández, D. A.; Zamora, O.; Prieto, C. Allende; Jönsson, H.; Pérez, A. E. García [Instituto de Astrofísica de Canarias (IAC), Vía Lactea S/N, E-38205, La Laguna, Tenerife (Spain); Smith, V. V. [National Optical Astronomy Observatory, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Mahadevan, S. [Department of Astronomy and Astrophysics, The Pennsylvania State University (United States); Blake, C. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Johnson, J. A.; Pinsonneault, M. [Department of Astronomy, The Ohio State University, Columbus, OH 43210 (United States); Holtzman, J. [New Mexico State University, Las Cruces, NM 88003 (United States); Majewski, S. R.; Sobeck, J. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904-4325 (United States); Shetrone, M. [University of Texas at Austin, McDonald Observatory (United States); Teske, J. [Department of Terrestrial Magnetism, Carnegie Institution for Science, Washington, DC 20015 (United States); Nidever, D. [Department of Astronomy, University of Michigan, Ann Arbor, MI, 48104 (United States); Schiavon, R. [Astrophysics Research Institute, Liverpool John Moores University, 146 Brownlow Hill, Liverpool, L3 5RF (United Kingdom); and others

    2017-02-01

    We report the first detailed chemical abundance analysis of the exoplanet-hosting M-dwarf stars Kepler-138 and Kepler-186 from the analysis of high-resolution ( R ∼ 22,500) H -band spectra from the SDSS-IV–APOGEE survey. Chemical abundances of 13 elements—C, O, Na, Mg, Al, Si, K, Ca, Ti, V, Cr, Mn, and Fe—are extracted from the APOGEE spectra of these early M-dwarfs via spectrum syntheses computed with an improved line list that takes into account H{sub 2}O and FeH lines. This paper demonstrates that APOGEE spectra can be analyzed to determine detailed chemical compositions of M-dwarfs. Both exoplanet-hosting M-dwarfs display modest sub-solar metallicities: [Fe/H]{sub Kepler-138} = −0.09 ± 0.09 dex and [Fe/H]{sub Kepler-186} = −0.08 ± 0.10 dex. The measured metallicities resulting from this high-resolution analysis are found to be higher by ∼0.1–0.2 dex than previous estimates from lower-resolution spectra. The C/O ratios obtained for the two planet-hosting stars are near-solar, with values of 0.55±0.10 for Kepler-138 and 0.52±0.12 for Kepler-186. Kepler-186 exhibits a marginally enhanced [Si/Fe] ratio.

  3. Effects of added dopants on various triboluminescent properties of europium dibenzoylmethide triethylammonium (EuD4TEA)

    Science.gov (United States)

    Owens, Constance; Fontenot, Ross S.; Bhat, Kamala N.; Aggarwal, Mohan D.

    2014-03-01

    A triboluminescent (TL) material is one that emits light upon pressure, impact, friction, or mechanical shock. TL materials are desirable for investigation because they have the potential to be used as the active element for smart impact sensors. While the material europium dibenzoylmethide triethylammonium (EuD4TEA) produces a TL emission yield that can be observed by the naked eye, it is still not sufficiently bright for use in smart sensor devices. Previous studies have shown that additional materials can be combined with EuD4TEA in order to improve the TL emission yield. In this paper, we discuss the effects of doping on EuD4TEA at different concentrations with a variety of materials on the TL emission yield and decay times. The dopants that were used in this study were nicotine, dibutyl phosphate (DBP), and magnesium. We also discuss both the effects of pH on EuD4TEA, and the doping effects on impact energy. For testing triboluminescent properties, we use a custom-built drop tower that generates triboluminescence by fracturing compounds through impact. Collected data is analyzed using specially written LabVIEW programs.

  4. Temperature effects on the interaction mechanisms between the europium (III) and uranyl ions and zirconium diphosphate

    International Nuclear Information System (INIS)

    Finck, N.

    2006-10-01

    Temperature should remain higher than 25 C in the near field environment of a nuclear waste repository for thousands years. In this context, the aim of this work is to study the temperature influence on the interaction mechanisms between europium (III) and uranyl ions and zirconium diphosphate, as well as the influence of a complexing medium (nitrate) on the sorption of the lanthanide. The experimental definition of the equilibria was achieved by combining a structural investigation with the macroscopic sorption data. Surface complexes were characterized at all temperatures (25 C to 90 C) by TRLFS experiments carried out on dry and in situ samples using an oven. This characterization was completed by XPS experiments carried out at 25 C on samples prepared at 25 C and 90 C. The reaction constants (surface hydration and cations sorption) were obtained by simulating the experimental data with the constant capacitance surface complexation model. The reaction constants temperature dependency allowed one to characterize thermodynamically the different reactions by application of the van't Hoff relation. The validity of this law was tested by performing microcalorimetric measurements of the sorption heat for both cations. (author)

  5. [Clinical analysis of 138 multiple primary cancers diagnosed of digestive system malignant tumor initially].

    Science.gov (United States)

    Lyu, J M; Xiong, H C; Wu, B; Zhou, X Q; Hu, J

    2018-02-23

    Objective: To study the clinical characteristics, strategy of treatment and prognosis of multiple primary cancers(MPC) diagnosed of digestive system malignant tumor firstly. Methods: From January, 2000 to December, 2015, the clinical, follow-up and prognostic data of 138 MPC patients diagnosed of digestive system malignant tumor firstly were retrospectively analyzed. Results: 138 cases were found in 10 580 cases with malignant tumors, and the incidence was 1.30%. There were 129 cases of duplex primary cancers, 8 cases of triple primary cancers and 1 case of quintuple primary cancers. The repetitive primary cancer was occurred in digestive system (61cases, 44.2%) most frequently, with the next in respiratory system (46 cases, 33.3%). 52.2% (72 cases) suffered second primary cancer in 2 years after first primary cancer diagnosed, and 75.4% (104 cases) in 5 years. The median overall survival in patients with all cancer lesions radically treated was 168 months, better than any other treatment (68 months, P digestive system malignant tumor most frequently occurred in the digestive system and respiratory system. More concern should be attracted in follow-up, especially in the first 5 years. The key to improve patient' prognosis was radical treatment to every primary cancer.

  6. Complexation and molecular modeling studies of europium(III)-gallic acid-amino acid complexes.

    Science.gov (United States)

    Taha, Mohamed; Khan, Imran; Coutinho, João A P

    2016-04-01

    With many metal-based drugs extensively used today in the treatment of cancer, attention has focused on the development of new coordination compounds with antitumor activity with europium(III) complexes recently introduced as novel anticancer drugs. The aim of this work is to design new Eu(III) complexes with gallic acid, an antioxida'nt phenolic compound. Gallic acid was chosen because it shows anticancer activity without harming health cells. As antioxidant, it helps to protect human cells against oxidative damage that implicated in DNA damage, cancer, and accelerated cell aging. In this work, the formation of binary and ternary complexes of Eu(III) with gallic acid, primary ligand, and amino acids alanine, leucine, isoleucine, and tryptophan was studied by glass electrode potentiometry in aqueous solution containing 0.1M NaNO3 at (298.2 ± 0.1) K. Their overall stability constants were evaluated and the concentration distributions of the complex species in solution were calculated. The protonation constants of gallic acid and amino acids were also determined at our experimental conditions and compared with those predicted by using conductor-like screening model for realistic solvation (COSMO-RS) model. The geometries of Eu(III)-gallic acid complexes were characterized by the density functional theory (DFT). The spectroscopic UV-visible and photoluminescence measurements are carried out to confirm the formation of Eu(III)-gallic acid complexes in aqueous solutions. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. Influence of organic solvent treatment on elasticoluminescent property of europium-doped strontium aluminates

    International Nuclear Information System (INIS)

    Fujio, Yuki; Xu, Chao-Nan; Terasaki, Nao; Ueno, Naohiro

    2014-01-01

    The influence of an organic solvent treatment on elasticoluminescent (ELS) characteristics of mechanoluminescent (ML) sensor using the composite film consisting of an ELS material and epoxy resin was investigated. We used strontium aluminate doped with a small amount of europium (SrAl 2 O 4 :Eu, SAOE) as an ELS material in this study. After evaluating the ELS characteristics of the fabricated ML sensors using SAOE treated with/without various organic solvents, SAOE treated with methanol and ethanol showed lower ELS intensities than that of untreated SAOE. In contrast, the ELS response curves against strain for the ML sensors using SAOE treated with acetone and toluene, overlapped with that of untreated SAOE. From the characterization of SAOE treated with alcohols, such as methanol and ethanol, we can hypothesize that poor ELS characteristics is due to the degradation of the SAOE grain surfaces by the hydrolyze reaction of SAOE with hydroxyl group of alcohol. Thus, on the basis of the obtained results, we can conclude that the selection of organic solvent used in the preparation of SAOE film is of considerable importance in the development of ML sensor with a highly-reliable ELS characteristic. -- Highlights: • Influence of organic solution treatment on the sensing characteristics of a mechanoluminescent (ML) sensor using SrAl 2 O 4 :Eu has been investigated. • An alcohol treatment of SAOE powder has considerable effect on its ML characteristic. • There is almost no influence of acetone and toluene treatments on ML characteristics

  8. EUROPIUM ION INFLUENCE ON THE FORMATION OF Ag-NANOPARTICLES IN FLUORINE PHOSPHATE GLASSES

    Directory of Open Access Journals (Sweden)

    R. O. Pysh'ev

    2015-05-01

    Full Text Available The paper deals with research of formation characteristics of silver nanoparticles in fluorophosphate glasses 0.25 Na2O - 0.5 P2O5 - 0.10 Ga2O3 - 0.075 AlF3 - 0.025 NaF - 0.05 ZnF2 doped with EuF3 (0.8 and 4 wt.% and without them. The synthesis was carried out in closed glassy carbon crucibles in argon atmosphere. Nanoparticles were formed after a low temperature process of Ag+ → Na+ ion-exchange (320 °C and subsequent heat treatment. It was shown that in the initial glasses doped with EuF3, rare earth ions exist in two valence forms (Eu2+ and Eu3+ in dynamic equilibrium and the concentration of Eu2+ increases proportionally to the total concentration of fluoride. It was shown that sizes of molecular clusters or metal nanoparticles depend on the concentration of europium fluoride and duration of ion exchange. The metallic Ag-nanoparticles sizes were defined for different times of heat treatment and ion exchange. The possibility of the stimulating growth of nanoparticles through the introduction of additional EuF3 in the glass was proved. The possibility of obtaining nanoparticles without the heat treatment in glasses with a high concentration of EuF3 was shown. Chemical mechanism for the formation of Ag-nanoparticles during the ion exchange was suggested.

  9. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP

    OpenAIRE

    Terra, Maurilo Monteiro; Pires, Erasmo José Paioli; Coelho, Sônia Maria Bonilha Marcondes; Passos, Ilene Ribeiro da Silva; Santos, Rui Ribeiro dos; Pommer, Celso Valdevino; Silva, André Camargo Pereira da; Ribeiro, Ivan José Antunes

    1990-01-01

    Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo) de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. T...

  10. CORRELATION OF 48Ca, 50Ti, AND 138La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

    International Nuclear Information System (INIS)

    Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang

    2015-01-01

    Precise determinations of 48 Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive 48 Ca/ 44 Ca anomalies in all analyzed CAIs after normalization to 42 Ca/ 44 Ca, and it is clearly shown that there is no simple correlation between 48 Ca/ 44 Ca and 50 Ti/ 48 Ti anomalies, in agreement with Jungck et al. Compared to the 48 Ca/ 44 Ca versus 50 Ti/ 48 Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated 50 Ti/ 48 Ti. Assuming the 48 Ca/ 44 Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess 50 Ti anomalies in CAIs can be calculated by subtracting the part associated with 48 Ca/ 44 Ca. These excesses show a linear correlation with 138 La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system 48 Ca, 50 Ti, and 138 La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II

  11. Quantitative analysis of T-wave morphology increases confidence in drug-induced cardiac repolarization abnormalities: evidence from the investigational IKr inhibitor Lu 35-138

    DEFF Research Database (Denmark)

    Graff, Claus; Matz, Jørgen; Christensen, Ellen B

    2009-01-01

    prolongation. Seventy-nine healthy subjects were included in this parallel study. After a baseline day during which no drug was given, 40 subjects received an I(Kr)-blocking antipsychotic compound (Lu 35-138) on 7 consecutive days while 39 subjects received placebo. Resting ECGs were recorded and used...... to determine a combined measure of repolarization morphology (morphology combination score [MCS]), based on asymmetry, flatness, and notching. Replicate measurements were used to determine reliable change and study power for both measures. Lu 35-138 increased the QTc interval with corresponding changes in T......-wave morphology as determined by MCS. For subjects taking Lu 35-138, T-wave morphology was a more reliable indicator of I(Kr) inhibition than QTcF (chi(2) = 20.3, P = .001). At 80% study power for identifying a 5-millisecond placebo-adjusted change from baseline for QTcF, the corresponding study power for MCS...

  12. ROOTSTOCKS EFFECTS ON THE PHYSICOCHEMICAL CHARACTERISTICS OF BORDÔ, ISABEL AND IAC 138-22 MÁXIMO MUST AND WINE

    Directory of Open Access Journals (Sweden)

    MARLON JOCIMAR RODRIGUES DA SILVA

    2017-09-01

    Full Text Available ABSTRACT It has been demonstrated that rootstocks can influence grape characteristics, but there are few data in literature about the rootstocks influence in the wine characteristics, especially in wines elaborated with Vitis labrusca or hybrid grapes. This study evaluated the influence of ‘IAC 766’ and ‘106-8 Mgt’ rootstocks on the physicochemical characteristics of ‘Bordô’, ‘Isabel’ and ‘IAC 138-22 ‘Máximo’ musts and wines. The musts were evaluated for pH, soluble solids, total acidity and soluble solids/acidity ratio. The wines were evaluated for density, alcohol content; total, volatile and fixed acidity; pH, dry extract, reducing sugars, reduced dry extract, alcohol in weight/reduced dry extract; free and total sulfur dioxide; anthocyanins, polyphenols index (I 280; polyphenols and total flavonoids and antioxidant activity. The ‘Bordô’, ‘Isabel’ and IAC 138-22 ‘Máximo’ musts had low soluble solids for winemaking. The ‘106-8 Mgt’ rootstock promoted higher dry extract content and reduced dry extract in Bordô wine, and lower total and fixed acidity in IAC 138-22 Máximo wine. In Isabel wine, higher pH was promoted by the ‘IAC 766’ rootstock. Aside from low total acidity of the Bordô wine, all the physicochemical characteristics of the wines studied are in accordance with Brazilian law. There was no effect of rootstocks in the phenolics content and antioxidant activity of wines.

  13. Sh2-138: physical environment around a small cluster of massive stars

    Science.gov (United States)

    Baug, T.; Ojha, D. K.; Dewangan, L. K.; Ninan, J. P.; Bhatt, B. C.; Ghosh, S. K.; Mallick, K. K.

    2015-12-01

    We present a multiwavelength study of the Sh2-138, a Galactic compact H II region. The data comprise of optical and near-infrared (NIR) photometric and spectroscopic observations from the 2-m Himalayan Chandra Telescope, radio observations from the Giant Metrewave Radio Telescope (GMRT), and archival data covering radio through NIR wavelengths. A total of 10 Class I and 54 Class II young stellar objects (YSOs) are identified in a 4.6 arcmin×4.6 arcmin area of the Sh2-138 region. Five compact ionized clumps, with four lacking of any optical or NIR counterparts, are identified using the 1280 MHz radio map, and correspond to sources with spectral type earlier than B0.5. Free-free emission spectral energy distribution fitting of the central compact H II region yields an electron density of ˜2250 ± 400 cm-3. With the aid of a wide range of spectra, from 0.5-15 μm, the central brightest source - previously hypothesized to be the main ionizing source - is characterized as a Herbig Be type star. At large scale (15 arcmin ×15 arcmin), the Herschel images (70-500 μm) and the nearest neighbour analysis of YSOs suggest the formation of an isolated cluster at the junction of filaments. Furthermore, using a greybody fit to the dust spectrum, the cluster is found to be associated with the highest column density (˜3 × 1022 cm-2) and high temperature (˜35 K) regime, as well as with the radio continuum emission. The mass of the central clump seen in the column density map is estimated to be ˜3770 M⊙.

  14. Uncertainties in measuring trace amounts of cobalt and europium with low-flux neutron activation analysis

    Directory of Open Access Journals (Sweden)

    Burnham Steven

    2017-01-01

    Full Text Available Neutron activation analysis is widely used for identification of elements and their quantities even in trace amounts in the samples of almost any type. The challenges in detecting trace amounts of particular elements are often associated with the neutron flux produced at the research reactors. Low-flux neutron activation analysis usually presents the biggest challenge when analyzing trace quantities of elements with lower magnitude of radiative capture cross-sections. In this paper, we present the methodology and the quantified uncertainties associated with the detection of trace amounts of cobalt and europium, using as an example concrete aggregates. Recent growing interest is in improving structural concrete (increasing its strength but reducing its activation in nuclear power plant environments. Aside from buildings, structural concrete is also used as a biological shield in nuclear power plant that become radioactive after exposure to neutron flux. Due to radiative capture interactions, artificial radionuclides are generated to high enough concentrations that classify concrete as low-level radioactive waste at the time of the plant's decommissioning. Disposal of this concrete adds to the expense of nuclear power plant financing and its construction. Three radionuclides, 60Co, 152Eu, and 154Eu, account for 99 % of total residual radioactivity of nuclear power plant decommissioned concrete. IAEA document RS-G-1.7, Application of the Concepts of Exclusion, Exemption, and Clearance, specifies clearance levels of radionuclides specific activities: a specific activity lower than 0.1 Bqg-1 for 60Co and 152Eu, and 154Eu allows for a concrete to be recycled after decommissioning of the nuclear power plant. Therefore, low-flux neutron activation analysis is used to test the detection limits of trace elements in samples of cement, coarse, and fine concrete aggregates. These samples are irradiated at the University of Utah's 100 kW TRIGA Reactor at

  15. Temperature effects on the interaction mechanisms between the europium (III) and uranyl ions and zirconium diphosphate; Effets de la temperature sur les mecanismes d'interaction entre les ions europium (3) et uranyle et le diphosphate de zirconium

    Energy Technology Data Exchange (ETDEWEB)

    Finck, N

    2006-10-15

    Temperature should remain higher than 25 C in the near field environment of a nuclear waste repository for thousands years. In this context, the aim of this work is to study the temperature influence on the interaction mechanisms between europium (III) and uranyl ions and zirconium diphosphate, as well as the influence of a complexing medium (nitrate) on the sorption of the lanthanide. The experimental definition of the equilibria was achieved by combining a structural investigation with the macroscopic sorption data. Surface complexes were characterized at all temperatures (25 C to 90 C) by TRLFS experiments carried out on dry and in situ samples using an oven. This characterization was completed by XPS experiments carried out at 25 C on samples prepared at 25 C and 90 C. The reaction constants (surface hydration and cations sorption) were obtained by simulating the experimental data with the constant capacitance surface complexation model. The reaction constants temperature dependency allowed one to characterize thermodynamically the different reactions by application of the van't Hoff relation. The validity of this law was tested by performing microcalorimetric measurements of the sorption heat for both cations. (author)

  16. A novel nano-immunoassay method for quantification of proteins from CD138-purified myeloma cells: biological and clinical utility.

    Science.gov (United States)

    Misiewicz-Krzeminska, Irena; Corchete, Luis Antonio; Rojas, Elizabeta A; Martínez-López, Joaquín; García-Sanz, Ramón; Oriol, Albert; Bladé, Joan; Lahuerta, Juan-José; Miguel, Jesús San; Mateos, María-Victoria; Gutiérrez, Norma C

    2018-05-01

    Protein analysis in bone marrow samples from patients with multiple myeloma has been limited by the low concentration of proteins obtained after CD138 + cell selection. A novel approach based on capillary nano-immunoassay could make it possible to quantify dozens of proteins from each myeloma sample in an automated manner. Here we present a method for the accurate and robust quantification of the expression of multiple proteins extracted from CD138-purified multiple myeloma samples frozen in RLT Plus buffer, which is commonly used for nucleic acid preservation and isolation. Additionally, the biological and clinical value of this analysis for a panel of 12 proteins essential to the pathogenesis of multiple myeloma was evaluated in 63 patients with newly diagnosed multiple myeloma. The analysis of the prognostic impact of CRBN /Cereblon and IKZF1 /Ikaros mRNA/protein showed that only the protein levels were able to predict progression-free survival of patients; mRNA levels were not associated with prognosis. Interestingly, high levels of Cereblon and Ikaros proteins were associated with longer progression-free survival only in patients who received immunomodulatory drugs and not in those treated with other drugs. In conclusion, the capillary nano-immunoassay platform provides a novel opportunity for automated quantification of the expression of more than 20 proteins in CD138 + primary multiple myeloma samples. Copyright © 2018 Ferrata Storti Foundation.

  17. Enantioselective cellular localisation of europium(iii) coordination complexes† †Electronic supplementary information (ESI) available: Complex synthesis and characterisation, selected cell images showing correspondence with commercial lysosomal or mitochondrial stains and spectral imaging profiles. See DOI: 10.1039/c7sc04422d

    Science.gov (United States)

    Frawley, Andrew T.; Linford, Holly V.; Starck, Matthieu; Pal, Robert

    2017-01-01

    The selective mitochondrial localisation of the Λ enantiomer of three different emissive europium(iii) complexes in NIH 3T3 and MCF7 cells contrasts with the behaviour of the Δ enantiomer, for which a predominant lysosomal localisation was observed by confocal microscopy. In each case, cell uptake occurs via macropinocytosis. PMID:29675151

  18. Crossing 138: two approaches to churn under the Affordable Care Act.

    Science.gov (United States)

    Ravel, Gabriel; DeSantis, J Angelo

    2014-01-01

    A predicted side effect of the Medicaid expansion and state-based Exchanges under the Affordable Care Act is churn. Churn is the shifting into and out of eligibility for insurance affordability programs due to income changes. Because the line between Medicaid and Exchange eligibility is fine -138% of the federal poverty level -millions of Americans are expected to gain and lose eligibility. Frequently, this churning undermines continuity of care, raises costs, and frustrates those affected. This article explores two proposed programs to mitigate the effects of churn: the Basic Health Program and the Bridge Program. This article evaluates both programs' ability to mitigate the effects of churn, the likely side effects to states' implementing them, and legal and practical obstacles to their implementation. It concludes that the Bridge Program is the better approach.

  19. Sparkle/PM3 for the modeling of europium(III), gadolinium(III), and terbium(III) complexes

    International Nuclear Information System (INIS)

    Freire, Ricardo O.; Rocha, Gerd B.; Simas, Alfredo M.

    2009-01-01

    The Sparkle/PM3 model is extended to europium(III), gadolinium(III), and terbium(III) complexes. The validation procedure was carried out using only high quality crystallographic structures, for a total of ninety-six Eu(III) complexes, seventy Gd(III) complexes, and forty-two Tb(III) complexes. The Sparkle/PM3 unsigned mean error, for all interatomic distances between the trivalent lanthanide ion and the ligand atoms of the first sphere of coordination, is: 0.080 A for Eu(III); 0.063 A for Gd(III); and 0.070 A for Tb(III). These figures are similar to the Sparkle/AM1 ones of 0.082 A, 0.061 A, and 0.068 A respectively, indicating they are all comparable parameterizations. Moreover, their accuracy is similar to what can be obtained by present-day ab initio effective core potential full geometry optimization calculations on such lanthanide complexes. Finally, we report a preliminary attempt to show that Sparkle/PM3 geometry predictions are reliable. For one of the Eu(III) complexes, BAFZEO, we created hundreds of different input geometries by randomly varying the distances and angles of the ligands to the central Eu(III) ion, which were all subsequently fully optimized. A significant trend was unveiled, indicating that more accurate local minima geometries cluster at lower total energies, thus reinforcing the validity of sparkle model calculations. (author)

  20. Reducing the photo-bleaching effect of a new europium complex embedded in styrene butadiene copolymer

    Science.gov (United States)

    Jiménez, G. Lesly; Reyes-Rodríguez, J. L.; Padilla, Isela; Alarcón-Flores, G.; Falcony, C.

    2018-02-01

    A highly luminescent europium complex obtained with two different ligands, succinimide (SI) and 2-thenoyltrifluoroacetone (TTA) , was synthetized with different TTA concentrations. The photoluminescence (PL) emission from these materials corresponds to the characteristic inter-electronic energy level transitions of the Eu3+ ions. However, the excitation spectrum is strongly dependent on the presence of TTA, having an optimum response when 0.75 mmol of this compound is added to the EuL3(H2O)3 complex. The quantum yield obtained by these powders were around 72 % ± 1.7 % indicating an optimum sensitization of these complex. The EuL3 TTA complex with the best PL properties was embedded in a styrene butadiene copolymer (SBC) film, produced by the drop casting method, obtaining similar PL behavior at different concentrations, the highest intensity was observed at 1.2% (w/v) of EuL3 TTA complex and the quantum yield of these composite films was 60.5 % ± 2 % . These films were exposed to continuous UV irradiation and after 141 h no photo-bleaching effect was observed in contrast with the EuL3 TTA complex that exhibited a noticeable photoluminescence intensity degradation at much shorter exposure times. Both the Eu-complexes and the composite films were characterized by FT-IR, XRD, SEM and fluorescence spectroscopy.

  1. Photocatalytic dechlorination of PCB 138 using leuco-methylene blue and visible light; reaction conditions and mechanisms

    International Nuclear Information System (INIS)

    Izadifard, Maryam; Langford, Cooper H.; Achari, Gopal

    2010-01-01

    A study of dechlorination of PCB 138, under visible light employing methylene blue (MB) and triethylamine (TEA) in acetonitrile/water has been conducted to investigate the details of the mechanism of dechlorination and to determine the efficiency of the process for this representative congener. Two other amines, N-methyldiethanolamine (MEDA) and (triethanolamine) TEOA also replaced TEA and two other solvents, methanol and ethanol replacing acetonitrile were examined for effects on reaction rates. The results show that PCB 138 can be dechlorinated efficiently in this photocatalytic reaction. Clarifying ambiguities in several previous reports, the reduced form of MB, leuco-methylene blue (LMB) was identified as responsible for the photoreaction with its excited state transferring an electron to PCBs; oxidized LMB (i.e. MB) is reduced back to LMB by the excess amine present. The reaction depends on a cycle driven by the amine as a sacrificial electron donor. MEDA proved to be the most efficient electron donor; apparently in consequence of the most favourable steady state concentration of LMB. Methanol and ethanol may be used to replace acetonitrile with little change in the efficiency of the reaction.

  2. Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

    International Nuclear Information System (INIS)

    Caires, A.C.F.

    1985-01-01

    A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

  3. Percepce rodičovského chování a jeho souvislost se sebehodnocením. 138. klinicko-psychologický den. Praha, 8. 1. 2007.

    OpenAIRE

    Macek Petr; Širůček Jan

    2007-01-01

    Prezentace, 138. klinicko-psychologický den. Praha, 8.1.2007. Příspěvek byl zaměřen na výzkum souvislostí mezi sebehodnocením adolescentů a jejich hodnocení obou rodičů. Presentation, 138th clinical-psychology workshop. Prague, 8.1.2007. Paper was focused on perception of parenting style during childhood and perception of parents as predictors of adolescent's self-esteem

  4. VUV and UV–vis optical study on KGd2F7 luminescent host doped with terbium and co-doped with europium

    International Nuclear Information System (INIS)

    Lisiecki, Radosław

    2013-01-01

    The KGd 2 F 7 :Tb and KGd 2 F 7 :Tb,Eu samples were obtained using a solid state reaction. Excitation spectra and emission spectra are reported and analyzed within the VUV–UV–vis spectral range. The intense green luminescence is observed in the KGd 2 F 7 :Tb while the combined emission of terbium and europium in the KGd 2 F 7 :Tb,Eu covers substantially the region of white light. The materials under study can be effectively excited making use of intense f–d transitions of Tb 3+ in the VUV–UV region. Experimental lifetimes of luminescent levels have been measured and discussed. It was found that the considerable energy transfer from Tb 3+ to Eu 3+ occurs. -- Highlights: • The prospective green and white emitting phosphors. • The effective VUV and UV–vis excitation process. • The considerable energy transfer among optically active ions. • The influence of (Tb, Eu) co-doping on relaxation dynamic of excited states

  5. Synthesis, characterization, and properties of reduced europium molybdates and tungstates

    Energy Technology Data Exchange (ETDEWEB)

    Abeysinghe, Dileka [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Gerke, Birgit [Institut für Anorganische und Analytische Chemie, Universität Münster , Corrensstrasse 30, Münster D-48149 (Germany); Morrison, Gregory; Hsieh, Chun H.; Smith, Mark D. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Pöttgen, Rainer [Institut für Anorganische und Analytische Chemie, Universität Münster , Corrensstrasse 30, Münster D-48149 (Germany); Makris, Thomas M. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Loye, Hans-Conrad zur, E-mail: zurloye@mailbox.sc.edu [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States)

    2015-09-15

    Single crystals of K{sub 0.094}Eu{sub 0.906}MoO{sub 4}, K{sub 0.097}Eu{sub 0.903}WO{sub 4}, EuWO{sub 4}, and EuMoO{sub 4} were grown from molten chloride fluxes contained in vacuum-sealed fused silica and structurally characterized via single crystal X-ray diffraction. The in situ reduction of Eu{sup 3+} to Eu{sup 2+} was carried out using Mo, W, and Zn as metal reducing agents. All four compounds crystallize in the tetragonal space group of I4{sub 1}/a and adopt the scheelite (CaWO{sub 4}) structure type. The magnetic susceptibility of the reported compounds shows paramagnetic behavior down to 2 K. {sup 151}Eu Mössbauer spectroscopy was used to analyze the relative Eu{sup 2+} and Eu{sup 3+} content of the samples. All the compounds were further characterized by EPR, and UV-vis spectroscopy. - Graphical abstract: TOC Caption Two new reduced europium containing quaternary oxides, K{sub 0.094}Eu{sub 0.906}MoO{sub 4} and K{sub 0.097}Eu{sub 0.903}WO{sub 4}, and two previously reported ternary reduced oxides, EuWO{sub 4} and EuMoO{sub 4}, were synthesized via an in situ reduction of Eu{sup 3+} to Eu{sup 2+} under flux method using Mo, W, and Zn as metal reducing agents. {sup 151}Eu Mössbauer spectroscopy was used to analyze the relative Eu{sup 2+} and Eu{sup 3+} content of the samples. - Highlights: • K{sub 0.094}Eu{sub 0.906}MoO{sub 4}, K{sub 0.097}Eu{sub 0.903}WO{sub 4}, EuWO{sub 4}, and EuMoO{sub 4} have been synthesized and characterized. • The in situ reduction of Eu{sup 3+} to Eu{sup 2+} was carried out using Mo, W, and Zn as metal reducing agents. • Magnetic susceptibility data were collected. • {sup 151}Eu Mössbauer spectroscopy was used to analyze Eu{sup 2+} and Eu{sup 3+} content.

  6. Photovoltaic Performance Enhancement of Silicon Solar Cells Based on Combined Ratios of Three Species of Europium-Doped Phosphors.

    Science.gov (United States)

    Ho, Wen-Jeng; You, Bang-Jin; Liu, Jheng-Jie; Bai, Wen-Bin; Syu, Hong-Jhang; Lin, Ching-Fuh

    2018-05-18

    This paper presents a scheme for the enhancement of silicon solar cells in terms of luminescent emission band and photovoltaic performance. The proposed devices are coated with an luminescent down-shifting (LDS) layer comprising three species of europium (Eu)-doped phosphors mixed within a silicate film (SiO₂) using a spin-on film deposition. The three species of phosphor were mixed at ratios of 0.5:1:1.5, 1:1:1, or 1.5:1:0.5 in weight percentage (wt %). The total quantity of Eu-doped phosphors in the silicate solution was fixed at 3 wt %. The emission wavelengths of the Eu-doped phosphors were as follows: 518 nm (specie-A), 551 nm (specie-B), and 609 nm (specie-C). We examined the extended luminescent emission bands via photoluminescence measurements at room temperature. Closely matching the luminescent emission band to the high responsivity band of the silicon semiconductor resulted in good photovoltaic performance. Impressive improvements in efficiency were observed in all three samples: 0.5:1:1.5 (20.43%), 1:1:1 (19.67%), 1.5:1:0.5 (16.81%), compared to the control with a layer of pure SiO₂ (13.80%).

  7. Europium-labeled epidermal growth factor and neurotensin: novel probes for receptor-binding studies.

    Science.gov (United States)

    Mazor, Ohad; Hillairet de Boisferon, Marc; Lombet, Alain; Gruaz-Guyon, Anne; Gayer, Batya; Skrzydelsky, Delphine; Kohen, Fortune; Forgez, Patricia; Scherz, Avigdor; Rostene, William; Salomon, Yoram

    2002-02-01

    We investigated the possibility of labeling two biologically active peptides, epidermal growth factor (EGF) and neurotensin (NT), with europium (Eu)-diethylenetriaminepentaacetic acid. More specifically, we tested them as probes in studying receptor binding using time-resolved fluorescence of Eu3+. The relatively simple synthesis yields ligands with acceptable binding characteristics similar to isotopically labeled derivatives. The binding affinity (Kd) of labeled Eu-EGF to human A431 epidermal carcinoid cells was 3.6 +/- 1.2 nM, similar to the reported Kd values of EGF, whereas the Kd of Eu-NT to human HT29 colon cancer cells (7.4 +/- 0.5 nM) or to Chinese hamster ovary (CHO) cells transfected with the high-affinity NT receptor (CHO-NT1) were about 10-fold higher than the Kd values of NT. The bioactivity of the Eu-labeled EGF as determined by stimulation of cultured murine D1 hematopoietic cell proliferation was nearly the same as that obtained with native EGF. The maximal stimulation of Ca2+ influx with NT and Eu-NT in CHO-NT1 cells was similar, but the respective K0.5 values were 20 pM and 1 nM, corresponding to differences in the binding affinities previously described. The results of these studies indicate that Eu labeling of peptide hormones and growth factor molecules ranging from 10(3) to 10(5) Da can be conveniently accomplished. Importantly, the Eu-labeled products are stable for approximately 2 years and are completely safe for laboratory use compared to the biohazardous radioligands. Thus, Eu-labeled peptides present an attractive alternative for commonly used radiolabeled ligands in biological studies in general and in receptor assays in particular.

  8. Size-dependent cytotoxicity of europium doped NaYF4 nanoparticles in endothelial cells

    International Nuclear Information System (INIS)

    Chen, Shizhu; Zhang, Cuimiao; Jia, Guang; Duan, Jianlei; Wang, Shuxiang; Zhang, Jinchao

    2014-01-01

    Lanthanide-doped sodium yttrium fluoride (NaYF 4 ) nanoparticles exhibit novel optical properties which make them be widely used in various fields. The extensive applications increase the chance of human exposure to these nanoparticles and thus raise deep concerns regarding their riskiness. In the present study, we have synthesized europium doped NaYF 4 (NaYF 4 :Eu 3+ ) nanoparticles with three diameters and used endothelial cells (ECs) as a cell model to explore the potential toxic effect. The cell viability, cytomembrane integrity, cellular uptake, intracellular localization, intracellular reactive oxygen species (ROS), mitochondrial membrane potential (MMP), apoptosis detection, caspase-3 activity and expression of inflammatory gene were studied. The results indicated that these nanoparticles could be uptaken into ECs and decrease the cell viability, induce the intracellular lactate dehydrogenase (LDH) release, increase the ROS level, and decrease the cell MMP in a size-dependent manner. Besides that, the cells were suffered to apoptosis with the caspase-3 activation, and the inflammation specific gene expressions (ICAM1 and VCAM1) were also increased. Our results suggest that the damage pathway may be related to the ROS generation and mitochondrial damage. The results provide novel evidence to elucidate their toxicity mechanisms and may be helpful for more rational applications of these compounds in the future. - Highlights: • NaYF 4 :Eu 3+ nanoparticles with three diameters have been synthesized. • NaYF 4 :Eu 3+ nanoparticles could be uptaken by endothelial cells (ECs). • NaYF 4 :Eu 3+ nanoparticles show a significant cytotoxicity on ECs. • The size of NaYF 4 :Eu 3+ nanoparticles may be important to their toxicology effect

  9. Influence of ligands on the photoluminescent properties of Eu3+ in europium β-diketonate/PMMA-doped systems

    International Nuclear Information System (INIS)

    Liu, H.-G.; Park, Seongtae; Jang, Kiwan; Feng, X.-S.; Kim, Changdae; Seo, H.-J.; Lee, Y.-I.

    2004-01-01

    Three kinds of europium β-diketonates Eu(DBM) 3 , Eu(BA) 3 and Eu(TTA) 3 (DBM: Dibenzoylmethane; BA: 1-Benzoylacetone; TTA: Thenoyltrifluoroacetone) were doped in poly(methyl methacrylate) (PMMA) matrix. The doped systems were studied by using photoluminescent (PL) spectroscopy, emission decay experiments and X-ray diffractometry. Eu(III) ions in the doped Eu(DBM) 3 /PMMA systems have two distinct symmetric sites and the emission band changes greatly with the compositions. Eu(III) in the Eu(BA) 3 /PMMA systems gives only one symmetric site in the doped systems and the emission band changes slightly with the compositions. Although two distinct symmetric sites of Eu(III) can be distinguished in the doped systems of Eu(TTA) 3 /PMMA, the two sites have similar 5 D 0 lifetimes and the luminescent spectra almost do not change with the compositions. XRD reveals that crystallites were formed in the doped Eu(DBM) 3 /PMMA systems that have different crystalline structure from that of the chelate, and Eu(BA) 3 and Eu(TTA) 3 exist in amorphous state in the doped systems. The difference between the PL properties and structures of the doped systems for the three kinds of chelates should be attributed to different interactions between the chelate molecules and between the chelate and PMMA

  10. Quantum dot based on tin/titanium mixed oxide doped with europium synthesized by protein sol-gel method

    International Nuclear Information System (INIS)

    Paganini, Paula P.; Felinto, Maria Claudia F.C.; Brito, Hermi F.

    2011-01-01

    Special luminescence biomarkers have been developed to find more sensitive fluoroimmunoassay methods. A new generation of these biomarkers is the semiconductors nanocrystals, known as quantum dots, doped with lanthanides. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. The protein sol-gel is a modification of conventional method, in which the coconut water replacing the alkoxides normally used. The advantage is that, the proteins present in coconut water bind chemically with metal salts forming a polymer chain. This work presents nanoparticles based on tin/titanium mixed oxide doped with 3% of europium synthesized by protein sol-gel method. The nanoparticles were burned at 300 deg C, 500 deg C, 800 deg C and 1100 deg C. The samples were analyzed and characterized by thermal analysis, X-ray powder diffraction (XRD), infrared spectroscopy (IR) and scanning electron microscopy (SEM). The synthesis was effective and the nanoparticles showed nanometric size and structural differences with the annealing. To be used in the fluoroimmunoassays tests, these particles need to be functionalized before be connect with biological molecules and after this process, these nanoparticles going to be submitted at gamma radiation for sterilization. (author)

  11. Quantum dot based on tin/titanium mixed oxide doped with europium synthesized by protein sol-gel method

    Energy Technology Data Exchange (ETDEWEB)

    Paganini, Paula P.; Felinto, Maria Claudia F.C., E-mail: paulapaganini@usp.b, E-mail: mfelinto@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Brito, Hermi F., E-mail: hefbrito@iq.usp.b [Universidade de Sao Paulo (IQ/USP), Sao Paulo, SP (Brazil). Inst. de Quimica. Lab. de Elementos do Bloco f

    2011-07-01

    Special luminescence biomarkers have been developed to find more sensitive fluoroimmunoassay methods. A new generation of these biomarkers is the semiconductors nanocrystals, known as quantum dots, doped with lanthanides. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. The protein sol-gel is a modification of conventional method, in which the coconut water replacing the alkoxides normally used. The advantage is that, the proteins present in coconut water bind chemically with metal salts forming a polymer chain. This work presents nanoparticles based on tin/titanium mixed oxide doped with 3% of europium synthesized by protein sol-gel method. The nanoparticles were burned at 300 deg C, 500 deg C, 800 deg C and 1100 deg C. The samples were analyzed and characterized by thermal analysis, X-ray powder diffraction (XRD), infrared spectroscopy (IR) and scanning electron microscopy (SEM). The synthesis was effective and the nanoparticles showed nanometric size and structural differences with the annealing. To be used in the fluoroimmunoassays tests, these particles need to be functionalized before be connect with biological molecules and after this process, these nanoparticles going to be submitted at gamma radiation for sterilization. (author)

  12. [Management of spontaneous pneumothorax: about 138 cases].

    Science.gov (United States)

    Habibi, Bouchra; Achachi, Leila; Hayoun, Sohaib; Raoufi, Mohammed; Herrak, Laila; Ftouh, Mustapha El

    2017-01-01

    Pneumothorax is a collection of air in the pleural cavity. We conducted a retrospective study of patients with spontaneous pneumothorax in the Department of Pneumology at the Ibn Sina Hospital in Rabat (2009-2011) with the aim to determine the epidemiological, clinical, radiological, therapeutic and evolutionary manifestation of spontaneous pneumothorax. The study involved 138 patients: 128 men and 10 women (17-83 years), with an average age of 44.5 +/- 17.4 years and sex ratio of 12/8. 81.2% of patients were smokers. Clinical symptomatology was chest pain (92%), dyspnea (60%). Chest radiograph showed total unilateral (110 cases); partial (10 cases); localized (6 cases); bilateral (4 cases); right (51.4%) or left (45.7%) PNO (pneumothorax). During our study period we found that 70% of patients had spontaneous primitive pneumothorax and 30% had PNO secondary to Chronic obstructive pulmonary disease (COPD) (44%) and pulmonary tuberculosis (TB) (39%). Initial management included patients hospitalization, chest drainage (95%), needle exsufflation (1%), rest and O 2 (4%). It enables the lung to stick to the chest wall within 10 days in 63% of patients. Evolution was favorable in 89% of patients. Immediate complications included: subcutaneous emphysema (5 cases); infection (6 cases) and 3 deaths (cardiorespiratory arrest). Late complications included: recurrences in 11.6%; the first recurrence occurred in 13 cases (chest drainage in 11 cases and oxygen therapy in 2 cases) while the second recurrence occurred in 3 cases (surgery). This study shows the role of chest drainage and monitoring in the management of pneumothorax to avoid complications and especially to prevent recurrences, with a possible need to resort to surgery.

  13. Design, synthesis, characterization, and OFET properties of amphiphilic heteroleptic tris(phthalocyaninato) europium(III) complexes. The effect of crown ether hydrophilic substituents.

    Science.gov (United States)

    Gao, Yingning; Ma, Pan; Chen, Yanli; Zhang, Ying; Bian, Yongzhong; Li, Xiyou; Jiang, Jianzhuang; Ma, Changqin

    2009-01-05

    Two amphiphilic heteroleptic tris(phthalocyaninato) europium complexes with hydrophilic crown ether heads and hydrophobic octyloxy tails [Pc(mCn)(4)]Eu[Pc(mCn)(4)]Eu[Pc(OC(8)H(17))(8)] [m = 12, n = 4, H(2)Pc(12C4)(4) = 2,3,9,10,16,17,23,24-tetrakis(12-crown-4)phthalocyanine; m = 18, n = 6, H(2)Pc(18C6)(4) = 2,3,9,10,16,17,23,24-tetrakis(18-crown-6)phthalocyanine; H(2)Pc(OC(8)H(17))(8) = 2,3,9,10,16,17,23,24-octakis(octyloxy)phthalocyanine] (1, 2) were designed and prepared from the reaction between homoleptic bis(phthalocyaninato) europium compound [Pc(mCn)(4)]Eu[Pc(mCn)(4)] (m = 12, n = 4; m = 18, n = 6) and metal-free H(2)Pc(OC(8)H(17))(8) in the presence of Eu(acac)(3).H(2)O (Hacac = acetylacetone) in boiling 1,2,4-trichlorobenzene. These novel sandwich triple-decker complexes were characterized by a wide range of spectroscopic methods and electrochemically studied. With the help of the Langmuir-Blodgett technique, these typical amphiphilic triple-decker complexes were fabricated into organic field effect transistors (OFET) with top contact configuration on bare SiO(2)/Si substrate, hexamethyldisilazane-treated SiO(2)/Si substrate, and octadecyltrichlorosilane (OTS)-treated SiO(2)/Si substrate, respectively. The device performance is revealed to be dependent on the species of crown ether substituents and substrate surface treatment. OFETs fabricated from the triple decker with 12-crown-4 hydrophilic substituents, 1, allow the hole transfer in the direction parallel to the aromatic phthalocyanine rings. In contrast, the devices of a triple-decker compound containing 18-crown-6 as hydrophilic heads, 2, transfer holes in a direction along the long axis of the assembly composed of face-to-face aggregated triple-decker molecules, revealing the effect of molecular structure, specifically the crown ether substituents on the film structure and OFET functional properties. The carrier mobility for hole as high as 0.33 cm(2) V(-1) s(-1) and current modulation of 7.91 x 10

  14. Raman, photoluminescence and EPR spectroscopic characterization of europium(III) oxide–lead dioxide–tellurite glassy network

    Energy Technology Data Exchange (ETDEWEB)

    Dehelean, A. [National Research and Development Institute for Isotopic and Molecular Technologies, Cluj-Napoca (Romania); Rada, S. [Technical University of Cluj-Napoca (Romania); Popa, A.; Suciu, R.C. [National Research and Development Institute for Isotopic and Molecular Technologies, Cluj-Napoca (Romania); Culea, E., E-mail: eugen.culea@phys.utcluj.ro [Technical University of Cluj-Napoca (Romania)

    2016-09-15

    Raman, photoluminescence and EPR spectroscopies were used to characterize some xEu{sub 2}O{sub 3}·(100−x)[4TeO{sub 2}·PbO{sub 2}] glasses with x=0–50 mol% obtained by melt quenching technique. Raman spectra of these glasses were interpreted in terms of vibration modes of deformed Te–O–Te linkages due to the intercalation of [PbO{sub n}] and [EuO{sub n}] entities produced by addition of Eu{sub 2}O{sub 3} to the host lead–tellurite glass. Photoluminescence spectra of xEu{sub 2}O{sub 3}·(100−x)[4TeO{sub 2}·PbO{sub 2}] glasses reveal the presence of Pb{sup 2+}, Eu{sup 2+} and Eu{sup 3+} ions. EPR data confirm the presence of Eu{sup 2+} ions in the europium–lead–tellurite glassy network and offer information about the compositional evolution of the Eu{sup 2+} ions local environment and Eu{sup 3+}↔Eu{sup 2+} redox process. PL and EPR data show that the decrease of the Eu{sup 2+} ions luminescence intensity for the x≥40 mol% Eu{sub 2}O{sub 3} region is not due to the clusterization of europium ions but is due the decrease of the amount of Eu{sup 2+} ions as result of changes in the Eu{sup 3+}→Eu{sup 2+} redox equilibrium.

  15. Doping β-Ga2O3 with europium: influence of the implantation and annealing temperature

    Science.gov (United States)

    Peres, M.; Lorenz, K.; Alves, E.; Nogales, E.; Méndez, B.; Biquard, X.; Daudin, B.; Víllora, E. G.; Shimamura, K.

    2017-08-01

    β-Ga2O3 bulk single crystals were doped by ion implantation at temperatures from room temperature to 1000 °C, using a 300 keV Europium beam with a fluence of 1  ×  1015 at cm-2. Rising the implantation temperature from room temperature to 400-600 °C resulted in a significant increase of the substitutional Eu fraction and of the number of Eu ions in the 3+  charge state as well as in a considerable decrease of implantation damage. Eu is found in both charge states 2+  and 3+  and their relative fractions are critically dependent on the implantation and annealing temperature, suggesting that defects play an important role in stabilizing one of the charge states. The damage recovery during post-implant annealing is a complex process and typically defect levels first increase for intermediate annealing temperatures and a significant recovery of the crystal only starts around 1000 °C. Cathodoluminescence spectra are dominated by the sharp Eu3+ related intra-ionic 4f transition lines in the red spectral region. They show a strong increase of the emission intensity with increasing annealing temperature, in particular for samples implanted at elevated temperature, indicating the optical activation of Eu3+ ions. However, no direct correlation of emission intensity and Eu3+ fraction was found, again pointing to the important role of defects on the physical properties of these luminescent materials.

  16. Solvent extraction of europium(III) with benzoylacetone and benzoyltrifluoroacetone into carbon tetrachloride in the absence and presence of tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1992-01-01

    The solvent extraction of europium (III) in 0.1 mol dm -3 sodium nitrate solutions with benzoylacetone (Hbza) or benzoyltrifluoroacetone (Hbfa) in carbon tetrachloride was measured in the absence and presence or tetrabutylammonium ions (tba + ). Although extraction with Hbfa occurred at lower pH than with Hbza, the extraction measured as a function of the β-diketonate ion concentration in the aqueous phase was rather similar. It was also found that extraction with Hbfa was greatly enhanced by the addition of tba + , the effect, however, was negligible with Hbza. The data were analyzed from the stand point that the neutral metal chelate, Eu(bfa) 3 , was extracted into the organic phase and associated with ion-pairs of the reagents, bfa - tba + , in this phase. It was also found that though extraction of ion-pairs of bfa - tba + occurred, that of bza - tba + was negligible. Thus, the reason for the negligible extraction of the ternary complex, Eu (bza) 4 - tba + , was explained in terms of the negligible extraction of the bza - tba + , which might associate with Eu(bza) 3 in the organic phase. (author)

  17. Europium-decorated graphene quantum dots as a fluorescent probe for label-free, rapid and sensitive detection of Cu{sup 2+} and L-cysteine

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Liping [College of Life Sciences, Fujian Agriculture and Forestry University, Fuzhou, 350002 (China); Song, Xinhong; Chen, Yiying; Rong, Mingcong; Wang, Yiru [Department of Chemistry and the MOE Key Laboratory of Spectrochemical Analysis & Instrumentation, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen, 361005 (China); Zhao, Li; Zhao, Tingting [Xiamen Huaxia College, Xiamen, 361024 (China); Chen, Xi, E-mail: xichen@xmu.edu.cn [Department of Chemistry and the MOE Key Laboratory of Spectrochemical Analysis & Instrumentation, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen, 361005 (China); State Key Laboratory of Marine Environmental Science, Xiamen University, Xiamen, 361005 (China)

    2015-09-03

    In this work, europium-decorated graphene quantum dots (Eu-GQDs) were prepared by treating three-dimensional Eu-decorated graphene (3D Eu-graphene) via a strong acid treatment. Various characterizations revealed that Eu atoms were successfully complexed with the oxygen functional groups on the surface of graphene quantum dots (GQDs) with the atomic ratio of 2.54%. Compared with Eu free GQDs, the introduction of Eu atoms enhanced the electron density and improved the surface chemical activities of Eu-GQDs. Therefore, the obtained Eu-GQDs were used as a novel “off-on” fluorescent probe for the label-free determination of Cu{sup 2+} and L-cysteine (L-Cys) with high sensitivity and selectivity. The fluorescence intensity of Eu-GQDs was quenched in the presence of Cu{sup 2+} owing to the coordination reaction between Cu{sup 2+} and carboxyl groups on the surface of the Eu-GQDs. The fluorescence intensity of Eu-GQDs recovered with the subsequent addition of L-Cys because of the strong affinity of Cu{sup 2+} to L-Cys via the Cu–S bond. The experimental results showed that the fluorescence variation of the proposed approach had a good linear relationship in the range of 0.1–10 μM for Cu{sup 2+} and 0.5–50 μM for L-Cys with corresponding detection limits of 0.056 μM for Cu{sup 2+} and 0.31 μM for L-Cys. The current approach also displayed a special response to Cu{sup 2+} and L-Cys over the other co-existing metal ions and amino acids, and the results obtained from buffer-diluted serum samples suggested its applicability in biological samples. - Highlights: • The europium-decorated graphene quantum dots (Eu-GQDs) have been successfully prepared. • Various characterizations results proved that Eu atoms were successfully introduced into graphene quantum dots. • The introduced Eu atoms changed the electron density and surface chemical activities of Eu-GQDs. • Eu-GQDs were used as an “off-on” fluorescent probe for Cu{sup 2+} and L-cysteine detection

  18. Addressing the psychosocial and communication challenges posed by radiological/nuclear terrorism: key developments since NCRP Report No. 138.

    Science.gov (United States)

    Becker, Steven M

    2005-11-01

    One of the most innovative aspects of NCRP Report No. 138 (Management of Terrorist Incidents Involving Radioactive Material) was the high priority it accorded to psychosocial and communication issues. While previous discussions of radiological and nuclear terrorism had occasionally referred to these topics, NCRP Report No. 138 was the first report of its kind to recognize the profound challenges posed by these issues and to place them at the heart of preparedness and response efforts. In the years since the report's release, a host of important developments have taken place in relation to psychosocial and communication issues. This paper reviews key changes and advances in five broad areas: (1) training exercises, (2) policy and guidance development, (3) findings on hospital and clinician needs, (4) survey research on public perceptions of radiological terrorism, and (5) risk communication for radiological and nuclear terrorism situations. The article concludes with a discussion of continuing psychosocial and communication challenges, including critical areas needing further attention as the nation moves to meet the threat of terrorism involving radioactive materials.

  19. Avaliação da resistência à corrosão de implantes em aços inoxidáveis ISO 5832-9 e F138 removidos de pacientes

    Directory of Open Access Journals (Sweden)

    Elison da Fonseca e Silva

    2012-01-01

    Full Text Available This work has compared the surfaces of two different steel samples used as orthopedical implants, classified as ASTM F138 and ISO5832-9, through optical emission spectroscopy, by means of SEM and EDS. The samples (implants were also submitted to potentiodynamic cyclic polarization in Ringer lactate and NaCl 0.9 M L-1 solutions; ISO5832-9 sample did not show any kind of localized corrosion, but in the case of F138 steel was observed a pit localized corrosion in both solutions. In Ringer lactate solution it was observed a loss of about 63% for nickel and 26% for iron for F138 stell, compared to the initial composition.

  20. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss

    International Nuclear Information System (INIS)

    Gomez Aleixandre, J. L.

    1967-01-01

    145 stars with N h >8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c π- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs

  1. Influence of natural mobile organic matter on europium retention on Bure clay rock

    International Nuclear Information System (INIS)

    Vu-Do, Laurence

    2013-01-01

    Bure clay rock (CR) was chosen as host rock for the French high and intermediate level long lived radioactive waste repository. This choice is mostly explained by the retention ability of the Callovo-Oxfordian rock (COx). Bure clay rock contains natural organic matter (OM) that could have an influence on radionuclide retention. The aim of this work is to assess the influence of natural mobile OM on the retention of Eu on clay rock. Eu was chosen as a chemical model for trivalent actinides contained in vitrified waste. Three organic molecules were studied: suberic, sorbic and tiglic acids, small organic acids identified in COx pore water. All the experiments were carried out in an environment recreating COx water (pH=7.5; I=0.1 mol/L; PCO 2 =10 -2 bar).Clay rock sample characterization showed that the sample used in this work was similar to those previously extracted from the area of interest and that it was necessary to maintain pH at 7.5 to avoid altering the clay rock. The Eu-OM system study indicated that organic acids had no influence on Eu speciation in COx water. The Eu-CR system experimental study confirmed that retention implied sorption on CR (C(Eu)≤6.10 -6 mol/L) and precipitation in COx water (C(Eu)≥6.10 -6 mol/L). Distribution coefficient Rd (quantifying sorption) was estimated at 170 ± 30 L/g. This high value is consistent with literature values obtained on clay rocks. The ternary Eu-OM-CR system study showed a slight increase of sorption in the presence of organic matter. This synergistic effect is very satisfactory in terms of storage security: the presence of small organic acids in clay rock does not question retention properties with respect to europium and trivalent actinides. (author)

  2. Photovoltaic Performance Enhancement of Silicon Solar Cells Based on Combined Ratios of Three Species of Europium-Doped Phosphors

    Directory of Open Access Journals (Sweden)

    Wen-Jeng Ho

    2018-05-01

    Full Text Available This paper presents a scheme for the enhancement of silicon solar cells in terms of luminescent emission band and photovoltaic performance. The proposed devices are coated with an luminescent down-shifting (LDS layer comprising three species of europium (Eu-doped phosphors mixed within a silicate film (SiO2 using a spin-on film deposition. The three species of phosphor were mixed at ratios of 0.5:1:1.5, 1:1:1, or 1.5:1:0.5 in weight percentage (wt %. The total quantity of Eu-doped phosphors in the silicate solution was fixed at 3 wt %. The emission wavelengths of the Eu-doped phosphors were as follows: 518 nm (specie-A, 551 nm (specie-B, and 609 nm (specie-C. We examined the extended luminescent emission bands via photoluminescence measurements at room temperature. Closely matching the luminescent emission band to the high responsivity band of the silicon semiconductor resulted in good photovoltaic performance. Impressive improvements in efficiency were observed in all three samples: 0.5:1:1.5 (20.43%, 1:1:1 (19.67%, 1.5:1:0.5 (16.81%, compared to the control with a layer of pure SiO2 (13.80%.

  3. Two-dimensional high spatial-resolution dosimeter using europium doped potassium chloride: a feasibility study

    International Nuclear Information System (INIS)

    Li, H Harold; Yang, Deshan; Xiao, Zhiyan; Driewer, Joseph P; Han, Zhaohui; Low, Daniel A

    2014-01-01

    Recent research has shown that KCl:Eu 2+  has great potential for use in megavoltage radiation therapy dosimetry because this material exhibits excellent storage performance and is reusable due to strong radiation hardness. This work reports the authors’ attempts to fabricate 2D KCl:Eu 2+  storage phosphor films (SPFs) using both a physical vapor deposition (PVD) method and a tape casting method. X-ray diffraction analysis showed that a 10 µm thick PVD sample was composed of highly crystalline KCl. No additional phases were observed, suggesting that the europium activator had been completely incorporated into the KCl matrix. Photostimulated luminescence and photoluminescence spectra suggested that F (Cl − ) centers were the electron storage centers post x-ray irradiation and that Eu 2+  cations acted as luminescence centers in the photostimulation process. The 150 µm thick casted KCl:Eu 2+  SPF showed sub-millimeter spatial-resolution. Monte Carlo simulations further demonstrated that the admixture of 20% KCl:Eu 2+  and 80% low Z polymer binder exhibited almost no energy-dependence in a 6 MV beam. KCl:Eu 2+  pellet samples showed a large dynamic range from 0.01 cGy to 60 Gy dose-to-water, and saturated at approximately 500 Gy as a result of KCl's intrinsic high radiation hardness. Taken together, this work provides strong evidence that KCl:Eu 2+ -based SPF with associated readout apparatus could result in a novel electronic film system that has all the desirable features associated with classic radiographic film and, importantly, water equivalence and the capability of permanent identification of each detector. (paper)

  4. Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms

    International Nuclear Information System (INIS)

    Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z.; Gillow, J.B.; Francis, A.J.

    2004-01-01

    We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K d ) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N H 2 O ) and the degree of strength of ligand field (R E/M ) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K d of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K d , indicating that an exchange with Na + on the functional groups was involved in their sorption. The ΔN H 2 O (= 9 - N H 2 O ) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R E/M for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)

  5. Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z. [Advanced Science Research Center, Japan Atomic Energy Research Inst., Ibaraki (Japan); Gillow, J.B.; Francis, A.J. [Environmental Sciences Dept., Brookhaven National Lab., Upton, NY (United States)

    2004-07-01

    We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K{sub d}) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N{sub H{sub 2}O}) and the degree of strength of ligand field (R{sub E/M}) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K{sub d} of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K{sub d}, indicating that an exchange with Na{sup +} on the functional groups was involved in their sorption. The {delta}N{sub H{sub 2}O} (= 9 - N{sub H{sub 2}O}) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R{sub E/M} for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)

  6. Paclitaxel-Fe3O4 nanoparticles inhibit growth of CD138–  CD34– tumor stem-like cells in multiple myeloma-bearing mice

    Directory of Open Access Journals (Sweden)

    Yang C

    2013-04-01

    Full Text Available Cuiping Yang,1,3,* Jing Wang,2,* Dengyu Chen,1,* Junsong Chen,1 Fei Xiong,4 Hongyi Zhang,1 Yunxia Zhang,2 Ning Gu,4 Jun Dou11Department of Pathogenic Biology and Immunology, Medical School, 2Department of Gynecology and Obstetrics, Zhongda Hospital, Southeast University, Nanjing, 3Department of Pathogenic Biology and Immunology, School of Basic Medicine, Jiangxi University of Traditional Chinese Medicine, Nanchang, 4School of Biological Science and Medical Engineering, Southeast University, Nanjing, People’s Republic of China*These authors contributed equally to this workBackground: There is growing evidence that CD138– CD34– cells may actually be tumor stem cells responsible for initiation and relapse of multiple myeloma. However, effective drugs targeted at CD138– CD34– tumor stem cells are yet to be developed. The purpose of this study was to investigate the inhibitory effect of paclitaxel-loaded Fe3O4 nanoparticles (PTX-NPs on CD138– CD34– tumor stem cells in multiple myeloma-bearing mice.Methods: CD138– CD34– cells were isolated from a human U266 multiple myeloma cell line using an immune magnetic bead sorting method and then subcutaneously injected into mice with nonobese diabetic/severe combined immunodeficiency to develop a multiple myeloma-bearing mouse model. The mice were treated with Fe3O4 nanoparticles 2 mg/kg, paclitaxel 4.8 mg/kg, and PTX-NPs 0.64 mg/kg for 2 weeks. Tumor growth, pathological changes, serum and urinary interleukin-6 levels, and molecular expression of caspase-3, caspase-8, and caspase-9 were evaluated.Results: CD138– CD34– cells were found to have tumor stem cell characteristics. All the mice developed tumors in 40 days after injection of 1 × 106 CD138– CD34– tumor stem cells. Tumor growth in mice treated with PTX-NPs was significantly inhibited compared with the controls (P <  0.005, and the groups that received nanoparticles alone (P < 0.005 or paclitaxel alone (P < 0.05. In addition

  7. Photo/electroluminescence properties of an europium (III) complex doped in 4,4'-N,N'-dicarbazole-biphenyl matrix

    International Nuclear Information System (INIS)

    Zhou Yonghui; Zhou Liang; Wu, Jing; Li, Hong-Yan; Zheng Youxuan; You Xiaozeng; Zhang Hongjie

    2010-01-01

    The photoluminescence properties of one europium complex Eu(TFNB) 3 Phen (TFNB = 4,4,4-trifluoro-1-(naphthyl)-1,3-butanedione, Phen = 1,10-phenanthroline) doped in a hole-transporting material CBP (4,4'-N,N'-dicarbazole-biphenyl) films were studied. A series of organic light-emitting devices (OLEDs) using Eu(TFNB) 3 Phen as the emitter were fabricated with a multilayer structure of indium tin oxide, 250 Ω/square)/TPD (N,N'-diphenyl-N,N'-bis(3-methyllphenyl)-(1,1'-biphenyl)-4,4'-diamine, 50 nm)/Eu(TFNB) 3 phen (x): CBP (4,4'-N,N'-dicarbazole-biphenyl, 45 nm)/BCP (2,9-dimethyl-4,7-diphenyl-l,10 phenanthroline, 20 nm)/AlQ (tris(8-hydroxy-quinoline) aluminium, 30 nm)/LiF (1 nm)/Al (100 nm), where x is the weight percentage of Eu(TFNB) 3 phen doped in the CBP matrix (1-6%). A red emission at 612 nm with a half bandwidth of 3 nm, characteristic of Eu(III) ion, was observed with all devices. The device with a 3% dopant concentration shows the maximum luminance up to 1169 cd/m 2 (18 V) and the device with a 5% dopant concentration exhibits a current efficiency of 4.46 cd/A and power efficiency of 2.03 lm/W. The mechanism of the electroluminescence was also discussed.

  8. Hydrothermal synthesis and crystal structure of a europium(III) coordination polymer with 5-sulfoisophthalate trivalent anions and free 4, 4'-bipyridine molecules

    International Nuclear Information System (INIS)

    Lin Humao; Qing Caixiao; Qian Miao; Ping Xiaohong

    2005-01-01

    A novel europium(III) coordination polymer [Eu(Sip)(H 2 O) 5 ] n · nH 2 O · 1.5 n(Bipy) (I) (Sip is 5-sulfoisophthalate trivalent anion and Bipy is 4,4'-bipyridine) is hydrothermally synthesized and determined by the single crystal X-ray diffraction method. Polymer I crystallizes in the monoclinic system, space group C2/c with a = 30.7515(6), b = 10.9577(2), c = 17.5545(4) A, β = 112.040(1) deg, Z = 4. In I, each Eu 3+ ion is coordinated by four oxygen atoms from two carboxylate groups of two different Sip anions and five oxygen atoms from five coordinated water molecules to complete a deformed mono-cap square antiprism. Moreover, each Sip anion acts as a tetradentate ligand to connect two adjacent Eu 3+ ions through its two chelating carboxylate groups, resulting in one-dimensional linear chains. In addition, fifteen different kinds of hydrogen-bonding interactions link the chains, lattice water molecules, and free Bipy molecules to engender a complicated hydrogen-bonding network [ru

  9. Crystallization in Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk metallic glass under pressure

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Zhou, T.J.; Rasmussen, Helge Kildahl

    2000-01-01

    The effect of pressure on the crystallization behavior of the bulk metallic glass-forming Zr41.2Ti13.8Cu12.5Ni10Be22.5 alloy with a wide supercooled liquid region has been investigated by in situ high-pressure and high-temperature x-ray powder diffraction measurements using synchrotron radiation......)], reporting a decrease of the crystallization temperature under pressure in a pressure range of 0-6 GPa for the bulk glass Zr41Ti14Cu12.5Ni9Be22.5C1 alloy. Compressibility with a volume reduction of approximately 22% at room temperature does not induce crystallization in the Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk...... glass alloy. This indicates that the densification effect induced by pressure in the pressure range investigated plays a minor role in the crystallization behavior of this bulk glass alloy. The different crystallization behavior of the carbon-free and the carbon-containing glassy alloys has been...

  10. Moessbauer spectroscopy study on the corrosion resistance of plasma nitrided ASTM F138 stainless steel in chloride solution

    International Nuclear Information System (INIS)

    Souza, S.D. de; Olzon-Dionysio, M.; Basso, R.L.O.; Souza, S. de

    2010-01-01

    Plasma nitriding of ASTM F138 stainless steel samples has been carried out using dc glow discharge under 80% H 2 -20% N 2 gas mixture, at 673 K, and 2, 4, and 7 h time intervals, in order to investigate the influence of treatment time on the microstructure and the corrosion resistance properties. The samples were characterized by scanning electron microscopy, glancing angle X-ray diffraction and conversion electron Moessbauer spectroscopy, besides electrochemical tests in NaCl aerated solution. A modified layer of about 6 μm was observed for all the nitrided samples, independent of nitriding time. The X-ray diffraction analysis shows broad γ N phase peaks, signifying a great degree of nitrogen supersaturation. Besides γ N, the Moessbauer spectroscopy results indicated the occurrence of γ' and ε phases, as well as some other less important phases. Corrosion measurements demonstrate that the plasma nitriding time affects the corrosion resistance and the best performance is reached at 4 h treatment. It seems that the ε/γ' fraction ratio plays an important role on the resistance corrosion. Additionally, the Moessbauer spectroscopy was decisive in this study, since it was able to identify and quantify the iron phases that influence the corrosion resistance of plasma nitrided ASTM F138 samples.

  11. Interaction of europium and nickel with calcite studied by Rutherford Backscattering Spectrometry and Time-Resolved Laser Fluorescence Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Sabau, A. [Agence Nationale pour la gestion des Déchets RAdioactifs, 1-7 rue J. Monnet, Parc de la Croix Blanche, 92298 Châtenay-Malabry Cedex (France); Université de Nice Sophia Antipolis, Ecosystèmes Côtiers Marins et Réponses aux Stress (ECOMERS), 28 avenue Valrose, 06108 Nice Cedex 2 (France); Pipon, Y., E-mail: pipon@ipnl.in2p3.fr [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); Institut Universitaire de Technologie (IUT) Lyon-1, Université Claude Bernard Lyon 1, 69 622 Villeurbanne Cedex (France); Toulhoat, N. [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); CEA/DEN, Saclay, 91191 Gif sur Yvette (France); Lomenech, C. [Université de Nice Sophia Antipolis, Ecosystèmes Côtiers Marins et Réponses aux Stress (ECOMERS), 28 avenue Valrose, 06108 Nice Cedex 2 (France); Jordan, N. [Helmholtz Zentrum Dresden Rossendorf (HZDR), Institute of Resource Ecology (IRE) (Germany); Moncoffre, N. [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); Barkleit, A. [Helmholtz Zentrum Dresden Rossendorf (HZDR), Institute of Resource Ecology (IRE) (Germany); and others

    2014-08-01

    This study aims at elucidating the mechanisms regulating the interaction of Eu and Ni with calcite (CaCO{sub 3}). Calcite powders or single crystals (some mm sized) were put into contact with Eu or Ni solutions at concentrations ranging from 10{sup −3} to 10{sup −5} mol L{sup −1} for Eu and 10{sup −3} mol L{sup −1} for Ni. The sorption durations ranged from 1 week to 1 month. Rutherford Backscattering Spectrometry (RBS) well adapted to discriminate incorporation processes such as: (i) adsorption or co precipitation at the mineral surfaces or, (ii) incorporation into the mineral structure (through diffusion for instance), has been carried out. Moreover, using the fluorescence properties of europium, the results have been compared to those obtained by Time-Resolved Laser Fluorescence Spectroscopy (TRLFS) on calcite powders. For the single crystals, complementary SEM observations of the mineral surfaces at low voltage were also performed. Results showed that Ni accumulates at the calcite surface whereas Eu is also incorporated at a greater depth. Eu seems therefore to be incorporated into two different states in calcite: (i) heterogeneous surface accumulation and (ii) incorporation at depth greater than 160 nm after 1 month of sorption. Ni was found to accumulate at the surface of calcite without incorporation.

  12. Migration of strontium, cesium, and europium from poly(butyl acrylate)/phosphate/composites prepared using gamma radiation

    Energy Technology Data Exchange (ETDEWEB)

    Alhassanieh, O., E-mail: cscientific@aec.org.s [Nuclear and Radiochemistry Division, Chemistry Department, Atomic Energy Commission of Syria, Damascus, P.O. Box 6091 (Syrian Arab Republic); Ajji, Z. [Polymer Technology Division, Radiation Technology Department, Atomic Energy Commission of Syria, Damascus, P.O. Box 6091 (Syrian Arab Republic); Alkourdi, H.; Haloum, D. [Nuclear and Radiochemistry Division, Chemistry Department, Atomic Energy Commission of Syria, Damascus, P.O. Box 6091 (Syrian Arab Republic)

    2011-02-15

    Composites based on natural phosphate powder and the monomer N-butyl acrylate have been prepared by means of gamma irradiation. The conversion of polymerization was followed up with respect to the irradiation dose using thermogravimetric analyzer (TGA). A total polymerization conversion was achieved by exposure of the samples to a dose of 10 kGy. A thermomechanical analyzer (TMA) was used to locate the region of the glass transition temperatures (T{sub g}) using the mode with alternative variable force; the mode with constant force was used to determine the T{sub g} of the pure polymer and the composite prepared at the same irradiation dose. The T{sub g} of the pure poly(butyl acrylate) is -51.41 {sup o}C, and the T{sub g} of poly(butyl acrylate)/phosphate/composites is -46.54 {sup o}C. The distribution of {sup 137}Cs, {sup 152}Eu, and {sup 85}Sr in a solid-aqueous system, a composite of phosphate-polybutyl acrylate in contact with groundwater, was investigated using {gamma}-spectrometry. The effect of contact time, pH, and the concentration of concurrent elements (Na, Ca, and La) were studied. The results were compared with earlier results with phosphate alone in the solid phase. The ability of the produced composites to keep the studied radioisotopes in the solid phase is much higher than mineral phosphate. This improvement is more remarkable by strontium and cesium than europium, due to its high element ratio in the solid phase in phosphate experiments.

  13. Comparative analysis of CD138 antigen targeting for the treatment of multiple myeloma with bismuth-213 and Melphalan chemotherapy

    International Nuclear Information System (INIS)

    Gouard, S.; Gaschet, J.; Maurel, C.; Barbet, J.; Davodeau, F.; Pallardy, A.; Faivre-Chauvet, A.; Kraeber-Bodere, F.; Bruchertseifer, F.; Morgenstern, A.; Cherel, M.

    2015-01-01

    Full text of publication follows. Aim: multiple myeloma (MM) is a B-cell malignancy of terminally differentiated plasma cells within the bone marrow, with the presence of a monoclonal immunoglobulin in serum and/or urine and development of osteolytic bone lesions in human. Despite intense research to develop new treatments, cure is almost never achieved. Alpha-radioimmunotherapy (RIT) has been shown to be effective in vivo in a multiple myeloma model and seems particularly suited for disseminated tumour cells or small clusters of tumour cells. CD138 (Syndecan-1) is found mainly in epithelial cells, but has been shown to be expressed by most myeloma cells, both in human and in mouse. In order to define where alpha RIT stands in MM treatment, the aim of this study was to compare Melphalan, MM standard treatment, with alpha RIT using a bismuth-213-labelled anti-mouse CD138 rat antibody in a syngeneic mouse MM model. Material and Methods: C57BL/KaLwRij mice were grafted with 10 6 5T33 cells (murine myeloma cells). Luciferase transfected 5T33 were used for in vivo localization of the cells during the course of disease. The first step of the study was to assess the dose-response of Melphalan (100, 200 et 300 μg/mouse), 21 days after engraftment. The second step consisted in therapeutic association: Melphalan followed by RIT at d22 et d25 after engraftment. Toxicity (animal weight, blood cell counts) and treatment efficacy were studied in animals receiving no treatment, injected with Melphalan alone (200 μg), RIT alone at d22 and d25 (3.7 MBq of 213 Bi-anti-CD138) and Melphalan combined with alpha RIT. Results: fifty percent of untreated mice died by d64 after MM engraftment. In mice treated with Melphalan alone, only the 200 μg dose improved median survival. No animal was cured after Melphalan treatment whereas 60% of the mice survived with RIT alone at d22 after tumour engraftment. However, the therapeutic window seems to be narrow, indeed no effect was observed with

  14. Preparation of transparent sol-gel films containing europium, terbium, and ytterbium cations from 4-(3'-triethoxysilylpropylimino)pent-2-en-2-ol

    International Nuclear Information System (INIS)

    Semenov, V.V.; Cherepennikova, N.F.; Kuznetsova, O.V.; Melenskova, N.V.; Bushuk, B.A.; Bushuk, S.B.; Kal'vinkovskaya, Yu.A.; Duglas, V.E.

    2007-01-01

    A reaction of 3-aminopropyl(triethoxy)silane with acetylacetone gave a mixture of two isomeric carbon-functionalized organosilicon compounds capable of complexation and sol-gel polymerization. These were 4-(3'-triethoxysilylpropylimino)pent-2-en-2-ol (EtO) 3 Si-CH 2 CH 2 CH 2 -N=C(Me)CH=C(Me)OH (Ia, 83%) and 4-(3'-triethoxysilylpropylamino)pent-3-en-2-one (EtO) 3 Si-CH 2 CH 2 CH 2 -NH-C(Me)=CH-C(O)Me (Ib, 17%). With acetylacetone trimethylsilyl ether instead of acetylacetone itself, compound Ia and silylated derivatives (Me 3 SiO) n (EtO) 3-n Si-CH 2 CH 2 CH 2 -N=C(Me)CH=C(Me)OH were obtained as admixture in 84 and 16% yields, respectively. Reactions of ligands Ia and Ib with europium and terbium propan-2-olates afforded the corresponding complexes. Formulations of lanthanide complexes, oligodimethylsiloxanediols, and 3-aminopropyl(triethoxy)silane were used to prepare transparent sol-gel films. The photoluminescence spectra of the films show narrow bands due to Eu 3+ or Tb 3+ emission. Emission from the organosilicon matrix appears as a broad band at 430 to 435 nm [ru

  15. Targeting of human GGT in a renal cell carcinoma mouse model with 99mTc-HYNIC-mAb 138H11

    International Nuclear Information System (INIS)

    Kuenstler, J.U.; Seifert, S.; Zimmermann, J.; Fischer, P.; Invancevic, V.; Johannsen, B.

    2002-01-01

    The study shows that the specific tumor uptake of 99m Tc-HYNIC-mAb 138H11 in GGT positive tumours was 2 to 5 times as high as in the controls. A high unspecific background activity was observed in the blood and in all organs well supplied with blood. (orig.)

  16. Chemical species of europium (III) in ionic force media 0.02M, 0.1M, and 0.7M NaClO{sub 4} at 298 K; Especies quimicas del europio (III) en medios de fuerza ionica 0.02M, 0.1M y 0.7M NaClO{sub 4} a 298 K

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E.; Jimenez R, M.; Solache R, M. [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

    2000-07-01

    In order to know the effects of the controlled or accidental liberation of the europium in the environment, it is necessary to know its chemical behavior in found conditions in oceans, ground and surface water. The behavior of this element in these environments can be controlled mainly by the hydrolysis and its interaction with inorganic and organic ions. (Author)

  17. CORRELATION OF {sup 48}Ca, {sup 50}Ti, AND {sup 138}La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang, E-mail: hart.chen@bristol.ac.uk [Institute of Earth Sciences, Academia Sinica, Taipei, Taiwan, ROC (China)

    2015-06-10

    Precise determinations of {sup 48}Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive {sup 48}Ca/{sup 44}Ca anomalies in all analyzed CAIs after normalization to {sup 42}Ca/{sup 44}Ca, and it is clearly shown that there is no simple correlation between {sup 48}Ca/{sup 44}Ca and {sup 50}Ti/{sup 48}Ti anomalies, in agreement with Jungck et al. Compared to the {sup 48}Ca/{sup 44}Ca versus {sup 50}Ti/{sup 48}Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated {sup 50}Ti/{sup 48}Ti. Assuming the {sup 48}Ca/{sup 44}Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess {sup 50}Ti anomalies in CAIs can be calculated by subtracting the part associated with {sup 48}Ca/{sup 44}Ca. These excesses show a linear correlation with {sup 138}La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system {sup 48}Ca, {sup 50}Ti, and {sup 138}La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II.

  18. Study of 138 Neisseria meningitidis strains isolated from blood or cerebrospinal fluid in Lombardy between 2007 and 2010

    Directory of Open Access Journals (Sweden)

    Laura Daprai

    2012-06-01

    Full Text Available Neisseria meningitidis, Streptococcus pneumoniae, and Haemophilus influenzae type b cause the majority of cases of bacterial septicaemia in children and young adults. Disease epidemiology is evolving rapidly due to the introduction of vaccines and changing in bacterial antibiotic-resistance patterns. (Asymptomatic nasopharyngeal colonization with Neisseria meningitides occurs in 5-10% of adult. The aim of this study was to calculate the frequency of each serogroup of this pathogens involved in invasive infection and to study susceptibility to antibiotics of these strains. Between March 2007 and June 2010 we received, from 43 hospitals of Lombardy, 138 strains of Neisseria meningitidis, from 138 patients aged (2-80yrs. The most frequent serogroup was B (58%, followed by serogroup C (34%, serogroup G (4% and W 135 (2%. Serogroup A end X accounted for 1% of invasive infection, each. We observed a decrease in susceptibility towards penicillin in 38% of strains. In addition we studied, by REP- PCR, genotype of 9 strains selected on the basis of epidemiological data.Among these strains, 3 different clusters according to the 3 small epidemic outbreaks occurred between June and September 2009, were recognised. Seven of these strains, although belonged to the same serogroup, brought about two different clusters. The present findings demonstrated that phenotypic data are not sufficient to define epidemic clusters, therefore molecular genotyping is required.

  19. Recurrent De Novo Mutations Affecting Residue Arg138 of Pyrroline-5-Carboxylate Synthase Cause a Progeroid Form of Autosomal-Dominant Cutis Laxa.

    Science.gov (United States)

    Fischer-Zirnsak, Björn; Escande-Beillard, Nathalie; Ganesh, Jaya; Tan, Yu Xuan; Al Bughaili, Mohammed; Lin, Angela E; Sahai, Inderneel; Bahena, Paulina; Reichert, Sara L; Loh, Abigail; Wright, Graham D; Liu, Jaron; Rahikkala, Elisa; Pivnick, Eniko K; Choudhri, Asim F; Krüger, Ulrike; Zemojtel, Tomasz; van Ravenswaaij-Arts, Conny; Mostafavi, Roya; Stolte-Dijkstra, Irene; Symoens, Sofie; Pajunen, Leila; Al-Gazali, Lihadh; Meierhofer, David; Robinson, Peter N; Mundlos, Stefan; Villarroel, Camilo E; Byers, Peter; Masri, Amira; Robertson, Stephen P; Schwarze, Ulrike; Callewaert, Bert; Reversade, Bruno; Kornak, Uwe

    2015-09-03

    Progeroid disorders overlapping with De Barsy syndrome (DBS) are collectively denoted as autosomal-recessive cutis laxa type 3 (ARCL3). They are caused by biallelic mutations in PYCR1 or ALDH18A1, encoding pyrroline-5-carboxylate reductase 1 and pyrroline-5-carboxylate synthase (P5CS), respectively, which both operate in the mitochondrial proline cycle. We report here on eight unrelated individuals born to non-consanguineous families clinically diagnosed with DBS or wrinkly skin syndrome. We found three heterozygous mutations in ALDH18A1 leading to amino acid substitutions of the same highly conserved residue, Arg138 in P5CS. A de novo origin was confirmed in all six probands for whom parental DNA was available. Using fibroblasts from affected individuals and heterologous overexpression, we found that the P5CS-p.Arg138Trp protein was stable and able to interact with wild-type P5CS but showed an altered sub-mitochondrial distribution. A reduced size upon native gel electrophoresis indicated an alteration of the structure or composition of P5CS mutant complex. Furthermore, we found that the mutant cells had a reduced P5CS enzymatic activity leading to a delayed proline accumulation. In summary, recurrent de novo mutations, affecting the highly conserved residue Arg138 of P5CS, cause an autosomal-dominant form of cutis laxa with progeroid features. Our data provide insights into the etiology of cutis laxa diseases and will have immediate impact on diagnostics and genetic counseling. Copyright © 2015 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

  20. ROOTSTOCKS EFFECTS ON THE PHYSICOCHEMICAL CHARACTERISTICS OF BORDÔ, ISABEL AND IAC 138-22 MÁXIMO MUST AND WINE

    OpenAIRE

    MARLON JOCIMAR RODRIGUES DA SILVA; LUCIANA TREVISAN BRUNELLI; MARA FERNANDES MOURA; JOSÉ LUIZ HERNANDES; SARITA LEONEL; MARCO ANTONIO TECCHIO

    2017-01-01

    ABSTRACT It has been demonstrated that rootstocks can influence grape characteristics, but there are few data in literature about the rootstocks influence in the wine characteristics, especially in wines elaborated with Vitis labrusca or hybrid grapes. This study evaluated the influence of ‘IAC 766’ and ‘106-8 Mgt’ rootstocks on the physicochemical characteristics of ‘Bordô’, ‘Isabel’ and ‘IAC 138-22 ‘Máximo’ musts and wines. The musts were evaluated for pH, soluble solids, total acidity and...

  1. New limits on 2ε, εβ{sup +} and 2β{sup +} decay of {sup 136}Ce and {sup 138}Ce with deeply purified cerium sample

    Energy Technology Data Exchange (ETDEWEB)

    Belli, P.; Bernabei, R. [INFN Sezione Roma ' ' Tor Vergata' ' , Rome (Italy); Universita di Roma ' ' Tor Vergata' ' , Dipartimento di Fisica, Rome (Italy); Boiko, R.S. [Institute for Nuclear Research, Kyiv (Ukraine); National University of Life and Environmental Sciences of Ukraine, Kyiv (Ukraine); Cappella, F. [INFN Sezione Roma, Rome (Italy); Cerulli, R.; Laubenstein, M. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Danevich, F.A.; Kropivyansky, B.N.; Polischuk, O.G.; Tretyak, V.I. [Institute for Nuclear Research, Kyiv (Ukraine); Incicchitti, A. [INFN Sezione Roma, Rome (Italy); Universita di Roma ' ' La Sapienza' ' , Dipartimento di Fisica, Rome (Italy); Mokina, V.M. [Institute for Nuclear Research, Kyiv (Ukraine); INFN Sezione Roma, Rome (Italy)

    2017-08-15

    A search for double electron capture (2ε), electron capture with positron emission (εβ{sup +}), and double positron emission (2β{sup +}) in {sup 136}Ce and {sup 138}Ce was realized with a 465 cm{sup 3} ultra-low background HP Ge γ spectrometer over 2299 h at the Gran Sasso underground laboratory. A 627 g sample of cerium oxide deeply purified by liquid-liquid extraction method was used as a source of γ quanta expected in double β decay of the cerium isotopes. New improved half-life limits were set on different modes and channels of double β decay of {sup 136}Ce and {sup 138}Ce at the level of T{sub 1/2} > 10{sup 17}-10{sup 18} yr. (orig.)

  2. Preparation of a novel fluorescence probe of terbium-europium co-luminescence composite nanoparticles and its application in the determination of proteins

    Energy Technology Data Exchange (ETDEWEB)

    Gao Feng [College of Chemistry and Materials Science, Anhui Key Laboratory of Chemo/Biosensing, Anhui Normal University, Wuhu 241000 (China)], E-mail: summit8848cn@hotmail.com; Luo Fabao; Tang Lijuan; Dai Lu [College of Chemistry and Materials Science, Anhui Key Laboratory of Chemo/Biosensing, Anhui Normal University, Wuhu 241000 (China); Wang Lun [College of Chemistry and Materials Science, Anhui Key Laboratory of Chemo/Biosensing, Anhui Normal University, Wuhu 241000 (China)], E-mail: wanglun@mail.ahnu.edu.cn

    2008-03-15

    Terbium-europium Tb-Eu/acetylacetone(acac)/poly(acrylamide) (PAM) co-luminescence composite nanoparticles were successfully prepared using the ultrasonic approach. The as-prepared composite nanoparticles show the characteristic emission spectra of Tb{sup 3+}, located at 496 and 549 nm. Furthermore, the nanoparticles are water soluble, stable and have extremely narrow emission bands and high internal fluorescence quantum yield due to the co-luminescence effect. Further studies indicate that proteins can interact with the nanoparticles and induce the fluorescence quenching of the nanoparticles. Based on the fluorescence quenching of nanopaticles in the presence of proteins, a novel method for the sensitive determination of trace amounts of proteins was proposed. Under the optimal experimental conditions, the linear ranges of calibration curves are 0-3.5 {mu}g mL{sup -1} for human serum albumin (HSA) and 0-4.0 {mu}g mL{sup -1} for {gamma}-globulin ({gamma}-IgG), respectively. The limits of detection are 7.1 for HSA and 6.7ng mL{sup -1} for {gamma}-IgG, respectively. The method was applied to the quantification of proteins in synthetic samples and actual human serum samples with satisfactory results. This proposed method is sensitive, simple and has potential application in the clinical assay of proteins.

  3. An Overview of NCRP Report No. 138 on Terrorist Activities

    Science.gov (United States)

    Poston, John, Sr.

    2005-04-01

    In late 1998, the National Council on Radiation Protection and Measurements (NCRP) convened Scientific Committee 46-14 to prepare a report on the radiological safety aspects of terrorist activities involving radioactivity. The work of this committee was funded through a contract with the Planning and Preparedness Division of the Office of Emergency Management of the Department of Energy. The committee was composed of a diverse group of individuals with expertise in many areas in addition to radiation safety and emergency response. These areas included law (both federal and state), public communications, and psychosocial aspects of such incidents. The statement of work focused the work of the committee, and the resulting report did not necessarily address all issues of such activities. One of the charges of the committee was to provide guidance as to necessary research and make recommendations regarding the present infrastructure with the responsibility for responding to such incidents. This presentation will provide an overview of NCRP Report No. 138 and focus on some of the critical issues raised in the report. These issues include recognition of the event, the interface between federal, state, and local authorities, exposure limits for the first-responders, clean-up criteria, training and resources, the psychosocial aspects of such events, and communications with the media and the public. This report represented the ``beginning'' of such considerations. It pointed the way for additional studies and research in this very important area.

  4. Emodin (1,3,8-trihydroxy-6-methylanthraquinone): a spectrophotometric reagent for the determination of beryllium(II), magnesium(II) and calcium(II)

    International Nuclear Information System (INIS)

    Pal, T.; Jana, N.R.

    1993-01-01

    The individual determination of Be II , Mg II or Ca II by conventional spectrophotometry and simultaneous determination of Mg II and Ca II in mixtures by first-derivative spectrophotometry are possible at trace levels, using emodin (1,3,8-trihydroxy-6-methylanthraquinone) as spectrophotometric reagent. Interference from other metal species, application of these methods to rock samples and statistical analysis of the results are discussed. (author)

  5. Studies on the rare earth complexes with pyridine derivatives and their N-oxide(II) - Synthesis and properties of fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with 2,2'-bipyridine-N,N'-dioxide

    International Nuclear Information System (INIS)

    Minyu, T.; Ning, T.; Yingli, Z.; Jiyuan, B.

    1985-01-01

    The solid complexes of rare earth nitrates perchlorates and thiocyanates with 2,2'-bipyridine-N,N'-dioxide (bipyO/sub 2/) have been reported. However, the corresponding complexes of other rear earth chlorides have not been investigated except lanthanum, cerium and yttrium. As an extension of our previous work on the synthesis of complexes of praseodymium and neodymium chlorides wiht bipoyO/sub 2/, the authors have now prepared fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with biphyO/sub 2/, using methanol as a reaction medium. The new synthesized compounds have been identified by means of elemental analysis, infrared spectrometry, conductometry, differential thermal analysis (DTA), thermogravimetry (TG) and X-ray powder diffraction

  6. Validation of interphase fluorescence in situ hybridization (iFISH for multiple myeloma using CD138 positive cells

    Directory of Open Access Journals (Sweden)

    Renata Kiyomi Kishimoto

    2016-06-01

    Full Text Available ABSTRACT BACKGROUND: Multiple myeloma is a plasma cell neoplasm with acquired genetic abnormalities of clinical and prognostic importance. Multiple myeloma differs from other hematologic malignancies due to a high fraction of low proliferating malignant plasma cells and the paucity of plasma cells in bone marrow aspiration samples, making cytogenetic analysis a challenge. An abnormal karyotype is found in only one-third of patients with multiple myeloma and interphase fluorescence in situ hybridization is the most useful test for studying the chromosomal abnormalities present in almost 90% of cases. However, it is necessary to study the genetic abnormalities in plasma cells after their identification or selection by morphology, immunophenotyping or sorting. Other challenges are the selection of the most informative FISH panel and determining cut-off levels for FISH probes. This study reports the validation of interphase fluorescence in situ hybridization using CD138 positive cells, according to proposed guidelines published by the European Myeloma Network (EMN in 2012. METHOD: Bone marrow samples from patients with multiple myeloma were used to standardize a panel of five probes [1q amplification, 13q14 deletion, 17p deletion, t(4;14, and t(14;16] in CD138+ cells purified by magnetic cell sorting. RESULTS: This test was validated with a low turnaround time and good reproducibility. Five of six samples showed genetic abnormalities. Monosomy/deletion 13 plus t(4;14 were found in two cases. CONCLUSION: This technique together with magnetic cell sorting is effective and can be used in the routine laboratory practice. In addition, magnetic cell sorting provides a pure plasma cell population that allows other molecular and genomic studies.

  7. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  8. Photophysical studies of highly luminescent europium(III) and terbium(III) complexes functionalized with amino and mercapto groups

    Energy Technology Data Exchange (ETDEWEB)

    Souza, E.R.; Monteiro, J.H.S.K.; Mazali, I.O.; Sigoli, F.A., E-mail: fsigoli@iqm.unicam.br

    2016-02-15

    This work proposes the replacement of coordinated-water molecules from the precursor complexes [Ln(aba){sub 3}(H{sub 2}O)] and [Ln(tta){sub 3}(H{sub 2}O){sub 2}], (Ln=Eu{sup 3+}, Gd{sup 3+} or Tb{sup 3+}, aba{sup −}=aminobenzoate, tta{sup −}=thenoyltrifluoroacetonate) by the ligands mercaptobenzoate (mba{sup −}), mercaptopropionate (mpa{sup −}), phenanthroline (phen), dimethylformamide (dmf) and acetoacetanilide (aaa{sup −}), leading to anionic or neutral amino (–NH{sub 2}) or mercapto (–SH) functionalized-lantanides (III) complexes with reasonable emission quantum yields for potential application on fluorescence microscopy of biological moieties. The complexes photophysical properties were studied using luminescence spectroscopy and theoretical models to determine the transfer and back energy transfer rates and quantum yields, that were compared with experimental ones. The anionic complexes [Eu(tta){sub 3}(L)]{sup −} showed high quantum yield values and their sensitization efficiency are in the range of 39–81%. The overlay of the ground state geometries, obtained from the Sparkle/PM3 model, of the complexes [Eu(tta){sub 3}(aba)]{sup −}, [Eu(tta){sub 3}(mba)]{sup −} and [Eu(tta){sub 3}(mpa)]{sup −}, suggest similar coordination polyhedrons occupied by the europium(III). The highest transfer rates T→{sup 5}D{sub 1,0} were obtained for the anionic complexes [Eu(tta){sub 3}(L)]{sup −} which might be a result of the low triplet level energies and R{sub L} values. - Highlights: • Lanthanides functionalized-complexes. • Free mercapto and amino groups. • Covalence degree of Eu-ligands. • Energy transfer rates. • Intrinsic and absolute quantum yields and sensitization.

  9. The extraction system: Eu{sup 3+}-water-NaCl-HDBM-Benzene; El sistema de extraccion: Eu{sup 3+}-agua-NaCl-HDBM-Benceno

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez R, M.; Solache R, M.; Rojas H, A. [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    1998-07-01

    It was studied the behavior as in acid as alkaline media of the extraction system with dissolvant integrated by trivalent europium in a 2a sodium chloride media and dibenzoylmethane (HDBM) in benzene at 303 K. It was established: the time in which the balance is reached, the influence of europium hydrolysis, the influence of atmospheric carbon dioxide, the influence of a competitive ligand such as diglycolic acid and the number of HDBM molecules that are consumed by each europium ion during extraction. The europium hydrolysis constants were determined by the potentiometric method, in presence or absence of carbonate ions and with those data distribution diagrams of the europium chemical species were obtained which were present in the aqueous phases of the extraction with dissolvant. (Author)

  10. The extraction system: Eu3+-water-NaCl-HDBM-Benzene

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.; Rojas H, A.

    1998-01-01

    It was studied the behavior as in acid as alkaline media of the extraction system with dissolvant integrated by trivalent europium in a 2a sodium chloride media and dibenzoylmethane (HDBM) in benzene at 303 K. It was established: the time in which the balance is reached, the influence of europium hydrolysis, the influence of atmospheric carbon dioxide, the influence of a competitive ligand such as diglycolic acid and the number of HDBM molecules that are consumed by each europium ion during extraction. The europium hydrolysis constants were determined by the potentiometric method, in presence or absence of carbonate ions and with those data distribution diagrams of the europium chemical species were obtained which were present in the aqueous phases of the extraction with dissolvant. (Author)

  11. Crystal structure and tautomerism of Pigment Yellow 138 determined by X-ray powder diffraction and solid-state NMR

    DEFF Research Database (Denmark)

    Gumbert, Silke D.; Körbitzer, Meike; Alig, Edith

    2016-01-01

    The crystal structure of C.I. Pigment Yellow 138 was determined from X-ray powder diffraction data using real-space methods with subsequent Rietveld refinements. The tautomeric state was investigated by solid-state 1D and 2D multinuclear NMR experiments. In the crystals, the compound exhibits...... the NH-tautomer with a hydrogen atom situated at the nitrogen of the quinoline moiety. Direct evidence of the presence of the NH-tautomer is provided by 1H–14N HMQC solid-state NMR at very fast MAS. Solid-state dispersion-corrected density functional theory calculations with BLYP-D3 confirm...

  12. Results of the radiological survey at 23 Yardboro Avenue, Albany, New York (AL138)

    International Nuclear Information System (INIS)

    Marley, J.L.

    1987-12-01

    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 23 Yardboro Avenue in Albany, New York (AL138) was the subject of a radiological investigation initiated May 7, 1986. The property was a residence with a one and one-half-story frame house located on a rectangular lot. An asphalt driveway or parking area is located at the east side of the house. An area of /approximately/10 m /times/ 14 m at the rear was inaccessible. A diagram of the property showing the approximate boundaries and the 3-m grid network established for measurements outside the house is shown. The lot included in the radiological survey was /approximately/14 m wide by 36 m deep. Front and rear views of the property are shown. 13 refs., 5 figs., 5 tabs

  13. Investigation of local environment around rare earths (La and Eu) by fluorescence line narrowing during borosilicate glass alteration

    Energy Technology Data Exchange (ETDEWEB)

    Molières, Estelle [CEA – DEN-DTCD-LCV-SECM Laboratoire d' études du Comportement à Long Terme, 30207 Bagnols-sur-Cèze (France); Panczer, Gérard; Guyot, Yannick [Institut Lumière Matière, UMR5306 Université Lyon 1-CNRS, Université de Lyon, 69622 Villeurbanne cedex (France); Jollivet, Patrick [CEA – DEN-DTCD-LCV-SECM Laboratoire d' études du Comportement à Long Terme, 30207 Bagnols-sur-Cèze (France); Majérus, Odile; Aschehoug, Patrick; Barboux, Philippe [Laboratoire de Chimie de la Matière Condensée de Paris, UMR-CNRS 7574, École Nationale Supérieure de Chimie de Paris (ENSCP Chimie-ParisTech), 11 rue Pierre et Marie Curie, 75231 Paris (France); Gin, Stéphane [CEA – DEN-DTCD-LCV-SECM Laboratoire d' études du Comportement à Long Terme, 30207 Bagnols-sur-Cèze (France); Angeli, Frédéric, E-mail: frederic.angeli@cea.fr [CEA – DEN-DTCD-LCV-SECM Laboratoire d' études du Comportement à Long Terme, 30207 Bagnols-sur-Cèze (France)

    2014-01-15

    The local environment of europium in soda-lime borosilicate glasses with a range of La{sub 2}O{sub 3} content was probed by continuous luminescence and Fluorescence Line Narrowing (FLN) to investigate the local environment of rare earth elements in pristine and leached glass. After aqueous leaching at 90 °C at pH 7 and 9.5, rare earths were fully retained and homogeneously distributed in the amorphous alteration layer (commonly called gel). Two separate silicate environments were observed in pristine and leached glasses regardless of the lanthanum content and the leaching conditions. A borate environment surrounding europium was not observed in pristine and leached glasses. During glass alteration, OH groups were located around the europium environment, which became more organized (higher symmetry) in the first coordination shell. -- Highlights: • No borate environment surrounding europium was detected in pristine borosilicate glasses. • Up to 12 mol% of REE2O3 in glass, local environment of europium does not significantly change. • Europium environment becomes more ordered and symmetric in gels than in pristine glasses. • Two distinct silicate sites were observed, as well in pristine glass as in gels (leached glasses). • In altered glasses, OH groups were located around europium.

  14. Investigation of local environment around rare earths (La and Eu) by fluorescence line narrowing during borosilicate glass alteration

    International Nuclear Information System (INIS)

    Molières, Estelle; Panczer, Gérard; Guyot, Yannick; Jollivet, Patrick; Majérus, Odile; Aschehoug, Patrick; Barboux, Philippe; Gin, Stéphane; Angeli, Frédéric

    2014-01-01

    The local environment of europium in soda-lime borosilicate glasses with a range of La 2 O 3 content was probed by continuous luminescence and Fluorescence Line Narrowing (FLN) to investigate the local environment of rare earth elements in pristine and leached glass. After aqueous leaching at 90 °C at pH 7 and 9.5, rare earths were fully retained and homogeneously distributed in the amorphous alteration layer (commonly called gel). Two separate silicate environments were observed in pristine and leached glasses regardless of the lanthanum content and the leaching conditions. A borate environment surrounding europium was not observed in pristine and leached glasses. During glass alteration, OH groups were located around the europium environment, which became more organized (higher symmetry) in the first coordination shell. -- Highlights: • No borate environment surrounding europium was detected in pristine borosilicate glasses. • Up to 12 mol% of REE2O3 in glass, local environment of europium does not significantly change. • Europium environment becomes more ordered and symmetric in gels than in pristine glasses. • Two distinct silicate sites were observed, as well in pristine glass as in gels (leached glasses). • In altered glasses, OH groups were located around europium

  15. Effect of the ion force on the hydrolysis constants and of the solubility product of Europium; Efecto de la fuerza ionica sobre las constantes de hidrolisis y del producto de solubilidad del europio

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez R, M.; Ramirez G, J.J.; Solache R, M.; Rojas H, A. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2003-07-01

    A study on the behavior of the first hydrolysis constant {beta}{sub Eu,H}{sup l-0} and the constant of the solubility product Kps of the europium in front of the changes of the ion force: 0. 02 M, 0.1 M, 0.7M, 2M, 3M and 4M of sodium perchlorate, at 303 K. Experimentally the potentiometry and also radioactivity measures its were used. The specific interaction of ions theory (SIT) of Bronsted-Guggenheim-Scatchard allows the extrapolation of the values to infinite dilution and the results were: log {beta}{sub Eu,H}{sup l-0} = -7 36 and log K{sub sp}{sup l-0} = -24. 68. A discussion of the group of results with the data of the literature is presented. (Author)

  16. Crystal structure and luminescence properties of the first hydride oxide chloride with divalent europium. LiEu{sub 2}HOCl{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Rudolph, Daniel; Schleid, Thomas [Institute for Inorganic Chemistry, University of Stuttgart (Germany); Enseling, David; Juestel, Thomas [Department of Chemical Engineering, Muenster University of Applied Sciences, Steinfurt (Germany)

    2017-11-17

    The mixed-anionic hydride oxide chloride LiEu{sub 2}HOCl{sub 2} with divalent europium was synthesized by the reduction of Eu{sub 2}O{sub 3} with LiH in a LiCl flux at 750 C for 4 d in silica-jacketed niobium capsules. According to structure determination by single-crystal X-ray diffraction the yellow compound crystallizes in the orthorhombic space group Cmcm (a = 1492.30(11) pm, b = 570.12(4) pm, c = 1143.71(8) pm, Z = 8) with a crystal structure closely related to that one of the quaternary hydride oxide LiLa{sub 2}HO{sub 3} and the hydride nitride LiSr{sub 2}H{sub 2}N. On the other hand it can also be derived from the PbFCl-type structure of EuHCl showing astonishingly short Eu{sup 2+}..Eu{sup 2+} contacts of 326 and 329 pm. Both crystallographically different Eu{sup 2+} cations have nine anionic neighbors, while all other ions (Li{sup +}, H{sup -}, O{sup 2-} and Cl{sup -}) reside in six-membered coordination spheres. LiEu{sub 2}OCl{sub 2}H exhibits a bright yellow luminescence with an emission maximum at 581 nm upon excitation at 440 nm. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. Heat treatment of investment cast PH 13-8 Mo stainless steel: Part II. Isothermal aging kinetics

    Science.gov (United States)

    Robino, C. V.; Cieslak, M. J.; Hochanadel, P. W.; Edwards, G. R.

    1994-04-01

    The hardening response of investment cast PH 13-8 Mo stainless steel has been evaluated by hardness measurements following aging in the temperature range normally specified for this alloy (510 °C to 593 °C). A new relationship between fraction transformed and hardness was developed, and analysis of the data in terms of the kinetics of precipitation, in a manner similar to that frequently applied to other precipitation-hardenable martensitic steels, yielded low time exponents and a low value for the apparent activation energy. The values of the time exponents were 0.49, 0.37, 0.56, and 0.53 at 510 °C, 538 °C, 566 °C, and 593 °C, respectively, and that for the apparent activation energy was 139 kJ/mole. As has been proposed for other maraging type steels, these estimates suggest that Β-NiAl precipitates along or near dislocations and that growth of the precipitates is dominated by dislocation pipe diffusion. However, these predictions were neither supported nor refuted by transmission electron microscopy (TEM) because of difficulties in imaging the Β-NiAl precipitates at the aging times and temperatures used. Further, analysis of the data using the formalism of Wert and Zener for the growth of precipitates with interfering diffusion fields indicated that the estimates of fraction transformed from hardness data are not fully appropriate for maraging type steels. Consideration of the nature of the Avrami analysis and the electron microscopy results suggests that other phenomena, including dislocation recovery and reversion of martensite to austenite, occur at rates sufficient to convolute the Avrami analysis. It is further suggested that these results cast doubt on the fundamental implications of previous analyses of precipitation kinetics in age-hardening martensitic steels. Although the Avrami analysis was found not to provide a tenable description of the precipitation kinetics, it does provide a reasonable methodology for portrayal of the hardening response

  18. Grazing incidence synchrotron X-ray diffraction and Moessbauer spectroscopy analyses of plasma nitrided ASTM F138 stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Danilo Olzon Dionysio de; Ardisson, Jose Domingos, E-mail: dolzon@gmail.com [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Silva, Edilaine Honorio [Studiecentrum voor Kernenergie (Belgium); Olzon-Dionysio, Maristela; Souza, Sylvio Dionysio de; Fabris, Jose Domingos [Universidade Federal dos Vales do Jequitinhonha e Mucuri (UFVJM), Diamantina, MG (Brazil); Martinez, L.G. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2016-07-01

    Full text: systematic investigation of samples of plasma-nitriding austenitic stainless steels ASTM F138 and AISI 316L is reported. The surface treatment of the steels through plasma-nitriding was used to improve further the hardness, wear and corrosion resistance of these stainless steels. The resulting layered crystallographic structure actually corresponds to several phases with close cell parameters, making their identification and quantification a real experimental challenge. The ASTM F138 and AISI 316L stainless steel disks were plasma nitrided for 4 h at 400 deg C in a 80% H{sub 2} -20% N2 atmosphere at 6 torr, using plasma current frequencies between 6 and 100 kHz. Data of Moessbauer (CEMS and CXMS) and grazing incidence synchrotron X-ray diffraction (XRD-SR) were systematically collected. The nitrided layer thickness were not in general influenced by the plasma frequency, except at 12 kHz, which produced a layer thickness of approximately 8.0 mm, being in average 40% thicker than for the other samples. CXMS and CEMS Moessbauer spectra for this 12 kHz-sample show a much more pronounced magnetic resonance lines than for the other samples. The Fe{sub 4}N phase presents a single magnetic hyperfine interaction; the other two (Fe{sub 2-3}N and the expanded austenite) present both paramagnetic and magnetic components, even though their hyperfine parameters may not be safely separated. We also present the results of XRD-SR that were probed at several depths. The data from these techniques may be consistently correlated and this leads to an improved model to explain the structure of the nitrided layers. (author)

  19. Spectrophotometric investigation of addition compounds between neodymium (III) and europium (III) perchorates and hexafluorophosphate and cyclic ligants with two oxygen in opposite position

    International Nuclear Information System (INIS)

    Oliveira, M.A.S.

    1986-01-01

    Addition compounds between Nd 3+ and Eu 3+ perchlorates and hexafluorophosphates with trans-1,4-dithino-1,4-dioxide (TDTD), pyrazine-1,4-dioxide (pyzDO), 2,5 - piperazinedione (pdo) and 1-4-diazabicyclo /2,2,2/-octane-1,4-dioxide or triethylenediamine dioxide (TEDADO) were prepared. The lanthanide content was determined by complexometric titration with EDTA. Carbon, hydrogen and nitrogen were determined by microanalytical procedures and water by the Karl Fischer method. The following stoichiometries were determined: Nd(ClO 4 ) 3 .6TDTD.8H 2 O; Eu(ClO 4 ) 3 .6TDTD.4H 2 O; Ln(PF 6 ) 3 .4TDTD.4H 2 O; Ln(ClO 4 ) 3 .4pyzDO; Ln(ClO 4 ) 3 .4pdo; Ln(ClO 4 ) 3 .3TEDADO.3H 2 O; Ln(PF 6 ) 3 .3TEDADO.3H 2 O (Ln = Nd 3+ and Eu 3+ ). X-ray powder patterns of the perchlorates show that the compounds of neodymium and europium with the respective ligands are isomorphous. The samme occurs in relation to Nd 3+ and Eu 3+ hexafluorophosphates. The results of the infared spectra, Raman spectra, absorption electronic spectra and fluorescence electronic spectra are also presented. (author) [pt

  20. Measurements of europium-152 depth profile of stone embankments exposed the Nagasaki atomic bomb for neutron spectrum analysis

    International Nuclear Information System (INIS)

    Tatsumi-Miyajima, Junko; Shimasaki, Tatsuya; Okajima, Shunzo; Takada, Jitsuya; Yoshida, Masahiro; Takao, Hideaki; Okumura, Yutaka; Nakazawa, Masaharu.

    1990-01-01

    Quantitative measurement of neutron-induced radionuclide of 152 Eu in rocks near the hypocenter (ground center of the atomic bomb explosion) in Nagasaki was performed to obtain the depth profiles and calculate the neutron energy spectrum. Core samples were drilled and taken from the stone embankments on both sides of river within a radius of 500 m from the hypocenter. After cutting each core into about 27 mm-thick sections, each section was measured its gamma-ray spectrum with a pure germanium semiconductor detector and analyzed a content of natural europium by the activation method. The highest value 8.0 x 10 -2 Bq/μg of 152 Eu at the time of the blast was obtained from the surface plates of rock cores collected near the hypocenter. The surface activity of cores was reduced with increasing the slant distances from the hypocenter. The slopes of the depth profiles were similar among samples taken from the same location. In order to analyze the depth profile of 152 Eu activity in rock andesite, experiments using a fast neutron reactor and thermal neutron reactor were carried out. Comparing the measurements on the A-bomb exposure rock with the simulated results at the reactors, among the experiments, the depth profile using the neutron moderator of 10 mm polyethylene was closed to that obtained from the A-bomb exposed samples. The experiment of thermal neutron incidence only could not reproduce the profiles from the A-bomb exposed samples. This fact indicates that the depth profiles of 152 Eu in rock exposed to the A-bomb include valuable information concerning the neutron spectrum and intensity. (author)

  1. Use of Box-Wilson method for determination of optimum conditions for extraction some lanthanoids with amines

    International Nuclear Information System (INIS)

    Kopyrin, A.A.; Murashov, V.D.; Shvedov, V.P.

    1980-01-01

    The effect of DTPA, cerium and europium nitrates concentration in the range from 10 -1 -10 -6 M on extraction and separation of americium (3), cerium (3), prometium and europium 0.2 M with the solution of tri-n-octylamine nitrate in n-xylol of concentrated lithium nitrate solutions, is investigated. The method of Box-Wilson is used to determine the optimum conditions of separation of the above elements. The maximum values of separation factors are obtained for the following pairs: cerium(3)-americium(3) - 100, americium (3)-europium - 12, promethium-americium(3) - 35, cerium(3)-promethium - 30, cerium(3)-europium - 890 [ru

  2. A simple MRI protocol in patients with clinically suspected appendicitis: results in 138 patients and effect on outcome of appendectomy

    International Nuclear Information System (INIS)

    Cobben, Lodewijk; Groot, Ingrid; Kingma, Lucas; Coerkamp, Emile; Puylaert, Julien; Blickman, Johan

    2009-01-01

    To establish the value of breathhold magnetic resonance imaging (MRI) in the diagnosis of acute appendicitis. Over a 14-month period, 138 patients clinically suspected of having appendicitis were evaluated prospectively with MRI and comprised the study group. Fast turbo spin-echo breathhold T1, T2 and T2 fat suppression sequences were used in coronal and axial planes. The imaging results were recorded separately and subsequently correlated with clinical, radiological and histopathological follow-up. The effect of imaging strategies in patients suspected of appendicitis on hospital resources was calculated. Sixty-two of the 138 patients had a histopathologically proven appendicitis. MRI determined appendicitis in 63 patients, with one examination being false positive. The resulting sensitivity and specificity were 100% and 99%, respectively. MRI showed an alternative diagnosis in 41 of the 75 remaining patients. In 22 of the remaining 34 patients, a normal appendix was depicted with MRI. In two patients, where MRI showed no appendicitis, an alternative diagnosis or normal appendix, an unnecessary appendectomy was performed. The overall effect of using MRI in patients suspected of appendicitis on the use of hospital resources could have been a net saving between EUR 55,746 and EUR 72,534. MRI has a high accuracy in detecting and excluding appendicitis, an alternative diagnosis or showing the normal appendix, and can be a valuable and cost-effective tool in the workup of patients clinically suspected of having appendicitis. (orig.)

  3. A simple MRI protocol in patients with clinically suspected appendicitis: results in 138 patients and effect on outcome of appendectomy

    Energy Technology Data Exchange (ETDEWEB)

    Cobben, Lodewijk [Medisch Centrum Haaglanden, Department of Radiology, Leidschendam (Netherlands); Groot, Ingrid [Medisch Centrum Haaglanden, Department of Surgery, Leidschendam (Netherlands); Kingma, Lucas; Coerkamp, Emile; Puylaert, Julien [Medisch Centrum Haaglanden, Department of Radiology, Den Haag (Netherlands); Blickman, Johan [Universitair Medisch Centrum St Radboud, Department of Radiology, Geert Grooteplein 10, GA, Nijmegen (Netherlands)

    2009-05-15

    To establish the value of breathhold magnetic resonance imaging (MRI) in the diagnosis of acute appendicitis. Over a 14-month period, 138 patients clinically suspected of having appendicitis were evaluated prospectively with MRI and comprised the study group. Fast turbo spin-echo breathhold T1, T2 and T2 fat suppression sequences were used in coronal and axial planes. The imaging results were recorded separately and subsequently correlated with clinical, radiological and histopathological follow-up. The effect of imaging strategies in patients suspected of appendicitis on hospital resources was calculated. Sixty-two of the 138 patients had a histopathologically proven appendicitis. MRI determined appendicitis in 63 patients, with one examination being false positive. The resulting sensitivity and specificity were 100% and 99%, respectively. MRI showed an alternative diagnosis in 41 of the 75 remaining patients. In 22 of the remaining 34 patients, a normal appendix was depicted with MRI. In two patients, where MRI showed no appendicitis, an alternative diagnosis or normal appendix, an unnecessary appendectomy was performed. The overall effect of using MRI in patients suspected of appendicitis on the use of hospital resources could have been a net saving between EUR 55,746 and EUR 72,534. MRI has a high accuracy in detecting and excluding appendicitis, an alternative diagnosis or showing the normal appendix, and can be a valuable and cost-effective tool in the workup of patients clinically suspected of having appendicitis. (orig.)

  4. Distribution of Europium between poly-maleic acid in solution or adsorbed onto alumina and Bacillus subtilis

    International Nuclear Information System (INIS)

    Markai, S.

    2002-07-01

    In order to understand the interactions of radionuclides under natural water conditions, the interactions were studied in a quaternary system composed of well characterized reference substances: europium as a heavy metal, poly-maleic acid (PMA) as model of humic substances, alumina as mineral phase and Bacillus subtilis representing biomass. The work was performed at pH=5 in 0,1 mol/L of NaClO 4 . The fundamental question addressed was to know if parameters deduced from the quantitative study of the reference systems Eu/PMA, Eu/PMA-Al 2 O 3 and Eu/Bacillus subtilis, could be used to quantify the distribution of Eu in the multi-substrate systems Eu/PMA/Bacillus subtilis and Eu/PMA-Al 2 O 3 /Bacillus subtilis. The experimental interaction data were described by a Langmuir-type model or by a surface complexation model, with surface speciation assessment by time resolved laser induced fluorescence spectroscopy. The study of the Eu/PMA system showed similarities with the Eu/ humic substances system as far as interaction strength and the nature of Eu environment were concerned. When PMA was adsorbed onto Al 2 O 3 , its complexation properties towards Eu were different. For high concentrations of Eu, a ternary complex was formed in which Eu was bound to a carboxylic function of PMA and to an aluminol function of Al 2 O 3 . For the Eu/B.subtilis system, Eu was bound to a carboxylic function and to a phosphate function. For the PMA/Eu/bacteria system, the reference systems were reversible and the parameters deduced from sub-systems allowed to quantify the distribution of Eu in the global system. In the PMA A l 2 O 3 /Eu/bacteria system, the equilibrium Eu/PMA-Al 2 O 3 was not reversible due to a diffusion of Eu in the adsorbed layer of PMA, reducing its bio-availability. (author)

  5. Multifunctional stannum oxide compact bilayer modified by europium and erbium respectively doped ytterbium fluoride for high-performance dye-sensitized solar cell

    International Nuclear Information System (INIS)

    Yue, Jingyi; Xiao, Yaoming; Li, Yanping; Han, Gaoyi

    2017-01-01

    Graphical abstract: Multifunctional SnO 2 compact bilayer respectively modified by YbF 3 :Eu 3+ (SYEu) and YbF 3 :Er 3+ (SYEr) demonstrates three functions: 1) reducing the recombination rate of electron-hole pairs, 2) improving the utilization of sunlight, and 3) enhancing the long-term stability of the photovoltaic device. Display Omitted -- Highlights: •Multifunctional SYEu/SYEr compact bilayer is designed and fabricated. •The compact bilayer exhibits a reduced electron recombination rate. •The compact bilayer shows enhanced UV and IR light response via light-conversions. •The double layer has no significant influence on arising quenching effect. -- Abstract: Multifunctional stannum oxide compact bilayer modified by europium and erbium respectively doped ytterbium fluoride (SYEu/SYEr) is designed and prepared by a convenient and low-cost spin-coating approach for dye-sensitized solar cell. The most important three functions of the compact bilayer are reducing the recombination rate of electrons as a barrier layer, enlarging the utilization of sunlight as a luminescence material both with down- and up- conversions, and enhancing the long-term stability of the device as a defender of the dye. Besides, the construction of double layer with down- and up- conversion functions has no significant influence on giving rise to quenching effect. Furthermore, these findings offer potential applications for photovoltaic device with a wide range response of sunlight via the variation in rare-earth species and cell structures.

  6. Estudio seccional de crecimiento, desarrollo y nutrición en 12.138 niños de Bogotá, Colombia

    Directory of Open Access Journals (Sweden)

    Helberto Luna Jaspe

    1971-01-01

    Full Text Available Se informan los resultados de un estudio antropométrico practicado en 12.138 individuos de ambos sexos, pertenecientes a 4 clases socio-económicas de Bogotá, Colombia. Los valores centilares encontrados en grupo de edad y sexo, se proponen como patrones de referencia en la evaluación del crecimiento de niños de comunidades de características similares a la estudiada. Se comenta acerca de la influencia de los factores ambientales sobre el potencial genético de crecimiento, así como de la capacidad de adaptación de la especie humana a las influencias ambientales.

  7. COMPETITION BEETWEN DYNAMIC RECUPERATION AND RECRYSTALLIZATION OF ASTM F 138 AUSTENITIC STAINLESS STEEL UTILIZED IN MEDICAL DEVICES

    Directory of Open Access Journals (Sweden)

    Fabio Henrique Casarini Geronimo

    2013-06-01

    Full Text Available ASTM F 138 austenitic stainless steel has being used in the manufacture of orthopedical devices by hot forging. In this work, the flow stress curves are determined by hot torsion tests in a wide range of temperatures and strain rates. With the observed microestrutural evolution by optical microscopy in different hot forming conditions in addiction with EBSD (Electron Backscatter Diffraction techniques it is possible to obtained the recrystallized volume fraction and the misorientation angles of the samples. Due to the intermediate level of stacking fault energy of this material, during the dynamic softening occurs a competition between recrystallization and recovery. The aim of this work is to identify the softening mechanisms in this stainless steel, as well as in which hot work conditions they become more active.

  8. Carbon footprint assessment of recycling technologies for rare earth elements: A case study of recycling yttrium and europium from phosphor.

    Science.gov (United States)

    Hu, Allen H; Kuo, Chien-Hung; Huang, Lance H; Su, Chao-Chin

    2017-02-01

    Rare earth elements are key raw materials in high-technology industries. Mining activities and manufacturing processes of such industries have caused considerable environmental impacts, such as soil erosion, vegetation destruction, and various forms of pollution. Sustaining the long-term supply of rare earth elements is difficult because of the global shortage of rare earth resources. The diminishing supply of rare earth elements has attracted considerable concern because many industrialized countries regarded such elements as important strategic resources for economic growth. This study aims to explore the carbon footprints of yttrium and europium recovery techniques from phosphor. Two extraction recovery methods, namely, acid extraction and solvent extraction, were selected for the analysis and comparison of carbon footprints. The two following functional units were used: (1) the same phosphor amounts for specific Y and Eu recovery concentrations, and (2) the same phosphor amounts for extraction. For acid extraction method, two acidic solutions (H 2 SO 4 and HCl) were used at two different temperatures (60 and 90°C). For solvent extraction method, acid leaching was performed followed by ionic liquid extraction. Carbon footprints from acid and solvent extraction methods were estimated to be 10.1 and 10.6kgCO 2 eq, respectively. Comparison of the carbon emissions of the two extraction methods shows that the solvent extraction method has significantly higher extraction efficiency, even though acid extraction method has a lower carbon footprint. These results may be used to develop strategies for life cycle management of rare earth resources to realize sustainable usage. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Study of the spectroscopy properties of uranium matrix doped with europium. Energy transfer between UO22+ and Eu3+

    International Nuclear Information System (INIS)

    Luiz, Jose Eduardo Monteiro de Sa

    2007-01-01

    Uranyl compounds (UO 2 2+ ) present a great potential as luminescent materials, for instance, applied in technology laser, luminescent probes, cells for conversion of energy, etc. In this work it is studied the efficiency of energy transfer in the compound Eu 3+ doped in UO 2 (MS) 2 .(H 2 O)n matrix and UO 2 2+ in Eu(MS) 3 (H 2 O)n for to be used as efficient Light Conversion Molecular Devices (LCMD) and/or in solar cells for energy conversion. It is also described the synthesis, characterization and spectroscopic study of the matrix Eu(MS) 3 .(H 2 O)n.(x%mol) UO 2 2+ and UO 2 (MS) 2 .(H 2 O)n.(x%mol) Eu 3+ (where x= 1, 3, 5 and 10). The compounds obtained was characterized by elementary analyses for determine the U 6+ concentration, infrared spectra, thermal analyses and luminescence spectra. The IR data suggest that the MS ligand acts as bidentate one. The emission spectra of Eu 3+ doped in UO 2 (MS) 2 .(H 2 O) 2 matrix showed characteristic fluorescence bands of the uranyl ion, attributed to the transition of 3 Π u -> 1 Σ g + of the uranium matrix. For the UO 2 2+ in Eu(MS) 3 (H 2 O) 6 the transitions of D o -> 7 F J (J=0 ->4 ) are predominant in the spectra. The intense europium luminescence associated with uranyl sensitising is registered in emission spectra of Eu 3+ ions in the range of 420-720 nm. The quenching rate constant of UO 2 2+ fluorescence with Eu 3+ is also determined. (author)

  10. PCB138, but not PCB153 and PCB180, acts as a weak antiandrogen in vitro

    DEFF Research Database (Denmark)

    Vinggaard, A.M.; Bonefeld-Jørgensen, Eva Cecilie

    2000-01-01

    The polychlorinated biphenyls (PCBs) constitute a group of persistent environmental chemicals including 209 possible congeners exhibiting a variety of chlorine substitution patterns. Due to their lipophilic nature and resistance toward biotransformation, PCBs accumulate in the food chain and all...... environmental matrixes including human adipose tissue, blood and milk. In most biological extracts PCB#138 (2,2',3,4,4',5-hexaCB), PCB#153 (2,2',4,4',5,5'-hexaCB), and PCB#180 (2,2',3,4,4',5,5'-heptaCB) are the dominating components. Depending on the position and number of chlorine substitutions, different...... classes of PCB congeners elicit a complex spectrum of biological and toxic responses in in vivo and in vitro models. Some PCBs exert dioxin-like activities mediated through the aryl hydrocarbon receptor (Ah receptor) giving rise to health risk such as organ toxicity and carcinogenesis. Although reports...

  11. An UHPLC-MS/MS method for simultaneous quantification of human amyloid beta peptides Aβ1-38, Aβ1-40 and Aβ1-42 in cerebrospinal fluid using micro-elution solid phase extraction.

    Science.gov (United States)

    Lin, Ping-Ping; Chen, Wei-Li; Yuan, Fei; Sheng, Lei; Wu, Yu-Jia; Zhang, Wei-Wei; Li, Guo-Qing; Xu, Hong-Rong; Li, Xue-Ning

    2017-12-01

    Amyloid beta (Aβ) peptides in cerebrospinal fluid are extensively estimated for identification of Alzheimer's disease (AD) as diagnostic biomarkers. Unfortunately, their pervasive application is hampered by interference from Aβ propensity of self-aggregation, nonspecifically bind to surfaces and matrix proteins, and by lack of quantitive standardization. Here we report on an alternative Ultra-high performance liquid chromatography-tandem mass spectrometry (UHPLC-MS/MS) method for simultaneous measurement of human amyloid beta peptides Aβ1-38, Aβ1-40 and Aβ1-42 in cerebrospinal fluid (CSF) using micro-elution solid phase extraction (SPE). Samples were pre-processing by the mixed-mode micro-elution solid phase extraction and quantification was performed in the positive ion multiple reaction monitoring (MRM) mode using electrospray ionization. The stable-isotope labeled Aβ peptides 15 N 51 - Aβ1-38, 15 N 53 - Aβ1-40 and 15 N 55 - Aβ1-42 peptides were used as internal standards. And the artificial cerebrospinal fluid (ACSF) containing 5% rat plasma was used as a surrogate matrix for calibration curves. The quality control (QC) samples at 0.25, 2 and 15ng/mL were prepared. A "linear" regression (1/x 2 weighting): y=ax+b was used to fit the calibration curves over the concentration range of 0.1-20ng/mL for all three peptides. Coefficient of variation (CV) of intra-batch and inter-batch assays were all less than 6.44% for Aβ1-38, 6.75% for Aβ1-40 and 10.74% for Aβ1-42. The precision values for all QC samples of three analytes met the acceptance criteria. Extract recoveries of Aβ1-38, Aβ1-40 and Aβ1-42 were all greater than 70.78%, both in low and high QC samples. The stability assessments showed that QC samples at both low and high levels could be stable for at least 24h at 4°C, 4h at room temperature and through three freeze-thaw cycles without sacrificing accuracy or precision. And no significant carryover effect was observed. This validated UHPLC

  12. Investigations of gamma irradiation on the properties of luminescent films of polycarbonate(PC) matrix doped with europium complex [Eu(tta)3(H2O)2

    International Nuclear Information System (INIS)

    Forster, Pedro L.; Lugao, Ademar B.; Martins, Natalia A.; Egute, Nayara S.; Parra, Duclerc F.; Brito, Hermi F.

    2009-01-01

    Luminescent lanthanide complexes have attracted much recent interest for their application as luminescent materials. The combination of unique spectroscopic properties from rare earth complexes associated to physical and chemical intrinsic properties of polymers became more attractive in the last years. A number of advantages of these substances have been reported or realized over the much studied conjugated polymers and nonlanthanide. Luminescent films composed by diaquatris(thenoyltrifluoroacetonate)europium(III) complex [Eu(tta) 3 (H 2 O) 2 ] doped into a polycarbonate (PC) matrix were prepared and irradiated at gamma radiation with 5, 10, and 20 kGy. The PC polymer was doped with 1% (w/w) of the Eu 3+ complex. The thermal properties was investigated by utilization of differential scanning calorimeter (DSC) changes in thermal stability was observed due to the addition of doping agent into the polycarbonate matrix. Changes in photophysical properties due of gamma radiation was observed by emission, excitation spectra and fourier transformed infrared spectra (FTIR). Based on the emission spectra of PC:1% Eu(tta)3 film were observed the characteristic bands arising from the 5 D 0 7 F J transitions of Eu 3+ ion (J=0-4), indicating the ability to obtain the luminescence films. (author)

  13. Carrageenan-based semi-IPN nanocomposite hydrogels: Swelling kinetic and slow release of sequestrene Fe 138 fertilizer

    Directory of Open Access Journals (Sweden)

    Mohammad Kazem Bahrami

    2016-09-01

    Full Text Available Nanocomposite hydrogels based on kappa-carrageenan were synthesized by incorporating natural sodium montmorillonite (Cloisite nanoclay. Acrylamide (AAm and methylenebisacrylamide (MBA were used as a monomer and a crosslinker, respectively. Effects of reaction variables on the swelling kinetics were studied. The results revealed that the rate of swelling for nanocomposites with high content of MBA was higher than those of nanocomposites consisting of low content of MBA. Similar to the effect of MBA, the rate of swelling enhanced as the carrageenan content was decreased. The influence of clay content on swelling rate was not remarkable. The experimental swelling data were evaluated by pseudo-first-order and pseudo-second-order kinetic models. The swelling data described well by pseudo-second-order kinetic model. Sequestrene Fe 138 (Sq as an agrochemical was loaded into nanocomposites and releasing of this active agent from nanocomposites was studied. The clay-free hydrogel released the whole loaded Sq; whereas the presence of clay restricted the release of Sq.

  14. The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure; Fragmentacion de nucleos pesados por protones de 13'8 GeV/c, como contribucion al estudio del mecanismo de interaccion y estructura nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gil Perez, D

    1967-07-01

    We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.

  15. Formation of thin luminescent Eu3+-LB films by in situ coordination with 2,3,5,6-tetra(2′-pyridyl)pyrazine and 1-octadecanol in pure and mixed Langmuir monolayers

    International Nuclear Information System (INIS)

    Fugisawa, Fernanda P.; Ramos, Ana P.; Sousa Filho, Paulo C. de; Serra, Osvaldo A.; Zaniquelli, Maria E.D.

    2012-01-01

    The in situ complexation between 2,3,5,6-tetra(2-pyridyl)pyrazine (tppz) molecules and europium ions at the air–liquid interface by means of mixed 1-octadecanol Langmuir films is reported. These films were transferred to solid supports by means of the Langmuir–Blodgett (LB) technique. The EDS maps attested the homogeneity of the LB films as well as the presence of the europium ions. The mixed alcohol/tppz LB film contained a larger amount of europium ions as compared to the pure octadecanol LB film. This work reports the production of a thin luminescent Eu 3+ film containing europium ions using only alcohol molecules as ligands—an unexpected result, since it is well known that there is an occurrence of non-radiative deactivation of excited europium by hydroxyl groups. Europium ion multiple binding sites were detected from lifetime decay measurements of these films in the presence of tppz molecules. - Highlights: ► In situ complexation of Eu (III) ions with 1-octadecanol and tppz. ► Formation of thin luminescent Eu(III)-LB films. ► EDS and luminescence studies attest to the presence of Eu(III) in the films. ► Eu(III) coordinates with both tppz and alcohol molecules at air/liquid interface. ► Relatively strong luminescence is observed in LB-films containing only Eu(III) and O–H oscillators.

  16. TH-C-19A-12: Two-Dimensional High Spatial-Resolution Dosimeter Using Europium Doped Potassium Chloride

    International Nuclear Information System (INIS)

    Li, H; Yang, D; Xiao, Z; Driewer, J; Han, Z; Low, D

    2014-01-01

    Purpose: Recent research has shown that KCl:Eu2+ has great potential for use in megavoltage radiation therapy dosimetry because this material exhibits excellent storage performance and is reusable due to strong radiation hardness. This work reports our attempts to fabricate 2D KCl:Eu2+ storage phosphor films (SPFs) using both a physical vapor deposition (PVD) method and a tape casting method. Methods: A thin layer of KCl:Eu2+ was deposited on a substrate of borosilicate glass (e.g., laboratory slides) with a PVD system. For tape casting, a homogenous suspension containing storage phosphor particles, liquid vehicle and polymer binder was formed and subsequently cast by doctor-blade onto a polyethylene terephthalate substrate to form a 150 μm thick SPF. Results: X ray diffraction analysis showed that a 10 μm thick PVD sample was composed of highly crystalline KCl. No additional phases were observed, suggesting that the europium activator had completed been incorporated into the KCl matrix. Photostimulated luminescence and photoluminescence spectra suggested that F (Cl−) centers were the electron storage centers post x ray irradiation and that Eu2+ cations acted as luminescence centers in the photostimulation process. The 150 μm thick casted KCl:Eu2+ SPF showed sub-millimeter spatial resolution. Monte Carlo simulations further demonstrated that the admixture of 20% KCl:Eu2+ and 80% low Z polymer binder exhibited almost no energy dependence in a 6 MV beam. KCl:Eu2+ pellet samples showed a large dynamic range from 0.01 cGy to 60 Gy dose-to-water, and saturated at approximately 500 Gy as a Result of its intrinsic high radiation hardness. Conclusions: This discovery research provides strong evidence that KCl:Eu2+ based SPF with associated readout apparatus could Result in a novel electronic film system that has all the desirable features associated with classic radiographic film and, importantly, water equivalence and the capability of permanent identification of

  17. Structural, optical and electrical properties of europium picrate tetraethylene glycol complex as emissive material for OLED

    Energy Technology Data Exchange (ETDEWEB)

    Kusrini, Eny, E-mail: ekusrini@che.ui.ac.id [Department of Chemical Engineering, Faculty of Engineering, Universitas Indonesia, 16424 Depok (Indonesia); Saleh, Muhammad I.; Adnan, Rohana [School of Chemical Sciences, Universiti Sains Malaysia, 11800 Penang (Malaysia); Yulizar, Yoki [Department of Chemistry, Faculty of Mathematics and Natural Sciences, Universitas Indonesia, 16424 Depok (Indonesia); Sha Shiong, Ng; Fun, H.K. [School of Physics, Universiti Sains Malaysia, 11800 Penang (Malaysia); Adhha Abdullah, M.A.; Mamat, Mazidah [Department of Chemical Sciences, Faculty of Science and Technology, Universiti Malaysia Terengganu, 21030 Kuala Terengganu, Terengganu Darul Iman (Malaysia); Za' aba, N.K.; Abd. Majid, W.H. [Solid State Research Laboratory, Department of Physics, Universiti Malaya, 50603 Kuala Lumpur (Malaysia)

    2012-01-15

    A new europium complex [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75H{sub 2}O was synthesized and used as the emission material for the single layer device structure of ITO/EO4-Eu-Pic/Al, using a spin-coating technique. Study on the optical properties of the [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75H{sub 2}O complex where EO4=tetraethylene glycol and Pic=picrate anion, had to be undertaken before being applicable to the study of an organic light emitting diode (OLED). The electrical property of an OLED using current-voltage (I-V) measurement was also studied. In complex, the Eu(III) ion was coordinated with the EO4 ligand as a pentadentate mode, one water molecule, and with two Pic anions as bidentate and monodentate modes, forming a nine-coordination number. The photoluminescence (PL) spectra of the crystalline complex in the solid state and its thin film showed a hypersensitive peak at 613.5-614.9 nm that assigned to the {sup 5}D{sub 0}{yields}{sup 7}F{sub 2} transition. A narrow band emission from the thin film EO4-Eu-Pic was obtained. The typical semiconductor I-V curve of device ITO/EO4-Eu-Pic/Al showed the threshold and turn on voltages at 1.08 and 4.6 V, respectively. The energy transfer process from the ligand to the Eu(III) ion was discussed by investigating the excitation and PL characteristics. Effect of the picrate anion on the device performance was also studied. - Highlights: > The [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75(H{sub 2}O) is crystallized in triclinic with space group P-1. > The complex is applied as a emissive center in single layer device structure of ITO/EO4-Eu-Pic/Al. > The complex displays a red luminescence in both the crystalline complex and its thin film state. > The low turn on voltage of the device (4.6 V), indicating that this material is suitable for OLED. > The roughness and morphology of the thin film affects luminance and electrical properties of OLED.

  18. TH-C-19A-12: Two-Dimensional High Spatial-Resolution Dosimeter Using Europium Doped Potassium Chloride

    Energy Technology Data Exchange (ETDEWEB)

    Li, H; Yang, D; Xiao, Z [Washington University School of Medicine, St. Louis, MO (United States); Driewer, J [University of Nebraska Medical Center, Omaha, NE (United States); Han, Z [Brigham and Womens Hospital and Harvard Medical School, Boston, MA (United States); Low, D [UCLA, Los Angeles, CA (United States)

    2014-06-15

    Purpose: Recent research has shown that KCl:Eu2+ has great potential for use in megavoltage radiation therapy dosimetry because this material exhibits excellent storage performance and is reusable due to strong radiation hardness. This work reports our attempts to fabricate 2D KCl:Eu2+ storage phosphor films (SPFs) using both a physical vapor deposition (PVD) method and a tape casting method. Methods: A thin layer of KCl:Eu2+ was deposited on a substrate of borosilicate glass (e.g., laboratory slides) with a PVD system. For tape casting, a homogenous suspension containing storage phosphor particles, liquid vehicle and polymer binder was formed and subsequently cast by doctor-blade onto a polyethylene terephthalate substrate to form a 150 μm thick SPF. Results: X ray diffraction analysis showed that a 10 μm thick PVD sample was composed of highly crystalline KCl. No additional phases were observed, suggesting that the europium activator had completed been incorporated into the KCl matrix. Photostimulated luminescence and photoluminescence spectra suggested that F (Cl−) centers were the electron storage centers post x ray irradiation and that Eu2+ cations acted as luminescence centers in the photostimulation process. The 150 μm thick casted KCl:Eu2+ SPF showed sub-millimeter spatial resolution. Monte Carlo simulations further demonstrated that the admixture of 20% KCl:Eu2+ and 80% low Z polymer binder exhibited almost no energy dependence in a 6 MV beam. KCl:Eu2+ pellet samples showed a large dynamic range from 0.01 cGy to 60 Gy dose-to-water, and saturated at approximately 500 Gy as a Result of its intrinsic high radiation hardness. Conclusions: This discovery research provides strong evidence that KCl:Eu2+ based SPF with associated readout apparatus could Result in a novel electronic film system that has all the desirable features associated with classic radiographic film and, importantly, water equivalence and the capability of permanent identification of

  19. Low lag luminescent phosphors

    International Nuclear Information System (INIS)

    1976-01-01

    The addition of potassium or rubidium salts to europium-activated fluorohalide phosphors produces X-ray screens with low lag, even at very low europium concentrations. The chemical preparation and afterglow test results are described

  20. Isolation of Human CD138+ Microparticles from the Plasma of Patients with Multiple Myeloma

    Directory of Open Access Journals (Sweden)

    Sabna Rajeev Krishnan

    2016-01-01

    Full Text Available The confinement of multiple myeloma (MM to the bone marrow microenvironment requires an invasive bone marrow biopsy to monitor the malignant compartment. The existing clinical tools used to determine treatment response and tumor relapse are limited in sensitivity mainly because they indirectly measure tumor burden inside the bone marrow and fail to capture the patchy, multisite tumor infiltrates associated with MM. Microparticles (MPs are 0.1- to 1.0-μm membrane vesicles, which contain the cellular content of their originating cell. MPs are functional mediators and convey prothrombotic, promalignant, proresistance, and proinflammatory messages, establishing intercellular cross talk and bypassing the need for direct cell-cell contact in many pathologies. In this study, we analyzed plasma cell–derived MPs (CD138+ from deidentified MM patients (n = 64 and normal subjects (n = 18 using flow cytometry. The morphology and size of the MPs were further analyzed using scanning electron microscopy. Our study shows the proof of a systemic signature of MPs in MM patients. We observed that the levels of MPs were significantly elevated in MM corresponding to the tumor burden. We provide the first evidence for the presence of MPs in the peripheral blood of MM patients with potential applications in personalized MM clinical monitoring.

  1. Isotope separation by chemical exchange process: Final technical report

    International Nuclear Information System (INIS)

    Schneider, A.

    1987-02-01

    The feasibility of a chemical exchange method for the separation of the isotopes of europium was demonstrated in the system EuCl 2 -EuCl 3 . The single stage separation factor, α, in this system is 1.001 or 1.0005 per mass unit. This value of α is comparable to the separation factors reported for the U 4+ - U 6 and U 3+ - Y 4+ systems. The separation of the ionic species was done by precipitation of the Eu 2+ ions or by extraction of the Eu 3+ ions with HDEHP. Conceptual schemes were developed for a countercurrent reflux cascades consisting of solvent extraction contractors. A regenerative electrocel, combining simultaneous europium reduction, europium oxidation with energy generation, and europium stripping from the organic phase is described. 32 refs., 22 figs., 6 tabs

  2. Observations of three bright extragalactic radiosources at the 1.38 cm wavelength with the resolution up to 8''

    International Nuclear Information System (INIS)

    Berlin, A.B.; Korenev, Yu.V.; Lesovoj, V.Yu.; Parijskij, Yu.N.; Smirnov, V.I.; Soboleva, N.S.

    1980-01-01

    New observations of radiogalaxies in the shortest wavelength region of the RATAN-600 radiotelescope were performed using the 1.38-cm radiometer. One-dimentional radiobrightness distribution of 3C 405 (Cyg A) and Cen A as well as instantaneous spectra of the nuclear sources in 3C 111, 3C 405 and Cen A are presented. Spectra of nuclear components in radiosources 3C 111 and Cen A show marked variations at the time scale of the order of three years. Fluxes for the nuclear component of Cyg A at the wavelengths greater than 3.9 cm have decreased during the last 5 years. Wavelength independence is pointed out for brightness distribution in the main components of all sources. This contradicts to some extragalactic radiosources models in which radiation losses of relativistic electrons when moving from the hot ''spots'' to ''tails'' are suggested

  3. 13.8 the quest to find the true age of the Universe and the Theory of Everything

    CERN Document Server

    Gribbin, John

    2015-01-01

    The twentieth century gave us two great theories of physics. The general theory of relativity describes the behaviour of very large things; quantum theory the behaviour of very small things. In this landmark book, John Gribbin - one of the best-known writers of popular science over the past 30 years - presents his own version of the Holy Grail of physics, the search that has been going on for decades to find a unified 'Theory of Everything' that combines these ideas into one mathematical package, a single equation that could be printed on a T-shirt, containing the answer to life, the Universe and everything. With his inimitable mixture of science, history and biography, Gribbin shows how - despite scepticism among many physicists - these two great theories are indeed very compatible, and point to a deep truth about the nature of our existence. The answer lies, intriguingly, with the age of the Universe: 13.8 billion years.

  4. Synthesis of dihydropyrimidin-2-one/thione library and cytotoxic activity against the human U138-MG and Rat C6 glioma cell lines

    International Nuclear Information System (INIS)

    Canto, Romulo F.S.; Eifler-Lima, Vera Lucia; Bernardi, Andressa; Battastini, Ana Maria O.; Russowsky, Dennis

    2011-01-01

    Two series of 4-aryl-3,4-dihydropyrimidin-2(1H)-(thio)ones including monastrol (1a), have been synthesized by an environment-friendly methodology based on the combined use of citric acid or oxalic acid and TEOF (triethylorthoformate). The library was evaluated as inhibitor of cell proliferation on two glioma cell lines (human-U138-MG and Rat-C6). The compounds derived from thiourea 1f and 1d were more cytotoxic than monastrol. The compound derived from urea 2d showed the highest cytotoxic activity among the analyzed compounds. (author)

  5. Formation of thin luminescent Eu{sup 3+}-LB films by in situ coordination with 2,3,5,6-tetra(2 Prime -pyridyl)pyrazine and 1-octadecanol in pure and mixed Langmuir monolayers

    Energy Technology Data Exchange (ETDEWEB)

    Fugisawa, Fernanda P. [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, 14040-901 Ribeirao Preto, SP (Brazil); Ramos, Ana P., E-mail: anapr@ffclrp.usp.br [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, 14040-901 Ribeirao Preto, SP (Brazil); Sousa Filho, Paulo C. de; Serra, Osvaldo A.; Zaniquelli, Maria E.D. [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, 14040-901 Ribeirao Preto, SP (Brazil)

    2012-05-15

    The in situ complexation between 2,3,5,6-tetra(2-pyridyl)pyrazine (tppz) molecules and europium ions at the air-liquid interface by means of mixed 1-octadecanol Langmuir films is reported. These films were transferred to solid supports by means of the Langmuir-Blodgett (LB) technique. The EDS maps attested the homogeneity of the LB films as well as the presence of the europium ions. The mixed alcohol/tppz LB film contained a larger amount of europium ions as compared to the pure octadecanol LB film. This work reports the production of a thin luminescent Eu{sup 3+} film containing europium ions using only alcohol molecules as ligands-an unexpected result, since it is well known that there is an occurrence of non-radiative deactivation of excited europium by hydroxyl groups. Europium ion multiple binding sites were detected from lifetime decay measurements of these films in the presence of tppz molecules. - Highlights: Black-Right-Pointing-Pointer In situ complexation of Eu (III) ions with 1-octadecanol and tppz. Black-Right-Pointing-Pointer Formation of thin luminescent Eu(III)-LB films. Black-Right-Pointing-Pointer EDS and luminescence studies attest to the presence of Eu(III) in the films. Black-Right-Pointing-Pointer Eu(III) coordinates with both tppz and alcohol molecules at air/liquid interface. Black-Right-Pointing-Pointer Relatively strong luminescence is observed in LB-films containing only Eu(III) and O-H oscillators.

  6. A visible-light-excited europium(III) complex-based luminescent probe for visualizing copper ions and hydrogen sulfide in living cells

    Science.gov (United States)

    Wang, Yiren; Wang, Huan; Yang, Mei; Yuan, Jingli; Wu, Jing

    2018-01-01

    Development of visible-light-excited lanthanide (III) complex-based luminescent probes is highly appealing due to their superiority of less damage to the living biosystems over the conventional UV-light-excited ones. In this work, a visible-light-excited europium (III) complex-based luminescent probe, BPED-BHHCT-Eu3+-BPT, has been designed and synthesized by conjugating the Cu2+-binding N,N-bis(2-pyridylmethyl)ethanediamine (BPED) to a tetradentate β-diketone ligand 4,4‧-bis(1″,1″,1″,2″,2″,3″,3″-heptafluoro-4″,6″-hexanedione-6″-yl)chlorosulfo-o-terphenyl (BHHCT) and coordinating with a coligand 2-(N,N-diethylanilin-4-yl)-4,6-bis(pyrazol-1-yl)-1,3,5-triazine) (BPT) for the time-gated luminescence detection of Cu2+ ions and hydrogen sulfide (H2S) in living cells. BPED-BHHCT-Eu3+-BPT exhibited a sharp excitation peak at 407 nm and a wide excitation window extending to beyond 460 nm. Upon its reaction with Cu2+ ions, the luminescence of BPED-BHHCT-Eu3+-BPT was efficiently quenched, which could be reversibly restored by the addition of H2S due to the strong affinity between Cu2+ ions and H2S. The "on-off-on" type luminescence behavior of BPED-BHHCT-Eu3+-BPT towards Cu2+ ions and H2S enabled the sensing of the two species with high sensitivity and selectivity. The performances of BPED-BHHCT-Eu3+-BPT for visualizing intracellular Cu2+ ions and H2S were investigated, and the results have demonstrated the practical applicability of the probe for molecular imaging of cells.

  7. Photoluminescent study of Polycarbonate (PC) and Poly(9-vinylcarbazole) (PVK) doped films with europium complex; Estudo fotoluminescente de filmes de Policarbonato (PC) e Poli(9-vinilcarbazol) (PVK) dopados com complexo de europio

    Energy Technology Data Exchange (ETDEWEB)

    Forster, Pedro Lima

    2010-07-01

    Polymers doped with rare earth complexes are advantaged in film production for many applications in the luminescent field. In this study luminescent polymer obtained from polycarbonate (PC) and poly(9-vinylcarbazole) films doped with diaquatris(thenoyltrifluoroacetonate)europium(III) complex [Eu(tta){sub 3}(H{sub 2}0){sub 2}] were prepared and their calorimetric and luminescent properties in the solid state are reported. The thermal behavior was investigated by differential scanning calorimetry (OSC) and thermogravimetry analysis (TGA). Due of the addition of rare earth Eu(tta){sub 3}(H{sub 2}0){sub 2}] into PC and PVK matrices, changes were observed in the thermal behavior concerning the glass transition and thermal stability. Characteristic broadened narrow bands arising from the {sup 5}D{sub 0} -{yields} {sup 7}F{sub J} transitions (J = 0-4) of Eu{sup 3+} ion indicate the incorporation of the Eu{sup 3+} ions into those polymers. The luminescent films show enhancement emission intensity with an increase in the rare earth concentration in polymeric matrix accompanied by decrease in thermal stability. (author)

  8. Excited state interaction between Hydrochlorothiazide and europium ion in PMMA polymer and its application as optical sensor for Hydrochlorothiazide in tablet and serum samples

    Energy Technology Data Exchange (ETDEWEB)

    Attia, M.S., E-mail: Mohamed_sam@yahoo.com [Department of Chemistry, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt); Othman, A.M. [Environmental Biotechnology, Genetic Engineering and Biotechnology Institute, Menofiea University (Egypt); Youssef, A.O. [Department of Chemistry, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt); El-Raghi, E. [Environmental Biotechnology, Genetic Engineering and Biotechnology Institute, Menofiea University (Egypt)

    2012-08-15

    This paper reports on a facile technique combined with a simple, sensitive and selective spectrofluorimetric method for the determination of hydrochlorothiazide. In methanol, at pH 8.3 and {lambda}{sub ex}=340, hydrochlorothiazide can remarkably enhance the luminescence intensity of the Eu{sup 3+} ion doped in polymethylmethacrylate polymer (PMMA) matrix. This could be due to the energy transfer from hydrochlorothiazide to Eu{sup 3+} in the excited stated. At the optimized experimental conditions, the enhancement of the characteristic emission band (617 nm) of Eu{sup 3+} ion doped PMMA is directly proportional to the concentration of hydrochlorothiazide with a dynamic range of 5 Multiplication-Sign 10{sup -8}-1.0 Multiplication-Sign 10{sup -5} mol L{sup -1} and detection limit of 8.0 Multiplication-Sign 10{sup -9} mol L{sup -1}. Application of the suggested method was successfully applied to the determination of hydrochlorothiazide in pharmaceutical preparations and human serum samples, with high percentage of recovery, good accuracy and precision. - Highlights: Black-Right-Pointing-Pointer HCT was determined by europium sensitized by HCT in PMMA polymer. Black-Right-Pointing-Pointer Band at 617 nm of Eu{sup 3+} ion ({sup 5}D{sub 0}{yields}{sup 7}F{sub 2}) is sensitive to HCT concentration. Black-Right-Pointing-Pointer Recovery and R.S.D for tablets serum samples in proposed method were calculated. Black-Right-Pointing-Pointer Method is verified for HCT determination in real samples with no interferences.

  9. MERLIN observations of the OH/IR stars OH 53.6-0.2, OH 138.0+7.2 and OH 141.7+3.5

    International Nuclear Information System (INIS)

    Chapman, J.; Cohen, R.J.; Norris, R.P.; Diamond, P.J.; Booth, R.S.

    1984-01-01

    OH maser emission from the three OH/IR stars OH 53.6-0.2, OH 138.0+7.2 and OH 141.7+3.5 has been mapped with an angular resolution of 0.28 arcsec and a velocity resolution of 0.7 km s -1 using the Jodrell Bank MERLIN array. Maps are presented of the 1612-MHz OH emission over individual velocity ranges. The maps are consistent with a uniform expanding shell model, and by fitting such models to the data the angular diameters of the shells have been estimated to an accuracy of approx. 25 per cent. (author)

  10. Corrosion fatigue investigation of a high nitrogen 12% Cr-steel and of a high strength martensitic PH 13-8 Mo steel under simulated steam turbine conditions. Final report

    International Nuclear Information System (INIS)

    Schmitt-Thomas, K.G.; Schweigart, H.

    1992-01-01

    This report summarizes the results of the corrosion fatigue investigations of two martensitic stainless steels (PH 13-8 Mo, X20 CrMoV 12 1; corrosion medium: 0,01 m NaCl or 22 wt% NaCl; pH value 3 or 7). The working programm includes electrochemical and corrosion fatigue tests. Also chemical analysis, mechanical-technological and metallographical as SEM investigations were performed. (orig.)

  11. Raman spectroscopic study of the oxidation state of Eu in molten LiCl-KCl

    Energy Technology Data Exchange (ETDEWEB)

    Park, Seung; Yun, Jong-Il [KAIST, Daejeon(Korea, Republic of)

    2016-10-15

    Spectroscopy can provide high reliability for the quantitative analysis of such system. The molar absorptivity of Eu(II) at 325 nm is reported as about 1645 M{sup -1}cm{sup -1}, which is too high to apply to higher concentration. A high-temperature Raman spectroscopy has been set and employed for analyzing the molecular structure and coordination complex and investigating the oxidation state of europium in molten LiCl-KCl. Europium can be present in divalent state while many other lanthanides exist in trivalent state. The thermodynamic properties of europium ions have been studied using electrochemical methods, spectroscopic methods, and EPR technique. Although there has been discrepancy of the reduced amount of europium in previous works, the majority of Eu(III) is thought to be reduced to Eu(II) in molten LiCl-KCl spontaneously at relatively low concentration (< 7.5 × 10{sup -4} M). Raman spectroscopy was employed to investigate the oxidation state of EuClx in LiCl-KCl at 500 .deg. C. The Raman scattering results suggest the majority of trivalent europium is reduced to divalent state with the composition change by vaporization. The Raman bands show highly asymmetric structure, quite different from regular octahedral structure.

  12. Environmental Assessment for Central Power and Light Company`s proposed Military Highway-CFE tie 138/69-kV transmission line project Brownsville, Cameron County, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1992-04-01

    Central Power and Light Company (CPL) intends to upgrade its existing transmission line ties with the Commision Federal de Electricidad (CFE) system in Mexico. CPL currently has a single 69-kilovolt (kV) transmission line in the Brownsville area which connects CPL`s system with the system of CFE. This existing line runs between the Brownsville Switching Station, located on Laredo Road in Brownsville, Cameron County, Texas, and an existing CFE 69-kV line at the Rusteberg Bend of the Rio Grande in Cameron County. Under current conditions of need, the existing 69-kV line does not possess sufficient capability to engage in appropriate power exchanges. Therefore, CPL is proposing to build a new line to link up with CFE. This proposed line would be a double-circuit line, which would (1) continue (on a slightly relocated route) the existing 69-kV tie from CPL`s Brownsville Switching Station to CFE`s facilities, and (2) add a 138-kV tie from the Military Highway Substation, located on Military Highway (US Highway 281), to CFE`s facilities. The proposed 138/69-kV line, which will be constructed and operated by CPL, will be built primarily on steel single-pole structures within an average 60-foot (ft) wide right-of-way (ROW). It will be approximately 6900--9200 ft (1.3--1.7 miles) in length, depending on the alternative route constructed.

  13. Establishment and antitumor effects of dasatinib and PKI-587 in BD-138T, a patient-derived muscle invasive bladder cancer preclinical platform with concomitant EGFR amplification and PTEN deletion.

    Science.gov (United States)

    Chang, Nakho; Lee, Hye Won; Lim, Joung Eun; Jeong, Da Eun; Song, Hye Jin; Kim, Sudong; Nam, Do-Hyun; Sung, Hyun Hwan; Jeong, Byong Chang; Seo, Seong Il; Jeon, Seong Soo; Lee, Hyun Moo; Choi, Han-Yong; Jeon, Hwang Gyun

    2016-08-09

    Muscle-invasive bladder cancer (MIBC) consists of a heterogeneous group of tumors with a high rate of metastasis and mortality. To facilitate the in-depth investigation and validation of tailored strategies for MIBC treatment, we have developed an integrated approach using advanced high-throughput drug screening and a clinically relevant patient-derived preclinical platform. We isolated patient-derived tumor cells (PDCs) from a rare MIBC case (BD-138T) that harbors concomitant epidermal growth factor receptor (EGFR) amplification and phosphatase and tensin homolog (PTEN) deletion. High-throughput in vitro drug screening demonstrated that dasatinib, a SRC inhibitor, and PKI-587, a dual PI3K/mTOR inhibitor, exhibited targeted anti-proliferative and pro-apoptotic effects against BD-138T PDCs. Using established patient-derived xenograft models that successfully retain the genomic and molecular characteristics of the parental tumor, we confirmed that these anti-tumor responses occurred through the inhibition of SRC and PI3K/AKT/mTOR signaling pathways. Taken together, these experimental results demonstrate that dasatinib and PKI-587 might serve as promising anticancer drug candidates for treating MIBC with combined EGFR gene amplification and PTEN deletion.

  14. The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure

    International Nuclear Information System (INIS)

    Gil Perez, D.

    1967-01-01

    We present he re an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs

  15. Study of rare earth elements as material for control rods

    International Nuclear Information System (INIS)

    1975-03-01

    The properties of rare earth elements as the material for control rods were studied. The rare earth elements, especially europium oxide, has the nuclear property corresponding to boron carbide, and its neutron absorption process does not emit alpha particles. The elements produced as a result of neutron capture also have large capture cross sections. This paper presents survey report on the properties and nuclear properties of rare earth elements, and comparison with other materials. Preliminary experiment was performed to make the pellets of europium oxide, and is described in this paper. Because of large density, the crystal form to be made was monoclinic system. Europium hydroxide was decomposed at 1000 0 C and 10 -5 torr. The obtained powder was dipped into benzene, and dryed in the air at 450 0 C. This powder was pressed and sintered in the air for one hour at 1500 0 C. The density of the obtained pellets was 97.0% of the theoretical density. The cross section of europium for fast neutron absorption is not yet accurately obtained, and is in the range between 4.65 and 8.5 barn for 151 Eu(n,γ) reaction. Since chain absorption reaction is caused in Eu, the overall capability of neutron absorption is not much changed by the loss of original material due to absorption. The pellets of europium oxide may be handled in air, but must be kept in dry atmosphere. The reactions of europium oxide with various metals were also investigated. The characteristic behavior in case of irradiation depends on the amount of silicon contained, and it was very good if the amount was less than 0.03%. (Kato, T.)

  16. Studies on laser-assisted Penning ionization by the optogalvanic effect in Ne/Eu hollow cathode discharge.

    Science.gov (United States)

    Saini, V K; Kumar, P; Dixit, S K; Nakhe, S V

    2015-02-01

    Laser-assisted Penning ionization (LAPI) is detected in a Ne/Eu hollow cathode (HC) discharge lamp using the pulsed optogalvanic (OG) method. In the Ne/Eu discharge, doubly ionized europium excited energy levels Eu[4f(7)(P(7/2,5/2)6)] lie within the thermal limit (∼kT) from the laser-excited neon's energy level [2p(5)(P3/202)3p or 2p(8) (in Paschen notation)] lying at 149,848  cm(-1). Therefore, Penning ionization (PI) of europium atoms likely to occur into its highly excited ionic states is investigated. To probe the PI of europium, the temporal profiles of its counterpart neon OG signal are studied as a function of discharge current for the transitions (1s(4)→2p(8)) and (1s(2)→2p(2)), corresponding to 650.65 and 659.89 nm wavelengths, respectively. It is observed that PI of europium alters the overall discharge characteristics significantly and, hence, modifies the temporal profile of the OG signals accordingly. The quasi-resonant ionizing energy transfer collisions between laser-excited Ne 2p(8) atoms and electronically excited europium P(9/2)10 atoms are used to explain the LAPI mechanism. Such LAPI studies carried out in HC discharge could be useful for the discharge of a metal-vapor laser with appropriate Penning mixtures.

  17. Europium-decorated graphene quantum dots as a fluorescent probe for label-free, rapid and sensitive detection of Cu(2+) and L-cysteine.

    Science.gov (United States)

    Lin, Liping; Song, Xinhong; Chen, Yiying; Rong, Mingcong; Wang, Yiru; Zhao, Li; Zhao, Tingting; Chen, Xi

    2015-09-03

    In this work, europium-decorated graphene quantum dots (Eu-GQDs) were prepared by treating three-dimensional Eu-decorated graphene (3D Eu-graphene) via a strong acid treatment. Various characterizations revealed that Eu atoms were successfully complexed with the oxygen functional groups on the surface of graphene quantum dots (GQDs) with the atomic ratio of 2.54%. Compared with Eu free GQDs, the introduction of Eu atoms enhanced the electron density and improved the surface chemical activities of Eu-GQDs. Therefore, the obtained Eu-GQDs were used as a novel "off-on" fluorescent probe for the label-free determination of Cu(2+) and l-cysteine (L-Cys) with high sensitivity and selectivity. The fluorescence intensity of Eu-GQDs was quenched in the presence of Cu(2+) owing to the coordination reaction between Cu(2+) and carboxyl groups on the surface of the Eu-GQDs. The fluorescence intensity of Eu-GQDs recovered with the subsequent addition of L-Cys because of the strong affinity of Cu(2+) to L-Cys via the Cu-S bond. The experimental results showed that the fluorescence variation of the proposed approach had a good linear relationship in the range of 0.1-10 μM for Cu(2+) and 0.5-50 μM for L-Cys with corresponding detection limits of 0.056 μM for Cu(2+) and 0.31 μM for L-Cys. The current approach also displayed a special response to Cu(2+) and L-Cys over the other co-existing metal ions and amino acids, and the results obtained from buffer-diluted serum samples suggested its applicability in biological samples. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Avaliação de compostos fenólicos em geléia de uva produzida com a variedade IAC-138-22 (máximo)

    OpenAIRE

    Luciula Lemos Lima Morelli

    2011-01-01

    Resumo: O presente trabalho buscou avaliar a presença de compostos fenólicos antioxidantes em geleia de uva produzida com a variedade Máximo (IAC-138-22), por meio de (1) métodos colorimétricos e (2) cromatografia liquida de alta eficiência. Foram produzidas 3 formulações de geleia com a nova variedade e 3 outras com a mistura entre as variedades Niágara Rosada e Isabel, para efeito comparativo. As formulações diferiam em relação à quantidade de casca de uva incorporada à formulação, sendo a ...

  19. Mechanical properties of Zr41.2Ti13.8Ni10Cu12.5Be22.5 bulk metallic glass with different geometric confinements

    Science.gov (United States)

    Zhang, Changqin; Zhang, Haifeng; Sun, Qilei; Liu, Kegao

    2018-03-01

    Zr41.2Ti13.8Ni10Cu12.5Be22.5 (Vit 1) bulk metallic glass with Cu sleeves at different positions was prepared by the Cu mold casting method, and the effects of different geometric confinements offered by Cu sleeves on the mechanical properties of Vit 1 were investigated. It was found that the mechanical properties were prominently influenced by different geometric confinements and the plasticity could be modified by optimizing the positions of Cu sleeves. The results revealed that shear band initiation and propagation could be efficiently intervened by changing the radial boundary restraints, which led to quite different mechanical behaviors.

  20. Production of a tracer packet of heavier rare earth elements

    International Nuclear Information System (INIS)

    Lahiri, S.; Nayak, D.; Maji, S.

    2004-01-01

    Production of a tracer packet of heavier rare earth elements containing carrier-free radionuclides of 153,155 Tb, 153,155,157 Dy, 159 Ho, 159,161 Er, 161 Tm produced by medium energy 7 Li and 12 C irradiation on an europium oxide target and the subsequent separation of bulk europium from the carrier-free products is described. (author)

  1. A138

    Directory of Open Access Journals (Sweden)

    K. Yurchenko

    2015-11-01

    Thus, results suggest that vascular disruption in the NDV-treated group indicates the virus ability to directly or indirectly affect tumor angiogenesis and regulate tissue trophism in that way. Understanding how and in which step this effect occurs may provide capacity to use oncolytic NDV strains for therapeutic benefit.

  2. Electron tunneling transport across heterojunctions between europium sulfide and indium arsenide

    Science.gov (United States)

    Kallaher, Raymond L.

    This dissertation presents research done on utilizing the ferromagnetic semiconductor europium sulfide (EuS) to inject spin polarized electrons into the non-magnetic semiconductor indium arsenide (InAs). There is great interest in expanding the functionality of modern day electronic circuits by creating devices that depend not only on the flow of charge in the device, but also on the transport of spin through the device. Within this mindset, there is a concerted effort to establish an efficient means of injecting and detecting spin polarized electrons in a two dimensional electron system (2DES) as the first step in developing a spin based field effect transistor. Thus, the research presented in this thesis has focused on the feasibility of using EuS, in direct electrical contact with InAs, as a spin injecting electrode into an InAs 2DES. Doped EuS is a concentrated ferromagnetic semiconductor, whose conduction band undergoes a giant Zeeman splitting when the material becomes ferromagnetic. The concomitant difference in energy between the spin-up and spin-down energy bands makes the itinerant electrons in EuS highly spin polarized. Thus, in principle, EuS is a good candidate to be used as an injector of spin polarized electrons into non-magnetic materials. In addition, the ability to adjust the conductivity of EuS by varying the doping level in the material makes EuS particularly suited for injecting spins into non-magnetic semiconductors and 2DES. For this research, thin films of EuS have been grown via e-beam evaporation of EuS powder. This growth technique produces EuS films that are sulfur deficient; these sulfur vacancies act as intrinsic electron donors and the resulting EuS films behave like heavily doped ferromagnetic semiconductors. The growth parameters and deposition procedures were varied and optimized in order to fabricate films that have minimal crystalline defects. Various properties and characteristics of these EuS films were measured and compared to

  3. The effect of equal channel angular pressing on the tensile properties and microstructure of two medical implant materials: ASTM F-138 austenitic steel and Grade 2 titanium

    Science.gov (United States)

    Mendes Filho, A. de A.; Sordi, V. L.; Kliauga, A. M.; Ferrante, M.

    2010-07-01

    Titanium and F-138 stainless steel are employed in bone replacement and repair. The former material was ECAP-deformed at room temperature and at 300°C, followed in some cases by cold rolling. The steel was ECAP-deformed at room temperature only. Work-hardening behavior was studied by making use of the Kocks-mecking plots and microstructural evolution was followed by TEM. Conclusions show that for Ti, ECAP combined with cold rolling gives the best strength-ductility combination, whilst room temperature ECAP increases the tensile strength of the steel but caused substantial ductility loss.

  4. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    International Nuclear Information System (INIS)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed

  5. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    Science.gov (United States)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.

  6. A educação como projeto de melhoramento racial: uma análise do art. 138 da Constituição de 1934 (Education as a racial enhancement project: an analysis of art. 138 of the 1934 Brazilian Constitution

    Directory of Open Access Journals (Sweden)

    Simone Rocha

    2018-01-01

    Full Text Available Historically, laws are created to meet the needs of a particular place and time, taking into account cultural, ideological and political aspects on which they act. In this sense, the Brazilian parliamentarians intended to encourage the promotion of an “eugenic education” by adopting legislative and administrative measures related to social hygiene, seeking racial “improvement” through socio-educational measures. For the eugenics, the “education” factor would only have the purpose of stimulating the good strains of the “well born.” The bill advocated in Art. 138 of the 1934 Constitution would pretend to act before a population constituted mostly of blacks and mulattos, making it diffcult for them to contract marriage with white people of high social status. The present article sought to analyze the discourse of parliamentarians and eugenics that defended and articulated the preliminary project that advocated the encouragement of eugenic education in a moment of signifcant historical and educational importance. Approaching this theme leads us to think how political actions, articulated aiming at racial improvement, influenced the decisions in the educational policy of the country, and for which social segments did they effectively act as a propellant of social and human development though education. Historicamente as leis são criadas visando atender às necessidades de um determinado local e tempo, levando em consideração aspectos culturais, ideológicos e políticos sobre os quais atuam. Nesse sentido, os parlamentares brasileiros pretendiam fomentar o estímulo a uma “educação eugênica” pela adoção de medidas legislativas e administrativas relacionadas à higiene social buscando o “melhoramento” racial através de medidas sócio/educativas. Logo, para os eugenistas, o fator “educação” teria apenas o objetivo de estimular as boas estirpes dos “bem nascidos”. O projeto de lei defendido no Art. 138, da

  7. A lanthanide complex with dual biosensing properties: CEST (chemical exchange saturation transfer) and BIRDS (biosensor imaging of redundant deviation in shifts) with europium DOTA-tetraglycinate.

    Science.gov (United States)

    Coman, Daniel; Kiefer, Garry E; Rothman, Douglas L; Sherry, A Dean; Hyder, Fahmeed

    2011-12-01

    Responsive contrast agents (RCAs) composed of lanthanide(III) ion (Ln3R) complexes with a variety of1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate (DOTA4S) derivatives have shown great potential as molecular imaging agents for MR. A variety of LnDOTA–tetraamide complexes have been demonstrated as RCAs for molecular imaging using chemical exchange saturation transfer (CEST). The CEST method detects proton exchange between bulk water and any exchangeable sites on the ligand itself or an inner sphere of bound water that is shifted by a paramagnetic Ln3R ion bound in the core of the macrocycle. It has also been shown that molecular imaging is possible when the RCA itself is observed (i.e. not its effect on bulk water) using a method called biosensor imaging of redundant deviation in shifts (BIRDS). The BIRDS method utilizes redundant information stored in the nonexchangeable proton resonances emanating from the paramagnetic RCA for ambient factors such as temperature and/or pH.Thus, CEST and BIRDS rely on exchangeable and nonexchangeable protons, respectively, for biosensing. We posited that it would be feasible to combine these two biosensing features into the same RCA (i.e. dual CEST and BIRDS properties). A complex between europium(III) ion (Eu3R) and DOTA–tetraglycinate [DOTA–(gly)S4] was used to demonstrate that its CEST characteristics are preserved, while its BIRDS properties are also detectable. The in vitro temperature sensitivity of EuDOTA–(gly)S4 was used to show that qualitative MR contrast with CEST can be calibrated using quantitative MR mapping with BIRDS, thereby enabling quantitative molecular imaging at high spatial resolution.

  8. HIGH-TIME-RESOLUTION MEASUREMENTS OF THE POLARIZATION OF THE CRAB PULSAR AT 1.38 GHz

    Energy Technology Data Exchange (ETDEWEB)

    Słowikowska, Agnieszka [Kepler Institute of Astronomy, University of Zielona Góra, Lubuska 2, 65-265 Zielona Góra (Poland); Stappers, Benjamin W. [Jodrell Bank Centre for Astrophysics, University of Manchester, Manchester M13 9PL (United Kingdom); Harding, Alice K. [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); O' Dell, Stephen L.; Elsner, Ronald F.; Weisskopf, Martin C. [Astrophysics Office, NASA Marshall Space Flight Center, ZP12, Huntsville, AL 35812 (United States); Van der Horst, Alexander J. [Astronomical Institute, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands)

    2015-01-20

    Using the Westerbork Synthesis Radio Telescope, we obtained high-time-resolution measurements of the full polarization of the Crab pulsar. At a resolution of 1/8192 of the 34 ms pulse period (i.e., 4.1 μs), the 1.38 GHz linear-polarization measurements are in general agreement with previous lower-time-resolution 1.4 GHz measurements of linear polarization in the main pulse (MP), in the interpulse (IP), and in the low-frequency component (LFC). We find the MP and IP to be linearly polarized at about 24% and 21% with no discernible difference in polarization position angle. However, contrary to theoretical expectations and measurements in the visible, we find no evidence for significant variation (sweep) in the polarization position angle over the MP, the IP, or the LFC. We discuss the implications, which appear to be in contradiction to theoretical expectations. We also detect weak circular polarization in the MP and IP, and strong (≈20%) circular polarization in the LFC, which also exhibits very strong (≈98%) linear polarization at a position angle of 40° from that of the MP or IP. The properties are consistent with the LFC, which is a low-altitude component, and the MP and IP, which are high-altitude caustic components. Current models for the MP and IP emission do not readily account for the absence of pronounced polarization changes across the pulse. We measure IP and LFC pulse phases relative to the MP consistent with recent measurements, which have shown that the phases of these pulse components are evolving with time.

  9. Alignment creation in atomic ensembles by elastic electron scattering; the case of 138Ba(...6s6p 1P1) atoms

    International Nuclear Information System (INIS)

    Trajmar, S.; Kanik, I.; LeClair, L.R.; Khakoo, M.A.; Bray, I.; Fursa, D.; Csanak, G.

    1998-01-01

    We describe some of our results from a joint experimental and theoretical program concerning elastic electron scattering by 138 Ba(...6s6p 1 P 1 ) atoms. From the experimental results, we derived various scattering parameters and magnetic sublevel specific differential elastic scattering cross sections at impact energy (E 0 ) of 20.0 eV and at scattering angles (θ) of 10deg, 15deg, and 20deg. The same parameters and cross sections were calculated by the convergent close coupling (CCC) approximation and compared to the experimental results. An excellent agreement, found for the two sets of data, gave us confidence in the CCC method and allowed us to extend the angular and energy ranges for the purpose of generating integral elastic scattering cross sections needed for the deduction of the alignment creation cross sections. (J.P.N.)

  10. Investigation of precipitation and hardening response of maraging stainless steels 17-4 and 13-8+Mo during multi-pass welding

    Science.gov (United States)

    Hamlin, Robert J.

    Martensitic precipitation strengthened stainless steels 17-4 and 13-8+Mo are candidate alloys for high strength military applications. These applications will require joining by fusion welding processes thus, it is necessary to develop an understanding of microstructural and mechanical property changes that occur during welding. Previous investigations on these materials have demonstrated that significant softening occurs in the heat affected zone (HAZ) during welding, due to dissolution of the strengthen precipitates. It was also observed that post weld heat treatments (PWHT's) were required to restore the properties. However, PWHT's are expensive and cannot be applied when welding on a large scale or making a repair in the field. Thus, the purpose of the current work is to gain a fundamental understanding of the precipitation kinetics in these systems so that optimized welding procedures can be developed that do not require a PWHT. Multi-pass welding provides an opportunity to restore the strengthening precipitates that dissolve during primary weld passes using the heat from secondary weld passes. Thus, a preliminary investigation was performed to determine whether the times and temperatures associated with welding thermal cycles were sufficient to restore the strength in these systems. A Gleeble thermo-mechanical simulator was used to perform multi-pass welding simulations on samples of each material using a 1000 J/mm and 2000 J/mm heat input. Additionally, base metal and weld metal samples were used as starting conditions to evaluate the difference in precipitation response between each. Hardness measurements were used to estimate the extent of precipitate dissolution and growth. Microstructures were characterized using light optical microscopy (LOM), scanning electron microscopy (SEM), and energy dispersive spectrometry (EDS). It was determined that precipitate dissolution occurred during primary welding thermal cycles and that significant hardening could be

  11. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  12. International Conference: Fundamentals of Laser Assisted Micro- & Nanotechnologies (FLAMN-07). Workshop: Laser Cleaning and Artworks Conservation (LCAC). St. Petersburg, Russia, 25-28 June 2007. Abstracts

    Science.gov (United States)

    2007-06-28

    DIKETONATE OF EUROPIUM (EUFOD3) CONFINED IN MICROPOROUS GLASS: UV LASER INDUCED LUMINESCENCE KINETICS AND QUANTUM YIELD...efficiency of controllable laser thermal cleavage of insulating materials,” J.Opt.Technol. 71, 117-120 (2004). WEDNESDAY, JUNE 27 Laser-induced static...PS2_23 B-diketonate of europium (EuFOD3) confined in microporous glass: UV laser induced luminescence kinetics and quantum yield Chutko E.A.1

  13. Phosphors containing boron and metals of Group IIIA and IIIB

    Science.gov (United States)

    Setlur, Anant Achyut; Srivastava, Alok Mani; Comanzo, Holly Ann; Manivannan, Venkatesan

    2006-10-31

    A phosphor comprises: (a) at least a first metal selected from the group consisting of yttrium and elements of lanthanide series other than europium; (b) at least a second metal selected from the group consisting of aluminum, gallium, indium, and scandium; (c) boron; and (d) europium. The phosphor is used in light source that comprises a UV radiation source to convert UV radiation to visible light.

  14. The effect of equal channel angular pressing on the tensile properties and microstructure of two medical implant materials: ASTM F-138 austenitic steel and Grade 2 titanium

    Energy Technology Data Exchange (ETDEWEB)

    Filho, A de A Mendes; Sordi, V L; Kliauga, A M; Ferrante, M, E-mail: ferrante@ufscar.b [Federal University of Sao Carlos, Materials Engineering Department, Sao Carlos, 13565-905 (Brazil)

    2010-07-01

    Titanium and F-138 stainless steel are employed in bone replacement and repair. The former material was ECAP-deformed at room temperature and at 300{sup 0}C, followed in some cases by cold rolling. The steel was ECAP-deformed at room temperature only. Work-hardening behavior was studied by making use of the Kocks-mecking plots and microstructural evolution was followed by TEM. Conclusions show that for Ti, ECAP combined with cold rolling gives the best strength-ductility combination, whilst room temperature ECAP increases the tensile strength of the steel but caused substantial ductility loss.

  15. Synthesis and Characterization of Electroresponsive Materials with Applications In: Part I. Second Harmonic Generation. Part II. Organic-Lanthanide Ion Complexes for Electroluminescence and Optical Amplifiers.

    Science.gov (United States)

    Claude, Charles

    1995-01-01

    oxidative stability and for their optical properties. Organic-europium ion complexes based on derivatives of 2-benzoyl benzoate are stable to a temperature 70^circ C higher than the europium beta -diketonate complexes. The optical and fluorescence properties of the organic-europium ion complexes were characterized. The methoxy and the t-butyl derivatives of the europium 2-benzoylbenzoate complexes exhibited fluorescence quantum efficiencies that were comparable to europium tris(thenoyl trifluoroacetonate) in methylene chloride but the extinction coefficient was two-thirds of the europium thenoyltrifluoroacetonate complexes. The last complex characterized was the europium bis(diphenylphosphino)imine complex. The complex exhibited thermal stability to 550 ^circC under nitrogen.

  16. Competitive effect of metallic canister and clay barrier on the sorption of Eu3+ under subcritical conditions

    International Nuclear Information System (INIS)

    El Mrabet, Said; Castro, Miguel A.; Orta, M. Mar; Pazos, M. Carolina; Alba, Maria D.; Astudillo, Julio; Rueda, Silvia; Hurtado, Santiago; Villa, Mara

    2012-01-01

    Document available in extended abstract form only. The disposal of high level radioactive wastes (HLW) such as spent fuel or reprocessing waste resulting from the operation and dismantling of nuclear reactors is one of the most problems facing the worlds because of its long half life and radionuclide migration to the biosphere. For long term performance assessment of radioactive waste disposal, knowledge concerning radionuclide retention processes on materials composing the engineered barrier (clay and container waste) is required. Steel waste containers and bentonite have been proposed as candidate materials for overpack and buffer respectively in most of the proposed repositories designs for nuclear waste disposal. This contribution aims to study the competitiveness of the bentonite and the metallic canister in the retention process of some kinds of radioactive waste such as 152 Eu. The europium was chosen because it is a toxic metal and usually taken as a simulator of the trivalent high level radioactive waste. In order to elucidate the mechanisms involved in the retention processes of europium by both bentonite and metallic canister, a cylindrical steel mini-reactor was designed and prepared from the same material as the steel reactor AISI-316L. The bentonite was then introduced and compacted within the mini-reactor forming a set mini-reactor- bentonite. The system mini-reactor -bentonite was then subjected to hydrothermal treatments at 300 deg. C for 4.5 days. The morphology and chemical composition of both steel and bentonite were analyzed by XRD and SEM. SEM and XRD results revealed that both the bentonite and the metallic canister were involved in sorption mechanism of europium by the formation of insoluble phases of europium silicates originated from the mixed solution of bentonite, Eu 3+ and canister. The pH-Redox potential (Eh) indicated that the interlayer cations of bentonite were replaced by Eu 3+ with higher acidity and Eh which means that the active

  17. Analytical developments for screening of lanthanides/ligands interactions

    International Nuclear Information System (INIS)

    Varenne, F.

    2012-01-01

    This work investigates the potential of hyphenated capillary electrophoresis and inductively coupled mass spectrometry to classify different ligands according to their europium binding affinity in a hydro-organic medium. On the one hand, this method enables to evaluate the affinity of phosphorus-containing ligands in less than two hours and using less than 15 ng of ligand. On the other hand, complexation constants could be determined. The results are in excellent agreement with the values obtained by spectrophotometric titrations.Moreover, a library of copolymers for solid/liquid extraction of europium is investigated. The extraction protocol enables to classify copolymers according to their europium affinity in a hydro-organic medium. This screening requires 60 mg of copolymers. For the most promising recognition properties and selectivity La 3+ /Eu 3+ /Lu 3+ are evaluated. (author)

  18. A Study of the r-Process Path Nuclides,$^{137,138,139}$Sb using the Enhanced Selectivity of Resonance Ionization Laser Ionization

    CERN Multimedia

    Walters, W

    2002-01-01

    The particular features of the r-process abundances with 100 < A < 150 have demonstrated the close connection between knowledge of nuclear structure and decay along the r-process path and the astrophysical environement in which these elements are produced. Key to this connection has been the measurement of data for nuclides (mostly even-N nuclides) that lie in the actual r-process path. Such data are of direct use in r-process calculations and they also serve to refine and test the predictive power of nuclear models where little or no data now exist. In this experiment we seek to use the newly developed ionization scheme for the Resonance Ionization Laser Ion Source (RILIS) to achieve selective ionization of neutron-rich antimony isotopes in order to measure the decay properties of r-process path nuclides $^{137,138,139}$Sb. These properties include the half-lives, delayed neutron branches, and daughter $\\gamma$-rays. The new nuclear structure data for the daughter Te nuclides is also of considerable in...

  19. Solvent extraction of lanthanum (III), europium (III), and lutetium (III) with 5,7-dichloro-8-quinolinol into chloroform in the absence and presence of tetrabutylammonium ions or trioctylphosphine oxide

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1993-01-01

    The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)

  20. Addition compounds between lanthanide trifluoromethane sulphonates and N,N,N',N' - tetrametilmalonamida (TMMA)

    International Nuclear Information System (INIS)

    Bellis, V.M. de.

    1984-01-01

    The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt

  1. Solvation and complexation study by fluorescence spectroscopy of Eu(III) and Cm(III) ions in octanol solution and at the interface with water

    International Nuclear Information System (INIS)

    Vu, T.H.

    2008-01-01

    Polydentate N-donors ligands like bis-triazine-pyridine (BTP) and bis-triazine-bis-pyridine (BTBP) can selectively extract minor actinides (III) from lanthanides (III) ions and therefore have been studied in the field of nuclear waste reprocessing. The aim of the researches carried out during this thesis is a better description of this family in biphasic systems: speciation in the organic phase and around the interfacial area. After an exhaustive description of the solvation of europium(III) cation in mixed solutions n-octanol water with TRLIF spectrometry, the complexation with nitrogen ligands iPr-BTP, C5-BTBP and CyMe4-BTBP has been studied by TRLIF and ESI-MS techniques. For each compound, the inner sphere of europium has been described and the conditional stability constants determined. The composition of the organic medium, and particularly the hydration degree of n-octanol, has an impact on the nature and the ratio of species 'cation - counter ion - ligand - water'. With high water content (representative of extraction systems), the complexes observed with Cm(III) and Eu(III) have the same stoichiometry but the affinity towards the curium cation is higher and consistent to separation factors measured with biphasic systems. The method TIRF (total internal reflection fluorescence) was retained to study the behaviour of europium(III) inside the interfacial area. Fluorescence spectra of europium have been obtained but side signals and the high depth resolution of detection lead to difficulty in obtaining the signal of interfacial europium alone. The selected technique remains promising but some improvements need to be implemented for forthcoming measurement at liquid/liquid interface. (author) [fr

  2. EFTF cobalt test assembly results

    International Nuclear Information System (INIS)

    Rawlins, J.A.; Wootan, D.W.; Carter, L.L.; Brager, H.R.; Schenter, R.E.

    1988-01-01

    A cobalt test assembly containing yttrium hydride pins for neutron moderation was irradiated in the Fast Flux Test Facility during Cycle 9A for 137.7 equivalent full power days at a power level fo 291 MW. The 36 test pins consisted of a batch of 32 pins containing cobalt metal to produce Co-60, and a set of 4 pins with europium oxide to produce Gd-153, a radioisotope used in detection of the bone disease Osteoporosis. Post-irradiation examination of the cobalt pins determined the Co-60 produced with an accuracy of about 5 %. The measured Co-60 spatially distributed concentrations were within 20 % of the calculated concentrations. The assembly average Co-60 measured activity was 4 % less than the calculated value. The europium oxide pins were gamma scanned for the europium isotopes Eu-152 and Eu-154 to an absolute accuracy of about 10 %. The measured europium radioisotpe anc Gd-153 concentrations were within 20 % of calculated values. In conclusion, the hydride assembly performed well and is an excellent vehicle for many Fast Flux Test Facility isotope production applications. The results also demonstrate that the calculational methods developed by the Westinghouse Hanford Company are very accurate. (author)

  3. Analysis and results of a hydrogen-moderated isotope production assembly in the Fast Flux Test Facility

    International Nuclear Information System (INIS)

    Wootan, D.W.; Rawlins, J.A.; Carter, L.L.; Brager, H.R.; Schenter, R.E.

    1989-01-01

    This paper reports on a cobalt test assembly containing yttrium hydride pins for neutron moderation irradiated in the Fast Flux Test Facility (FFTF) during cycle 9A for 137.7 equivalent full-power days at a power level of 291 MW. The 36 test pins consisted of a batch of 32 pins containing cobalt metal used to produce 60 Co and a set of four pins with europium oxide to produce 153 Gd, a radioisotope used in detection of the bone disease osteoporosis. Postirradiation examination of the cobalt pins determined the 60 Co production to be predictable to an accuracy of ∼ 5%. The measured 60 Co spatially distributed concentrations were within 20% of the calculated concentrations. The assembly average 60 Co measured activity was 4% less than the calculated value. The europium oxide pins were gamma scanned for the europium isotopes 152 Eu and 154 Eu to an absolute accuracy of ≅ 10%. The measured europium radioisotope and 153 Gd concentrations were within 20% of calculated values. The hydride assembly performed well and is an excellent vehicle for many FFTF isotope production applications. The results also demonstrate the accuracy of the calculational methods developed by the Westinghouse Hanford Company for predicting isotope production rates in this type of assembly

  4. Extraction of 152Gd from HFIR control plates

    International Nuclear Information System (INIS)

    Kohring, M.W.

    1986-01-01

    The primary method of 153 Gd production at the Oak Ridge National Lab. (ORNL) research reactors since 1980 has been the irradiation of a natural europium oxide powder (Eu 2 O 3 ) followed by the chemical extraction of the gadolinium fraction. The specific activity of the resulting source is 45 to 50 Ci/g with a radiochemical purity of > 99.99%. A potential alternative method involves the extraction of gadolinium from the europium-bearing region of highly radioactive, spent control plates used in the High Flux Isotope Reactor (HFIR), followed by neutron irradiation. This alternative to the traditional process is attractive in that chemical separation of the europium and gadolinium occurs before the 153 Gd production irradiation, thus reducing process and decay losses and, most significantly, the gadolinium is highly enriched in the parent isotope, 152 Gd. Investigation into the usefulness of the gadolinium isotopes contained in spent HFIR control plates began in the late 1960s. However, separation of the gadolinium from the europium to the purity levels required for a marketable specific activity could not be attained. Due to the recent increase in 153 Gd demand and separation process improvements, research into this valuable source of parent material was resurrected

  5. Extraction of gadolinium from high flux isotope reactor control plates

    International Nuclear Information System (INIS)

    Kohring, M.W.

    1987-04-01

    Gadolinium-153 is an important radioisotope used in the diagnosis of various bone disorders. Recent medical and technical developments in the detection and cure of osteoporosis, a bone disease affecting an estimated 50 million people, have greatly increased the demand for this isotope. The Oak Ridge National Laboratory (ORNL) has produced 153 Gd since 1980 primarily through the irradiation of a natural europium-oxide powder followed by the chemical separation of the gadolinium fraction from the europium material. Due to the higher demand for 153 Gd, an alternative production method to supplement this process has been investigated. This process involves the extraction of gadolinium from the europium-bearing region of highly radioactive, spent control plates used at the High Flux Isotope Reactor (HFIR) with a subsequent re-irradiation of the extracted material for the production of the 153 Gd. Based on the results of experimental and calculational analyses, up to 25 grams of valuable gadolinium (≥60% enriched in 152 Gd) resides in the europium-bearing region of the HFIR control components of which 70% is recoverable. At a specific activity yield of 40 curies of 153 Gd for each gram of gadolinium re-irradiated, 700 one-curie sources can be produced from each control plate assayed

  6. Surprising luminescent properties of the polyphosphates Ln(PO3)3:Eu (Ln = Y, Gd, Lu).

    Science.gov (United States)

    Höppe, Henning A; Kazmierczak, Karolina; Kacprzak, Sylwia; Schellenberg, Inga; Pöttgen, Rainer

    2011-10-21

    The optical emission properties of the lanthanoid catena-polyphosphates Ln(PO(3))(3) (Ln = Y, Gd, Lu) doped with europium were investigated. Incommensurately modulated β-Y(PO(3))(3):Eu (super space group Cc (0|0.364|0)0) and Gd(PO(3))(3):Eu (space group I2/a) show the usual emission characteristics of Eu(3+), while in Lu(PO(3))(3):Eu (space group Cc) the europium is unprecedentedly partially reduced to the divalent state, as proven by both a broad emission band at 406 nm excited at 279 nm and an EPR spectroscopic investigation. (151)Eu-Mössbauer spectroscopy showed that only a very small part of the europium is reduced in Lu(PO(3))(3):Eu. An explanation for this unusual behaviour is given. This journal is © The Royal Society of Chemistry 2011

  7. Outpatient management of pulmonary embolism in cancer: data on a prospective cohort of 138 consecutive patients.

    Science.gov (United States)

    Font, Carme; Carmona-Bayonas, Alberto; Fernández-Martinez, Aranzazu; Beato, Carmen; Vargas, Andrés; Gascon, Pere; Otero, Remedios

    2014-03-01

    The purpose of this prospective cohort study was to assess the feasibility of outpatient treatment in patients with cancer and objectively confirmed pulmonary embolism (PE), and to compare the performance of the different prognostic scales available in this setting. Patients were selected for outpatient management according to a set of exclusion criteria. Outcomes at 30 and 90 days of follow-up included thromboembolic recurrences, major bleeding, and all-cause death. The performance of 4 prognostic scales (Pulmonary Embolism Severity Index, Geneva Prognostic Score, POMPE-C, and Registro Informatizado de Enfermedad Tromboembólica [RIETE registry]) was evaluated. Of 138 patients, 62 (45%) were managed as outpatients. Incidental PE constituted 47% of the sample. Most patients treated at home had an incidentally detected PE (89%). The rate of recurrence and major bleeding events was similar in both groups. Mortality rates were higher for patients admitted to the hospital compared with outpatients at 30 days (18% vs 3%; P=.06) and 90 days (34% vs 10%; P=.001) of follow-up. None of the patients selected for home treatment required further admission because of PE complications. None of the prognostic models developed for symptomatic PE was significantly associated with 30-day mortality. Improved survival outcomes were observed in incidentally detected PEs compared with acute symptomatic events (overall mortality rates, 3.2% vs 18.4%; P=.006). A large proportion of patients with cancer and PE may be safely treated as outpatients, especially those with incidental PE. Cancer-specific prognostic scales including incidental PE should be developed for the optimal management of PE in this setting.

  8. Association between gender inequality index and child mortality rates: a cross-national study of 138 countries.

    Science.gov (United States)

    Brinda, Ethel Mary; Rajkumar, Anto P; Enemark, Ulrika

    2015-03-09

    Gender inequality weakens maternal health and harms children through many direct and indirect pathways. Allied biological disadvantage and psychosocial adversities challenge the survival of children of both genders. United Nations Development Programme (UNDP) has recently developed a Gender Inequality Index to measure the multidimensional nature of gender inequality. The global impact of Gender Inequality Index on the child mortality rates remains uncertain. We employed an ecological study to investigate the association between child mortality rates and Gender Inequality Indices of 138 countries for which UNDP has published the Gender Inequality Index. Data on child mortality rates and on potential confounders, such as, per capita gross domestic product and immunization coverage, were obtained from the official World Health Organization and World Bank sources. We employed multivariate non-parametric robust regression models to study the relationship between these variables. Women in low and middle income countries (LMICs) suffer significantly more gender inequality (p Gender Inequality Index (GII) was positively associated with neonatal (β = 53.85; 95% CI 41.61-64.09), infant (β = 70.28; 95% CI 51.93-88.64) and under five mortality rates (β = 68.14; 95% CI 49.71-86.58), after adjusting for the effects of potential confounders (p gender inequality and child mortality. We present the socio-economic problems, which sustain higher gender inequality and child mortality in LMICs. We further discuss the potential solutions pertinent to LMICs. Dissipating gender barriers and focusing on social well-being of women may augment the survival of children of both genders.

  9. Rapid and sensitive lateral flow immunoassay method for determining alpha fetoprotein in serum using europium (III) chelate microparticles-based lateral flow test strips

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Rong-Liang; Xu, Xu-Ping; Liu, Tian-Cai; Zhou, Jian-Wei; Wang, Xian-Guo; Ren, Zhi-Qi [Institute of Antibody Engineering, School of Biotechnology, Southern Medical University, Guangzhou 510515, Guangdong (China); Hao, Fen [DaAn Gene Co. Ltd. of Sun Yat-sen University, 19 Xiangshan Road, Guangzhou 510515 (China); Wu, Ying-Song, E-mail: wg@smu.edu.cn [Institute of Antibody Engineering, School of Biotechnology, Southern Medical University, Guangzhou 510515, Guangdong (China)

    2015-09-03

    Alpha-fetoprotein (AFP), a primary marker for many diseases including various cancers, is important in clinical tumor diagnosis and antenatal screening. Most immunoassays provide high sensitivity and accuracy for determining AFP, but they are expensive, often complex, time-consuming procedures. A simple and rapid point-of-care system that integrates Eu (III) chelate microparticles with lateral flow immunoassay (LFIA) has been developed to determine AFP in serum with an assay time of 15 min. The approach is based on a sandwich immunoassay performed on lateral flow test strips. A fluorescence strip reader was used to measure the fluorescence peak heights of the test line (H{sub T}) and the control line (H{sub C}); the H{sub T}/H{sub C} ratio was used for quantitation. The Eu (III) chelate microparticles-based LFIA assay exhibited a wide linear range (1.0–1000 IU mL{sup −1}) for AFP with a low limit of detection (0.1 IU mL{sup −1}) based on 5ul of serum. Satisfactory specificity and accuracy were demonstrated and the intra- and inter-assay coefficients of variation (CV) for AFP were both <10%. Furthermore, in the analysis of human serum samples, excellent correlation (n = 284, r = 0.9860, p < 0.0001) was obtained between the proposed method and a commercially available CLIA kit. Results indicated that the Eu (III) chelate microparticles-based LFIA system provided a rapid, sensitive and reliable method for determining AFP in serum, indicating that it would be suitable for development in point-of-care testing. - Highlights: • Europium (III) chelate microparticles was used as a label for LIFA. • Quantitative detection by using H{sub T}/H{sub C} ratio was achieved. • LIFA for simple and rapid AFP detection in human serum. • The sensitivity and linearity was more excellent compared with QD-based ICTS. • This method could be developed for rapid point-of-care screening.

  10. A de novo 1.38 Mb duplication of 1q31.1 in a boy with hemifacial microsomia, anophthalmia, anotia, macrostomia, and cleft lip and palate.

    Science.gov (United States)

    Huang, Xue-shuang; Zhu, Bao; Jiang, Hai-ou; Wu, Su-fan; Zhang, Zai-qi; Xiao, Lin; Yi, Li-lan; Zhang, Jian-xiang

    2013-04-01

    We reported a 2-year-old boy with developmental delay, mild mental retardation, and severe craniofacial malformation, including facial asymmetry with hypoplasia of the left zygoma, maxilla, and mandible, and left anophthalmia and anotia. A genome-wide screen revealed a 1.38 Mb duplication on chromosome 1q31.1, which was absent in his parents and 27 healthy controls. The duplication region contains two Refseq genes, PLA2G4A and C1orf99, which have not been reported to be implicated in craniofacial malformation. Functional studies of these genes and additional clinical analysis are necessary to elucidate the pathogenesis of craniofacial malformation. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  11. Effect of heat treatment on the electrochemical behaviour and catalytic activity of metal-glass of an Fe76.1Cu1.0Nb3.0Si13.8B6.1

    International Nuclear Information System (INIS)

    Zhdanova, L.I.; Sharipova, E.Kh.; Lad'yanov, V.I.; Volkov, V.A.

    1999-01-01

    Effect of the different degree of the initial surface crystallization of Fe 76.1 Cu 1.0 Nb 3.0 Si 13.8 B 6.1 metal glasses on the electrochemical behaviour and catalytic activity of the alloy during thermal treatment of tapes was studied. Growth of amorphous-nanocrystalline structure during annealing is shown to improve protective properties of fast-hardened tapes. The highest corrosion resistance of the material is manifested when in nanocrystalline state subsequent to annealing under 550 deg C [ru

  12. Synthesis and evaluation of 3-[(2,4-dioxo-1,3,8-triazaspiro[4.6]undec-3-yl)methyl]benzonitrile derivatives as potential anticonvulsants.

    Science.gov (United States)

    Madaiah, Malavalli; Prashanth, Maralekere K; Revanasiddappa, Hosakere D; Veeresh, Bantal

    2013-03-01

    New 3-[(2,4-dioxo-1,3,8-triazaspiro[4.6]undec-3-yl)methyl]benzonitrile derivatives 8-37 were synthesized and their pharmacological activities were determined with the objective to better understand their structure-activity relationship (SAR) for anticonvulsant activity. All the compounds were evaluated for their possible anticonvulsant activity by maximal electroshock seizure (MES) and pentylenetetrazole (PTZ) test. Compounds 11, 18, 31, and 32 showed significant and protective effect on seizure, when compared with the standard drug valproate. The same compounds were found to exhibit advanced anticonvulsant activity as well as lower neurotoxicity than the reference drug. From this study, it is quite apparent that there are at least three parameters for the activity of anticonvulsant drugs, that is, a lipophilic domain, a hydrophobic center, and a two-electron donor. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Study of radionuclides speciation with biological molecules of interest by spectrometric techniques; Etude de la speciation des radionucleides avec les molecules d'interet biologique par approche spectrometrique

    Energy Technology Data Exchange (ETDEWEB)

    Lourenco, V

    2007-07-15

    Mechanisms of complexation and accumulation of the radionuclides at the cellular and molecular level are complex and poorly known because the studies on these subjects are scarce. Within the framework of this thesis, we studied the interactions of these cations with biological molecules of interest. We chose to focus on an actinide: uranium (VI) as well as europium as an analogue of trivalent actinides. The selected biological molecules are the phyto-chelatins: their role is to protect cells against intrusions from nonessential heavy metals (thus toxic). These proteins are likely to be implied in the mechanisms of sequestration of radionuclides in living organisms. However, their structure is complex, this is why, in order to better include/understand their reactivity, we extended our studies to lower entities which constitute them (amino acid: glycine, glutamic acid and cysteine; polypeptides: glutathione reduced and oxidized forms). In particular, we determined solution speciation (stoichiometry, structure) as well as the complexing constants associated with the formation with these species. These studies were undertaken by Time Resolved Laser induced Fluorescence (TRLIF), Electro-Spray-Mass Spectrometry (ES-MS), Nuclear Magnetic Resonance (NMR), Fourier Transform Infra-Rouge spectroscopy (FTIR) and Extended X-ray Absorption Fine Structure Spectroscopy (EXAFS).The determination of the complexation constants enabled us to conclude that the complexing capacity of these molecules with respect to radionuclides was moderate (log{sub 10}K{sub 1} {<=} 3, pH 3 or 6), the formed species are mononuclear with only one ligand molecule (1:1). The interaction is performed via oxygenated (hard) groups. The direct complexation of europium with phyto-chelatins at acidic pH was studied jointly by TRLIF and ES-MS. The complexing capacity of these molecules is much higher than that of GSH from which they result. The interaction of europium with metallothioneins is, on the contrary

  14. Study of radionuclides speciation with biological molecules of interest by spectrometric techniques

    International Nuclear Information System (INIS)

    Lourenco, V.

    2007-07-01

    Mechanisms of complexation and accumulation of the radionuclides at the cellular and molecular level are complex and poorly known because the studies on these subjects are scarce. Within the framework of this thesis, we studied the interactions of these cations with biological molecules of interest. We chose to focus on an actinide: uranium (VI) as well as europium as an analogue of trivalent actinides. The selected biological molecules are the phyto-chelatins: their role is to protect cells against intrusions from nonessential heavy metals (thus toxic). These proteins are likely to be implied in the mechanisms of sequestration of radionuclides in living organisms. However, their structure is complex, this is why, in order to better include/understand their reactivity, we extended our studies to lower entities which constitute them (amino acid: glycine, glutamic acid and cysteine; polypeptides: glutathione reduced and oxidized forms). In particular, we determined solution speciation (stoichiometry, structure) as well as the complexing constants associated with the formation with these species. These studies were undertaken by Time Resolved Laser induced Fluorescence (TRLIF), Electro-Spray-Mass Spectrometry (ES-MS), Nuclear Magnetic Resonance (NMR), Fourier Transform Infra-Rouge spectroscopy (FTIR) and Extended X-ray Absorption Fine Structure Spectroscopy (EXAFS).The determination of the complexation constants enabled us to conclude that the complexing capacity of these molecules with respect to radionuclides was moderate (log 10 K 1 ≤ 3, pH 3 or 6), the formed species are mononuclear with only one ligand molecule (1:1). The interaction is performed via oxygenated (hard) groups. The direct complexation of europium with phyto-chelatins at acidic pH was studied jointly by TRLIF and ES-MS. The complexing capacity of these molecules is much higher than that of GSH from which they result. The interaction of europium with metallothioneins is, on the contrary, lower than

  15. Quantitation of amyloid beta peptides Aβ(1-38), Aβ(1-40), and Aβ(1-42) in human cerebrospinal fluid by ultra-performance liquid chromatography-tandem mass spectrometry.

    Science.gov (United States)

    Lame, Mary E; Chambers, Erin E; Blatnik, Matthew

    2011-12-15

    Critical events in Alzheimer's disease (AD) involve an imbalance between the production and clearance of amyloid beta (Aβ) peptides from the brain. Current methods for Aβ quantitation rely heavily on immuno-based techniques. However, these assays require highly specific antibodies and reagents that are time-consuming and expensive to develop. Immuno-based assays are also characterized by poor dynamic ranges, cross-reactivity, matrix interferences, and dilution linearity problems. In particular, noncommercial immunoassays are especially subject to high intra- and interassay variability because they are not subject to more stringent manufacturing controls. Combinations of these factors make immunoassays more labor-intensive and often challenging to validate in support of clinical studies. Here we describe a mixed-mode solid-phase extraction method and an ultra-performance liquid chromatography tandem mass spectrometry (SPE UPLC-MS/MS) assay for the simultaneous quantitation of Aβ(1-38), Aβ(1-40), and Aβ(1-42) from human cerebrospinal fluid (CSF). Negative ion versus positive ion species were compared using their corresponding multiple reaction monitoring (MRM) transitions, and negative ions were approximately 1.6-fold greater in intensity but lacked selectivity in matrix. The positive ion MRM assay was more than sufficient to quantify endogenous Aβ peptides. Aβ standards were prepared in artificial CSF containing 5% rat plasma, and quality control samples were prepared in three pooled CSF sources. Extraction efficiency was greater than 80% for all three peptides, and the coefficient of variation during analysis was less than 15% for all species. Mean basal levels of Aβ species from three CSF pools were 1.64, 2.17, and 1.26 ng/ml for Aβ(1-38); 3.24, 3.63, and 2.55 ng/ml for Aβ(1-40); and 0.50, 0.63, and 0.46 ng/ml for Aβ(1-42). Copyright © 2011 Elsevier Inc. All rights reserved.

  16. Neutron Activation Resonance Integrals of 74Se, 78Se, 80Se, 81Br, 127I, 130Te, 138Ba, 140Ce, and 142Ce

    International Nuclear Information System (INIS)

    Ricabarra, M. D.; Turjanskl, R.; Ricabarra, G. H.; Bigham, C.B.

    1968-01-01

    A lithium-drift germanium γ-ray spectrometer has been used to make accurate intercomparisons of the ratio of resonance-integral to thermal-activation cross section by measuring cadmium ratios or relative activation rates in two different neutron spectra. The standard, gold, or secondary standard, indium, was mixed uniformly in the samples and the activities resolved with the spectrometer. Expressed as Westcott S 0 values, the results relative to S 0 = 17.7 for gold were as follows: 74 Se = 10.3 +± 0.1, 78 Se = 12.3 ± 0.3, 80 Sc = 2.65 ± 0.02, 81 Br = 24.3 ± 0.5, 127 I = 27.8 ± 0.5, 130 Te = 2.10 ± 0.07, 138 Ba = 0.649 ± 0.004, 140 Ce = 0.476 ± 0.003, 142 Ce = 0.865 ± 0.005. (author)

  17. Effect of kinetic properties of extraction systems on separation of some elements by liquid chromatography method with free fixed phase

    International Nuclear Information System (INIS)

    Fedotov, P.S.; Maryutina, T.A.; Pichugin, A.A.; Spivakov, B.Ya.

    1993-01-01

    Effect of kinetic properties of a series of extraction systems on the separation of certain elements by the method of liquid chromatography with free fixed phase is considered. Chromatographic behaviour of europium 3 and iron 3 ions when using systems based on di-2-ethylhexylphosphovers acid and tetraphenylmethylenediphosphine dioxide is investigated. Kinetic properties of the extraction systems used are studied by diffusion cell method with mixing, europium 3 and iron 3 mass transfer coefficients are determined

  18. Role of Eu"2"+ on the blue‐green photoluminescence of In_2O_3:Eu"2"+ nanocrystals

    International Nuclear Information System (INIS)

    Devi, Konsam Reenabati; Meetei, Sanoujam Dhiren; Singh, Shougaijam Dorendrajit

    2016-01-01

    Blue‐green light emitting undoped and europium doped indium oxide nanocrystal were synthesized by simple precipitation method. X-ray diffraction (XRD) pattern confirmed the cubic phase of undoped and europium doped samples. Further, transmission electron microscopy (TEM), scanning electron microscopy (SEM) , energy dispersive analysis of X-rays (EDAX), Fourier transform infra-red (FT-IR), photoluminescence (PL), electron paramagnetic resonance (EPR) studies were performed to characterise the samples. PL analysis of the samples is the core of the present research. It includes excitation, emission and CIE (Commission Internationale de l’e´ clairage) studies of the samples. On doping europium to In_2O_3 lattice, ln"3"+ site is substituted by Eu"2"+ thereby increasing the concentration of singly ionized oxygen vacancy and hence blue–green emission from the host is found to increase. Further, this increase in blue–green emission after doping may also be attributed to 4f → 5d transitions of Eu"2"+. However, the blue–green PL emission is found to decrease after an optimum dopant concentration (Eu"2"+ = 4%) due to luminescence and size quenching. CIE co-ordinates of the samples are calculated to know colour of light emitted from the samples. It suggests that this blue–green light emitting In_2O_3: Eu"2"+ nanocrystals may find application in lighting such as in generation of white light. - Highlight: • XRD and TEM study confirms the synthesis of cubic doped and europium doped nanocrystals. • EPR study reveals the doped europium is in + 2 oxidation state. • Enhance PL emission intensity of host material due to increase in singly ionized oxygen vacancy and 4f–5d transitions of Eu"2"+ • CIE co-ordinates suggest the blue–green colour of the samples.

  19. T-138C and A-7G polymorphisms in the MGP gene and the association with coronary arthery disease: Iranian patients

    Directory of Open Access Journals (Sweden)

    Abiri M

    2009-05-01

    Full Text Available "n Normal 0 false false false EN-GB X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:Arial; mso-bidi-theme-font:minor-bidi;} Background: Coronary Artery Disease (CAD is a major cause of death worldwide including Iran.  The risk of developing disease in patients without symptoms is assessed in part by factors that are associated with disease. Among these factors family history points to the significance of genetic component in the risk of CAD. The identification of the genetic variants that confer risk for CAD is essential for detecting high-risk individuals, so preventative life style and therapeutic action can be taken before overt disease develops. So far more than 100 genes have been reported with possible role in developing risk for CAD. Matrix- Gla Protein (MGP is one of these genes that association of its single nucleotide polymorphism (SNP with CAD has been reported.  Among the polymorphisms, there are two promoter SNPs at position -7 & -138 that their association with CAD has been reported before. Here we investigated the association of these SNPs with CAD in Iranian population. "n"n Methods: 150 cases and 150 controls were selected on the basis of their clinical assessments and angiographic reports. DNA was extracted from blood samples. The genotypes for both SNPs were determined using Polymerase Chain Reaction

  20. Study on photophysical properties of Eu(III) complexes with aromatic β-diketones – Role of charge transfer states in the energy migration

    Energy Technology Data Exchange (ETDEWEB)

    Räsänen, Markus, E-mail: mpvras@utu.fi [Department of Chemistry, University of Turku, FIN-20014 Turku (Finland); Takalo, Harri [DHR Finland Oy, Innotrac Diagnostics, Biolinja 12, FIN-20750 Turku (Finland); Rosenberg, Jaana; Mäkelä, Joonas [Department of Biochemistry and Food Chemistry, University of Turku, FIN-20014 Turku (Finland); Haapakka, Keijo; Kankare, Jouko [Department of Chemistry, University of Turku, FIN-20014 Turku (Finland)

    2014-02-15

    We synthesized a set of aromatic β-diketones and measured the photophysical properties of their europium(III) complexes. According to these photophysical properties, the europium complexes can be divided into two groups: the complexes with or without the freely rotating amino-group (FRAG). On the basis of the experimental results, it can be concluded that in the FRAG complexes, the ligand-centered excitation energy is most probably transferred from a ligand to a coordinated europium via the intraligand charge transfer (ILCT) state. The temperature dependency of the lifetimes of the emissive {sup 5}D{sub 0} state revealed that in the FRAG complexes, the energy of the emissive {sup 5}D{sub 0} state is back-transferred to the ligand-to-metal charge transfer (LMCT) state and in the non-FRAG complexes, to the triplet state of the ligand. The most efficient complex synthesized was the europium complex of carbazole derivative L{sup 6} with the quantum yield of 47% and molar absorption coefficient of 70,400 M{sup −1}cm{sup −1}. -- Highlights: • We synthesized a set of substituted aromatic β-diketones and their Eu(III) complexes. • We measured the photophysical properties of these Eu(III) complexes. • Carbazole derivative of β-diketone forms the brightest Eu(III) complex. • The Jablonski diagrams proposed for the luminescence of these complexes.