Tucaković, Ivana; Barišić, Delko; Grahek, Željko; Kasap, Ante; Širić, Ivan
2018-01-01
The aim of this study was to select species with higher potential to accumulate 137 Cs among the available mushroom species, by determining the activity concentrations of 137 Cs in mushrooms collected along north and north-western part of Croatia. A total of 55 samples of 14 different species were analyzed and the potential of mycorrhizal and saprotrophic species to accumulate 137 Cs was compared. A wide range of the dry weight activity concentrations of 137 Cs was detected, ranging from 0.95 to 1210 Bq/kg (154 Bq/kg mean value; 52.3 Bq/kg geometric mean) in mycorrhizal and 1.05-36.8 Bq/kg (8.90 Bq/kg mean value; 5.49 Bq/kg geometric mean) in saprotrophic species. Statistical analyses showed that mycorrhizal species accumulate significantly higher concentrations of 137 Cs and thus could perform better as long-term bioindicators of environmental pollution by radiocaesium then saprotrophic species. The comparison of Boletus sp. and Hydnum repandum (both mycorrhizal species commonly found in Croatia) showed, in general order of magnitude, higher accumulation in Hydnum repandum. Clearly, mushrooms, especially mycorrhizal species, can be used as significant indicators even decades after the occurrence of any serious 137 Cs contamination event. However, as a wide range of values indicates that various parameters may influence the total uptake of the 137 Cs into the mushroom fruit bodies, it is necessary to emphasize that 137 Cs activity detected in a single mushroom sample is very site-specific. Copyright © 2017 Elsevier Ltd. All rights reserved.
Fluorescent Europium Chelate Stain
Scaff, W. L.; Dyer, D. L.; Mori, K.
1969-01-01
The europium chelate of 4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedione (thenoyl-trifluoroacetone; TTA) is firmly bound to microorganisms. It fluoresces brightly at 613 nm with activation at 340 nm. Cells may be stained with 10−3m chelate in 50% ethyl alcohol, followed by washing with 50% ethyl alcohol. Equal or better stains are produced with 10−3m aqueous europium salt, water wash, and 10−2m aqueous TTA. A noncomplexing buffer should be used to maintain the pH at 6.5 to 6.8. Images PMID:4181107
Europium-155 in Debris from Nuclear Weapons
DEFF Research Database (Denmark)
Aarkrog, Asker; Lippert, Jørgen Emil
1967-01-01
The lithium-drifted germanium detector enables determination of europium-155 on a routine basis in environmental samples contaminated with debris from nuclear weapons. From measurements of europium-155, cesium-144, and strontium-90 in air filters collected between 1961 and 1966, the yield...... of europium-155 from weapons was estimated at 1400 atoms per 10$^{6}$ fissions, which is close to the yield of europium-155 from fast fission of uranium-238....
The electrochemical synthesis of europium boride
Directory of Open Access Journals (Sweden)
Bukatova G.A.
2003-01-01
Full Text Available The electroreduction of boron, europium and the electrochemical synthesis of europium boride have been investigated in NaCl-KCl-NaF(10 wt. % melt on silver and molybdenum electrodes. The parameters of boron reduction in the chloride-fluoride melt have been obtained and the character of its joint deposition with europium has been studied.
The electrochemical synthesis of europium boride
Bukatova G.A.; Kuznetsov S.A.; Gaune-Escard M.
2003-01-01
The electroreduction of boron, europium and the electrochemical synthesis of europium boride have been investigated in NaCl-KCl-NaF(10 wt. %) melt on silver and molybdenum electrodes. The parameters of boron reduction in the chloride-fluoride melt have been obtained and the character of its joint deposition with europium has been studied.
Liposome Biodistribution via Europium Complexes.
Mignet, Nathalie; Scherman, Daniel
2017-01-01
The drug delivery field needs tools to follow vector biodistribution. Radioactive tracers and conventional fluorophores are widely used. We propose here to use europium complexes. Use of pulsed light source time-resolved fluorimetry takes into account the fluorescence decay time of the lanthanide chelates to gain sensitivity in biological media. The method was developed to follow liposome biodistribution. Octadecyl-DTPA.Eu compound has been prepared and incorporated into liposomes without alteration of its fluorescence signal. The method has been validated by comparison with fluorophore-labeled liposomes. The way to proceed to use this method for liposomes or other vectors is detailed.
Resonance ionization scheme development for europium
Chrysalidis, K; Fedosseev, V N; Marsh, B A; Naubereit, P; Rothe, S; Seiffert, C; Kron, T; Wendt, K
2017-01-01
Odd-parity autoionizing states of europium have been investigated by resonance ionization spectroscopy via two-step, two-resonance excitations. The aim of this work was to establish ionization schemes specifically suited for europium ion beam production using the ISOLDE Resonance Ionization Laser Ion Source (RILIS). 13 new RILIS-compatible ionization schemes are proposed. The scheme development was the first application of the Photo Ionization Spectroscopy Apparatus (PISA) which has recently been integrated into the RILIS setup.
Resonance ionization scheme development for europium
Energy Technology Data Exchange (ETDEWEB)
Chrysalidis, K., E-mail: katerina.chrysalidis@cern.ch; Goodacre, T. Day; Fedosseev, V. N.; Marsh, B. A. [CERN (Switzerland); Naubereit, P. [Johannes Gutenberg-Universität, Institiut für Physik (Germany); Rothe, S.; Seiffert, C. [CERN (Switzerland); Kron, T.; Wendt, K. [Johannes Gutenberg-Universität, Institiut für Physik (Germany)
2017-11-15
Odd-parity autoionizing states of europium have been investigated by resonance ionization spectroscopy via two-step, two-resonance excitations. The aim of this work was to establish ionization schemes specifically suited for europium ion beam production using the ISOLDE Resonance Ionization Laser Ion Source (RILIS). 13 new RILIS-compatible ionization schemes are proposed. The scheme development was the first application of the Photo Ionization Spectroscopy Apparatus (PISA) which has recently been integrated into the RILIS setup.
Electronic state of europium atoms on surface of oxidized tungsten
Davydov, S Y
2001-01-01
The energy scheme of the europium atoms adsorption system on the tungsten surface, coated with the oxygen monolayer, is considered. The evaluations of the europium adatoms charged state on the oxidized tungsten surface are performed. It is established, that europium, adsorbed at the oxidized tungsten surface, is a positive ion with the charge close to the unit. The zonal scheme of the Eu-O/W adsorption system for the europium low and high concentrations is proposed
Europium anomaly in plagioclase feldspar - Experimental results and semiquantitative model.
Weill, D. F.; Drake, M. J.
1973-01-01
The partition of europium between plagioclase feldspar and magmatic liquid is considered in terms of the distribution coefficients for divalent and trivalent europium. A model equation is derived giving the europium anomaly in plagioclase as a function of temperature and oxygen fugacity. The model explains europium anomalies in plagioclase synthesized under controlled laboratory conditions as well as the variations of the anomaly observed in natural terrestrial and extraterrestrial igneous rocks.
Fermi Surface and Antiferromagnetism in Europium Metal
DEFF Research Database (Denmark)
Andersen, O. Krogh; Loucks, T. L.
1968-01-01
We have calculated the Fermi surface of europium in order to find those features which determine the wave vector of the helical moment arrangement below the Néel point. We find that there are two pieces of Fermi surface: an electron surface at the symmetry point H, which has the shape of rounded...... of the nearly cubical part of the hole surface at P, and we also discuss the effects of the electron surface at H. Since it is likely that barium and europium have similar Fermi surfaces, we have presented several extremal areas and the corresponding de Haas-van Alphen frequencies in the hope that experimental...
Organophosphate Nerve Agent Detection with Europium Complexes
Directory of Open Access Journals (Sweden)
Jake R. Schwierking
2004-01-01
Full Text Available We explore the detection of paraoxon, a model compound for nonvolatile organophosphate nerve agents such as VX. The detection utilizes europium complexes with 1,10 phenanthroline and thenoyltrifluoroacetone as sensitizing ligands. Both europium luminescence quenching and luminescence enhancement modalities are involved in the detection, which is simple, rapid, and sensitive. It is adaptable as well to the more volatile fluorophosphate nerve agents. It involves nothing more than visual luminescence observation under sample illumination by an ordinary hand-held ultraviolet lamp.
Cesium-137 Decorporation Model
2014-10-01
data, in vitro experiments simulating Cs transport through potassium channels , and in vitro tissue selectivity experiments (Leggett 1995, 2003). The...Lung and its Influence on Particle Deposition, Inhalation Toxicology 18:795-801. Boecker BB. 1969 Comparison of 137Cs metabolism in the beagle dog...biokinetic model for 137Cs. Health Phys 73(2):320-332. Melo DR, et al. 1998. Prussian blue decorporation of 137Cs in humans and beagle dogs. Radiat Prot
Europium enabled luminescent nanoparticles for biomedical applications
Energy Technology Data Exchange (ETDEWEB)
Syamchand, S.S., E-mail: syamchand.ss@gmail.com; Sony, G., E-mail: emailtosony@gmail.com
2015-09-15
Lanthanide based nanoparticles are receiving great attention ought to their excellent luminescent and magnetic properties and find challenging biomedical applications. Among the luminescent lanthanide NPs, europium based NPs (Eu-NPs) are better candidates for immunoassay and imaging applications. The Eu-NPs have an edge over quantum dots (QDs) by means of their stable luminescence, long fluorescence lifetime, sharp emission peaks with narrow band width, lack of blinking and biocompatibility. This review surveys the synthesis and properties of a variety of Eu-NPs consolidated from different research articles, for their applications in medicine and biology. The exquisite luminescent properties of Eu-NPs are explored for developing biomedical applications such as immunoassay and bioimaging including multimodal imaging. The biomedical applications of Eu-NPs are mostly diagnostic in nature and mainly focus on various key analytes present in biological systems. The luminescent properties of europium enabled NPs are influenced by a number of factors such as the site symmetry, the metal nanoparticles, metal ions, quantum dots, surfactants, morphology of Eu-NPs, crystal defect, phenomena like antenna effect and physical parameters like temperature. Through this review we explore and assimilate all the factors which affect the luminescence in Eu-NPs and coil a new thread of parameters that control the luminescence in Eu-NPs, which would provide further insight in developing Eu-based nanoprobes for future biomedical prospects. - Highlights: • The review describes 14 major factors that influence the luminescence properties of europium enabled luminescent nanoparticles (Eu-NPs). • Surveys different types of europium containing nanoparticles that have been reported for their biomedical applications. • Eu-NPs are conveniently divided into four different categories, based on the type of the substrates involved. The four categories are (1) virgin Eu-substrate based NPs; (2
The Europium Oxybarometer: Power and Pitfalls
McKay, G.
2004-01-01
One of the most important characteristics of a planet is the oxidation state of its mantle, as reflected in primitive basalts. Petrologists have devised several methods to estimate the oxygen fugacity under which basalts crystallized. One method that has been the subject of recent interest involves the depth of the Eu anomaly in first-crystallizing minerals. A discussion detailing the experimental calibration of the Europium oxybarometer and the application of this device to Angrites and Martian basaltic meteorites are presented. The strengths and weaknesses of the instrument are also included.
Europium Effect on the Electron Transport in Graphene Ribbons
Energy Technology Data Exchange (ETDEWEB)
Bobadilla, Alfredo D.; Ocola, Leonidas E.; Sumant, Anirudha V.; Kaminski, Michael; Kumar, Narendra; Seminario, Jorge M.
2015-10-01
We report in this complementary theoretical-experimental work the effect of gating on the election transport of grapheme ribbons when exposed to very low concentration of europium in an aqueous solution. We find a direct correlation between the level of concentration of europium ions in the solvent and the change in electron transport in graphene, observing a change of up to 3 orders of magnitude at the lowest level of concentration tested (0.1 mM), suggesting a possibility that graphene ribbons can be used for detecting very low concentrations of europium in liquid solutions.
Paramagnetic Europium Salen Complex and Sickle-Cell Anemia
Wynter, Clive I.; Ryan, D. H.; May, Leopold; Oliver, F. W.; Brown, Eugene; Hoffman, Eugene J.; Bernstein, David
2005-04-01
A new europium salen complex, Eu(salen)2NH4, was synthesized, and its composition was confirmed by chemical analysis and infrared spectroscopy. Further characterization was carried out by 151 Eu Mössbauer spectroscopy and magnetic susceptibility measurements. Mössbauer spectroscopic measurements were made at varying temperatures between 9 K and room temperature and a value of Debye temperature of 133 ±5 K was computed. Both Mössbauer and magnetic susceptibility measurements confirmed the paramagnetic behavior of this complex and the trivalent state of the europium ion. In view of the fact that the "odd" paramagnetic molecule NO has been shown to reverse sickling of red blood cells in sickle cell anemia, the interaction between the paramagnetic europium salen complex and sickle cells was examined after incubation with this europium complex and shown to have similar effects.
Energy Technology Data Exchange (ETDEWEB)
Neves, Cristina S.; Granadeiro, Carlos M.; Cunha-Silva, Luis; Eaton, Peter; Balula, Salete S.; Pereira, Eulalia [REQUIMTE/Departamento de Quimica e Bioquimica, Faculdade de Ciencias, Universidade do Porto (Portugal); Ananias, Duarte [CICECO, Departamento de Quimica, Universidade de Aveiro (Portugal); Gago, Sandra [REQUIMTE, Departamento de Quimica, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Monte de Caparica (Portugal); Feio, Gabriel [CENIMAT/I3N, Departamento de Ciencia dos Materiais, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Monte de Caparica (Portugal); Carvalho, Patricia A. [ICEMS/Departamento de Bioengenharia, Instituto Superior Tecnico, Lisboa (Portugal)
2013-06-15
The incorporation of europium polyoxometalates into silica nanoparticles can lead to a biocompatible nanomaterial with luminescent properties suitable for applications in biosensors, biological probes, and imaging. Keggin-type europium polyoxometalates Eu(PW{sub 11}){sub x} (x = 1 and 2) with different europium coordination environments were prepared by using simple methodologies and no expensive reactants. These luminescent compounds were then encapsulated into silica nanoparticles for the first time through the water-in-oil microemulsion methodology with a nonionic surfactant. The europium polyoxometalates and the nanoparticles were characterized by using several techniques [FTIR, FT-Raman, {sup 31}P magic angle spinning (MAS) NMR, and TEM/energy-dispersive X-ray spectroscopy (TEM-EDS), AFM, dynamic light scattering (DLS), and inductively coupled plasma MS (ICP-MS) analysis]. The stability of the material and the integrity of the europium compounds incorporated were also examined. Furthermore, the photoluminescence properties of the Eu(PW{sub 11}){sub x} rate at SiO{sub 2} nanomaterials were evaluated and compared with those of the free europium polyoxometalates. The silica surface of the most stable nanoparticles was successfully functionalized with appropriate organosilanes to enable the covalent binding of oligonucleotides. (Copyright copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Spectral Properties of a bis-Azospiropyran Complexed with Europium
Nourmohammadian, F.; Ghahari, M.; Gholami, M. Davoudzadeh
2015-09-01
The complexation of recently synthesized symmetrical bifunctional bis-azospiropyran photochromic dye with europium nitrate and its effect on UV-vis absorption and fluorescent emission was studied. Upon addition of Eu 3+ to colorless spiropyran, a yellow merocyanine europium complex was obtained with an absorption band at 410 nm. Negatively charged phenolic oxygenin zwitterionic ring-open form provides an effective metal binding site for Eu 3+ . Meanwhile, the inherent fluorescence emission of the photochromic dye at 380 nm is switched off due to the Eu 3+ - induced drive of spiro-mero equilibrium to form mero form. The stoichiometry of dye-europium complexation was evaluated by fluorescence emission and UV-vis absorption spectroscopy and a 8:1 ratio was obtained in both cases. The binding constant (K) value of the dye-europium complex was 3 × 106 M -1 . In conclusion, the current molecular switch is a useful sensitive dual measuring tool for solutions containing europium or europium-like elements by evaluation of visible absorption or fluorescent emission spectroscopy.
Metal plasmon enhanced europium complex luminescence
Energy Technology Data Exchange (ETDEWEB)
Liu Feng [Department of Chemistry, Queen' s University, 90 Bader Lane, Kingston, Ontario, K7L 3N6 (Canada); Aldea, Gabriela [Department of Chemistry, Queen' s University, 90 Bader Lane, Kingston, Ontario, K7L 3N6 (Canada); Petru Poni Institute of Macromolecular Chemistry Iasi, Aleea Grigore Ghica Voda 41A, 700487 Iasi (Romania); Nunzi, Jean-Michel, E-mail: nunzijm@queensu.c [Department of Chemistry, Queen' s University, 90 Bader Lane, Kingston, Ontario, K7L 3N6 (Canada)
2010-01-15
The plasmon enhanced luminescence of a rare-earth complex Tris(6, 6, 7, 7, 8, 8, 8-heptafluoro-2, 2-dimethyl-3, 5-octanedionato) europium (Eu(fod){sub 3}) was investigated. A polyvinyl alcohol (PVA) thin film was successfully adopted as a spacer to separate the Eu complex from the silver island film (SIF), and five-fold enhancement of the radiative decay rate of the Eu complex on SIF was demonstrated based on the luminescence intensity and lifetime measurement. Investigation of the distance dependent luminescence indicates that 7 nm is an optimal distance for SIF enhanced Eu luminescence. Plasmon enhanced rare-earth luminescence based on an organic film spacer would find potential applications in plasmon enhanced organic light emitting diode (OLED) devices.
Courrol, Lilia Coronato; Monteiro, A.M.; SILVA, F.R.O.; L. Gomes; VIEIRA, N.D.; Gidlund, Magnus; Figueiredo Neto, A.M.
2007-01-01
We report here the observation of the enhancement of Europium-tetracycline complex emission in Low Density Lipoprotein (LDL) solutions. Europium emission band of tetracycline solution containing Europium (III) chloride hexahydrate was tested to obtain effective enhancement in the presence of native LDL and oxidized LDL. Europium emission lifetime in the presence of lipoproteins was measured, resulting in a simple method to measure the lipoproteins quantity in an aqueous solution at physiologi...
Europium ion as a probe for binding sites to carrageenans
Energy Technology Data Exchange (ETDEWEB)
Ramos, Ana P.; Goncalves, Rogeria R.; Serra, Osvaldo A. [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, Ribeirao Preto, Sao Paulo 14040-901 (Brazil); Zaniquelli, Maria Elisabete D. [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, Ribeirao Preto, Sao Paulo 14040-901 (Brazil)], E-mail: medzaniquelli@ffclrp.usp.br; Wong, Kenneth [Laboratorio de Fisico-Quimica, Centro de Pesquisas de Paulinia, Rhodia Brasil, Paulinia, Sao Paulo (Brazil)
2007-12-15
Carrageenans, sulfated polysaccharides extracted from red algae, present a coil-helix transition and helix aggregation dependence on the type and concentration of counterions. In this study, we focus attention on a mixed valence counterion system: Eu{sup 3+}/Na{sup +} or K{sup +} with different gel-forming carrageenans: kappa, iota, and kappa-2. Results of stationary and time-dependent luminescence showed to be a suitable tool to probe ion binding to both the negatively charged sulfate group and the hydroxyl groups present in the biopolymer. For lower europium ion concentrations, a single longer decay emission lifetime was detected, which was attributed to the binding of europium ion to the carrageenan sulfate groups. An additional decay ascribed to europium binding to hydroxyl groups was observed above a threshold concentration, and this decay was dependent on the carrageenan charge density. Symmetry of the europium ion microenvironment was estimated by the ratio between the intensities of its emission bands, which has been shown to depend on the concentration of europium ions and on the specificity of the monovalent counterion bound to the carrageenan.
Red polymer light-emitting devices based on an oxadiazole-functionalized europium(III) complex
Energy Technology Data Exchange (ETDEWEB)
Liu, Yu, E-mail: liuyu03b@126.com [Department of Chemistry, Key Lab of Environment-Friendly Chemistry and Application in the Ministry of Education, Xiangtan University, Xiangtan 411105 (China); Wang, Yafei [Department of Chemistry, Key Lab of Environment-Friendly Chemistry and Application in the Ministry of Education, Xiangtan University, Xiangtan 411105 (China); Li, Chun [Institute of Polymer Optoelectronic Materials and Devices, South China University of Technology, Guangzhou 510640 (China); Huang, Ying; Dang, Dongfeng; Zhu, Meixiang [Department of Chemistry, Key Lab of Environment-Friendly Chemistry and Application in the Ministry of Education, Xiangtan University, Xiangtan 411105 (China); Zhu, Weiguo, E-mail: zhuwg18@126.com [Department of Chemistry, Key Lab of Environment-Friendly Chemistry and Application in the Ministry of Education, Xiangtan University, Xiangtan 411105 (China); Cao, Yong, E-mail: yongcao@scut.edu.cn [Institute of Polymer Optoelectronic Materials and Devices, South China University of Technology, Guangzhou 510640 (China)
2014-02-14
A novel tris(dibenzoylmethanato)[5-(2-(4-tert-butylbenzenyl)-5-benzenyl-1,3, 4-oxadiazole-4′)-1,10-phenanthroline]europium(III) [Eu(DBM){sub 3}(BuOXD-Phen)] containing an electron-transporting oxadiazole-functionalized phenanthroline ligand was synthesized and characterized. Its UV–vis absorption and photoluminescence (PL), as well as the electroluminescence (EL) in polymer light-emitting devices (PLEDs) were investigated. The double-layer PLEDs with a configuration of ITO/PEDOT:PSS (50 nm)/PVK (40 nm)/PFO:PBD (30%):Eu(DBM){sub 3}(BuOXD-Phen) (1–8 wt %) (80 nm)/Ba (4 nm)/Al (150 nm) were fabricated. Saturated red Eu{sup 3+} ion emission, based on the {sup 5}D{sub 0} → {sup 7}F{sub 2} transition, is centered at a wavelength of 614 nm with a full width at half maximum (FWHM) of 10 nm. The highest external quantum efficiency (QE{sub ext}) of 1.26% at current density of 1.65 mA cm{sup −2}, with a maximum brightness of 568 cd m{sup −2} at 137.8 mA cm{sup −2} was achieved from the device at 1 wt % dopant concentration. - Highlights: • An oxadiazole-functionalized europium(III) complex of Eu(DBM){sub 3}(BuOXD-Phen) was presented. • The optophysical properties of Eu(DBM){sub 3}(BuOXD-Phen) were investigated. • Saturated red emission was observed in the PLEDs. • An external quantum efficiency of 1.26% was obtained in these devices.
First-Principles Investigations on Europium Monoxide
Wang, Hao
2011-05-01
Europium monoxide is both an insulator and a Heisenberg ferromagnet (Tc=69 K). In the present thesis, the author has investigated the electronic structure of different types of EuO by density functional theory. The on-site Coulomb interaction of the localized Eu 4f and 5d electrons, which is wrongly treated in the standard generalized gradient approximation method, is found to be crucial to obtain the correct insulating ground state as observed in experiments. Our results show that the ferromagnetism is stable under pressure, both hydrostatic and uniaxial. For both types of pressure an insulator-metal transition is demonstrated. Moreover, the experimentally observed insulator-metal transition in oxygen deficient and gadolinium-doped EuO is reproduced in our calculations for impurity concentrations of 6.25% and 25%. Furthermore, a 10- layer EuO thin film is theoretically predicted to be an insulator with a narrow band gap of around 0.08 eV, while the Si/EuO interface shows metallic properties with the Si and O 2p as well as Eu 5d bands crossing the Fermi level.
Chloride, bromide and iodide scintillators with europium
Zhuravleva, Mariya; Yang, Kan
2016-09-27
A halide scintillator material is disclosed where the halide may comprise chloride, bromide or iodide. The material is single-crystalline and has a composition of the general formula ABX.sub.3 where A is an alkali, B is an alkali earth and X is a halide which general composition was investigated. In particular, crystals of the formula ACa.sub.1-yEu.sub.yI.sub.3 where A=K, Rb and Cs were formed as well as crystals of the formula CsA.sub.1-yEu.sub.yX.sub.3 (where A=Ca, Sr, Ba, or a combination thereof and X=Cl, Br or I or a combination thereof) with divalent Europium doping where 0.ltoreq.y.ltoreq.1, and more particularly Eu doping has been studied at one to ten mol %. The disclosed scintillator materials are suitable for making scintillation detectors used in applications such as medical imaging and homeland security.
Electrochemical extraction of europium from molten fluoride media
Energy Technology Data Exchange (ETDEWEB)
Gibilaro, M. [Universite de Toulouse, INPT, UPS, Laboratoire de Genie Chimique, Departement Procedes Electrochimiques, F-31062 Toulouse cedex 09 (France); CNRS, Laboratoire de Genie Chimique, F-31062 Toulouse cedex 09 (France); Massot, L., E-mail: massot@chimie.ups-tlse.f [Universite de Toulouse, INPT, UPS, Laboratoire de Genie Chimique, Departement Procedes Electrochimiques, F-31062 Toulouse cedex 09 (France); CNRS, Laboratoire de Genie Chimique, F-31062 Toulouse cedex 09 (France); Chamelot, P.; Cassayre, L.; Taxil, P. [Universite de Toulouse, INPT, UPS, Laboratoire de Genie Chimique, Departement Procedes Electrochimiques, F-31062 Toulouse cedex 09 (France); CNRS, Laboratoire de Genie Chimique, F-31062 Toulouse cedex 09 (France)
2009-12-15
This work concerns the extraction of europium from molten fluoride media. Two electrochemical ways have been examined: (i) the use of a reactive cathode made of copper and (ii) the co-deposition with aluminium on inert electrode, leading to the formation of europium-copper and europium-aluminium alloys, respectively, as identified by SEM-EDS analysis. Cyclic voltammetry and square wave voltammetry were used to identify the reduction pathway and to characterise the step of Cu-Eu and Al-Eu alloys formation. Then, electrochemical extractions using the two methodologies have been performed with extraction efficiency around 92% for copper electrode and 99.7% for co-reduction with aluminium ions.
Solubilization of europium fulvate in aqueous solutions containing complexing agents
Energy Technology Data Exchange (ETDEWEB)
Legin, E.K.; Trifonov, Yu.I.; Khokhlov, M.L. [Khlopin Radium Inst., St. Petersburg (Russian Federation)] [and others
1995-07-01
The europium fulvate complex is synthesized and characterized by spectroscopic and chemical methods. By an example of this complex, it is demonstrated that metal complexes of humic substances are solubilized in the presence of complexing anions such as OAc{sup {minus}}, C{sub 2}O{sup 2{minus}}{sub 4}, and EDTA{sup 2{minus}}. The solubilization is studied by the optical and radioactive tracer methods. The solubilization of europium fulvate increases parallel to the complexing power of anions. In the solid fulvate europium is bonded stronger than in the ethylenediaminetetraacetate complex. The solubilization is considered as a potential source for decomposition of the {open_quotes}absorbing soil complex,{close_quotes} resulting in mobile forms of a metal and humic component in soils and soil waters.
Excess europium content in Precambrian sedimentary rocks and continental evolution
Jakes, P.; Taylor, S. R.
1974-01-01
It is proposed that the europium excess in Precambrian sedimentary rocks, relative to those of younger age, is derived from volcanic rocks of ancient island arcs, which were the source materials for the sediments. Precambrian sedimentary rocks and present-day volcanic rocks of island arcs have similar REE patterns, total REE abundances, and excess Eu, relative to the North American shale composite. The present upper crustal REE pattern, as exemplified by that of sediments, is depleted in Eu, relative to chondrites. This depletion is considered to be a consequence of development of a granodioritic upper crust by partial melting in the lower crust, which selectively retains europium.
Murine High Specificity/Sensitivity Competitive Europium Insulin Autoantibody Assay
Babaya, Naru; Liu, Edwin; Miao, DongMei; Li, Marcella; Yu, Liping
2009-01-01
Abstract Background Most insulin autoantibody assays for both human and animal models are in a radioassay format utilizing 125I-insulin, but despite the radioassay format international workshops have documented difficulty in standardization between laboratories. There is thus a need for simpler assay formats that do not utilize radioactivity, yet retain the high specificity and sensitivity of radioassays. Methods To establish an easier enzyme-linked immunosorbent assay (ELISA) for insulin autoantibodies of non-obese diabetic (NOD) mice, we used an ELISA format, competition with unlabeled insulin, europium-avidin, and time-resolved fluorescence detection (competitive europium insulin autoantibody assay). Results The competitive europium assay of insulin autoantibodies when applied to sera from NOD mice had high sensitivity and specificity (92% sensitivity, 100% specificity) compared to our standard insulin autoantibody radioassay (72% sensitivity, 100% specificity) in analyzing blind workshop sera. It is noteworthy that though the assay has extremely high sensitivity for murine insulin autoantibodies and utilizes human insulin as target autoantigen, human sera with high levels of insulin autoantibodies are not detected. Conclusions Our results clearly indicate that low levels of insulin autoantibodies can be detected in an ELISA-like format. Combining a europium-based ELISA with competition with fluid-phase autoantigen can be applicable to many autoantigens to achieve high specificity and sensitivity in an ELISA format. PMID:19344197
Tridentate benzimidazole-pyridine-tetrazolates as sensitizers of europium luminescence.
Shavaleev, Nail M; Eliseeva, Svetlana V; Scopelliti, Rosario; Bünzli, Jean-Claude G
2014-05-19
We report on new anionic tridentate benzimidazole-pyridine-tetrazolate ligands that form neutral 3:1 complexes with trivalent lanthanides. The ligands are UV-absorbing chromophores that sensitize the red luminescence of europium with energy-transfer efficiency of 74-100%. The lifetime and quantum yield of the sensitized europium luminescence increase from 0.5 ms and 12-13% for the as-prepared solids to 2.8 ms and 41% for dichloromethane solution. From analysis of the data, the as-prepared solids can be described as aqua-complexes [Ln(κ(3)-ligand)2(κ(1)-ligand)(H2O)x] where the coordinated water molecules are responsible for the strong quenching of the europium luminescence. In solution, the coordinated water molecules are replaced by the nitrogen atoms of the κ(1)-ligand to give anhydrous complexes [Ln(κ(3)-ligand)3] that exhibit efficient europium luminescence. X-ray structures of the anhydrous complexes confirm that the lanthanide ion (La(III), Eu(III)) is nine-coordinate in a distorted tricapped trigonal prismatic environment and that coordination of the lanthanide ion by tetrazolate is weaker than by carboxylate.
Europium 2-benzofuranoate: Synthesis and use for bioimaging
Utochnikova, V. V.; Koshelev, D. S.; Medvedko, A. V.; Kalyakina, A. S.; Bushmarinov, I. S.; Grishko, A. Yu; Schepers, U.; Bräse, S.; Vatsadze, S. Z.
2017-12-01
Europium 2-benzofuranoate Eu(BFC)3(H2O)3 was successfully used for bioimaging in cellulo due to the combination of high solubility and high luminescence intensity in solution. It was possible due to the purposeful variation of the aromatic core of carboxylate anion.
SEPARATION OF EUROPIUM FROM OTHER LANTHANIDE RAE EARTHS BY SOLVENT EXTRACTION
Peppard, D.F.; Horwitz, E.P.; Mason, G.W.
1963-02-12
This patent deals with a process of separating europium from other lanthanides present in aqueous hydrochloric or sulfuric acid solutions. The europium is selectively reduced to the divalent state with a divalent chromium salt formed in situ from chromium(III) salt plus zinc amalgam. The other trivalent lanthanides are then extracted away from the divalent europium with a nitrogen-flushed phosphoric acid ester or a phosphonic acid ester. (AEC)
Decorporation of cesium-137; Decorporation du cesium-137
Energy Technology Data Exchange (ETDEWEB)
Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)
1997-12-31
Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)
Distribution, elimination, and renal effects of single oral doses of europium in rats.
Ohnishi, Keiko; Usuda, Kan; Nakayama, Shin; Sugiura, Yumiko; Kitamura, Yasuhiro; Kurita, Akihiro; Tsuda, Yuko; Kimura, Motoshi; Kono, Koichi
2011-11-01
Single doses of europium (III) chloride hexahydrate were orally administered to several groups of rats. Cumulative urine samples were taken at 0-24 h, and blood samples were drawn after 24-h administration. The europium concentration was determined in these samples by inductively coupled plasma atomic emission spectroscopy. The volume, creatinine, ß-2-microglobulin, and N-acetyl-ß-D-glucosaminidase were measured in the urine samples to evaluate possible europium-induced renal effects. The blood samples showed low europium distribution, with an average of 77.5 μg/L for all groups. Although the urinary concentration and excretion showed dose-dependent increases, the percentage of europium excreted showed a dose-dependent decrease, with an average of 0.31% in all groups. The administration of europium resulted in a significant decrease of creatinine and a significant increase of urinary volume, N-acetyl-ß-D-glucosaminidase, and ß-2-microglobulin. Rare earth elements, including europium, are believed to form colloidal conjugates that deposit in the reticuloendothelial system and glomeruli. This specific reaction may contribute to low europium bioavailability and renal function disturbances. Despite low bioavailability, the high performance of the analytical method for determination of europium makes the blood and urine sampling suitable tools for monitoring of exposure to this element. The results presented in this study will be of great importance in future studies on the health impacts of rare earth elements.
[Synthesis and luminescence properties of reactive ternary europium complexes].
Guo, Dong-cai; Shu, Wan-gen; Zhang, Wei; Liu, You-nian; Zhou, Yue
2004-09-01
In this paper, five new reactive ternary europium complexes were synthesized with the first ligand of 1,10-phenanthroline and the reactive second ligands of maleic anhydride, acrylonitrile, undecenoic acid, oleic acid and linoleic acid, and also characterized by means of elemental analysis, EDTA titrimetric method, FTIR spectra and UV spectra. The fluorescence spectra show that the five new ternary complexes have much higher luminescence intensity than their corresponding binary complexes, and the synergy ability sequence of the five reactive ligands is as follows: linoleic acid > oleic acid > acrylonitrile > maleic anhydride > undecenoic acid. At the same time, the reactive ternary europium complexes coordinated with the reactive ligands, which can be copolymerized with other monomers, will provide a new way for the synthesis of bonding-type rare earth polymer functional materials with excellent luminescence properties.
Rout, Alok; Souza, Ernesto Rezende; Binnemans, Koen
2014-01-01
Europium(III) was extracted by bis(2-ethylhexyl)diglycolamic acid (DEHDGA) dissolved in the non-fluorinated ionic liquid tetraoctylammonium dodecyl sulphate, [N8888][DS]. The extraction behaviour of europium(III) was investigated as a function of various parameters: pH, extractant concentration, concentration of the europium(III) ion in the aqueous feed and concentration of the salting-out agent. A comparison was made with extraction of europium(III) by the acidic extractants bis(2-ethylhexyl...
Silver lead borate glasses doped with europium ions for phosphors ...
Indian Academy of Sciences (India)
2017-07-25
Jul 25, 2017 ... Abstract. Europium (Eu3+) doped silver lead borate glasses with the composition of xEu2O3−(1 − x)Ag2. O−29PbO−70B2O3 (x = 0, 0.1, 0.2, 0.3, 0.4 and 0.5 mol%) have been successfully prepared by conventional melt quenching method. Thermal, structural and luminescence properties have been studied ...
Silver lead borate glasses doped with europium ions for phosphors ...
Indian Academy of Sciences (India)
Europium (Eu 3 + ) doped silver lead borate glasses with the composition of x Eu 2 O 3 −( 1 − x )Ag 2 O−29PbO−70B 2 O 3 ( x = 0 , 0.1, 0.2, 0.3, 0.4 and 0.5 mol%) have been successfully prepared by conventional meltquenching method. Thermal, structural and luminescence properties have been studied using ...
Synthesis and luminescence properties for europium oxide nanotubes
Energy Technology Data Exchange (ETDEWEB)
Mo Zunli, E-mail: mozl@163.com [Key Laboratory of Eco-Environment-Related Polymer Materials, Ministry of Education of China, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China) and State Key Laboratory of Solidification Processing, Northwestern Polytechnical University, Xi' an 710072 (China); Deng Zhepeng; Guo Ruibin [Key Laboratory of Eco-Environment-Related Polymer Materials, Ministry of Education of China, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China); Fu Qiangang [State Key Laboratory of Solidification Processing, Northwestern Polytechnical University, Xi' an 710072 (China); Feng Chao; Liu Pengwei; Sun Yu [Key Laboratory of Eco-Environment-Related Polymer Materials, Ministry of Education of China, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China)
2012-01-25
Highlights: Black-Right-Pointing-Pointer A novel high temperature sensitive fluorescent CNTs/Eu{sub 2}O{sub 3} nanocomposite was fabricated. Black-Right-Pointing-Pointer The nanocomposite showed strong fluorescent emission peaks at around 540 and 580 nm after calcined beyond 620 Degree-Sign C for 4 h. Black-Right-Pointing-Pointer The ultrahigh fluorescence intensity of the nanocomposites resulted from a synergetic effect of CNTs and europium oxide. Black-Right-Pointing-Pointer We also discovered that CNTs had an effect of fluorescence quenching. - Abstract: A novel high temperature sensitive fluorescent nanocomposite has been successfully synthesized by an economic hydrothermal method using carbon nanotubes (CNTs), europium oxide, and sodium dodecyl benzene sulfonate (SDBS). To our great interest, the nanocomposites show high temperature sensitivity after calcinations at various temperatures, suggesting a synergetic effect of CNTs and europium oxide which leads to ultrahigh fluorescence intensity of europium oxide nanotubes. When the novel high temperature sensitive fluorescent nanocomposites were calcined beyond 620 Degree-Sign C for 4 h, the obtained nanocomposites have a strong emission peak at around 540 and 580 nm, due to the {sup 5}D{sub 0} {yields} {sup 7}F{sub j} (j = 0, 1) forced electric dipole transition of Eu{sup 3+} ions. In turn, the emission spectra showed a slight blue shift. The intensity of this photoluminescence (PL) band is remarkably temperature-dependent and promotes strongly beyond 620 Degree-Sign C. This novel feature is attributed to the thermally activated carrier transfer process from nanocrystals and charged intrinsic defects states to Eu{sup 3+} energy levels. The novel high temperature sensitive fluorescent nanocomposite has potential applications in high temperature warning materials, sensors and field emission displays. It is also interesting to discover that CNTs have the effect of fluorescence quenching.
Optical and magnetization studies on europium based iron pnictides
Energy Technology Data Exchange (ETDEWEB)
Zapf, Sina Maria Ute
2015-07-01
The investigations carried out in the framework of this thesis mainly concentrate on europium based iron pnictides. These are a peculiar member of the 122 family as they develop at low temperatures (∝20K) an additional magnetic order of the local rare earth moments. Therefore, europium based iron pnictides provide a unique platform to study the interplay of structural, magnetic and electronic effects in high-temperature superconductors. For this challenging purpose, we have employed SQUID magnetometry and Fourier-transform infrared spectroscopy on EuFe{sub 2}(As{sub 1-x}P{sub x}){sub 2} single crystals. By systematic studies of the in- and out-of-plane magnetic properties of a series of single crystals, we derived the complex magnetic phase diagram of europium based iron pnictides, which contains an A-type antiferromagnetic and a re-entrant spin glass phase. Furthermore, we have investigated the magneto-optical properties of EuFe{sub 2}As{sub 2}, revealing a much more complex magnetic detwinning process than expected. These studies demonstrate a remarkable interdependence between magnetic, electronic and structural effects that might be very important to understand the unconventional superconductivity in these fascinating materials.
Use of europium ions for SAD phasing of lysozyme at the Cu Kα wavelength
Vijayakumar, Balakrishnan; Velmurugan, Devadasan
2012-01-01
Europium(III) ions bound to the surface of hen egg-white lysozyme were found to exhibit good anomalous signal facilitating SAD phasing using laboratory-source data and automated model building. The europium ion-binding sites were observed up to the 15σ level.
Directory of Open Access Journals (Sweden)
Soumen Dhara
2017-02-01
Full Text Available We show that europium doped ZnO nanowires after surface modification with organic ligand, 1,10 phenanthroline (phen leads to strong red emission at 613 nm which is a characteristic emission from the atomic levels of Eu3+. Surface modification with phen leads to formation of phenanthroline-europium interface on the surface of the nanowires due to attachment of Eu3+ ions. After an optimized surface modification with phen, intensity of both the UV emission (band edge and red emission improved by two orders of magnitude at room temperature. We observed multiple energy transfer pathways to the energy levels of Eu3+ ions through the phenanthroline-europium interface, which found to be very effective to the significant enhancement of emission from the dopant Eu3+. This study shows a new insight in to the energy transfer process from phen to the europium doped ZnO system.
Dual doped graphene oxide for electrochemical sensing of europium ion
Kumar, Sunil; Patra, Santanu; Madhuri, Rashmi; Sharma, Prashant K.
2017-05-01
This present work represents a single step hydrothermal method for the preparation of N, and N, S dual doped graphene oxide (GO). First time, a comparative electrochemical study between single dope and dual doped GO was carried out using potassium ferrocyanide as an electro-active probe molecule and found that the dual doped GO has the highest electrocatalytic activity than single doped, due to the presence of two heteroatoms as a doping material. Afterwards, the dual doped GO was successfully applied for the electrochemical detection of a rare earth element i.e. europium, with LOD value of 5.92 μg L-1.
Crystal growth of nanoscaled europium selenide having characteristic crystal shapes
Energy Technology Data Exchange (ETDEWEB)
Tanaka, Atsushi; Adachi, Taka-aki [Graduate School of Materials Science, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, Nara 630-0192 (Japan); Hasegawa, Yasuchika, E-mail: hasegawa@ms.naist.j [Graduate School of Materials Science, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, Nara 630-0192 (Japan); Kawai, Tsuyoshi [Graduate School of Materials Science, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, Nara 630-0192 (Japan)
2009-12-04
Tetrapod-shaped EuSe nanocrystals were prepared through the thermal reduction of europium chloride an organic selenide complex, n-hexadecylamine, and two additives oleic acid and oleylamine. The obtained EuSe nanoparticles were characterized by X-ray diffraction (XRD). The crystal grain size from the XRD spectrum was estimated to be 50 nm. In contrast, observation of the transmission electron microscope (TEM) gave larger sized EuSe (average size: 200 nm). Anisotropic crystal-growth of EuSe nanocrystals was achieved by addition of a small amount of oleic acid in the crystal growth process.
Photoprotective properties of the fluorescent europium complex in UV-irradiated skin.
Vogt, O; Lademann, J; Rancan, F; Meinke, M C; Schanzer, S; Stockfleth, E; Sterry, W; Lange-Asschenfeldt, B
2013-01-01
In this study, we compared the UV-protective abilities of the europium complex compared to titanium dioxide, which represents the most common physical filter for ultraviolet light in the broad-band spectral range. The UV absorption and light transformative capacities of the europium complex were evaluated using a spectrometer with a double-integrating sphere showing that the europium complex does not only absorb and reflect UV light, but transforms it into red and infrared light. It was found that the europium complex binds to the surface of Jurkat cells in vitro. Cells incubated with the europium complex showed a significantly higher viability after UVA and UVB irradiation as compared to untreated cells and cells incubated with titanium dioxide pointing out its photoprotective properties. The europium complex and titanium dioxide show similar penetration capacities into the stratum corneum as tested in human and porcine skin using tape stripping analysis. The europium complex has proved to be an efficient UV filter with a low cyto- and phototoxic profile and therefore represents a potential candidate for use in sunscreen formulations. Copyright © 2013 S. Karger AG, Basel.
Low-voltage cathodoluminescence of europium-activated yttrium orthovanadate
Energy Technology Data Exchange (ETDEWEB)
Phillips, M.L.F.
1995-03-01
Emissive flat panel display systems operating in full color demand higher performance at low voltages (ca. 501000 V) from cathodoluminescent (CL) phosphors than cathode ray tubes require. Hydrothermal synthesis has been suggested as a route to phosphors with improved efficiencies, lower voltage thresholds, and increased saturation power. This hypothesis was tested in europium-doped yttrium orthovanadate (YVO{sub 4}:Eu), an efficient, red emitting CL phosphor. The CL efficiency of YVO{sub 4}:Eu crystallized from aqueous solution at 200{degrees}C is relatively low until it is annealed. The distribution of particle sizes in the low-temperature phosphor is similar to that in material made via a solid-state route, but crystallites remain much smaller (ca. 400 {Angstrom}) until they are annealed. These observations, along with the anomalously strong dependence of CL intensity on europium concentration, support a model in which efficiency principally depends on crystallite size. CL efficiency of both solid state and hydrothermal YVO{sub 4}:Eu increases with voltage at constant power. Surface-bound electrons are likely the dominant influence on efficiency at voltages near threshold. Saturation power is independent of synthetic route. It is apparent that the CL properties of hydrothermally synthesized YVO{sub 4}:Eu are essentially the same as those of YVO{sub 4}:Eu produced via conventional, high-temperature routes.
In Vivo Toxicity Studies of Europium Hydroxide Nanorods in Mice
Patra, Chitta Ranjan; Abdel Moneim, Soha S.; Wang, Enfeng; Dutta, Shamit; Patra, Sujata; Eshed, Michal; Mukherjee, Priyabrata; Gedanken, Aharon; Shah, Vijay H; Mukhopadhyay, Debabrata
2009-01-01
Lanthanide nanoparticles and nanorods have been widely used for diagnostic and therapeutic applications in biomedical nanotechnology due to their fluorescence properties and pro-angiogenic to endothelial cells, respectively. Recently, we have demonstrated that europium (III) hydroxide [EuIII(OH)3] nanorods, synthesized by the microwave technique and characterized by several physico-chemical techniques, can be used as pro-angiogenic agents which introduce future therapeutic treatment strategies for severe ischemic heart/limb disease, and peripheral ischemic disease. The toxicity of these inorganic nanorods to endothelial cells was supported by several in vitro assays. To determine the in vivo toxicity, these nanorods were administered to mice through intraperitoneal injection (IP) everyday over a period of seven days in a dose dependent (1.25 to 125 mgKg−1day−1) and time dependent manner (8–60 days). Bio-distribution of europium elements in different organs was analyzed by inductively coupled plasma mass spectrometry (ICPMS). Short-term (S-T) and long-term (L-T) toxicity studies (mice sacrificed on day 8 and 60 for S-T and L-T, respectively) show normal blood hematology and serum clinical chemistry with the exception of a slight elevation of liver enzymes. Histological examination of nanorod treated vital organs (liver, kidney, spleen and lungs) showed no or only mild histological changes that indicate mild toxicity at the higher dose of nanorods. PMID:19616569
Temperature dependences in electron-stimulated desorption of neutral europium
Ageev, V N; Madey, T E
2003-01-01
The electron-stimulated desorption (ESD) yield for neutral europium (Eu) atoms from Eu layers adsorbed on oxygen-covered tungsten surfaces has been measured as a function of electron energy, europium coverage and degree of oxidation of tungsten, with an emphasis on effects of substrate temperature. The measurements have been carried out using a time-of-flight method and surface ionization detector. We expand on an earlier report, and compare ESD of multivalent Eu with ESD of monovalent alkali atoms, studied previously. The Eu atom ESD is a complicated function of Eu coverage, electron energy and substrate temperature. In the coverage range 0.05-0.35 monolayer (ML), overlapping resonant-like Eu atom yield peaks are observed at electron energies E sub e of 36 and 41 eV that might be associated with Eu or W shallow core level excitations. Additional resonant-like peaks are seen at E sub e of 54 and 84 eV that are associated with W 5p and 5s level excitations. The Eu atom yield peaks at 36 and 41 eV are seen only...
The Oxidation State of Europium in Halide Glasses
Weber, J.K.R.; Vu, M.; Paßlick, C.; Schweizer, S.; Brown, D.E.; Johnson, C.E.; Johnson, J.A.
2012-01-01
The luminescent properties of divalent europium ions can be exploited to produce storage phosphors for x-ray imaging applications. The relatively high cost and limited availability of divalent europium halides makes it desirable to synthesize them from the readily available trivalent salts. In this work, samples of pure EuCl3 and fluoride glass melts doped with EuCl3 were processed at 700-800 °C in an inert atmosphere furnace. The Eu oxidation state in the resulting materials was determined using fluorescence and Mössbauer spectroscopy. Heat treatment of pure EuCl3 for 10 minutes at 710 °C resulted in a material comprising approximately equal amounts of Eu2+ and Eu3+. Glasses made using mixtures of EuCl2 and EuCl3 in the starting material contained both oxidation states. This paper describes the sample preparation and analysis and discusses the results in the context of chemical equilibria in the melts. PMID:22101252
Innovative triboluminescence study of multivitamin doped europium tetrakis
Energy Technology Data Exchange (ETDEWEB)
Fontenot, R.S. [Alabama A and M University, Department of Physics, Chemistry, and Mathematics, P.O. Box 1268, Normal, Alabama 35762 (United States); University of Louisiana at Lafayette, Department of Physics, P.O. Box 44210, Lafayette, LA 70504 (United States); Bhat, K.N.; Aggarwal, M.D. [Alabama A and M University, Department of Physics, Chemistry, and Mathematics, P.O. Box 1268, Normal, Alabama 35762 (United States); Hollerman, W.A. [University of Louisiana at Lafayette, Department of Physics, P.O. Box 44210, Lafayette, LA 70504 (United States)
2012-05-15
As the Space Shuttle program ends, NASA is developing the next generation of space vehicles. These new concept designs will require new and innovative structural health monitoring capabilities. One way to solve this problem is with smart impact sensors that use triboluminescent materials. In 2011, the authors reported an 82% increase in the triboluminescence yield of europium dibenzoylmethide triethylammonium (EuD{sub 4}TEA) by changing the starting material. It has been shown that introduction of dopants tends to enhance the triboluminescent light yield. Here we report the successful synthesis of a multivitamin doped europium tetrakis which appears to be spherical in shape. Inductively Coupled Plasma - Optical Emission Spectroscopy analysis showed the presence of 3.6% calcium, 0.62% magnesium, 0.1% iron, 0.01% copper and manganese. This new product has no shift in the triboluminescent or photoluminescent emission peaks, but only a change in the intensity. In addition, the doped EuD{sub 4}TEA powder statistically emits more triboluminescence while having the same decay time. (copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Energy Technology Data Exchange (ETDEWEB)
Santos Garcia, Irene Teresinha, E-mail: irene@iq.ufrgs.br [Departamento de Fisico-Quimica, Instituto de Quimica, Universidade Federal do Rio Grande do Sul, Av. Bento Goncalves 9500, Bairro Agronomia, CEP 91501-970, Porto Alegre, RS (Brazil); Velleda Ribeiro, Patricia; Silva Correa, Diogo; Neto da Cunha, Igor Michel; Lenin Villarreal Carreno, Neftali [Instituto de Quimica e Geociencias, Universidade Federal de Pelotas, Campus Capao do Leao, s/n. CEP 96010-900, Pelotas, RS (Brazil); Ceretta Moreira, Eduardo [PPGEE, Universidade Federal do Pampa, Campus Bage, Bage- RS (Brazil); Severo Rodembusch, Fabiano [Departamento de Quimica Organica, Instituto de Quimica, Universidade Federal do Rio Grande do Sul, Av. Bento Goncalves 9500, Bairro Agronomia, CEP 91501-970, Porto Alegre, RS (Brazil)
2011-12-01
A photoactive complex based on europium(III) using the amino acid phenylalanine as ligand was prepared and characterized. The obtained europium(III)/phenylalanine complex presents an effective energy transfer from ligands to the rare earth center. The observed photoluminescent behavior for europium(III)/phenylalanine complex was similar to the well known europium(III)/ acetyl-{beta}-acetonate hydrate. New photoactive polyamide thin films were prepared using polycaprolactam as host of these complexes. The structural characterizations of the films were studied through Rutherford backscattering (RBS), Fourier transform infrared (FTIR) and Raman spectroscopies. The polyamide films doped with the amino acid and acetyl-{beta}-acetonate rare earth complexes maintain the original photoluminescent behavior, narrow emission bands corresponding to transitions {sup 5}D{sub 0} {yields} {sup 7}F{sub 0-4}, which indicates that this polymer is an excellent host to these complexes.
Shan, Wenfei; Liu, Fen; Liu, Jiang; Chen, Yanwen; Yang, Zehui; Guo, Dongcai
2015-09-01
Four novel salicylaldehyde isonicotinoyl hydrazone derivatives and their corresponding europium ion complexes were synthesized and characterized, while the luminescence properties and the fluorescence quantum yields of the target complexes were investigated. The results indicated that the ligands favored energy transfers to the emitting energy level of europium ion, and four target europium complexes showed the characteristic luminescence of central europium ion. Besides the luminescence intensity of the complex with methoxy group, which possessed the highest fluorescence quantum yield (0.522), was stronger than that of other complexes. Furthermore, the electrochemical properties of the target complexes were further investigated by cyclic voltammetry, the results indicated that the highest occupied molecular orbital (HOMO), lowest unoccupied molecular orbital (LUMO) energy levels and the oxidation potential of the complexes with electron donating group increased, however, that of the complexes with accepting electron group decreased. Copyright © 2015 Elsevier Inc. All rights reserved.
Guo, Dong-cai; Yi, Li-ming; Shu, Wan-gen; Zhang, Zhen-zhen; Zeng, Zhao-rong; Zhang, Xi-qian
2006-11-01
Five ternary complexes were synthesized from europium with aromatic carboxylic acid (p-methylbenzoic acid, methoxybenzoic acid, m-chlorobenzoic acid and benzoic acid, p-hydroxylbenzoic acid) and acrylonitrile, and characterized by means of elemental analysis, thermal analysis, FTIR spectra and UV spectra. The fluorescence spectra show that five ternary complexes have good luminescence properties, and the sequence of the ability of the aromatic carboxylic acids to transfer light energy to europium ion is as follows: p-methylbenzoic acid>benzoic acid>m-chlorobenzoic acid>p-hydroxylbenzoic acid>methoxybenzoic acid. Meanwhile, the ternary europium complexes containing a reactive ligand acrylonitrile will possibly have a potential application to the fabrication of bonding-type europium polymer luminescent materials.
Cesium-137, a drama recounted; Cesio-137, um drama recontado
Energy Technology Data Exchange (ETDEWEB)
Vieira, Suzane de Alencar
2013-01-15
The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)
Motta, Fabiana Villela da; Marques,Ana Paula de Azevedo; Araújo,Vinícius Dantas de; Tavares, Mara Tatiane De Souza; Delmonte,Mauricio Roberto Bomio; Paskocimas, Carlos Alberto; Li, Máximo Siu; Nascimento, Rubens Maribondo do; Longo, Elson [UNESP
2014-01-01
Crystalline europium-doped indium hydroxide (In(OH)3:Eu) nanostructures were prepared by rapid and efficient Microwave-Assisted Hydrothermal (MAH) method. Nanostructures were obtained at low temperature. FE-SEM images confirm that these samples are composed of 3D nanostructures. XRD, optical diffuse reflectance and photoluminescence (PL) measurements were used to characterize the products. Emission spectra of europium-doped indium hydroxide (IH:xEu) samples under excitation (350.7 nm) present...
Soares, M.R.N.; Nico, C.; Peres, M.; Ferreira, N.; Fernandes, A.J.S.; Monteiro, T.; COSTA, F.M.
2011-01-01
Yttria stabilized zirconia single crystal fibers doped with europium ions were developed envisaging optical applications. The laser floating zone technique was used in order to grow millimetric high quality single crystal fibers. The as-grown fibers are completely transparent and inclusion free, exhibiting a cubic structure. Under ultraviolet (UV) excitation, a broad emission band appears at 551 nm. The europium doped fibers are translucent with a tetragonal structure and exhibit an intense r...
African Journals Online (AJOL)
Design: A prospective study of cases managed. Setting: University College Hospital, Ibadan, Nigeria. Subjects: Seventy six patients seen and managed .... of women who own motorcars, motorcycles and bicycles is negligible compared to that of men which exposes them to road traffic accidents which was the leading cause ...
A non-aqueous reduction process for purifying ¹⁵³Gd produced in natural europium targets.
Johnsen, Amanda M; Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R
2013-12-01
Gadolinium-153 is a low-energy gamma-emitter used in nuclear medicine imaging quality assurance. Produced in nuclear reactors using natural Eu₂O₃ targets, ¹⁵³Gd is radiochemically separated from europium isotopes by europium reduction. However, conventional aqueous europium reduction produces hydrogen gas, a flammability hazard in radiological hot cells. We altered the traditional reduction method, using methanol as the process solvent to nearly eliminate hydrogen gas production. This new, non-aqueous reduction process demonstrates greater than 98% europium removal and gadolinium yields of 90%. © 2013 Elsevier Ltd. All rights reserved.
Intercalated europium metal in epitaxial graphene on SiC
Anderson, Nathaniel A.; Hupalo, Myron; Keavney, David; Tringides, Michael C.; Vaknin, David
2017-10-01
X-ray magnetic circular dichroism (XMCD) reveals the magnetic properties of intercalated europium metal under graphene on SiC(0001). The intercalation of Eu nanoclusters (average size 2.5 nm) between graphene and SiC substate are formed by deposition of Eu on epitaxially grown graphene that is subsequently annealed at various temperatures while keeping the integrity of the graphene layer. Using sum-rules analysis of the XMCD of Eu M4 ,5 edges at T =15 K, our samples show paramagnetic-like behavior with distinct anomaly at T ≈90 K, which may be related to the Nèel transition, TN=91 K, of bulk metal Eu. We find no evidence of ferromagnetism due to EuO or antiferromagnetism due to Eu2O3 , indicating that the graphene layer protects the intercalated metallic Eu against oxidation over months of exposure to atmospheric environment.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Appeals. 1703.137 Section 1703.137 Agriculture Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine Combination Loan and Grant Program § 1703.137...
29 CFR 452.137 - Effective dates.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Effective dates. 452.137 Section 452.137 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR-MANAGEMENT STANDARDS... OF 1959 Dates and Scope of Application § 452.137 Effective dates. (a) Section 404 states when the...
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Water supply. 137.1 Section 137.1 Indians BUREAU OF... CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.1 Water supply. The engineering report dealt with in... capacity of the San Carlos reservoir created by the Coolidge Dam and the water supply therefor over a...
42 CFR 137.2 - Congressional policy.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Congressional policy. 137.2 Section 137.2 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE General Provisions § 137.2 Congressional policy...
42 CFR 137.6 - Secretarial policy.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Secretarial policy. 137.6 Section 137.6 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE General Provisions § 137.6 Secretarial policy. In...
25 CFR 137.6 - Power development.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Power development. 137.6 Section 137.6 Indians BUREAU OF... CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.6 Power development. The cost of the power development at... power development shall be disposed of as required by the terms and conditions of the act of March 7...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Retention. 27.137 Section 27.137 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF... Filing and Retention of Records and Reports § 27.137 Retention. All records required by this part...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Excluded milk. 58.137 Section 58.137 Agriculture... Milk § 58.137 Excluded milk. A plant shall not accept milk from a producer if: (a) The milk has been in...) Three of the last five milk samples have exceeded the maximum bacterial estimate of 500,000 per ml...
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Semolina. 137.320 Section 137.320 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Related Products § 137.320 Semolina. (a) Semolina is the food prepared by grinding and bolting cleaned...
28 CFR 13.7 - Judicial review.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Judicial review. 13.7 Section 13.7 Judicial Administration DEPARTMENT OF JUSTICE ATOMIC WEAPONS AND SPECIAL NUCLEAR MATERIALS REWARDS REGULATIONS § 13.7 Judicial review. The decision of the Attorney General is final and conclusive and no court...
49 CFR 176.137 - Portable magazine.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Portable magazine. 176.137 Section 176.137... Requirements for Class 1 (Explosive) Materials Stowage § 176.137 Portable magazine. (a) Each portable magazine... wood, a portable magazine must be framed of nominal 5 cm × 10 cm (2×4 inch) lumber, and sheathed with...
Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-10-01
The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``
2010-07-01
..., strontium salt(1:1:2), dysprosium and europium-doped. 721.9511 Section 721.9511 Protection of Environment...), magnesium, strontium salt(1:1:2), dysprosium and europium-doped. (a) Chemical substance and significant new..., strontium salt(1:1:2), dysprosium and europium-doped. (PMN P-98-848; CAS No.181828-07-9) is subject to...
Sicchieri, Letícia Bonfante; de Andrade Natal, Rodrigo; Courrol, Lilia Coronato
2016-10-01
The objective of this study is to characterize arterial tissue with and without atherosclerosis by fluorescence lifetime imaging microscopy (FLIM) using Europium Chlortetracycline complex (EuCTc) as fluorescent marker. For this study, twelve rabbits were randomly divided into a control group (CG) and an experimental group (EG), where they were fed a normal and hypercholesterolemic diet, respectively, and were treated for 60 days. Cryosections of the aortic arch specimens were cut in a vertical plane, mounted on glass slides, and stained with Europium (Eu), Chlortetracycline (CTc), Europium Chlortetracycline (EuCTc), and Europium Chlortetracycline Magnesium (EuCTcMg) solutions. FLIM images were obtained with excitation at 405 nm. The average autofluorescence lifetime within plaque depositions was ~1.36 ns. Reduced plaque autofluorescence lifetimes of 0.23 and 0.31 ns were observed on incubation with EuCTc and EuCTcMg respectively. It was observed a quenching of collagen, cholesterol and TG emission spectra increasing EuCTc concentration. The drastic reduction in fluorescence lifetimes is due to a resonant energy transfer between collagen, triglycerides, cholesterol and europium complexes, quenching fluorescence.
Reddy, M L P; Divya, V; Pavithran, Rani
2013-11-21
Visible-light sensitized luminescent europium(III) molecular materials are of considerable importance because their outstanding photophysical properties make them well suited as labels in fluorescence-based bioassays and low-voltage driven pure red-emitters in optoelectronic technology. One challenge in this field is development of visible-light sensitizing ligands that can form highly emissive europium(III) complexes with sufficient stability and aqueous solubility for practical applications. Indeed, some of the recent reports have demonstrated that the excitation-window can be shifted to longer-wavelengths in europium(III)-β-diketonate complexes by appropriate molecular engineering and suitably expanded π-conjugation in the complex molecules. In this review, attention is focused on the latest innovations in the syntheses and photophysical properties of visible-light sensitized europium(III)-β-diketonate complexes and their application as bioprobes for cellular imaging. Furthermore, luminescent nanomaterials derived from long-wavelength sensitized europium(III)-β-diketonate complexes and their application in life sciences are also highlighted.
The electronic properties of mixed valence hydrated europium chloride thin film.
Silly, M G; Charra, F; Lux, F; Lemercier, G; Sirotti, F
2015-07-28
We investigate the electronic properties of a model mixed-valence hydrated chloride europium salt by means of high resolution photoemission spectroscopy (HRPES) and resonant photoemission spectroscopy (RESPES) at the Eu 3d → 4f and 4d → 4f transitions. From the HRPES spectra, we have determined that the two europium oxidation states are homogeneously distributed in the bulk and that the hydrated salt film is exempt from surface mixed valence transition. From the RESPES spectra, the well separated resonant contributions characteristic of divalent and trivalent europium species (4f(6) and 4f(7) final states, respectively) are accurately extracted and quantitatively determined from the resonant features measured at the two edges. The partial absorption yield spectra, obtained by integrating the photoemission intensity in the valence-band region, can be well reproduced by atomic multiplet calculation at the M(4,5) (3d-4f) absorption edge and by an asymmetric Fano-like shape profile at the N(4,5) (4d-4f) absorption edge. The ratio of Eu(2+) and Eu(3+) species measured at the two absorption edges matches with the composition of the mixed valence europium salt as determined chemically. We have demonstrated that the observed spectroscopic features of the mixed valence salt are attributed to the mixed-valence ground state rather than surface valence transition. HRPES and RESPES spectra provide reference spectra for the study of europium salts and their derivatives.
Europium-doped calcium titanate: Optical and structural evaluations
Energy Technology Data Exchange (ETDEWEB)
Mazzo, Tatiana Martelli; Pinatti, Ivo Mateus [INCTMN, LIEC, Departamento de Química, Universidade Federal de São Carlos, P.O. Box 676, 13565-905 São Carlos, SP (Brazil); Macario, Leilane Roberta [INCTMN, LIEC, Instituto de Química, Universidade Estadual Paulista, P.O. Box 355, 14800-900 Araraquara, SP (Brazil); Avansi, Waldir [Centro de Ciências Exatas e de Tecnologia, Departamento de Física, Universidade Federal de São Carlos, Jardim Guanabara, 13565-905 São Carlos, SP (Brazil); Moreira, Mario Lucio [Instituto de Física e Matemática, Universidade Federal de Pelotas, P.O. Box 354, Campus do Capão do Leão, 96001-970 Pelotas, RS (Brazil); Rosa, Ieda Lucia Viana, E-mail: ilvrosa@ufscar.br [INCTMN, LIEC, Departamento de Química, Universidade Federal de São Carlos, P.O. Box 676, 13565-905 São Carlos, SP (Brazil); Mastelaro, Valmor Roberto [Instituto de Física de São Carlos, Departamento de Física e Ciência dos Materiais, Universidade de São Paulo, P.O. Box 369, Av Trabalhador São Carlense 400, 13560-970 São Carlos, SP (Brazil); Varela, José Arana; Longo, Elson [INCTMN, LIEC, Instituto de Química, Universidade Estadual Paulista, P.O. Box 355, 14800-900 Araraquara, SP (Brazil)
2014-02-05
Highlights: • CaTiO{sub 3}:Eu{sup 3+} were obtained using low temperatures and very short reactional times. • The Eu{sup 3+} changes the local order–disorder of the [TiO{sub 6}] and [CaO{sub 12}] clusters. • Lifetime decay curves reveal two sites of symmetry of the Eu{sup 3+} in the CT matrix. • CaTiO{sub 3}:Eu{sup 3+} exhibit the strongest luminescent intensity and pure red color. -- Abstract: Pure Calcium Titanate (CT-pure) and Europium doped Calcium Titanate Ca{sub 1−x}Eu{sub x}TiO{sub 3} (x = 0.5%, 1.0% and 2.0% molar ratio of Eu{sup 3+} ions) powders were synthesized by hydrothermal microwave method (HTMW) at 140 °C for 8 min. The HTMW method appears to be an efficient method to prepare the luminescence materials using low temperatures and very short reactional times. In addition it is possible to determine specific correlations imposed by TiCl{sub 4} replacement by titanium isopropoxide [Ti(OC{sub 3}H{sub 7}){sub 4}] changing the reaction character and resulting in two different options of europium doping CT syntesis. To evaluate the influence of the structural order–disorder among the reactions and different properties of these materials, the following techniques were used for characterization. XANES spectroscopy that revealed that the introduction of Eu{sup 3+} ions into the CT lattice induces to significant changes in the local order–disorder around both, [TiO{sub 6}] and [CaO{sub 12}], complex clusters. PL spectra show Eu{sup 3+} emission lines ascribed to the Eu{sup 3+} transitions from {sup 5}D{sub 0} excited states to {sup 7}F{sub J} (J = 0, 1–4) fundamental states in CT:Eu{sup 3+} powders excited at 350 and 394 nm.
RBS and RNRA studies on sorption of europium by apatite
Energy Technology Data Exchange (ETDEWEB)
Ohnuki, Toshihiko; Kozai, Naofumi; Isobe, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murakami, Takashi; Yamamoto, Shunya; Aoki, Yasushi; Naramoto, Hiroshi
1997-03-01
The sorption mechanism of europium, alternative of trivalent TRU has been studied based on the depth profiles of elements obtained by Rutherford Backscattering Spectroscopy (RBS) and Resonant Nuclear Reaction Analysis (RNRA). The positive peak for Eu and the negative peak for Ca were observed in the subtracted RBS spectra of the apatites on which Eu was sorbed from that of the fresh apatite. This indicates that Eu was sorbed on apatite, while a fraction of Ca was released from apatite. The peak height for Eu in the RBS spectrum of the apatite obtained at 75degC was higher than that of the apatite at 40degC. The depth profile of hydrogen of the apatite on which Eu was sorbed was similar to that of the fresh apatite. The concentration of Eu in the solution decreased with increasing temperature. On the contrary, the concentration of Ca increased with increasing temperature. Thus, it is concluded that a fraction of Eu is exchanged for Ca in the structure of apatite. (author)
Spectrofluorimetric determination of heparin using doxycycline-europium probe
Energy Technology Data Exchange (ETDEWEB)
Li Jing [Department of Chemistry, Shandong Normal University, Jinan 250014 (China); Liu Jinkai [Department of Chemistry, Shandong Normal University, Jinan 250014 (China); Zhu Xiaojing [Department of Chemistry, Shandong Normal University, Jinan 250014 (China); Peng Qian [Department of Chemistry, Shandong Normal University, Jinan 250014 (China); Jiang Chongqiu [Department of Chemistry, Shandong Normal University, Jinan 250014 (China)]. E-mail: jiangchongqiu@sdnu.edu.cn
2005-06-15
A new spectrofluorimetric method was developed for the determination of the trace amount of heparin (Hep). Using doxycycline (DC)-europium ion (Eu{sup 3+}) as a fluorescent probe, in the buffer solution of pH=8.9, Hep can remarkably enhance the fluorescence intensity of the DC-Eu{sup 3+} complex at {lambda}=612 nm and the enhanced fluorescence intensity of Eu{sup 3+} ion is in proportion to the concentration of Hep. Optimum conditions for the determination of Hep were also investigated. The linear range and detection limit for the determination of Hep are 0.04-0.8 {mu}g/mL and 19.7 ng/mL, respectively. This method is simple, practical, and relatively free of interference from coexisting substances and can be successfully applied to assess Hep in biological samples. By the Rosenthal graphic method, the association constant and binding numbers of Hep with the probe are 6.60x10{sup 4} L/mol and 33.9. Moreover, the enhancement mechanism of the fluorescence intensity in the DC-Eu{sup 3+} system and the DC-Eu{sup 3+}-Hep-CTMAB system have been also discussed.
Extraction of americium and europium by CMPO-substituted adamantylcalixarenes
Energy Technology Data Exchange (ETDEWEB)
Babain, V.A.; Alyapyshev, M.Yu.; Karavan, M.D. [V.G. Khlopin Radium Inst., St. Petersburg (Russian Federation); Boehmer, V.; Wang, L. [Johannes Guttenberg Univ., Mainz (Germany); Shokova, E.A.; Motornaya, A.E.; Vatsouro, I.M.; Kovalev, V.V. [M. V. Lomonosov Moscow State Univ., Moscow (Russian Federation)
2005-07-01
Eight p-adamantylcalix[4]arene derivatives, bearing four CMPO-like functions [-(CH{sub 2}){sub n}-NH-C(O)-CH{sub 2-}P(O)Ph{sub 2}] at the wide (4a,b, n = 0, 1) or narrow (5a-c and 6a-c, n = 2-4) rims were synthesized for the first time. Studies of the extraction of americium(III) and europium(III) from 3 M HNO{sub 3} solutions to organic phases (dichloromethane, m-nitro-trifluoromethylbenzene) showed: (i) The extraction ability for all the adamantylcalixarene ligands is much better than for their monomeric analogues -N-(1-adamantyl)-, N-(1-adamantylmethyl)- and N,N-(dibutyl)carbamoylmethyldiphenylphosphine oxides 7a, 7b, 8; (ii) The extraction percentage increases strongly with increasing length of the spacer for all types of ligands 4-6, and best extraction results were found for 4b (n = 1) and 5c (n = 4); (iii) The separation coefficient D{sub Am}/D{sub Eu} for the investigated compounds did not exceed 2, which is close to the narrow rim CMPO calixarenes, studied earlier; (iv) Variation of the spacer length between CMPO groups attached to the 1,3- and 2,4-positions of the calixarene platform in 6 did not lead to appreciably improved extractants, neither with respect to the extraction abilities (D) nor to the selectivities (D{sub Am}/D{sub Eu}). (orig.)
Preparation of europium-labelled DNA probes and their properties.
Hurskainen, P; Dahlén, P; Ylikoski, J; Kwiatkowski, M; Siitari, H; Lövgren, T
1991-01-01
A chemical method for labelling DNA with a europium chelate is presented. First, primary aliphatic amino groups are introduced onto DNA in a transamination reaction. The transamination reaction is altered by adjusting temperature and duration of the reaction. Subsequently, the modified DNA is reacted with an isothiocyanate derivative of a Eu chelate. The optimum amount of Eu chelates on a DNA probe is 4-8% of total nucleotides. There is a decrease of 0.7 degrees C in the melting temperature of DNA for each incorporated Eu chelate on 100 bases. Hybridization efficiency is lowered by the introduction of Eu chelates but this effect can be partly overcome by using high DNA probe concentrations. The detection limit of the Eu-labelled probe is 0.15 attomoles of target DNA in a mixed-phase hybridization assay on microtitration wells. In addition to high sensitivity the Eu-labelled probes offer convenience in use and results which are quantitative and easy to interpret. PMID:1826948
Chloride, bromide and iodide scintillators with europium doping
Zhuravleva, Mariya; Yang, Kan
2014-08-26
A halide scintillator material is disclosed where the halide may comprise chloride, bromide or iodide. The material is single-crystalline and has a composition of the general formula ABX.sub.3 where A is an alkali, B is an alkali earth and X is a halide which general composition was investigated. In particular, crystals of the formula ACa.sub.1-yEu.sub.yI.sub.3 where A=K, Rb and Cs were formed as well as crystals of the formula CsA.sub.1-yEu.sub.yX.sub.3 (where A=Ca, Sr, Ba, or a combination thereof and X=Cl, Br or I or a combination thereof) with divalent Europium doping where 0.ltoreq.y.ltoreq.1, and more particularly Eu doping has been studied at one to ten mol %. The disclosed scintillator materials are suitable for making scintillation detectors used in applications such as medical imaging and homeland security.
Spectrofluorimetric determination of lecithin using a tetracycline-europium probe
Energy Technology Data Exchange (ETDEWEB)
Wang Ting [Department of Chemistry, Shandong Normal University, Jinan, Shandong 250014 (China); Jiang Chongqiu [Department of Chemistry, Shandong Normal University, Jinan, Shandong 250014 (China)]. E-mail: jiangchongqiu@sdnu.edu.cn
2006-03-02
Trace amount of lecithin (PC) was determined in the buffer solution of pH 5.7, using tetracycline (TC)-europium ion (Eu{sup 3+}) as a fluorescent probe. PC can remarkably enhance the fluorescence intensity of the TC-Eu{sup 3+} complex at {lambda} = 612 nm and the enhanced fluorescence intensity of Eu{sup 3+} is in proportion to the concentration of PC. Optimum conditions for the determination of PC were also investigated. The linear range and detection limit for the determination of PC are 4.0 x 10{sup -7} to 1.4 x 10{sup -5} mol/L and 3.9 x 10{sup -8} mol/L. This method is simple, practical and relatively free of interference from coexisting substances and can be successfully applied to assess PC in serum samples. Moreover, the enhancement mechanism of the fluorescence intensity in the TC-Eu{sup 3+} system, the TC-Eu{sup 3+}-PC system, and the TC-Eu{sup 3+}-PC-sodium dodecyl benzene sulfonate (SDS) system is also discussed.
Artifacts in the determination of the binding of americium and europium to an aquatic fulvic acid
Energy Technology Data Exchange (ETDEWEB)
Lead, J.R.; Hamilton-Taylor, J.; Kelly, M. [Institute of Environmental and Biological Sciences, Lancaster University, Lancaster (United Kingdom)
1995-11-23
The binding of europium and americium by an aquatic fulvic acid was investigated using an equilibrium ion exchange technique (Schubert`s method). The results for europium were consistent with literature data. Americium gave anomalous results for both the D{sub o} values (partition coefficient of the metal between the resin and solution phases in the absence of the fulvic acid) and D values (partition coefficient of the metal between the resin and solution phases in the presence of the fulvic acid). The values for americium were unexpectedly low and, in the case of D values, only slightly pH dependent. The cause of the discrepancy was found to be the partial dissolution of the resin or the loss of small colloidal material from the resin. The effects on the europium results were minimal due to the use of lower resin weights and higher metal concentrations
Guo, Dongcai; He, Wei; Liu, Bang; Gou, Lining; Li, Ruixia
2013-01-01
Six novel 2-(benzylcarbamoyl)phenyl derivatives were synthesized and characterized by (1) H-NMR, mass spectrometry, infrared spectra and elemental analysis. Their europium complexes were prepared and characterized by elemental analysis, EDTA titrimetric analysis, IR and UV spectra as well as molar conductivity measurements. The luminescence properties of these complexes were investigated and results show that 2-(benzylcarbamoyl)phenyl derivatives possess high selectivity and good coordination with the europium ion. Complex Eu-2-(benzylcarbamoyl)phenyl-2-phenylacetate showed green luminescence that was emitted by the ligand of 2-(benzylcarbamoyl)phenyl-2-phenylacetate, while other complexes showed the characteristic red luminescence of europium ion and also possessed high luminescence intensity. Copyright © 2012 John Wiley & Sons, Ltd.
Induction of Circularly Polarized Luminescence from Europium by Amino Acid Based Ionic Liquids.
Zercher, Ben; Hopkins, Todd A
2016-11-07
Materials that emit circularly polarized light have application in several important industries. Because they show large optical activity and emit sharp visible light transitions, europium complexes are often exploited in applications that require circularly polarized luminescence (CPL). Chiral and coordinating ionic liquids based on prolinate, valinate, and aspartate anions are used to induce CPL from a simple achiral europium triflate salt. The sign of the induced CPL is dependent on the handedness (l vs d) of the amino acid anion. Comparison of the CPL spectra in ionic liquid with proline and valine vs aspartate shows that the number of carboxylate groups in the amino acid anion influences the europium coordination environment. DFT calculations predict a chiral eight-coordinate Eu(Pro)4- structure in the prolinate ionic liquid and a chiral seven- or eight-coordinate Eu(Asp)33- structure in the aspartate ionic liquid.
Soulié, Marine; Latzko, Frédéric; Bourrier, Emmanuel; Placide, Virginie; Butler, Stephen J; Pal, Robert; Walton, James W; Baldeck, Patrice L; Le Guennic, Boris; Andraud, Chantal; Zwier, Jurriaan M; Lamarque, Laurent; Parker, David; Maury, Olivier
2014-07-07
A series of europium and terbium complexes based on a functionalized triazacyclononane carboxylate or phosphinate macrocyclic ligand is described. The influence of the anionic group, that is, carboxylate, methylphosphinate, or phenylphosphinate, on the photophysical properties was studied and rationalized on the basis of DFT calculated structures. The nature, number, and position of electron-donating or electron-withdrawing aryl substituents were varied systematically within the same phenylethynyl scaffold in order to optimize the brightness of the corresponding europium complexes and investigate their two-photon absorption properties. Finally, the europium complexes were examined in cell-imaging applications, and selected terbium complexes were studied as potential oxygen sensors. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLF137 (Link to dictyBase) - - - Contig-U16249-1 SLF137Z (Link... to Original site) - - SLF137Z 480 - - - - Show SLF137 Library SL (Link to library) Clone ID SLF137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLF1-B/SLF137Q.Seq.d/ Representative seq. ID SLF13...7Z (Link to Original site) Representative DNA sequence >SLF137 (SLF137Q) /CSM/SL/SLF1-B/SLF137Q.Seq.d/ XXXXX...qyqmlsfiyqiqlvnvihch y*nvqvvrl*htlvmkivv*llqlalnlhsvpwvchfvqqviv*inseqlkqmdvqyycd ptfvckth*flf
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHF137 (Link to dictyBase) - - - Contig-U16403-1 CHF137P (Link to Original site) CHF...137F 632 CHF137Z 765 CHF137P 1377 - - Show CHF137 Library CH (Link to library) Clone ID CHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHF1-B/CHF137Q.Seq.d/ Representative seq. ID CHF...137P (Link to Original site) Representative DNA sequence >CHF137 (CHF137Q) /CSM/CH/CHF1-B/CHF...AATTAATTAA ATAATAA sequence update 2002.10.25 Translated Amino Acid sequence *nlk
Magnetic and structural properties of yellow europium oxide compound and Eu(OH){sub 3}
Energy Technology Data Exchange (ETDEWEB)
Lee, Dongwook, E-mail: dongwookleedl324@gmail.com [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom); Seo, Jiwon, E-mail: jiwonseo@yonsei.ac.kr [Department of Physics and IPAP, Yonsei University, Seoul 120-749 (Korea, Republic of); Valladares, Luis de los Santos [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom); Avalos Quispe, O. [Laboratorio de Cerámicos y Nanomateriales, Facultad de Ciencias Físicas, Universidad Nacional Mayor de San Marcos, Ap. Postal 14-0149, Lima, Perú (Peru); Barnes, Crispin H.W. [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom)
2015-08-15
A new material based on a yellow europium oxide compound was prepared from europium oxide in a high vacuum environment. The structural and magnetic properties of the material were investigated. Owing to the absence of a crystal structure, the material exhibited a disordered magnetic behavior. In a reaction with deionized (DI) water without applied heat, the compound assumed a white color as soon as the DI water reached the powder, and the structure became polycrystalline Eu(OH){sub 3}. The magnetic properties, such as the thermal hysteresis, disappeared after the reaction with DI water, and the magnetic susceptibility of the yellow oxide compound weakened. The magnetic properties of Eu(OH){sub 3} were also examined. Although Eu{sup 3+} is present in Eu(OH){sub 3}, a high magnetic moment due to the crystal field effect was observed. - Graphical abstract: (top left) Optical image of the yellow europium oxide compound. (top right) Optical image of the product of DI water and yellow europium oxide. (bottom) Magnetization curves as a function of temperature measured in various magnetic field. - Highlights: • We prepared a new material based on a yellow europium oxide compound from europium oxide. • We characterized the magnetic properties of the material which exhibits a disordered magnetic behavior such as thermal hysteresis. • The compound turned white (Eu(OH){sub 3}) as soon as the DI water reached the powder. • The thermal hysteresis disappeared after the reaction with DI water and the magnetic susceptibility of the yellow oxide compound weakened.
Europium stearate additives delay oxidation of UHMWPE for orthopaedic applications: a pilot study.
Gallardo, Luis A; Carpentieri, Ilenia; Laurent, Michel P; Costa, Luigi; Wimmer, Markus A
2011-08-01
Ultrahigh-molecular-weight polyethylene (UHMWPE) is used as an articulating surface in prosthetic devices. Its failure under various mechanisms after oxidation is of utmost concern. Free radicals formed during the sterilization process using high-energy irradiation result in oxidation. Europium, an element of the lanthanide family, has a unique electron configuration with an unusual lack of preference for directional bonding and notable bonding to oxygen. Because of this, it currently is used in studies for stabilization of polymers such as polyvinyl chloride. We asked whether europium stearate could enhance the oxidation resistance after irradiation in nitrogen of UHMWPE. Conventional nonirradiated and gamma-irradiated in nitrogen UHMWPE were compared with polyethylene doped with 375 ppm and 3750 ppm europium(III) stearate under the same treatment conditions. Chemical characterization was performed by Fourier transform infrared (FTIR) microspectroscopy using 200-μm thin films. The oxidation of doped samples with time was compared with that of conventional samples using accelerated oven aging. The types of oxidation products were identified by FTIR and quantified per material and treatment condition as indications of the oxidation level and mechanism. The generation rate of hydroperoxides and ketones was decelerated proportionally with concentration of europium stearates. The oxidative mechanism appeared similar to that of conventional polyethylene with the same types of measurable end products as ketones and hydroperoxides. Yet, the rate of generation of the latter appeared to be slowed down by the action of europium stearate. Europium stearate mixed in UHMWPE decelerated the oxidation reactions triggered by gamma irradiation in nitrogen, seemingly without major alteration of the oxidation mechanism.
Temperature dependent luminescence of a europium complex incorporated in poly(methyl methacrylate).
Liang, Hao; Xie, Fang; Ren, Xiaojun; Chen, Yifa; Chen, Biao; Guo, Fuquan
2013-12-01
An europium β-diketonate complex with a dipyrazolyltriazine derivative ligand, Eu(TTA)3DPBT, has been incorporated into poly(methyl methacryate) (PMMA). The influence of temperature on its luminescence properties has been investigated. The fluorescence emission spectra and luminescence lifetimes showed temperature sensitivity. The analysis of the relative intensity ratio (R) of (5)D0 → (7)F2 to (5)D0 → (7)F1 transition and Judd-Ofelt experimental intensity parameters Ω2 indicated that the local structure and asymmetry in the vicinity of europium ions show no obvious change when the temperature is increased. Copyright © 2013 Elsevier B.V. All rights reserved.
21 CFR 211.137 - Expiration dating.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Expiration dating. 211.137 Section 211.137 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Packaging and Labeling Control...
14 CFR 137.31 - Aircraft requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft requirements. 137.31 Section 137.31 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... properly installed shoulder harness for use by each pilot. ...
Desorption of 137Cs+ from mosses
Directory of Open Access Journals (Sweden)
OLGICA NEDIC
2002-09-01
Full Text Available Mosses are biomonitors that accumulate large amounts of various pollutants, including radionuclides. In this work we investigated the possibility of 137Cs extraction from mosses, as well as the significance of species specificity on the efficiency of 137Cs desorption. Salt and acid solutions were used as extraction media. It was shown that a 5 % solution of both ammonium oxalate and phosphoric acid was able to desorb 81.8 % of 137Cs+ from Homalothecium sericeum, which was 39.9 % more than desorption from water. At the same time, most of the desorbed 137Cs+ was incorporated in crystals that precipitated from the solution. An interspecies difference in respect to 137Cs+ desorption was noticed.
Energy Technology Data Exchange (ETDEWEB)
Fernandez R, E.; Jimenez R, M.; Solache R, M.; Martinez M, V. [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)
2000-07-01
Europium as waste can produce a pollution problem in water that is in contact with it, what would has a heavy environmental impacts, because of the possibilities of diffusion of these wastes from their place of confinement or storage until the geo and biosphere. The solution of such problem requires of a lot of knowledge over the behavior of several chemical elements such as europium in aqueous solutions. In this work it was used a low ion force (0.02 M). The data set will allow extrapolate the hydrolytic behavior of europium in too much minors ion force media, such as the ground waters, including in ion force zero.
Thermodynamic and structural description of europium complexation in 1-octanol - H{sub 2}O solutions
Energy Technology Data Exchange (ETDEWEB)
Vu, T.H.; Charbonnel, M.C.; Boubals, N.; Couston, L. [CEA Marcoule, DEN/DRCP/SCPS/LCAM, BP 17171, 30207 Bagnols-sur-Ceze (France); Arnaud, F. [Laboratoire de Chimie Physique, IPHC, 25 rue Becquerel, 67087 Strasbourg (France)
2008-07-01
Polydentate N-bearing ligands such as bis-triazinyl-pyridines (BTPs) are interesting extractants for actinide(III)/lanthanide(III) separation. A description of europium complexation in 1-octanol solutions was undertaken to enhance the knowledge of the extraction mechanisms. The first solvation shell for europium(III) nitrate, chloride, and perchlorate with different amounts of water was determined by Time-Resolved Laser-Induced Fluorescence (TRLIF) spectroscopy. Europium nitrate complexation by iPr-BTP was then studied by TRLIF and micro-calorimetry; similar stability constants related to the formation of Eu(BTP){sub 2}{sup 3+} and Eu(BTP){sub 3}{sup 3+} were obtained by both techniques (log({beta}{sub 2}) = 9.0 {+-} 0.3 and log({beta}{sub 3}) = 13.8 {+-} 0.2). The presence of water in the octanol diluent has an influence on solvation of europium and also on the [Eu(BTP){sub 2}{sup 3+}] / [Eu(BTP){sub 3}{sup 3+}] ratio. (authors)
A novel biocompatible europium ligand for sensitive time-gated immunodetection.
Sayyadi, Nima; Connally, Russell E; Try, Andrew
2016-01-21
We describe the synthesis of a novel hydrophilic derivative of a tetradentate β-diketone europium ligand that was used to prepare an immunoconjugate probe against Giardia lamblia cysts. We used a Gated Autosynchronous Luminescence Detector (GALD) to obtain high quality delayed luminescence images of cells 30-fold faster than ever previously reported.
Europium-doped barium halide scintillators for x-ray and ?-ray detections
Selling, J.; Birowosuto, M.D.; Dorenbos, P.; Schweizer, S.
2007-01-01
Single crystals of undoped or europium-doped barium chloride, bromide, and iodide were investigated under x-ray and ?-ray excitations. The Eu2+-related x-ray excited luminescence found in the Eu-doped barium halides occurs at 402, 404, and 425?nm for the chloride, bromide, and iodide, respectively.
A europium luminescence assay of lactate and citrate in biological fluids†
Pal, Robert; Costello, Leslie C.
2013-01-01
Ratiometric methods of analysis have been developed for the selective determination of lactate or citrate in microlitre samples of human serum, urine or prostate fluids following comparison of anion binding affinities for a family of nine luminescent europium(III) complexes. PMID:19343236
Molecular interactions of Leucoagaricus naucinus with uranium(VI) and europium(III)
Energy Technology Data Exchange (ETDEWEB)
Wollenberg, Anne; Raff, Johannes [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Biogeochemistry; Guenther, A. [Helmholtz Institute Freiberg for Resource Technology, Freiberg (Germany)
2017-06-01
With regard to a molecular understanding of the interaction of fungal mycelium with radionuclides and its possible application for precautionary radiation protection and bio-remediation, the binding mechanism of the radionuclide uranium and the metal europium, as surrogate for trivalent actinides, where investigated with different starting conditions by the living fungal cells of Leucoagaricus naucinus.
Europium doped In(Zn)P/ZnS colloidal quantum dots
Thuy, Ung Thi Dieu; Maurice, Axel; Liem, Nguyen Quang; Reiss, Peter
2013-01-01
Chemically synthesised In(Zn)P alloy nanocrystals are doped with Eu(3+) ions using europium oleate as a molecular precursor and are subsequently covered with a ZnS shell. The presence of zinc in the synthesis of the InP core nanocrystals leads to the formation of an In(Zn)P alloy structure, making
NO fluorescence sensing by europium tetracyclines complexes in the presence of H2O2.
Simões, Eliana F C; Leitão, João M M; Esteves da Silva, Joaquim C G
2013-07-01
The effect on the fluorescence of the europium:tetracycline (Eu:Tc), europium:oxytetracycline (Eu:OxyTc) and europium:chlortetracycline (Eu:ClTc) complexes in approximately 2:1 ratio of nitric oxide (NO), peroxynitrite (ONOO(-)), hydrogen peroxide (H2O2) and superoxide (O2 (·-)) was assessed at three ROS/RNS concentrations levels, 30 °C and pH 6.00, 7.00 and 8.00. Except for the NO, an enhancement of fluorescence intensity was observed at pH 7.00 for all the europium tetracyclines complexes-the high enhancement was observed for H2O2. The quenching of the fluorescence of the Tc complexes, without and with the presence of other ROS/RNS species, provoked by NO constituted the bases for an analytical strategy for NO detection. The quantification capability was evaluated in a NO donor and in a standard solution. Good quantification results were obtained with the Eu:Tc (3:1) and Eu:OxyTc (4:1) complexes in the presence of H2O2 200 μM with a detection limit of about 3 μM (Eu:OxyTc).
Long-term tagging of elvers, Anguilla anguilla, with radioactive europium
DEFF Research Database (Denmark)
Hansen, Heinz Johs. Max; Fattah, A. T. A.
1986-01-01
-life of added europium of 1.6 .+-. 0.5 years. Thirteen hundred 155Eu-labelled elvers (50 Bq per eel), each weighing on average 0.21 g, were set out near Oskarshamn on the east coast of Sweden in June 1982. Three of these were caught nearby in May 1985 and one was caught in August 1985. They weighed...
ULTRAVIOLET TRANSITIONS IN EUROPIUM STUDIED WITH A FREQUENCY-DOUBLED CW RING DYE-LASER
Eliel, E.R.; Hogervorst, W.; van Leeuwen, K.A.H.; Post, B.H.
1981-01-01
High resolution laser spectroscopy has been applied to the study of three ultraviolet transitions in Europium at λ = 294.8, 295.1 and 295.8 nm. The tunable narrowband UV has been generated by intracavity frequency doubling in a cw ring dye laser using a temperate tuned, Brewster angled ADA crystal.
Cosico, J. A. M.; Ruales, P. K.; Marquez, M. C.
2017-06-01
In the age where application of nanotechnology in our society has proven to be eminent, different routes of synthesizing nanoparticles have emerged. In this study nanoparticles of cuprous oxide (Cu2O) doped with different amounts of europium was prepared by using solution precursor route approach with the aid of ultrasonic sound. Copper sulphate and europium (III) nitrate pentahydrate was used as source for copper ions and europium ions respectively. X-ray diffraction (XRD) and Fourier Transform Infrared spectroscopy (FTIR) were used to elucidate the cubic crystal structure and organic impurities present on Cu2Onanoparticles. UV-Vis spectroscopy was used to determine the absorption spectrum of the nanoparticles in the wavelength range of 400nm to 700nm. The bandgap of the undoped and doped Cu2O were found to fall between 2.1eV - 2.3eV. Scanning Electron Microscopy (SEM) coupled with energy dispersive x-ray was used to observe the dendritic and rodlike morphology and the presence of europium in the synthesized Cu2O nanoparticles. The observed effect on the absorbance of Cu2O upon adding Eu and a facile way of synthesizing Cu2O nanoparticles could bring a positive impact on the production of functional devices for optoelectronic and energy applications.
Potential value of Cs-137 capsules
Energy Technology Data Exchange (ETDEWEB)
Bloomster, C.H.; Brown, D.R.; Bruno, G.A.; Hazelton, R.F.; Hendrickson, P.L.; Lezberg, A.J.; Tingey, G.L.; Wilfert, G.L.
1985-04-01
We determined the value of Cs-137 compared to Co-60 as a source for the irradiation of fruit (apples and cherries), pork and medical supplies. Cs-137, in the WESF capsule form, had a value of approximately $0.40/Ci as a substitute for Co-60 priced at approximately $1.00/Ci. The comparison was based on the available curies emitted from the surface of each capsule. We developed preliminary designs for fourteen irradiation facilities; seven were based on Co-60 and seven were based on Cs-137. These designs provided the basis for estimating capital and operating costs which, in turn, provided the basis for determining the value of Cs-137 relative to Co-60 in these applications. We evaluated the effect of the size of the irradiation facility on the value of Cs-137. The cost of irradiation is low compared to the value of the product. Irradiation of apples for disinfestation costs $.01 to .02 per pound. Irradiation for trichina-safe pork costs $.02 per pound. Irradiation of medical supplies for sterilization costs $.07 to .12 per pound. The cost of the irradiation source, either Co-60 or Cs-137, contributed only a minor amount to the total cost of irradiation, about 5% for the fruit and hog cases and about 20% for the medical supply cases. We analyzed the sensitivity of the irradiation costs and Cs-137 value to several key assumptions.
{sup 137}Cs distribution in guava trees
Energy Technology Data Exchange (ETDEWEB)
Mosquera, B.; Veiga, R.; Mangia, L.; Carvalho, C.; Estellita, L.; Uzeda, D.; Facure, A.; Violini, B.; Anjos, R.M. [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Inst. de Fisica
2004-09-15
This paper presents results of {sup 137}Cs concentration measured from a guava tree cultivated after the first decontamination work of one of the sites where the worst Brazilian radiological accident occurred. The present work aims to verify how the {sup 137}Cs is transported and distributed along the tropical trees. Bi-dimensional analyses of the radial distribution of {sup 137}Cs in the main trunk are also presented. Neither symmetrical nor homogeneous behaviors of the specific activity distribution in the tree rings were observed. (author)
Cedeño, V. J.; Rangel, R.; Cervantes, J. L.; Lara, J.; Alvarado, J. J.; Galván, D. H.
2017-07-01
Graphene oxide decoration with europium was carried out using SDS (sodium dodecyl sulfate) as the surfactant. The reaction was performed in a microwave oven and subsequently underwent thermal treatment under hydrogen flow. The results found in the present work demonstrate that through the use of SDS surfactant aggregates of hemi-cylindrical and onion-like structures could be obtained; which propitiate an enhanced synergistic photoluminescence located at the red wavelength. On the other hand, after thermal treatment the aggregates disappear providing a good dispersion of europium, however a decrease in the photoluminescence signal is observed. The graphene oxide decorated with europium was characterized by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), Fourier infrared transform spectroscopy (FTIR), RAMAN spectroscopy, x-ray photoelectron spectroscopy (XPS) and transmission electron microscopy (TEM) techniques, showing the characteristic features of graphene oxide and europium.
Synthesis, characterization, and properties of reduced europium molybdates and tungstates
Energy Technology Data Exchange (ETDEWEB)
Abeysinghe, Dileka [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Gerke, Birgit [Institut für Anorganische und Analytische Chemie, Universität Münster , Corrensstrasse 30, Münster D-48149 (Germany); Morrison, Gregory; Hsieh, Chun H.; Smith, Mark D. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Pöttgen, Rainer [Institut für Anorganische und Analytische Chemie, Universität Münster , Corrensstrasse 30, Münster D-48149 (Germany); Makris, Thomas M. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Loye, Hans-Conrad zur, E-mail: zurloye@mailbox.sc.edu [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States)
2015-09-15
Single crystals of K{sub 0.094}Eu{sub 0.906}MoO{sub 4}, K{sub 0.097}Eu{sub 0.903}WO{sub 4}, EuWO{sub 4}, and EuMoO{sub 4} were grown from molten chloride fluxes contained in vacuum-sealed fused silica and structurally characterized via single crystal X-ray diffraction. The in situ reduction of Eu{sup 3+} to Eu{sup 2+} was carried out using Mo, W, and Zn as metal reducing agents. All four compounds crystallize in the tetragonal space group of I4{sub 1}/a and adopt the scheelite (CaWO{sub 4}) structure type. The magnetic susceptibility of the reported compounds shows paramagnetic behavior down to 2 K. {sup 151}Eu Mössbauer spectroscopy was used to analyze the relative Eu{sup 2+} and Eu{sup 3+} content of the samples. All the compounds were further characterized by EPR, and UV-vis spectroscopy. - Graphical abstract: TOC Caption Two new reduced europium containing quaternary oxides, K{sub 0.094}Eu{sub 0.906}MoO{sub 4} and K{sub 0.097}Eu{sub 0.903}WO{sub 4}, and two previously reported ternary reduced oxides, EuWO{sub 4} and EuMoO{sub 4}, were synthesized via an in situ reduction of Eu{sup 3+} to Eu{sup 2+} under flux method using Mo, W, and Zn as metal reducing agents. {sup 151}Eu Mössbauer spectroscopy was used to analyze the relative Eu{sup 2+} and Eu{sup 3+} content of the samples. - Highlights: • K{sub 0.094}Eu{sub 0.906}MoO{sub 4}, K{sub 0.097}Eu{sub 0.903}WO{sub 4}, EuWO{sub 4}, and EuMoO{sub 4} have been synthesized and characterized. • The in situ reduction of Eu{sup 3+} to Eu{sup 2+} was carried out using Mo, W, and Zn as metal reducing agents. • Magnetic susceptibility data were collected. • {sup 151}Eu Mössbauer spectroscopy was used to analyze Eu{sup 2+} and Eu{sup 3+} content.
Energy Technology Data Exchange (ETDEWEB)
Rodriguez, L.; Los Arcos, J.M.; Grau, A.
1995-07-01
A procedure for the preparation of a stable, homogeneous solution of 137Cs+''137mBa, for use in liquid scintillation measurements, is described. Its count rate stability and spectral time evolution has been followed for several weeks. The solution has been standardised by the CIEMAT/NIST method in both Ultima-Gold and Insta-Gel, to a combined uncertainty lower than 0,51 % (k=l). (Author) 5 refs.
Xu, Wentao; Zhou, Youfu; Huang, Decai; Su, Mingyi; Wang, Kun; Hong, Maochun
2014-07-07
Eu2PQC6 has been developed to detect Al(3+) by monitoring the quenching of the europium-based emission, with the lowest detection limit of ∼32 pM and the quantitative detection range to 150 μM. Eu2PQC6 is the first ever example that the europium(III) complex serves as an Al(3+) fluorescent sensor based on "competition-displacement" mode.
Yang, Chaolong; Xu, Jing; Ma, Jianying; Zhu, Dongyu; Zhang, Yunfei; Liang, Liyan; Lu, Mangeng
2013-02-01
Two novel trinuclear europium complexes based on trisphen(1,3,5-tris{4-((1,10-phenanthroline-[5,6-d]imidazol-2yl)phenoxy)methyl}-2,4,6-trimethyl-benzene) as a second ligand were designed, synthesized, and characterized by FT-IR, (1)H NMR, UV-visible, photoluminescence (PL) spectroscopy, elemental analysis (EA) and ESI-MS. The geometries of these two trinuclear europium complexes were predicted using the Sparkle/PM3 model and suggested a chemical environment of very low symmetry around the lanthanide ions (C(1)), which is in agreement with the luminescent spectra. CV analysis demonstrated that the trinuclear complexes possessed excellent electro-injection abilities. The effects of two additional Eu(3+) lumophors in these trinuclear europium complexes on their photoluminescent properties were investigated in detail. The results indicated that these trinuclear europium complexes exhibited highly luminescent quantum efficiencies and experimental intensity parameters in the solid state. Especially, due to the contribution of the two additional Eu(3+) lumophors in the trinuclear europium complexes, the quantum efficiency of the trinuclear complex Eu(3)(TTA)(9)trisphen was higher (ca. 34%) than the mononuclear europium complex Eu(TTA)(3)imidazophen.
21 CFR 137.215 - Yellow corn flour.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yellow corn flour. 137.215 Section 137.215 Food... Flours and Related Products § 137.215 Yellow corn flour. Yellow corn flour conforms to the definition and standard of identity prescribed by § 137.211 for white corn flour except that cleaned yellow corn is used...
21 CFR 137.280 - Bolted yellow corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bolted yellow corn meal. 137.280 Section 137.280... Flours and Related Products § 137.280 Bolted yellow corn meal. Bolted yellow corn meal conforms to the definition and standard of identity prescribed by § 137.255 for bolted white corn meal except that cleaned...
21 CFR 137.285 - Degerminated yellow corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Degerminated yellow corn meal. 137.285 Section 137... Cereal Flours and Related Products § 137.285 Degerminated yellow corn meal. Degerminated yellow corn meal, degermed yellow corn meal, conforms to the definition and standard of identity prescribed by § 137.265 for...
Distribution of cesium-137 in reindeer
Directory of Open Access Journals (Sweden)
Kristina Rissanen
1990-08-01
Full Text Available The influence of the Chernobyl accident in 1986 on the Finnish reindeer herding area was much smaller than the effects of the nuclear bomb tests in the 1960s. Only in one small area somewhat more Cs-137 was deposited than in the rest of the reindeer herding area. From that area 20 reindeer were chosen for investigation of the distribution of Cs-137. All tissues, organs, the skeleton, digestive tract, hide, head and hooves were sampled quantitatively. Three reindeer were pregnant and also the foetuses were studied. The Cs-137 amounts were determined by gammaspectrometric measurements. The results showed that the differences in the Cs-137 concentrations between muscle tissue from different parts of an individual reindeer were not more than 10 percent. Thus it is not essential from which part of the reindeer meat samples for surveillance purposes are taken. The concentration of Cs-137 in edible tissues other than muscle was lower except in the kidneys and scapula cartilage.
Energy Technology Data Exchange (ETDEWEB)
Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro
2015-07-01
The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).
Directory of Open Access Journals (Sweden)
Faley Jean de Sousa
2010-03-01
Full Text Available The sol-gel process is very effective for the preparation of new materials with potential applications in optics, sensors, catalyst supports, coatings, and specialty inorganic polymers that can be used as hosts for the accommodation of organic molecules. The low temperature employed in the process is the main advantage of this methodology. In this work, the europium (III complex with 1,10-phenantroline was prepared, and this luminescent complex was incorporated into silica nanoparticles and films by the sol-gel process. The nanoparticles were obtained by the modified Stöber methodology. The films were obtained by the dip-coating technique, at different deposition rates and numbers of layers. The nanoparticles and films were characterized by photoluminescence, thermal analysis, and Raman and infrared spectroscopies. Characterization revealed that the europium (III complex was not affected upon incorporation into the nanoparticles and films, opening a new field for the application of these materials.
Crawford, Lindsey; Higgins, Jaclyn; Putnam, David
2015-09-08
The biodistribution of biodegradable nanoparticles can be difficult to quantify. We report a method using time resolved fluorescence (TRF) from a lanthanide chelate to minimize background autofluorescence and maximize the signal to noise ratio to detect biodegradable nanoparticle distribution in mice. Specifically, antenna chelates containing europium were entrapped within nanoparticles composed of polylactic acid-polyethylene glycol diblock copolymers. Tissue accumulation of nanoparticles following intravenous injection was quantified in mice. The TRF of the nanoparticles was found to diminish as a second order function in the presence of serum and tissue compositions interfered with the europium signal. Both phenomena were corrected by linearization of the signal function and calculation of tissue-specific interference, respectively. Overall, the method is simple and robust with a detection limit five times greater than standard fluorescent probes.
A Comprehensive Strategy to Boost the Quantum Yield of Luminescence of Europium Complexes
Lima, Nathalia B. D.; Gonçalves, Simone M. C.; Júnior, Severino A.; Simas, Alfredo M.
2013-01-01
Lanthanide luminescence has many important applications in anion sensing, protein recognition, nanosized phosphorescent devices, optoelectronic devices, immunoassays, etc. Luminescent europium complexes, in particular, act as light conversion molecular devices by absorbing ultraviolet (UV) light and by emitting light in the red visible spectral region. The quantum yield of luminescence is defined as the ratio of the number of photons emitted over the number of UV photons absorbed. The higher the quantum yield of luminescence, the higher the sensitivity of the application. Here we advance a conjecture that allows the design of europium complexes with higher values of quantum yields by simply increasing the diversity of good ligands coordinated to the lanthanide ion. Indeed, for the studied cases, the percent boost obtained on the quantum yield proved to be strong: of up to 81%, accompanied by faster radiative rate constants, since the emission becomes less forbidden. PMID:23928866
Assembly of europium organic framework–gold nanoparticle composite thin films on silicon substrate
Energy Technology Data Exchange (ETDEWEB)
Deep, Akash, E-mail: dr.akashdeep@gmail.com [Central Scientific Instruments Organisation (CSIR-CSIO), Sector 30 C, Chandigarh 160030 (India); Academy of Scientific and Innovative Research, CSIR-CSIO, Sector 30 C, Chandigarh 160030 (India); Kaur, Rajnish [Central Scientific Instruments Organisation (CSIR-CSIO), Sector 30 C, Chandigarh 160030 (India); Academy of Scientific and Innovative Research, CSIR-CSIO, Sector 30 C, Chandigarh 160030 (India); Kumar, Parveen [Central Scientific Instruments Organisation (CSIR-CSIO), Sector 30 C, Chandigarh 160030 (India); Kumar, Pawan; Paul, A.K. [Central Scientific Instruments Organisation (CSIR-CSIO), Sector 30 C, Chandigarh 160030 (India); Academy of Scientific and Innovative Research, CSIR-CSIO, Sector 30 C, Chandigarh 160030 (India)
2014-08-28
Metal organic frameworks are a sub-class of coordination polymers and rapidly generating huge research interests in several technological areas. One of the emerging areas of their potential applications is the photovoltaics. The present study proposes the assembly of europium organic framework–gold nanoparticle nanocomposite thin film on silicon substrate. Microscopic, X-ray diffraction, surface area measurement and thermal studies have indicated the formation of the desired thin film. Spectral studies have been used to highlight their solid state optical property. Current–voltage studies have established semiconducting property of the above thin films. - Highlights: • Thin film of europium organic framework/gold nanoparticles is prepared on silicon. • Fairly homogeneous films with a roughness factor of 5–10 nm are obtained. • Above thin films offer solid-state photoluminescence and semiconducting properties.
Synthesis and optical features of an europium organic-inorganic silicate hybrid
Energy Technology Data Exchange (ETDEWEB)
Franville, A.C.; Zambon, D.; Mahiou, R.; Chou, S.; Cousseins, J.C. [Universite Blaise Pascal, Aubiere (France). Lab. des Materiaux Inorganiques; Troin, Y. [Laboratoire de Chimie des Heterocycles et des Glucides, EA 987, Universite Blaise-Pascal and ENSCCF, F-63177 Aubiere Cedex (France)
1998-07-24
A europium organic-inorganic silicate hybrid was synthesized by grafting a coordinative group (dipicolinic acid) to a silicate network precursor (3-aminopropyltriethoxysilane) via a covalent bonding. Sol-gel process and complexation were performed using different experimental conditions. The hybrid materials, in particular the Eu{sup 3+} coordination mode, were characterized by infrared and luminescence spectroscopies. Morphology of the materials and TG analysis showed that grafted silica enhanced thermal and mechanical resistances of the organic part. (orig.) 7 refs.
Liu, Jikun; Du, Bingchen; Zhang, Panhe; Haleyurgirisetty, Mohan; Zhao, Jiangqin; Ragupathy, Viswanath; Lee, Sherwin; DeVoe, Don L; Hewlett, Indira K
2014-11-15
Rapid, sensitive and specific diagnostic assays play an indispensable role in determination of HIV infection stages and evaluation of efficacy of antiretroviral therapy. Recently, our laboratory developed a sensitive Europium nanoparticle-based microtiter-plate immunoassay capable of detecting target analytes at subpicogram per milliliter levels without the use of catalytic enzymes and signal amplification processes. Encouraged by its sensitivity and simplicity, we continued to miniaturize this assay to a microchip platform for the purpose of converting the benchtop assay technique to a point-of-care test. It was found that detection capability of the microchip platform could be readily improved using Europium nanoparticle probes. We were able to routinely detect 5 pg/mL (4.6 attomoles) of HIV-1 p24 antigen at a signal-to-blank ratio of 1.5, a sensitivity level reasonably close to that of microtiter-plate Europium nanoparticle assay. Meanwhile, use of the microchip platform effectively reduced sample/reagent consumption 4.5 fold and shortened total assay time 2 fold in comparison with microtiter plate assays. Complex matrix substance in plasma negatively affected the microchip assays and the effects could be minimized by diluting the samples before loading. With further improvements in sensitivity, reproducibility, usability, assay process simplification, and incorporation of portable time-resolved fluorescence reader, Europium nanoparticle immunoassay technology could be adapted to meet the challenges of point-of-care diagnosis of HIV or other health-threatening pathogens at bedside or in resource-limited settings. Copyright © 2014 Elsevier B.V. All rights reserved.
Green Luminescence of Divalent Europium in the Hydride Chloride EuHCl
Kunkel, Nathalie; Rudolph, Daniel; Meijerink, A; Rommel, Stefan; Weihrich, Richard; Kohlmann, Holger; Schleid, Thomas
Luminescence properties of divalent europium in the mixed-anion hydride chloride EuHCl were studied for the first time. Olive-green single crystals of EuHCl (PbFCl-type structure: tetragonal, P4/nmm, a = 406.58(3) pm, c = 693.12(5) pm, c/a = 1.705, Z = 2) resulted from the reaction of elemental
Ferromagnetic semiconductor-metal transition in heterostructures of electron doped europium monoxide
Energy Technology Data Exchange (ETDEWEB)
Stollenwerk, Tobias
2013-09-15
In the present work, we develop and solve a self-consistent theory for the description of the simultaneous ferromagnetic semiconductor-metal transition in electron doped Europium monoxide. We investigate two different types of electron doping, Gadolinium impurities and Oxygen vacancies. Besides the conduction band occupation, we can identify low lying spin fluctuations on magnetic impurities as the driving force behind the doping induced enhancement of the Curie temperature. Moreover, we predict the signatures of these magnetic impurities in the spectra of scanning tunneling microscope experiments. By extending the theory to allow for inhomogeneities in one spatial direction, we are able to investigate thin films and heterostructures of Gadolinium doped Europium monoxide. Here, we are able to reproduce the experimentally observed decrease of the Curie temperature with the film thickness. This behavior is attributed to missing coupling partners of the localized 4f moments as well as to an electron depletion at the surface which leads to a reduction of the number of itinerant electrons. By investigating the influence of a metallic substrate onto the phase transition in Gadolinium doped Europium monoxide, we find that the Curie temperature can be increased up to 20%. However, as we show, the underlying mechanism of metal-interface induced charge carrier accumulation is inextricably connected to a suppression of the semiconductor-metal transition.
Redox electrochemistry of europium fluoride complexes in an equimolar NaCl-KCl melt
Energy Technology Data Exchange (ETDEWEB)
Kuznetsov, S.A., E-mail: kuznet@chemy.kolasc.net.ru [Institute of Chemistry, Kola Science Centre RAS, 26 Akademgorodok., 184209 Apatity, Murmansk region (Russian Federation); Gaune-Escard, M. [Ecole Polytechnique, Mecanique Energetique, Technopole de Chateau Gombert, 5 rue Enrico Fermi, 13453 Marseille Cedex 13 (France)
2011-07-15
The electrochemical behavior of europium fluoride complexes was studied by different electrochemical methods at a glassy carbon electrode in the temperature range 973-1100 K in the NaCl-KCl melt. The diffusion coefficients of Eu(III) and Eu(II) were determined by linear sweep voltammetry. The standard rate constants of charge transfer for the Eu(III)/Eu(II) redox couple were found on the base cyclic voltammetry, impedance spectroscopy and chronoamperometry data. The formal standard redox potentials E{sub Eu(III)/Eu(II)}{sup *} were obtained by linear sweep and cyclic voltammetry. The electrochemical behavior of europium fluoride and europium chloride complexes in NaCl-KCl melt was compared and discussed in connection with the strength and stability of these complexes. It was shown that the formation of stronger fluoride complexes reduced values of diffusion coefficients, standard rate constants for charge transfer of the Eu(III)/Eu(II) redox couple and shifted the formal standard redox potentials to the more electronegative values.
Lateral flow immunoassay using europium chelate-loaded silica nanoparticles as labels.
Xia, Xiaohu; Xu, Ye; Zhao, Xilin; Li, Qingge
2009-01-01
Despite their ease of use, lateral flow immunoassays (LFIAs) often suffer from poor quantitative discrimination and low analytical sensitivity. We explored the use of a novel class of europium chelate-loaded silica nanoparticles as labels to overcome these limitations. Antibodies were covalently conjugated onto europium chelate-loaded silica nanoparticles with dextran as a linker. The resulting conjugates were used as labels in LFIA for detection of hepatitis B surface antigen (HBsAg). We performed quantification with a digital camera and Adobe Photoshop software. We also used 286 clinical samples to compare the proposed method with a quantitative ELISA. A detection limit of 0.03 microg/L was achieved, which was 100 times lower than the colloidal gold-based LFIAs and lower than ELISA. A precise quantitative dose-response curve was obtained, and the linear measurement range was 0.05-3.13 microg/L, within which the CVs were 2.3%-10.4%. Regression analysis of LFIA on ELISA results gave: log (LFIA) = -0.14 log (ELISA) + 1.03 microg/L with r = 0.99 for the quantification of HBsAg in 35 positive serum samples. Complete agreement was observed for the qualitative comparison of 286 clinical samples assayed with LFIA and ELISA. Europium chelate-loaded silica nanoparticle labels have great potential to improve LFIAs, making them useful not only for simple screening applications but also for more sensitive and quantitative immunoassays.
Luminescent solutions and films of new europium complexes with chelating ligands
Kharcheva, Anastasia V.; Ivanov, Alexey V.; Borisova, Nataliya E.; Kaminskaya, Tatiana P.; Patsaeva, Svetlana V.; Popov, Vladimir V.; Yuzhakov, Viktor I.
2015-03-01
The development of new complexes of rare earth elements (REE) with chelating organic ligands opens up the possibility of purposeful alteration in the composition and structure of the complexes, and therefore tuning their optical properties. New ligands possessing two pyridine rings in their structure were synthesized to improve coordination properties and photophysical characteristics of REE compounds. Complexes of trivalent europium with novel chelating ligands were investigated using luminescence and absorption spectroscopy, as well as atomic force microscopy. Luminescence properties of new compounds were studied both for solutions and films deposited on the solid support. All complexes exhibit the characteristic red luminescence of Eu (III) ion with the absolute lumenescence quantum yield in polar acetonitrile solution varying from 0.21 to 1.45 % and emission lifetime ranged from 0.1 to 1 ms. Excitation spectra of Eu coordination complexes correspond with absorption bands of chelating ligand. The energy levels of the triplet state of the new ligands were determined from the phosphorescence at 77 K of the corresponding Gd (III) complexes. The morphology of films of europium complexes with different substituents in the organic ligands was investigated by atomic force microscopy (AFM). It strongly depends both on the type of substituent in the organic ligand, and the rotation speed of the spin-coater. New europium complexes with chelating ligands containing additional pyridine fragments represent outstanding candidates for phosphors with improved luminescence properties.
Use of europium ions for SAD phasing of lysozyme at the Cu Kα wavelength.
Vijayakumar, Balakrishnan; Velmurugan, Devadasan
2013-01-01
Europium is shown to be a good anomalous scatterer in SAD phasing for solving the structure of biological macromolecules. The large value of the anomalous contribution of europium, f'' = 11.17 e(-), at the Cu Kα wavelength is an advantage in de novo phasing and automated model building. Tetragonal crystals of hen egg-white lysozyme (HEWL) incorporating europium(III) chloride (50 mM) were obtained which diffracted to a resolution of 2.3 Å at a wavelength of 1.54 Å (Cu Kα). The master data set (360° frames) was split and analyzed for anomalous signal-to-noise ratio, multiplicity, completeness, SAD phasing and automated building. The structure solution and model building of the split data sets were carried out using phenix.autosol and phenix.autobuild. The contributions of the Eu ions to SAD phasing using in-house data collection are discussed. This study revealed successful lysozyme phasing by SAD using laboratory-source data involving Eu ions, which are mainly coordinated by the side chains of Asn46, Asp52 and Asp101 together with some water molecules.
Directory of Open Access Journals (Sweden)
Hiroaki Onoda
2014-04-01
Full Text Available Europium-substituted lanthanum phosphates (Eu; 5 mol% were prepared from lanthanum nitrate, europium nitrate, and sodium polyphosphate solutions by a hydrothermal process at 120 and 160 °C up to 8 h. The obtained phosphates were studied using XRD, IR spectroscopy, TG–DTA, and SEM. UV–vis absorbance and reflectance, as well as fluorescence, were estimated as functional properties of these phosphate materials. We found that samples prepared without hydrothermal treatment were amorphous (as indicated by their XRD patterns, whereas those prepared by a hydrothermal treatment contained peaks corresponding to lanthanum orthophosphate, indicating that the hydrothermal process caused the polyphosphate(s to decompose into orthophosphate(s. The TG–DTA curves of the samples prepared by a hydrothermal treatment were different from those of the samples prepared without hydrothermal treatment. All samples reported herein had no specified shape despite using prolonged hydrothermal treatment times. Although the samples prepared without hydrothermal treatment showed only weak fluorescence peaks, those prepared by a hydrothermal treatment showed strong peaks at 556, 590, 615, and 690 nm. These peaks corresponded to transitions from 5D0 to 7F0, 7F1, 7F2, and 7F4, respectively. Collectively, these results indicate that the hydrothermal treatment is a useful method of obtaining europium-substituted lanthanum phosphates with fluorescence properties.
Fabrication of coated graphite electrode for the selective determination of europium (III) ions.
Upadhyay, Anjali; Singh, Ashok Kumar; Bandi, Koteswara Rao; Jain, A K
2013-10-15
Preliminary complexation study showed that two ligands (ionophores) (2-((2-phenyl-2-(pyridin-2-yl)hydazono)methyl)pyridine) [L1], (2-((2-phenyl-2-(pyridin-2-yl)hydazono) methyl)phenol) [L2] can act as europium selective electrode. Europium selective coated graphite electrodes (CGE) were prepared by using ligands [L1] and [L2] and their potentiometric characteristics were determined. Membranes having different compositions of poly(vinylchloride) (PVC), the different plasticizers, anionic additives and ionophores were coated onto the graphite surface. The potential response measurements showed that the best performance was exhibited by the proposed CGE. This electrode had the widest working concentration range, Nernstian slope and fast response times of 10s. The selectivity studies showed that this electrode have higher selectivity towards Eu(3+) over a large number of cations. Furthermore, the electrode generated constant potentials in the pH range 2.7-9.0. This electrode can be used to quantify europium in soil, binary mixtures and also used as an indicator electrode in the potentiometric titration of Eu(3+) with EDTA. The proposed electrode was also successfully applied to the determination of fluoride ions in real samples. © 2013 Elsevier B.V. All rights reserved.
Wang, Huai-Song; Bao, Wen-Jing; Ren, Shi-Bin; Chen, Ming; Wang, Kang; Xia, Xing-Hua
2015-07-07
Oxidative stress caused by reactive oxygen species (ROS) is harmful to biological systems and implicated in various diseases. A variety of selective fluorescent probes have been developed for detecting ROS to uncover their biological functions. Generally, the preparation of the fluorescent probes usually undergoes multiple synthetic steps, and the successful fluorescent sensing usually relies on trial-and-error tests. Herein we present a simple way to prepare fluorescent ROS probes that can be used both in biological and environmental systems. The fluorescent europium(III) coordination polymers (CPs) are prepared by simply mixing the precursors [2,2'-thiodiacetic acid and Eu(NO3)3·6H2O] in ethanol. Interestingly, with the increase of reaction temperature, the product undergoes a morphological transformation from microcrystal to nanoparticle while the structure and fluorescent properties retain. The fluorescence of the sulfur-tagged europium(III) CPs can be selectively quenched by ROS, and thus, sensitive and selective monitoring of ROS in aerosols by the microcrystals and in live cells by the nanoparticles has been achieved. The results reveal that the sulfur-tagged europium(III) CPs provide a novel sensor for imaging ROS in biological and environmental systems.
Facile Synthesis, Characterization, and Cytotoxic Activity of Europium-Doped Nanohydroxyapatite
Niño-Martínez, Nereyda; Patiño-Marín, Nuria
2016-01-01
The objective of this study was to synthetize europium-doped nanohydroxyapatite using a simple aqueous precipitation method and, thereafter, characterize and impregnate selected samples with 5-fluorouracil in order to explore the properties and the releasing capacity of this material. The nanohydroxyapatite was doped with 3, 5, 10, and 20 wt% of europium. The obtained samples were characterized after they were dried at 80°C and hydrothermal treated at 120°C by 2 hours. The samples were analyzed by transmission electron microscopy, X-ray diffraction analysis, Fourier transform infrared spectroscopy, and photoluminescence. Also, impregnation and release of 5-fluorouracil were assessed in PBS. The toxicity effects of all samples were studied using viability assays on human fibroblasts cells (HGF-1) in vitro. The sizes of the crystallites were about 10–70 nm with irregular morphology and present the phase corresponding to the JCPDS card 9–0432 for hydroxyapatite. The results of the toxicity experiments indicated that doped and undoped powders are biocompatible with fibroblasts cells. Hydroxyapatite samples doped with 5% of europium and loaded with 5-fluorouracil release almost 7 mg/L of the drug after 60 minutes in PBS and decrease the viability of HeLa cells after 24 hours. PMID:27965525
2010-04-01
... Methods of Analysis of the Association of Official Analytical Chemists,” 13th Ed. (1980), Table 1..., other than durum wheat and red durum wheat, to such fineness that, when tested by the method prescribed... are determined by the methods therefor referred to in § 137.105(c). (2) The method referred to in...
21 CFR 137.190 - Cracked wheat.
2010-04-01
... the moisture as determined by the method prescribed in “Official Methods of Analysis of the Association of Official Analytical Chemists,” 13th Ed. (1980), section 7.002 under “Preparation of Sample... the method prescribed in § 137.200(c)(2), not less than 90 percent passes through a No. 8 sieve and...
Li, Hongguang; Lan, Rongfeng; Chan, Chi-Fai; Jiang, Lijun; Dai, Lixiong; Kwong, Daniel W J; Lam, Michael Hon-Wah; Wong, Ka-Leung
2015-09-25
A water-soluble light-responsive antitumor agent, PtEuL, based on a cisplatin-linked europium-cyclen complex has been synthesized and evaluated for controlled cisplatin release by linear/two-photon excitation in vitro with concomitant turn-on and long-lived europium emission as a responsive traceable signal.
Dhara, Soumen; Imakita, Kenji; Mizuhata, Minoru; Fujii, Minoru
2014-06-01
In this work, we investigated the effects of europium doping on the second harmonic generation (SHG) of ZnO nanowires (NWs). A non-monotonic enhancement in the SHG is observed with the increase of the europium concentration. Maximum SHG is observed from the 1 at.% europium doped ZnO NWs with an enhancement factor of 4.5. To understand the underlying mechanism, the effective second order non-linear coefficient (deff) is calculated from the theoretical fitting with consideration of the absorption effect. Microstructural characterization reveals the structural deformation of the ZnO NWs caused by europium doping. We estimated the deviation in the crystal site symmetry around the Eu3+ ions (defined as the asymmetric factor) from photoluminescence measurement and it is found to be strongly correlated with the calculated deff value. A strong linear dependence between the magnitudes of deff and the asymmetric factor suggests that deviation in the local site symmetry of the ZnO crystal by europium doping could be the most probable origin of the observed large second order non-linearity.
Pilot unit for cesium-137 separation; Unite pilote de separation du cesium-137
Energy Technology Data Exchange (ETDEWEB)
Raggenbass, A.; Quesney, M.; Fradin, J.; Dufrene, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-07-01
Users of radiation are becoming increasingly interested in cesium-137. At the same time the starting up of the industrial plant at Marcoule will make available in the near future large stocks of fission products which should be made use of as quickly as possible. The installation described is a pilot plant for cesium-137 production which should make it possible: - to verify the chemical method on actual solutions of fission products, by treating about 100 curies of {sup 137}Cs by operation, - to obtain technical information on the chemical equipment (tele-commands, corrosion, maintenance, etc...), - to obtain {sup 137}Cs in sufficient quantity to perfect the technique of the manufacture of sealed sources. (author)Fren. [French] L'interet des utilisateurs de rayonnement se porte de plus en plus vers le caesium-137. Parallelement, la mise en oeuvre de l'ensemble industriel de Marcoule nous permettra de disposer dans un avenir proche de stocks importants de produits de fission qu'il sera interessant de valoriser au plus vite. L'installation que nous decrivons est un pilote de production de caesium-137 qui doit nous permettre: - de verifier la methode chimique sur des solutions de produits de fission reelles en traitant environ 100 curies de {sup 137}Cs par operation; - d'obtenir des renseignements techniques sur l'appareillage chimique (telecommandes, corrosion, entretien, etc...); - d'obtenir du {sup 137}Cs en quantite suffisante pour mettre au point la technique de fabrication des sources scellees. (auteur)
Energy Technology Data Exchange (ETDEWEB)
Radhakrishnan, S. [Central Electrochemical Research Institute, Karaikudi-630006, T.N. (India); Jagannathan, R., E-mail: jags57_99@yahoo.com [Central Electrochemical Research Institute, Karaikudi-630006, T.N. (India)
2011-05-19
Highlights: > In this study, using opto-, magneto-opto impedance techniques, experimental proof for charge growth in europium manganite (EuMnO{sub 3}) near the region of its Neel temperature is presented. > This study gives data related to dielectric properties of europium manganite. > This study may open-up new avenues for investigating the dielectric characteristics of many electronic-ceramics. - Abstract: In this preliminary report, we present the impedance characteristics of poly-crystalline europium manganite, a promising colossal magneto resistance (CMR) system investigated under optical ({approx}5 eV) and magnetic (0.1 T) perturbations yielding some clues on the charge build-up and dispersion processes. This may possibly be resulting from switching between ferromagnetic and anti-ferromagnetic phases through a charge transfer transition mediated process centering Mn{sup 3+/4+} 3d spins thereby meriting a more detailed study correlating with magnetic measurements.
Ye, Jing; Wang, Jianling; Li, Qiwei; Dong, Xiawei; Ge, Wei; Chen, Yun; Jiang, Xuerui; Liu, Hongde; Jiang, Hui; Wang, Xuemei
2016-04-01
A new and facile method for rapidly and accurately achieving tumor targeting fluorescent images has been explored using a specifically biosynthesized europium (Eu) complex in vivo and in vitro. It demonstrated that a fluorescent Eu complex could be bio-synthesized through a spontaneous molecular process in cancerous cells and tumors, but not prepared in normal cells and tissues. In addition, the proteomics analyses show that some biological pathways of metabolism, especially for NADPH production and glutamine metabolism, are remarkably affected during the relevant biosynthesis process, where molecular precursors of europium ions are reduced to fluorescent europium complexes inside cancerous cells or tumor tissues. These results proved that the specific self-biosynthesis of a fluorescent Eu complex by cancer cells or tumor tissues can provide a new strategy for accurate diagnosis and treatment strategies in the early stages of cancers and thus is beneficial for realizing precise surgical intervention based on the relevant cheap and readily available agents.
Aikawa, Tatsuo; Mizuno, Akihiro; Kohri, Michinari; Taniguchi, Tatsuo; Kishikawa, Keiki; Nakahira, Takayuki
2016-09-01
Luminescent particles have been attracting significant attention because they can be used in biochemical applications, such as detecting and imaging biomolecules. In this study, luminescent polystyrene latex particles were prepared through miniemulsion polymerization of styrene with dissolved europium complexes in the presence of bovine serum albumin (BSA) and poly(ethylene glycol) monomethoxy methacrylate as surfactants. The solubility of the europium complex in styrene has a strong effect on the yield of the particle. Europium tris(2-thenoyl trifluoroacetonate) di(tri-n-octyl phosphine oxide), which has a high solubility in styrene, was sufficiently incorporated into the polystyrene particles compared to europium tris(2-thenoyl trifluoroacetonate), which has a low solubility in styrene. The luminescence property of the europium complex could remain intact even after its incorporation through the miniemulsion polymerization. In the aqueous dispersion, the resulting particles could emit strong luminescence, which is a characteristic of the europium complex. The antibody fragments were covalently attached to BSA-covered particles after a reaction with a bifunctional linker, N-(6-maleimidocaproyloxy)succinimide. The time-resolved fluoroimmunoassay technique showed that 3.3pg/mL of human α-fetoproteins (AFP) can be detected by using the resulting luminescent particles. An immunochromatographic assay using the resulting particles was also performed as a convenient method to qualitatively detect biomolecules. The detection limit of AFP measured by the immunochromatographic assay was determined to be 2000pg/mL. These results revealed that the luminescent particles obtained in this study can be utilized for the highly sensitive detection of biomolecules and in vitro biochemical diagnosis. Copyright © 2016 Elsevier B.V. All rights reserved.
Highly specific ''sensing'' of tryptophan by a luminescent europium(III) complex
Energy Technology Data Exchange (ETDEWEB)
Stubenrauch, Jan A.; Mevissen, Christian; Schulte, Marie F.; Bochenek, Steffen; Albrecht, Markus [RWTH Univ. Aachen (Germany). Inst. fuer Organische Chemie; Subramanian, Palani S. [Central Salt and Marine Chemicals, Research Institute (CSRI), Gujarat (India)
2016-07-01
The europium(III) complex 1-Cl{sub 3} (S,S-2,2{sup '}-(((1,10-phenanthroline-2,9-diyl)bis(methanylylidene))bis (azanylyliden e))bis(3-methylbutanamide)europiumtrichloride) undergoes, only in the presence of the amino acid tryptophan, a change of emission at 615 nm. In the presence of few equivalents of tryptophan, emission of the europium complex is enhanced while it disappears upon addition of large amounts. This behavior can be assigned to displacement of the sensitizing phenanthroline ligand of 1-Cl{sub 2} x Trp in the latter case.
Davydov, S Y
2002-01-01
One discusses nature of electron induced desorption of Eu sup 0 europium atoms under E sub e irradiating electron low-energies (approx 30 eV) and peculiarities of yield dependence of Eu sup 0 atoms on their concentration at oxidized tungsten surface. Primary act of vacancy origination in europium adatom inner 5p-shell turned to be the determining stage. Evaluations have shown that just the first of two possible scenarios of ionization (electron intra-atomic to Eu adatom external quasi-level or realise of knocked out electron into vacuum) leads to Eu sup 0 desorption. One determined concentration threshold for yield of Eu sup 0 atoms
21 CFR 137.260 - Enriched corn meals.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched corn meals. 137.260 Section 137.260 Food... Flours and Related Products § 137.260 Enriched corn meals. (a) Enriched corn meals are the foods, each of which conforms to the definition and standard of identity prescribed for a kind of corn meal by §§ 137...
21 CFR 137.275 - Yellow corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yellow corn meal. 137.275 Section 137.275 Food and... Related Products § 137.275 Yellow corn meal. Yellow corn meal conforms to the definition and standard of identity prescribed by § 137.250 for white corn meal except that cleaned yellow corn is used instead of...
10 CFR 600.137 - Property trust relationship.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Property trust relationship. 600.137 Section 600.137 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform..., Hospitals, and Other Nonprofit Organizations Post-Award Requirements § 600.137 Property trust relationship...
42 CFR 137.245 - What is retrocession?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What is retrocession? 137.245 Section 137.245 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Retrocession § 137.245 What is retrocession...
42 CFR 137.255 - What does reassumption mean?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What does reassumption mean? 137.255 Section 137.255 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Reassumption § 137.255 What does reassumption...
42 CFR 137.40 - What is a funding agreement?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What is a funding agreement? 137.40 Section 137.40 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Funding Agreements § 137.40 What is a funding...
42 CFR 137.3 - Effect on existing Tribal rights.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Effect on existing Tribal rights. 137.3 Section 137.3 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE General Provisions § 137.3 Effect on existing...
21 CFR 137.265 - Degerminated white corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Degerminated white corn meal. 137.265 Section 137... Cereal Flours and Related Products § 137.265 Degerminated white corn meal. (a) Degerminated white corn meal, degermed white corn meal, is the food prepared by grinding cleaned white corn and removing bran...
14 CFR 21.137 - Location of manufacturing facilities.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Location of manufacturing facilities. 21.137 Section 21.137 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS Production Certificates § 21.137 Location of manufacturing facilities. The Administrator...
Energy Technology Data Exchange (ETDEWEB)
Gerasimova, V.I., E-mail: vis@srd.sinp.msu.ru [Skobel' tsyn Research Institute of Nuclear Physics, Moscow State University, Leninskie Gory 1-2, GSP-1, 119991 Moscow (Russian Federation); Antoshkov, A.A.; Zavorotny, Yu.S.; Rybaltovskii, A.O. [Skobel' tsyn Research Institute of Nuclear Physics, Moscow State University, Leninskie Gory 1-2, GSP-1, 119991 Moscow (Russian Federation); Lemenovskii, D.A., E-mail: dali@org.chem.msu.ru [Chemistry Department, Moscow State University, Leninskie Gory 1-3, GSP-1, 119991 Moscow (Russian Federation)
2013-02-15
The optical properties of fluoropolymers and polypropylene doped with europium(III) {beta}-diketonates Eu(L){sub 3}{center_dot}2H{sub 2}O and Eu(L){sub 3}phen (L: fod=6,6,7,7,8,8,8-heptafluoro-2,2-dimethyl-3,5-octanedionato, bta=4,4,4-trifluoro-1-phenyl-1,3-butanedione, tta=4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedione, and phen=1,10-phenanthroline) using supercritical carbon dioxide were investigated by absorption and emission spectra. A comparative analysis of the PL decay times of Eu{sup 3+} ions in the initial europium (III) {beta}-diketonates and impregnated fluoropolymers was carried out. The supercritical fluid (SCF) impregnation of polymer samples with europium(III) {beta}-diketonates containing 1,10-phenanthroline was found to be obstructed differently depending on the type of ligand in the entire investigated impregnation temperature range (T{sub SCF}=50-90 Degree-Sign S). It is shown that from the variety of Eu(L){sub 3}phen only Eu(fod){sub 3}phen can be introduced into the polymer matrix by this method. - Highlights: Black-Right-Pointing-Pointer The optical properties of polymers doped with Eu{sup 3+} {beta}-diketonates using SC CO{sub 2} were investigated. Black-Right-Pointing-Pointer A comparative analysis of the PL decay times in the initial Eu{sup 3+} {beta}-diketonates and doped polymers was carried out. Black-Right-Pointing-Pointer The SC CO{sub 2} impregnation of polymers with Eu{sup 3+} {beta}-diketonates containing 1,10-phenanthroline was found to be obstructed.
Yi, Sijing; Li, Qintang; Liu, Hongguo; Chen, Xiao
2014-10-02
Fabrication of lyotropic aggregates containing the lanthanide ions is becoming a preferable way to prepare novel functional materials. Here, the lyotropic liquid crystals (LLCs) of reverse hexagonal, reverse bicontinuous cubic, and lamellar phases have been constructed in sequence directly from the mixtures of Eu(NO3)3·6H2O and Pluronic P123 amphiphilc block copolymer with increasing the salt proportion. Their phase types and structural characteristics were analyzed using polarized optical microscopy (POM) and small-angle X-ray scattering (SAXS) measurements. The driving forces of reverse LLC phase formation were investigated using Fourier-transformed infrared spectroscopy (FTIR) and rheological measurements. The hydrated europium salt was found to act not only as a solvent here, but also as the bridge to form hydrogen bonding between coordinated water molecules and PEO blocks, which played a key role in the reverse LLCs formation. Compared to those in aqueous solutions and solid state, the enhanced luminescence quantum yields and prolonged excited state lifetimes were observed in two europium containing reverse mesophases. The luminescence quenching effect of lanthanide ions was efficiently suppressed, probably due to the substitution of coordinated water molecules by oxyethyl groups of P123 and ordered phase structures of LLCs, where the coordinated europium ions were confined and isolated by PEO blocks. The optimum luminescence performance was then found to exist in the reverse hexagonal phase. The obtained results on such lanthanide-induced reverse LLCs should be referable for designing new luminescent soft materials construction to expand their application fields.
Maloubier, Melody; Shuh, David K; Minasian, Stefan G; Pacold, Joseph I; Solari, Pier-Lorenzo; Michel, Hervé; Oberhaensli, François R; Bottein, Yasmine; Monfort, Marguerite; Moulin, Christophe; Den Auwer, Christophe
2016-10-04
In the ocean, complex interactions between natural and anthropogenic radionuclides, seawater, and diverse marine biota provide a unique window through which to examine ecosystem and trophic transfer mechanisms in cases of accidental dissemination. The nature of interaction between radionuclides, the marine environment, and marine species is therefore essential for better understanding transfer mechanisms from the hydrosphere to the biosphere. Although data pertaining to the rate of global transfer are often available, little is known regarding the mechanism of environmental transport and uptake of heavy radionuclides by marine species. Among marine species, sponges are immobile active filter feeders and have been identified as hyperaccumulators of several heavy metals. We have selected the Mediterranean sponge Aplysina cavernicola as a model species for this study. Actinide elements are not the only source of radioactive release in cases of civilian nuclear events; however, their physicochemical transfer mechanisms to marine species remain largely unknown. We have targeted europium(III) as a representative of the trivalent actinides such as americium or curium. To unravel biological uptake mechanisms of europium in A. cavernicola, we have combined radiometric (γ) measurements with spectroscopic (time-resolved laser-induced fluorescence spectroscopy, TRLIFS, and X-ray absorption near-edge structure, XANES) and imaging (transmission electron microscopy, TEM, and scanning transmission X-ray microscopy, STXM) techniques. We have observed that the colloids of NaEu(CO3)2·nH2O formed in seawater are taken up by A. cavernicola with no evidence that lethal dose has been reached in our working conditions. Spectroscopic results suggest that there is no change of speciation during uptake. Finally, TEM and STXM images recorded at different locations across a sponge cross section, together with differential cell separation, indicate the presence of europium particles (around
Directory of Open Access Journals (Sweden)
Rema Matakova
2012-03-01
Full Text Available In the course of several decades at the department of analytical chemistry and chemistry of rare elements there were studied the electrode processes with participation of rare-earth metals (REM in accordance with the long awaiting problem of the development of rare-metal and rare-earth branch of non-ferrous metallurgy of Kazakhstan. With the aim of express and highly sensitive analytical control of raw materials and final product of rare-earth industry there were developed the methods of inversion-voltamperometric determination of low concentrations of europium, ytterbium and cerium under the conditions of their individual and combined presence in the solution.
Makrlík, Emanuel; Vaňura, Petr; Selucký, Pavel
2013-01-01
Extraction of microamounts of europium and americium by a nitrobenzene solution of hydrogen dicarbollylcobaltate (H+B-) in the presence of dodecaethylene glycol (DDEG, L) has been investigated. The equilibrium data have been explained assuming that the species HL+, H2L2+, ML3+ and MH-1L2+ (M3+ = Eu3+, Am3+; L = DDEG) are extracted into the organic phase. The values of extraction and stability constants of the complex species in nitrobenzene saturated with water have been determined. It was found that in this nitrobenzene medium, the stability constant of the EuL3+ complex is comparable with that of AmL3+.
Red/blue electroluminescence from europium-doped organic light emitting diodes
Hagen, Joshua A.; Li, Wayne X.; Grote, James G.; Steckl, Andrew J.
2006-02-01
Red/Blue emitting organic light emitting diodes (OLED) devices have been obtained using a Europium-doped organic emitting layer (NPB:Eu). The Eu-doped OLEDs emit in 2 color ranges: a broad blue (~420-500nm) band due to NPB emission and a narrow red peak at 620nm due to Eu emission. The red/blue devices achieve a brightness ~13x more intense than a similarly structured green (Alq 3) emitting OLED. These NPB:Eu emitting structures also reach a maximum efficiency of 0.2 cd/A at brightnesses above 100 cd/m2.
Energy Technology Data Exchange (ETDEWEB)
Ordonez R, E.; Fernandez V, S.M.; Garcia R, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)
2003-07-01
In previous works it has already been made notice that some phosphates have the property of sipping radioactive metals in solution, what takes advantage to fabricate reactive barriers that are placed in the repositories of nuclear wastes. In our laboratory it has been obtained to the zirconium silicate (ZrSiO{sub 4}) and the alpha zirconium hydrogen phosphate (Zr(HPO{sub 4}) 2H{sub 2}0) starting from sea sand in an easy and economic way. With the interest of knowing if these compounds can be used in contention barriers the evaluation of their surface properties it is made and of europium sorption. (Author)
Sol-Gel Synthesis, X-Ray Diffraction Studies, and Electric Conductivity of Sodium Europium Silicate
Directory of Open Access Journals (Sweden)
Ekaterina V. Borisova
2013-01-01
Full Text Available Sodium europium silicate, NaEu9(SiO46O2, with apatite structure has been obtained and studied using X-ray diffraction and SEM. It has been shown that sodium sublimation does not take place upon synthesis by the sol-gel method. Rietveld refinement has revealed that sodium atoms are ordered and occupy the 4f position. O(4 atoms not related to silicate ions are placed at the centers of Eu(2 triangles. DC and AC electric conductivity and activation energy have been determined for the compound studied.
Dai, Lixiong; Lo, Wai-Sum; Coates, Ian D; Pal, Robert; Law, Ga-Lai
2016-09-06
High glum values of +0.30 (ΔJ = 1, 591 nm, in DMSO) and -0.23 (ΔJ = 1, 589 nm, in H2O) were recorded in our series of newly designed macrocyclic europium(III) complexes. A sterically locking approach involving a bidentate chromophore is adopted to control the formation of one stereoisomer, giving rise to extreme rigidity, high stability, and high emission intensity. The combination of a chiral substituent on a macrocyclic chelate for lanthanide ions opens up new perspectives for the further development of circulary polarized luminescent chiral tags in optical and bioapplications.
Ma, Zhi Ya; Dosev, Dosi; Kennedy, Ian M
2010-01-01
A facile one-pot microemulsion method has been developed for the synthesis of spherical silver core–silica shell (Ag@SiO2) nanoparticles with europium chelates doped in the shell through a silane agent. The method is significantly more straightforward than other extant methods. Measurements of the luminescent emissions from the Ag@SiO2 nanoparticles, in comparison with control silica nanoparticles without silver cores, showed that the presence of the silver cores can increase the fluorescence intensity approximately 24-fold and decrease the luminescence lifetime. This enhancement offers a potential increase in overall particle detectability with increased fluorophore photostability. PMID:19417456
Bozoklu, Gülay; Gateau, Christelle; Imbert, Daniel; Pécaut, Jacques; Robeyns, Koen; Filinchuk, Yaroslav; Memon, Farah; Muller, Gilles
2012-01-01
The chiral dissymmetric tetradentate ligand SPhbipox (6’-(4-phenyloxazolin-2-yl)-2,2’-bipyridine-6-carboxylic acid) leads to the diastereoselective assembly of a homochiral Eu(III) triangle and of a highly emissive (QY=27%) heptanuclear wheel which is the largest example of chiral luminescent complex of Eu(III) reported to date. We show that the nuclearity of the assembly is controlled by the solvent and the europium cation. All the compounds show large circularly polarized luminescence with an activity which varies with the nature of the assembly (highest for the homochiral trimer). PMID:22548280
A europium(III)-based PARACEST agent for sensing singlet oxygen by MRI
Song, Bo; Wu, Yunkou; Yu, Mengxiao; Zhao, Piyu; Zhou, Cheng; Kiefer, Garry E.
2013-01-01
A europium (III) DOTA-tetraamide complex was designed as a MRI sensor of singlet oxygen (1O2). The water soluble, thermodynamically stable complex reacts rapidly with 1O2 to form an endoperoxide derivative that results in an ∼3 ppm shift in the position of the Eu(III)-bound water chemical exchange saturation transfer (CEST) peak. The potential of using this probe to detect accumulation of the endoperoxide derivative in biological media by ratiometric CEST imaging was demonstrated. PMID:23575743
Energy Technology Data Exchange (ETDEWEB)
Hoffman, R D; Kelley, K; Dietrich, F S; Bauer, R; Mustafa, M
2004-11-30
We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron and proton induced nuclear reaction cross sections in the mass region of samarium, europium and gadolinium (62 {le} Z {le} 64, 82 {le} N {le} 96).
Urumese, Ancila; Jenjeti, Ramesh Naidu; Sampath, S; Jagirdar, Balaji R
2016-08-15
Chemistry of lanthanide metals in their zerovalent state at the nanoscale remains unexplored due to the high chemical reactivity and difficulty in synthesizing nanoparticles by conventional reduction methods. In the present study, europium(0) nanoparticles, the most reactive of all the rare earth metals have been synthesized by solvated metal atom dispersion (SMAD) method using hexadecyl amine as the capping agent. The as-prepared europium nanoparticles show surface Plasmon resonance (SPR) band in the visible region of the electromagnetic spectrum. This lead to the investigation of its surface enhanced Raman scattering (SERS) using visible light excitation source. The SERS activity of europium nanoparticles has been followed using 4-aminothiophenol and biologically important molecules such as hemoglobin and Cyt-c as the analytes. This is the first example of lanthanide metal nanoparticles as SERS substrate which can possibly be extended to other rare-earth metals. Since hemoglobin absorbs in the visible region, the use of visible light excitation source leads to surface enhanced resonance Raman spectroscopy (SERRS). The interaction of biomolecules with Eu(0) has been followed using FT-IR and UV-visible spectroscopy techniques. The results indicate that there is no major irreversible change in the structure of biomolecules upon interaction with europium nanoparticles. Copyright © 2016 Elsevier Inc. All rights reserved.
Oxytetracycline (OTC) residue in catfish muscle was screened by dispersive liquid-liquid microextraction (DLLME) and europium-sensitized luminescence (ESL). After extraction in EDTA, HCl, and acetonitrile, cleanup was carried out by DLLME, and ESL was measured at microgram = 385 nm and wavelength = ...
Energy Technology Data Exchange (ETDEWEB)
Thang, Cao Xuan; Pham, Vuong-Hung, E-mail: vuong.phamhung@hust.edu.vn
2015-07-15
Highlights: • Europium doped silicon-substituted hydroxyapatite was synthesized by wet chemical synthesis method. • Morphology of nanoparticles depended on the synthesized method. • Photoluminescence intensity of the sample increases with the increasing of Si substitutions, Eu dopants and thermal annealing. - Abstract: This paper reports the first attempt for the synthesis of europium-doped Si-substituted hydroxyapatite (HA) nanostructure to achieve strong and stable luminescence of nanobiophosphor, particularly, by addition of different Eu dopants, Si substitutions, and application of optimum annealing temperatures of up to 1000 °C. The nanobiophosphor was synthesized by the coprecipitation, microwave, and hydrothermal methods. The nanoparticles demonstrated a nanowire to a spindle-like morphology, which was dependent on the method of synthesis. The photoluminescence (PL) intensity of the sample increases with the increase in Si substitutions and Eu dopants. The luminescent nanoparticles also showed the typical luminescence of Eu{sup 3+} centered at 610 nm, which was more efficient for the annealed Eu-doped Si-HA nanoparticles than for the as-synthesized nanoparticles. Among the different synthesis methods, the hydrothermal method reveals the best light emission represented by high PL intensity and narrow PL spectra. These results suggest the potential application of Eu-doped Si-HA in stable and biocompatible nanophosphors for light emission and nanomedicine.
Resonance ionization spectroscopy of Europium The first application of the PISA at ISOLDE-RILIS
AUTHOR|(CDS)2099873; Marsh, Bruce Alan
The following work has been carried out at the radioactive ion beam facility ISOLDE at CERN. A compact atomic beam unit named PISA (Photo Ionization Spectroscopy Apparatus) has been implemented as a recent addition to the laboratory of the Resonance Ionization Laser Ion Source (RILIS). The scope of this thesis work was to demonstrate different applications of the PISA, using the existing and highly developed laser setup of the RILIS installation. In a demonstration of the suitability of PISA for ionization scheme development, a new ionization scheme for Europium has been developed. This resulted in the observation of several new autoionizing states and Rydberg series. Through the analysis of the observed Rydberg resonances a refined value of $45734.33(3)(3)$ cm$^{-1}$ for the ionization potential of the europium atom has been determined. In addition this thesis reports on the feasibility of the use of the PISA as a RILIS performance monitoring device during laser ion source operations. Finally the present wor...
Structural and electrical properties of the europium-doped indium zinc oxide thin film transistors
Energy Technology Data Exchange (ETDEWEB)
Ting, Chu-Chi, E-mail: ccting@ccu.edu.tw [Graduate Institute of Opto-Mechatronics Engineering, National Chung Cheng University, 168 University Rd., Min-Hsiung, Chia-Yi, Taiwan, ROC (China); Advanced Institute for Manufacturing with High-Tech Innovations, National Chung Cheng University, 168 University Rd., Min-Hsiung, Chia-Yi, Taiwan, ROC (China); Li, Wei-Yang; Wang, Ching-Hua; Yong, Hua-En [Graduate Institute of Opto-Mechatronics Engineering, National Chung Cheng University, 168 University Rd., Min-Hsiung, Chia-Yi, Taiwan, ROC (China)
2014-07-01
The EuInZnO (EIZO) thin film transistor (TFT) devices were fabricated by the sol–gel spin-coating technique. The EIZO TFT operates in the n-channel depletion mode and exhibits a well-defined pinch-off and saturation region. Because europium ion possesses lower electronegativity (1.2) and standard electrode potential (− 1.991 V), it can act as the carrier suppressor to reduce the carrier concentrations of the IZO (In:Zn = 1:1) thin film. Eu{sup 3+} (13 mol%)-doped IZO TFT possesses the optimum performance, and its field-effect mobility in the saturated regime, threshold voltage, on–off ratio, and S-factor are 1.23 cm{sup 2}/Vs, 3.28 V, 1.07 × 10{sup 6}, and 2.28 V/decade, respectively. - Highlights: • Europium ions can act as the carrier suppressor in the InZnO system. • The EuInZnO forms an n-channel material for the thin film transistor (TFT) device. • The optimum performance of the EuInZnO TFT is the sample with 13 mol% Eu{sup 3+} doping.
Fernandes, Diana M; Vos, Johannes G; Freire, Cristina
2014-04-15
Hybrid multilayer films composed by osmium metallopolymer [Os(bpy)2(PVP)10Cl]Cl (Os-poly) and europium phosphomolybdate, K₁₁[Eu(III)(PMo₁₁O₃₉)₂] (Eu(PMo11)2), were prepared using the electrostatic layer-by-layer (LbL) self-assembly method. The film build-up, monitored by electronic spectroscopy, showed a regular stepwise growth indicating a strong interaction between layers. The XPS measurements corroborated the successful fabrication of the hybrid films with the Os-poly/Eu(PMo11)2 composition. SEM images revealed a completely covered surface with a highly roughened texture. Electrochemical characterisation of films by cyclic voltammetry revealed three Mo-based reduction processes (Mo(VI)→Mo(V)) in the potential range between -0.4 and 0.1 V and one Os reduction process (Os(III)→Os(II)) at ≈0.270 V. The cyclic voltammograms of two electroactive probes, [Fe(CN)₆](3-/4-) and [Ru(NH₃)₆](3+/2+) on {Os-poly/Eu(PMo11)2}n modified electrodes revealed redox mediation between film and the probes. Furthermore, the {Os-poly/Eu(PMo11)2}n multilayer films also showed excellent Mo-based electrocatalytic activity towards reduction of nitrite and iodate, confirming the multi-functional properties of the hybrid europium phosphomolybdate - osmium metallopolymer LbL films. Copyright © 2014 Elsevier Inc. All rights reserved.
Theoretical spectroscopic study of the conjugate microcystin-LR-europium cryptate
Energy Technology Data Exchange (ETDEWEB)
Santos, Julio G.; Dutra, Jose Diogo L.; Costa Junior, Nivan B. da; Freire, Ricardo O., E-mail: rfreire@ufs.br [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Quimica; Alves Junior, Severino; Sa, Gilberto F. de [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Quimica Fundamental
2013-02-15
In this work, theoretical tools were used to study spectroscopic properties of the conjugate microcystin-LR-europium cryptate. The Sparkle/AM1 model was applied to predict the geometry of the system and the INDO/S-CIS model was used to calculate the excited state energies. Based on the Judd-Ofelt theory, the intensity parameters were predicted and a theoretical model based on the theory of the 4f-4f transitions was applied to calculate energy transfer and backtransfer rates, radiative and non-radiative decay rates, quantum efficiency and quantum yield. A detailed study of the luminescent properties of the conjugate Microcystin-LR-europium cryptate was carried out. The results show that the theoretical quantum yield of luminescence of 23% is in good agreement with the experimental value published. This fact suggests that this theoretical protocol can be used to design new systems in order to improve their luminescence properties. The results suggest that this luminescent system may be a good conjugate for using in assay ELISA for detection by luminescence of the Microcystin-LR in water. (author)
pH-controlled delivery of luminescent europium coated nanoparticles into platelets
Davies, Amy; Lewis, David J.; Watson, Stephen P.; Thomas, Steven G.; Pikramenou, Zoe
2012-01-01
Water soluble, luminescent gold nanoparticles are delivered into human platelets via a rapid, pH-controlled mechanism using a pH low insertion peptide, pHLIP. The approach introduces cocoating of gold nanoparticles with a europium luminescent complex, EuL and the pHLIP peptide to give pHLIP•EuL•Au. The 13-nm diameter gold nanoparticles act as a scaffold for the attachment of both the luminescent probe and the peptide to target delivery. Their size allows delivery of approximately 640 lanthanide probes per nanoparticle to be internalized in human platelets, which are not susceptible to transfection or microinjection. The internalization of pHLIP•EuL•Au in platelets, which takes just minutes, was studied with a variety of imaging modalities including luminescence, confocal reflection, and transmission electron microscopy. The results show that pHLIP•EuL•Au only enters the platelets in low pH conditions, pH 6.5, mediated by the pHLIP translocation across the membrane, and not at pH 7.4. Luminescence microscopy images of the treated platelets show clearly the red luminescence signal from the europium probe and confocal reflection microscopy confirms the presence of the gold particles. Furthermore, transmission electron microscopy gives a detailed insight of the internalization and spatial localization of the gold nanoparticles in the platelets. Thus, we demonstrate the potential of the design to translocate multimodal nanoparticle probes into cells in a pH dependent manner. PMID:22308346
Głogocka, Daria; Noculak, Agnieszka; Pucińska, Joanna; Jopek, Wojciech; Podbielska, Halina; Langner, Marek; Przybyło, Magdalena
2015-01-01
The surface passivation with titanium sol-gel coatings is a frequently used technique to control the adsorption of selected biological macromolecules and to reduce the exposure of the bulk material to biological matter. Due to the increasing number of new coating-preparation methods and new gel compositions with various types of additives, the quality and homogeneity determination of the surface covering is a critical factor affecting performance of any implanted material. While coating thickness is easy to determine, the homogeneity of the surface distribution of coating materials requires more elaborate methodologies. In the paper, the laser induced breakdown spectroscopy (LIBS) based method, capable to quantitate the homogeneity and uniformity of the europium in titanium dioxide sol-gel coatings on stainless steel surfaces prepared with two different procedures: spin-coating and dip-coating, is presented. The emission intensity of titanium has been used to determine the coating thickness whereas the relative values of europium and titanium emission intensities provide data on the coating homogeneity. The obtained results show that the spin-coating technique provides better surface coverage with titanium dioxide. However, when the surface coating compositions were compared the dip-coating technique was more reliable.
Woods, Mark; Woessner, Donald E.; Zhao, Piyu; Pasha, Azhar; Yang, Meng-Yin; Huang, Ching-Hui; Vasalitiy, Olga; Morrow, Janet R.; Sherry, A. Dean
2009-01-01
Paramagnetic lanthanide(III) complexes that contain hyperfine-shifted exchangeable protons offer considerable advantages over diamagnetic molecules as chemical exchange saturation transfer (CEST) agents for MRI. As part of a program to investigate avenues to improve the sensitivity of such agents, the CEST characteristics of europium(III) macrocyclic complexes having appended hydroxyethyl groups were investigated. The CEST spectrum of the asymmetrical complex, EuCNPHC3+, shows five distinct peaks for each magnetically nonequivalent exchangeable proton in the molecule. The CEST spectra of this complex were fitted to NMR Bloch theory to yield exchange rates between each of six exchanging proton pools (five on the agent plus bulk water). Exchange between the Eu3+-bound hydroxyl protons and bulk water protons was slow in dry acetonitrile but accelerated incrementally upon stepwise addition of water. In pure water, exchange was too fast to observe a CEST effect. The utility of this class of europium(III) complex for CEST imaging applications is ultimately limited by the small chemical shifts induced by the hydroxyl-appended ligands of this type and the resulting small Δω values for the exchangeable hydroxyl protons. PMID:16881645
Red light emission from europium doped zinc sodium bismuth borate glasses
Hegde, Vinod; Viswanath, C. S. Dwaraka; Upadhyaya, Vyasa; Mahato, K. K.; Kamath, Sudha D.
2017-12-01
Zinc sodium bismuth borate (ZNBB) glasses doped with different concentrations of europium were prepared by conventional melt quenching method and characterized through the measurements of density, refractive index, X-ray diffraction (XRD), Fourier Transform Infrared (FTIR) spectra, optical absorption, luminescence and radiative lifetimes. FTIR spectra showed seven characteristic peaks of bismuth and borate functional groups in the range of 400-1600 cm-1. The optical band gap and bonding parameters have been calculated from absorption spectra. Photoluminescence spectra recorded in the visible region with 394 nm excitation are used to calculate the Judd-Ofelt (JO) intensity parameters (Ω2 and Ω4). The JO intensity parameters have been used to calculate the radiative parameters such as branching ratio (β), stimulated emission cross-section (σse), transition probability (A) for the fluorescent level of 5D0→7F2. Decay rates through single exponential are used to calculate the lifetime (τm) of the meta-stable state 5D0 of (Eu3+ ion) these glasses. The radiative parameters measured for all these glasses show 0.7 mol% europium doped zinc sodium bismuth borate glass 5D0→7F2 transition has the potential for red laser applications. The quality of the colour emitted by the present glasses are estimated quantitatively by CIE chromaticity coordinates, which confirms the suitability of these glasses as a red emitting material for field emission technologies and LEDs.
Samarium-153 EDTMP for metastatic bone pain palliation: the impact of europium impurities.
Kalef-Ezra, J A; Valakis, S T; Pallada, S
2015-02-01
To evaluate the impact on the radiation protection policies of the radiocontaminants in Samarium-153 ethylenediamine tetramethylene phosphonate ((153)Sm-EDTMP). The internal contamination of patients treated with (153)Sm-EDMTP for palliation of painful disseminated multiple bone metastases due to long-lived impurities was assessed by direct measurements. These measurements were coupled with dose-rate measurements close to their bodies and spectroscopic analysis of the residual activity in post-treatment radiopharmaceutical vials. Whole-body counting carried out in six patients showed a 30-81-kBq europium -152 plus europium-154 contamination. The 0.85 mean (152)Eu- to -(154)Eu activity ratio obtained by direct counting was similar to that assessed by analysis of post-treatment residual activities in twelve radiopharmaceutical vials following radiopharmaceutical injection. The long-lived radiocontaminants in the patient's bodies and the treatment wastes require modifications of the applicable radiation protection policies. Copyright © 2014 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.
Jennings, Laura; Waters, Ryan S; Pal, Robert; Parker, David
2017-02-03
Alpha-1-acid glycoprotein (α1 -AGP) is an important blood plasma glycoprotein. Following an acute-phase reaction such as stress, inflammation, burn, or infection, the bloodstream concentration of α1 -AGP can increase up to 400 % of its normal concentration. A wide range of drugs is known to bind α1 -AGP. Increased binding of pharmacologically active compounds to α1 -AGP moderates their clinical effect by decreasing the amount of unbound drug in the bloodstream. This has important clinical ramifications for such applications as the duration of anesthesia and in determining dosage for drug therapy. In this study, the competitive binding to α1 -AGP of a dynamically racemic europium(III) complex with seven pharmacologically active drugs absorbing in the range λ 250-290 nm was monitored by following changes in europium total emission and in induced circularly polarized luminescence (CPL). Binding affinities corresponding to Kd values in the range 0.5-100 μm were measured, in good agreement with published data. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Zhang Kui-Hua
2011-01-01
Full Text Available Abstract Calcium phosphate is the most important inorganic constituent of biological tissues, and synthetic calcium phosphate has been widely used as biomaterials. In this study, a facile method has been developed for the fabrication of amorphous calcium phosphate (ACP/polylactide-block-monomethoxy(polyethyleneglycol hybrid nanoparticles and ACP porous nanospheres. Europium-doping is performed to enable photoluminescence (PL function of ACP porous nanospheres. A high specific surface area of the europium-doped ACP (Eu3+:ACP porous nanospheres is achieved (126.7 m2/g. PL properties of Eu3+:ACP porous nanospheres are investigated, and the most intense peak at 612 nm is observed at 5 mol% Eu3+ doping. In vitro cytotoxicity experiments indicate that the as-prepared Eu3+:ACP porous nanospheres are biocompatible. In vitro drug release experiments indicate that the ibuprofen-loaded Eu3+:ACP porous nanospheres show a slow and sustained drug release in simulated body fluid. We have found that the cumulative amount of released drug has a linear relationship with the natural logarithm of release time (ln(t. The Eu3+:ACP porous nanospheres are bioactive, and can transform to hydroxyapatite during drug release. The PL properties of drug-loaded nanocarriers before and after drug release are also investigated.
Yi, Sijing; Wang, Jiao; Feng, Zhenyu; Chen, Xiao
2017-10-05
Soft materials of europium β-diketonate complexes constructed in lyotropic liquid crystals (LLCs) mediated by ionic liquids (ILs) are impressive for their excellent luminescence performance and stability. For the aim to further improve their mechanical processability and luminescent tunablility, the polyoxyethylene phytosterols (BPS-n) were introduced here as structure directing agents to prepare relatively "rigid" lamellar luminescent LLCs in 1-butyl-3-methyl-imidazolium hexafluorophosphate by doping europium β-diketonate complexes with different imidazolium counterions. As a result of the solvophobic sterol ring structure of BPS-n, the more effective isolation and confinement effects of europium complexes could be achieved. The longest fluorescence lifetime and the highest quantum efficiency reported so far for europium containing lyotropic organized soft materials were thus obtained. Changing the molecular structures of BPS-n with different oxyethylene chains or doped complexes with imidazolium counterions of different alkyl chain lengths, the spacings of lamellar LLC matrixes and position of dispersed complexes became tunable. The measured luminescent and rheological properties for such composite LLCs showed a dependence on the rigidity and isolation capability afforded by sterol molecules. It was also found that the increase of counterion alkyl chain length would weaken the LLC matrix's confinement and isolation effects and therefore exhibit the deteriorated luminescence performance. The enhanced luminescence efficiency and stability of doped BPS-n LLCs reflected the excellent segregation of europium complexes from each other and therefore the reduced self-quenching process. The obtained results here present the designability of LLC matrixes and their great potential to promote achieving the luminescence tunability of soft materials.
Energy Technology Data Exchange (ETDEWEB)
Wang, Dunjia, E-mail: dunjiawang@163.com; Pi, Yan; Zheng, Chunyang; Fan, Ling; Hu, Yanjun; Wei, Xianhong
2013-10-15
Highlights: •Preparation of europium (III) ternary complexes with β-diketone and nitrogen heterocyclic ligands. •Photoluminescence behavior of europium (III) ternary complexes. •Analysis of the Judd–Ofelt intensity parameters (Ω{sub t}), the lifetime (τ) and the luminescent quantum yield (η). -- Abstract: Preparation and photoluminescence behavior of four new europium (III) ternary complexes with β-diketones (1-(6-methoxy-naphthalen-2-yl)-3-phenyl-propane-1,3-dione (MNPPD) and 1-(4-tert-butyl-phenyl)-3-(6-methoxy-naphthalen-2-yl)-propane-1,3-dione (BPMPD)) and 2,2-dipyridine (Bipy) or 1,10-phenanthroline (Phen) were reported, in the solid state. Complexes Eu(MPPD){sub 3}·Bipy, Eu(BMPD){sub 3}·Bipy, Eu(MPPD){sub 3}·Phen and Eu(BMPD){sub 3}·Phen were characterized by elemental analysis, FT-IR, {sup 1}H NMR, UV–vis absorption. The emission spectra show narrow emission bands that arise from the {sup 5}D{sub 0} → {sup 7}F{sub J} (J = 0–4) transitions of the europium ion. Based on the emission spectra and luminescence decay curves in solid state, the intensity parameters (Ω{sub t}), lifetime (τ) and emission quantum efficiency (η) were determined. The Ω{sub 2} values indicate that the Eu(III) ion in these complexes is in a highly polarizable chemical environment. Complexes Eu(MPPD){sub 3}·Bipy and Eu(MPPD){sub 3}·Phen showed a longer lifetime (τ) and a higher luminescence quantum efficiency (η), which indicated that the energy transfer to the europium ion from MNPPD ligand is more efficient than that from BPMPD ligand.
Energy Technology Data Exchange (ETDEWEB)
Bel' tyukova, S.V.; Nazarenko, N.A.; Poluehktov, N.S.
1982-03-01
The complexes of europium and terbium with phenanthroline, ethylenediaminetetraacetate, nitrilotriacetate, some acids-phenol derivatives and ..beta..-diketones series have been used as an example to demonstrate that the value of the ratio of intensities on the two bands of europium(terbium) luminescence spectra - the one corresponding to the hypersensitive'' transition and the other, to the magnetic dipole one - can be used for determination of the complexes composition in solutions.
Energy Technology Data Exchange (ETDEWEB)
Guan Min [State Key Laboratory of Rare Earth Materials Chemistry and Applications, Peking University, Beijing 100871 (China); Gao Lihua [Department of Chemistry, Beijing Normal University, Beijing 100875 (China); Wang Shanshan [State Key Laboratory of Rare Earth Materials Chemistry and Applications, Peking University, Beijing 100871 (China); Huang Chunhui [State Key Laboratory of Rare Earth Materials Chemistry and Applications, Peking University, Beijing 100871 (China)], E-mail: chhuang@pku.edu.cn; Wang Kezhi [Department of Chemistry, Beijing Normal University, Beijing 100875 (China)
2007-12-15
Two europium complexes, Eu(DBM){sub 3}(PBO) and Eu(DBM){sub 3}(PBT) (DBM=dibenzoylmethanato, PBO=2-(2-pyridyl)benzoxazole, PBT=2-(2-pyridyl)benzothiazole), were prepared and used as emitting materials in organic electroluminescent (EL) devices. The devices with the structures ITO/TPD/Eu(DBM){sub 3}(PBO) (or Eu(DBM){sub 3}(PBT)/BCP/Alq{sub 3}/Mg:Ag/Ag emit red light originating from the europium complexes.
21 CFR 146.137 - Frozen orange juice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen orange juice. 146.137 Section 146.137 Food... Beverages § 146.137 Frozen orange juice. (a) Frozen orange juice is orange juice as defined in § 146.135, except that it is frozen. (b) The name of the food is “Frozen orange juice”. Such name may be preceded on...
42 CFR 137.441 - Will there be a hearing?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Will there be a hearing? 137.441 Section 137.441... of A Self-Governance Program § 137.441 Will there be a hearing? Yes, unless the Self-Governance Tribe...) If possible, the hearing will be held at the office of the Self-Governance Tribe. If the hearing is...
Murine immunization by cesium-137 irradiation attenuated Schistosoma mansoni cercariae
Energy Technology Data Exchange (ETDEWEB)
Stek, M. Jr.; Minard, P.; Cruess, D.F.
1984-06-01
Cesium-137, becoming a more readily available ionizing gamma radiation source for laboratory use, was shown to effectively attenuate Schistosoma mansoni cercariae for vaccine production. In parallel comparison studies with the murine model, cesium-137 attenuated cercariae consistently afforded better protection than did the cobalt-60 prepared vaccine. Dose-response data indicated that the optimal total irradiation with cesium-137 was between 45 and 50 Krad.
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFK137 (Link to dictyBase) - - - Contig-U13893-1 AFK137E (Link... Clone ID AFK137 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dict...DIFKSDQTFTLVQRLRSNVIKAGLKKLNTAYSR ISFNDICTKLKFDGTTQDIMFIIAKTIKDGVIDATXNYEGGYLQSRENIDAYSTQEPLHA FSNRIDICLKIHN...fissygdcsi*hknyslsiiiknflll*fil*ndk*ss*s*iniiists ysnikt***rssnny*fiieklfri*fi*tsr*iigqytipricikqsictlfllsr*...LNSSHKQLEKHHKTLLVVSEELFINFYPIVQLLMGEIPERNTFSQKQLKIA LKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKKLNTAYSR ISFNDICT
21 CFR 137.211 - White corn flour.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false White corn flour. 137.211 Section 137.211 Food and... Related Products § 137.211 White corn flour. (a) White corn flour is the food prepared by so grinding and bolting cleaned white corn that when tested by the method prescribed in paragraph (b)(2) of this section...
21 CFR 137.250 - White corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false White corn meal. 137.250 Section 137.250 Food and... Related Products § 137.250 White corn meal. (a) White corn meal is the food prepared by so grinding cleaned white corn that when tested by the method prescribed in paragraph (b)(2) of this section not less...
21 CFR 137.255 - Bolted white corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bolted white corn meal. 137.255 Section 137.255... Flours and Related Products § 137.255 Bolted white corn meal. (a) Bolted white corn meal is the food prepared by so grinding and sifting cleaned white corn that: (1) Its crude fiber content is less than 1.2...
Cesium-137 body burdens in Norwegian Lapps, 1965-1983
Energy Technology Data Exchange (ETDEWEB)
Westerlund, E.A.; Berthelsen, T.; Berteig, L.
1987-02-01
Results of measurements of the whole-body contents of /sup 137/Cs during the period 1965-1983 in Lapps from the Kautokeino area in Norway are reported with measurements of /sup 137/Cs in reindeer meat during the period 1966-1983. By using available data on /sup 137/Cs in precipitation for the period 1950-1980, transfer coefficients from /sup 137/Cs in precipitation to reindeer meat have been assessed. A correlation between the /sup 137/Cs content in reindeer meat and the /sup 137/Cs content in Lapp reindeer breeders has been established. The average whole-body committed dose equivalent, H50, to the reindeer breeders from internally deposited /sup 137/Cs from intakes up to year 2000 was assessed to 13 mSv with a peak value of 30 mSv. In comparison, the corresponding committed dose equivalent to the Norwegian population from internally deposited /sup 137/Cs has been estimated to be about 1 mSv. The higher intake of /sup 137/Cs by reindeer breeders is due to the lichen-reindeer-man exposure pathway.
Energy Technology Data Exchange (ETDEWEB)
Jensen, M.P.; Rickert, P.G.; Schmidt, M.A.; Nash, K.L.
1996-06-01
Even in moderately acidic solutions ([H{sup +}] > 0.01 M), N-piperidinomethane-1,1-diphosphonic acid (H{sub 4}PMDPA) is a strong complexant of trivalent lanthanide ions that shows enhanced complex solubility over previously studied 1,1-diphosphonic acids. The protonation constants of PMDPA in 2.0 M H/NaClO{sub 4} were determined by potentiometric and NMR titrations, and the stability constants for formation of complexes with Eu{sup 3+} were determined by solvent extraction. Difference in protonation equilibria induced by addition of the nitrogen heterocycle results in an increase in the complexation strength of PMDPA. In solutions containing 0.1 M H{sup +} and ligand concentrations greater than 0.02 M, PMDPA is the most effective 1,1-diphosphonic acid for europium complexation studied thus far.
Sorption of Europium in zirconium silicate; Sorcion de Europio en silicato de circonio
Energy Technology Data Exchange (ETDEWEB)
Garcia R, G. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)
2004-07-01
Some minerals have the property of sipping radioactive metals in solution, that it takes advantage to manufacture contention barriers that are placed in the repositories of nuclear wastes. The more recent investigations are focused in the development of new technologies guided to the sorption of alpha emissors on minerals which avoid their dispersion in the environment. In an effort to contribute to the understanding of this type of properties, some studies of sorption of Europium III are presented like homologous of the americium, on the surface of zirconium silicate (ZrSiO{sub 4}). In this work the results of sorption experiences are presented as well as the interpretation of the phenomena of the formation of species in the surface of the zirconium silicate. (Author)
First principles description of the insulator-metal transition in europium monoxide
Wang, Hao
2012-02-01
Europium monoxide, EuO, is a ferromagnetic insulator. Its electronic structure under pressure and doping is investigated by means of density functional theory. We employ spin polarized electronic structure calculations including onsite electron-electron interaction for the localized Eu 4f and 5d electrons. Our results show that under pressure the ferromagnetism is stable, both for hydrostatic and uniaxial pressure, while the compound undergoes an insulator-metal transition. The insulator-metal transition in O deficient and Gd doped EuO is reproduced for an impurity concentration of 6.25%. A 10 monolayer thick EuO(1 0 0) thin film is predicted to be an insulator with a narrow band gap of 0.08 eV. © 2011 Elsevier B.V. All rights reserved.
Development of europium doped BaSO4 TL OSL dual phosphor for radiation dosimetry applications
Patle, Anita; Patil, R. R.; Kulkarni, M. S.; Bhatt, B. C.; Moharil, S. V.
2015-08-01
This paper presents the results on the preparation and characterization of Europium-doped Barium sulfate (BaSO4: Eu) TL /OSL dual phosphor. The OSL sensitivity was found to be 11% of the commercially available Al2O3: C, using area integration method. The sample also shows good TL sensitivity and the dosimetric peak appears around 190°C with a shoulder at 282°C. After OSL readout, No change in the TL glow curve is observed. Since the observed TL peaks are not responsible for the observed OSL, good OSL as well as TL sensitivity and low fading will make this phosphor suitable for applications in radiation dosimetry using OSL as well as TL.
Energy Technology Data Exchange (ETDEWEB)
Kaczmarek, Malgorzata [Department of Rare Earths, Faculty of Chemistry, Adam Mickiewicz University, Grunwaldzka 6, 60 - 780 Poznan (Poland); Lis, Stefan, E-mail: blis@amu.edu.pl [Department of Rare Earths, Faculty of Chemistry, Adam Mickiewicz University, Grunwaldzka 6, 60 - 780 Poznan (Poland)
2009-04-20
A new simple chemiluminescent method for the determination of chlortetracycline (Chlor-TC), oxytetracycline (Oxy-TC) and doxycycline (Doxy-TC) is described. This method is based on the europium(III) emission as a result of the energy transfer process from the excited product of the tetracyclines oxidation to the uncomplexed Eu(III). Under the optimum conditions, calibration graphs were obtained for 4 x 10{sup -7} to 2 x 10{sup -5} mol L{sup -1} of Chlor-TC; 2 x 10{sup -7} to 2 x 10{sup -5} mol L{sup -1} of Oxy-TC and 1 x 10{sup -7} to 3 x 10{sup -5} mol L{sup -1} of Doxy-TC. The method was successfully applied to the determination of these drugs in pharmaceutical and veterinary formulation and honey.
Europium-doped aluminum oxide phosphors as indicators for frontal polymerization dynamics
Energy Technology Data Exchange (ETDEWEB)
Carranza, Arturo; Gewin, Mariah; Pojman, John A., E-mail: japojman@lsu.edu [Department of Chemistry, Louisiana State University, Baton Rouge, Louisiana 70803-1804 (United States)
2014-06-15
In this study, we present an inexpensive and practical method that allows the monitoring and visualization of front polymerization, propagation, and dynamics. Commercially available europium-doped aluminum oxide powders were combined with video imaging to visualize free-radical propagating polymer fronts. In order to demonstrate the applicability of this method, frontal copolymerization reactions of propoxylated glycerin triacrylate (EB53), pentaerythritol triacrylate (PETA), and pentaerythritol tetra-acrylate (PETEA) with 1,1-Bis(tert-butylperoxy)-3,3,5-trimethylcyclohexane (Luperox 231®) as an initiator were studied and compared to the results obtained by IR imaging. Systems exhibiting higher filler loading, higher EB53 content, and less acrylated monomers showed a marked decrease in front velocity, while those with more acrylated monomers and higher crosslinking density showed a marked increase in front velocity. Finally, in order to show the potential of the imaging technique, we studied fronts propagating in planar and spherical geometries.
Europium-doped aluminum oxide phosphors as indicators for frontal polymerization dynamics.
Carranza, Arturo; Gewin, Mariah; Pojman, John A
2014-06-01
In this study, we present an inexpensive and practical method that allows the monitoring and visualization of front polymerization, propagation, and dynamics. Commercially available europium-doped aluminum oxide powders were combined with video imaging to visualize free-radical propagating polymer fronts. In order to demonstrate the applicability of this method, frontal copolymerization reactions of propoxylated glycerin triacrylate (EB53), pentaerythritol triacrylate (PETA), and pentaerythritol tetra-acrylate (PETEA) with 1,1-Bis(tert-butylperoxy)-3,3,5-trimethylcyclohexane (Luperox 231®) as an initiator were studied and compared to the results obtained by IR imaging. Systems exhibiting higher filler loading, higher EB53 content, and less acrylated monomers showed a marked decrease in front velocity, while those with more acrylated monomers and higher crosslinking density showed a marked increase in front velocity. Finally, in order to show the potential of the imaging technique, we studied fronts propagating in planar and spherical geometries.
Electrochemiluminescence Study of Europium (III Complex with Coumarin3-Carboxylic Acid
Directory of Open Access Journals (Sweden)
Stefan Lis
2008-01-01
Full Text Available The europium (III complex of coumarin-3-carboxylic acid (C3CA has been prepared and characterized on the basis of elemental analysis, IR, and emission (photoluminescence and electrochemiluminescence spectroscopy. The synthesised complex having a formula Eu(C3CA2(NO3(H2O2 was photophysically characterized in solution and in the solid state. Electrochemiluminescence, ECL, of the system containing the Eu(III/C3CA complex was studied using an oxide-covered aluminium electrode. The goal of these studies was to show the possibility of the use of electrochemical excitation of the Eu(III ion in aqueous solution for emission generation. The generated ECL emission was very weak, and therefore its measurements and spectral analysis were carried out with the use of cut-off filters method. The studies proved a predominate role of the ligand-to-metal energy transfer (LMET in the generated ECL.
Europium incorporated in silica matrix obtained by sol-gel: luminescent materials
Directory of Open Access Journals (Sweden)
Nassar Eduardo José
2003-01-01
Full Text Available In this work we report some aspects of the chemistry involved in the preparation of modified silicon oxide by the sol-gel process. Europium III compounds were used as luminescent probe. An organic-inorganic hybrid was obtained by hydrolysis of tetraethylorthosilicate (TEOS and 3-aminopropyltriethoxysilane (APTS. The Eu III compounds were added in different ways. In the first, silica was prepared in the presence of Eu III, and in the second, Eu III was added on the silica surface. These materials were studied by luminescence, infrared spectroscopy and termogravimetric analysis. The results obtained for the hybrid material show different behavior for Eu III emission, which could be excited by the antenna effect and the influence of the surrounding in the luminescence quenching. The thermogravimetric data present different mass loss in samples to range temperature 50 - 150 °C. Thermogravimetric and infrared spectra showed that inorganic polymers incorporated the organic part.
Europium as an inhibitor of Amyloid-β(1-42) induced membrane permeation.
Williams, Thomas L; Urbanc, Brigita; Marshall, Karen E; Vadukul, Devkee M; Jenkins, A Toby A; Serpell, Louise C
2015-10-24
Soluble Amyloid-beta (Aβ) oligomers are a source of cytotoxicity in Alzheimer's disease (AD). The toxicity of Aβ oligomers may arise from their ability to interact with and disrupt cellular membranes mediated by GM1 ganglioside receptors within these membranes. Therefore, inhibition of Aβ-membrane interactions could provide a means of preventing the toxicity associated with Aβ. Here, using Surface Plasmon field-enhanced Fluorescence Spectroscopy, we determine that the lanthanide, Europium III chloride (Eu(3+)), strongly binds to GM1 ganglioside-containing membranes and prevents the interaction with Aβ42 leading to a loss of the peptides ability to cause membrane permeation. Here we discuss the molecular mechanism by which Eu(3+) inhibits Aβ42-membrane interactions and this may lead to protection of membrane integrity against Aβ42 induced toxicity. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.
Radiation effects on beta /10.6/ of pure and europium doped KCl
Grimes, H. H.; Maisel, J. E.; Hartford, R. H.
1975-01-01
Changes in the optical absorption coefficient as the result of X-ray and electron bombardment of pure monocrystalline and polycrystalline KCl and of divalent europium doped polycrystalline KCl were determined. A constant heat flow calorimetric method was used to measure the optical absorption coefficients. Both 300 kV X-ray irradiation and 2 MeV electron irradiation produced increases in the optical absorption coefficient at room temperature. X-ray irradiation produced more significant changes in pure monocrystalline KCl than equivalent amounts of electron irradiation. Electron irradiation of pure and Eu-doped polycrystalline KCl produced increases in the absorption by as much as a factor of 20 over untreated material. Bleaching of the electron-irradiated doped KCl with 649 millimicron light produced a further increase.
Excitation functions for the formation of longer lived isotopes by deuteron irradiation of Europium
Energy Technology Data Exchange (ETDEWEB)
Takács, S., E-mail: stakacs@atomki.hu [Institute for Nuclear Research, Hungarian Academy of Sciences, 4026 Debrecen (Hungary); Tárkányi, F. [Institute for Nuclear Research, Hungarian Academy of Sciences, 4026 Debrecen (Hungary); Hermanne, A.; Adam-Rebeles, R. [Cyclotron Laboratory, Vrije Universiteit Brussel, Brussels 1090 (Belgium); Takács, M.P. [Institute for Nuclear Research, Hungarian Academy of Sciences, 4026 Debrecen (Hungary); Institute of Physics, University of Debrecen, 4026 Debrecen (Hungary)
2013-09-01
Excitation functions for nuclear reactions induced on natural europium targets by energetic deuterons were studied up to 50 MeV. A standard stacked foil technique was used for irradiation and high resolution gamma spectrometry was applied for activity assessment. Direct or cumulative cross sections for reaction products with half-life longer than 2 h were determined. Reactions leading to the formation of the radionuclides {sup 147,149,151,153}Gd, {sup 147,148,149,150m,150g,152m,152g,154g}Eu, {sup 153}Sm and {sup 150}Pm were studied. In most cases no earlier data were available in the literature. The new experimental results were compared with values tabulated in the on-line TENDL2011 library.
Quadrupole splitting and Eu partial lattice dynamics in europium orthophosphate EuPO {sub 4}
Energy Technology Data Exchange (ETDEWEB)
Klobes, B., E-mail: b.klobes@fz-juelich.de [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany); Arinicheva, Y., E-mail: y.arinicheva@fz-juelich.de; Neumeier, S., E-mail: s.neumeier@fz-juelich.de [Forschungszentrum Jülich GmbH, Institute of Energy and Climate Research (IEK-6) Nuclear Waste Management and Reactor Safety (Germany); Simon, R. E., E-mail: r.simon@fz-juelich.de; Jafari, A., E-mail: a.jafari@fz-juelich.de [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany); Bosbach, D., E-mail: d.bosbach@fz-juelich.de [Forschungszentrum Jülich GmbH, Institute of Energy and Climate Research (IEK-6) Nuclear Waste Management and Reactor Safety (Germany); Hermann, R. P., E-mail: hermannrp@ornl.gov [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany)
2016-12-15
Hyperfine interactions in europium orthophosphate EuPO{sub 4} were investigated using {sup 151}Eu Mössbauer spectroscopy from 6 to 300 K. The value of the quadrupole splitting and the asymmetry parameter were refined and further substantiated by nuclear forward scattering data obtained at room temperature. The temperature dependence of the relative absorption was modeled with an Eu specific Debye temperature of 221(1) K. Eu partial lattice dynamics were probed by means of nuclear inelastic scattering and the mean force constant, the Lamb-Mössbauer factor, the internal energy, the vibrational entropy, the average phonon group velocity were calculated using the extracted density of phonon states. In general, Eu specific vibrations are characterized by rather small phonon energies and contribute strongly to the total entropy of the system. Although there is no classical Debye like behavior at low vibrational energies, the average phonon group velocity can be reasonably approximated using a linear fit.
Energy Technology Data Exchange (ETDEWEB)
Lima, E. [Centro de Quimica, Universidade do Minho, Gualtar, 4710-057 Braga (Portugal); Raphael, E.; Sentanin, F. [IQSC, Universidade de Sao Paulo, 13566-590 Sao Carlos, SP (Brazil); Rodrigues, L.C. [Centro de Quimica, Universidade do Minho, Gualtar, 4710-057 Braga (Portugal); Ferreira, R.A.S.; Carlos, L.D. [Departamento de Fisica, CICECO, Universidade de Aveiro, 3810-193 Aveiro (Portugal); Silva, M.M., E-mail: nini@quimica.uminho.pt [Centro de Quimica, Universidade do Minho, Gualtar, 4710-057 Braga (Portugal); Pawlicka, A. [IQSC, Universidade de Sao Paulo, 13566-590 Sao Carlos, SP (Brazil)
2012-04-15
Highlights: Black-Right-Pointing-Pointer We prepared ionic conducting membranes for the specific requirements of the device. Black-Right-Pointing-Pointer Luminescent reporter groups, with many applications in biotechnology. Black-Right-Pointing-Pointer Thermal and electrochemical stability of electrolytes is adequate for application. - Abstract: Dispersion of photoluminescent rare earth metal complexes in polymer matrices is of great interest due to the possibility of avoiding the saturation of the photoluminescent signal. The possibility of using a natural ionic conducting polymer matrix was investigated in this study. Samples of agar-based electrolytes containing europium picrate were prepared and characterized by physical and chemical analyses. The FTIR spectra indicated strong interaction of agar O-H and 3,6-anhydro-galactose C-O groups with glycerol and europium picrate. The DSC analyses revealed no glass transition temperature of the samples in the -60 to 250 Degree-Sign C range. From the thermogravimetry (TG), a thermal stability of the samples of up to 180 Degree-Sign C was stated. The membranes were subjected to ionic conductivity measurement, which provided the values of 2.6 Multiplication-Sign 10{sup -6} S/cm for the samples with acetic acid and 1.6 Multiplication-Sign 10{sup -5} S/cm for the samples without acetic acid. Moreover, the temperature-dependent ionic conductivity measurements revealed both Arrhenius and VTF models of the conductivity depending on the sample. Surface visualization through scanning electron microscopy (SEM) demonstrated good uniformity. The samples were also applied in small electrochromic devices and showed good electrochemical stability. The present work confirmed that these materials may perform as satisfactory multifunctional component layers in the field of electrochemical devices.
Energy Technology Data Exchange (ETDEWEB)
Hegde, Vinod; Wagh, Akshatha; Kamath, Sudha D. [Manipal University, Department of Physics, Manipal Institute of Technology, Manipal (India); Hegde, Hemanth [Manipal University, Department of Chemistry, Manipal Institute of Technology, Manipal (India); Vishwanath, C.S.D. [Sri Venkateswara University, Department of Physics, Tirupati (India)
2017-05-15
The present study explores a new borate family glasses based on 10ZnO-5Na{sub 2}O-10Bi{sub 2}O{sub 3}-(75 - x) B{sub 2}O{sub 3}-xEu{sub 2}O{sub 3} (x = 0, 0.1, 0.5, 1, 1.5, 2, 3 mol%) composition, synthesized by rapid melt quench technique. Prepared glasses were subjected to the density and refractive index measurements and their values were used to calculate other physical properties of the glass matrix as a function of Eu{sup 3+} concentration. XRD confirmed amorphous nature of the glasses. FTIR spectra in the absorption mode were recorded in the 400-4000 cm{sup -1} region to identify different functional groups in the glass matrix. Deconvoluted FTIR spectra showed increase in BO{sub 4} units with rise in europium content which confirmed the 'network strengthener' role of europium ions by creating bridging oxygens (BOs). Optical properties were investigated for their luminescence behavior through various spectroscopic techniques such as UV-Vis-NIR absorption, excitation, emission, decay profiles, and color measurements at room temperature. Lasing properties of the glasses like total radiative life time, branching ratio, emission cross section, and optical gain were obtained from the calculated Judd-Ofelt (Ω{sub 2},Ω{sub 4}) intensity parameters. From the measured values of emission, cross sections, branching ratios, life times, strong photoluminescence features, and CIE chromaticity coordinates, 0.5 mol% of Eu{sup 3+} ions doped ZnNaBiB glasses showed optimum performance and are potential candidate for red light generation at 613 nm. (orig.)
Europium nanoparticle-based high performing immunoassay for the screening of treponemal antibodies.
Directory of Open Access Journals (Sweden)
Sheikh M Talha
Full Text Available Treponema pallidum subspecies pallidum (Tp is the causative agent of syphilis which mainly spreads through sexual contact, blood transfusion and perinatal route. In order to curtail the spread of the infection and to clinically manage the disease, timely, accurate and reliable diagnosis is very important. We have developed an immunoassay for the detection of treponemal antibodies in human serum or plasma samples. In vivo biotinylated and non-biotinylated versions of the recombinant antigen were designed by the fusion of three Tp-specific antigens namely Tp15, Tp17 and Tp47. These fusion antigens were expressed in E. coli and purified using single-step metal affinity chromatography. Biotinylated fusion antigen immobilized on streptavidin coated plate was used to capture the treponemal antibodies and the non-biotinylated antigen coated on europium nanoparticles was used as tracer. Assays with two different incubation times of 10 min and 1 h were developed, and following the incubation the europium fluorescence was measured using time-resolved fluorometry. The developed time-resolved fluorometric (TRF immunoassays were evaluated with in-house and commercial serum/plasma sample panels. For well-established treponemal antibodies positive or negative samples, the sensitivity of TRF immunoassay with 10 min incubation time was 97.4%, and of TRF immunoassay with 1 h incubation time was 98.7%, and the specificities of both the TRF immunoassays were 99.2%. For the samples with discordant results with the reference assays, both the TRF immunoassays showed better specificity than the Enzygnost syphilis enzyme immunoassay as a screening test. The two different incubation times did not have any significant effect on the signal to cutoff (S/Co ratios obtained with the two immunoassays (p=0.06. Our results indicate that the developed immunoassay with a short incubation time of 10 min has the potential to be used in clinical laboratories and in blood
Visible-light-excited and europium-emissive nanoparticles for highly-luminescent bioimaging in vivo.
Wu, Yongquan; Shi, Mei; Zhao, Lingzhi; Feng, Wei; Li, Fuyou; Huang, Chunhui
2014-07-01
Europium(III)-based material showing special milliseconds photoluminescence lifetime has been considered as an ideal time-gated luminescence probe for bioimaging, but is still limited in application in luminescent small-animal bioimaging in vivo. Here, a water-soluble, stable, highly-luminescent nanosystem, Ir-Eu-MSN (MSN = mesoporous silica nanoparticles, Ir-Eu = [Ir(dfppy)2(pic-OH)]3Eu·2H2O, dfppy = 2-(2,4-difluorophenyl)pyridine, pic-OH = 3-hydroxy-2-carboxypyridine), was developed by an in situ coordination reaction to form an insoluble dinuclear iridium(III) complex-sensitized-europium(III) emissive complex within mesoporous silica nanoparticles (MSNs) which had high loading efficiency. Compared with the usual approach of physical adsorption, this in-situ reaction strategy provided 20-fold the loading efficiency (43.2%) of the insoluble Ir-Eu complex in MSNs. These nanoparticles in solid state showed bright red luminescence with high quantum yield of 55.2%, and the excitation window extended up to 470 nm. These Ir-Eu-MSN nanoparticles were used for luminescence imaging in living cells under excitation at 458 nm with confocal microscopy, which was confirmed by flow cytometry. Furthermore, the Ir-Eu-MSN nanoparticles were successfully applied into high-contrast luminescent lymphatic imaging in vivo under low power density excitation of 5 mW cm(-2). This synthetic method provides a universal strategy of combining hydrophobic complexes with hydrophilic MSNs for in vivo bioimaging. Copyright © 2014 Elsevier Ltd. All rights reserved.
Europium Nanoparticle-Based High Performing Immunoassay for the Screening of Treponemal Antibodies
Talha, Sheikh M.; Hytönen, Jukka; Westhorpe, Adam; Kumar, Sushil; Khanna, Navin; Pettersson, Kim
2013-01-01
Treponema pallidum subspecies pallidum (Tp) is the causative agent of syphilis which mainly spreads through sexual contact, blood transfusion and perinatal route. In order to curtail the spread of the infection and to clinically manage the disease, timely, accurate and reliable diagnosis is very important. We have developed an immunoassay for the detection of treponemal antibodies in human serum or plasma samples. In vivo biotinylated and non-biotinylated versions of the recombinant antigen were designed by the fusion of three Tp-specific antigens namely Tp15, Tp17 and Tp47. These fusion antigens were expressed in E. coli and purified using single-step metal affinity chromatography. Biotinylated fusion antigen immobilized on streptavidin coated plate was used to capture the treponemal antibodies and the non-biotinylated antigen coated on europium nanoparticles was used as tracer. Assays with two different incubation times of 10 min and 1 h were developed, and following the incubation the europium fluorescence was measured using time-resolved fluorometry. The developed time-resolved fluorometric (TRF) immunoassays were evaluated with in-house and commercial serum/plasma sample panels. For well-established treponemal antibodies positive or negative samples, the sensitivity of TRF immunoassay with 10 min incubation time was 97.4%, and of TRF immunoassay with 1 h incubation time was 98.7%, and the specificities of both the TRF immunoassays were 99.2%. For the samples with discordant results with the reference assays, both the TRF immunoassays showed better specificity than the Enzygnost syphilis enzyme immunoassay as a screening test. The two different incubation times did not have any significant effect on the signal to cutoff (S/Co) ratios obtained with the two immunoassays (p = 0.06). Our results indicate that the developed immunoassay with a short incubation time of 10 min has the potential to be used in clinical laboratories and in blood-bank settings as a
Zhang, Jixi; Prabhakar, Neeraj; Näreoja, Tuomas; Rosenholm, Jessica M
2014-01-01
Immobilization of lanthanide organic complexes in meso-organized hybrid materials for luminescence applications have attracted immense interest due to the possibility of controlled segregation at the nanoscopic level for novel optical properties. Aimed at enhancing the luminescence intensity and stability of the hybrid materials in aqueous media, we developed polyvinylpyrrolidone (PVP) stabilized, semiconducting polymer (poly(9-vinylcarbazole), PVK) encapsulated mesoporous silica hybrid particles grafted with Europium(III) complexes. Monosilylated β-diketonate ligands (1-(2-naphthoyl)-3,3,3-trifluoroacetonate, NTA) were first co-condensed in the mesoporous silica particles as pendent groups for bridging and anchoring the lanthanide complexes, resulting in particles with an mean diameter of ∼ 450 nm and a bimodal pore size distribution centered at 3.5 and 5.3 nm. PVK was encapsulated on the resulted particles by a solvent-induced surface precipitation process, in order to seal the mesopores and protect Europium ions from luminescence quenching by producing a hydrophobic environment. The obtained polymer encapsulated MSN-EuLC@PVK-PVP particles exhibit significantly higher intrinsic quantum yield (Φ(Ln) = 39%) and longer lifetime (τ(obs) = 0.51 ms), as compared with those without polymer encapsulation. Most importantly, a high luminescence stability was realized when MSN-EuLC@PVK-PVP particles were dispersed in various aqueous media, showing no noticeable quenching effect. The beneficial features and positive attributes of both mesoporous silica and semiconducting polymers as lanthanide-complex host were merged in a single hybrid carrier, opening up the possibility of using these hybrid luminescent materials under complex aqueous conditions such as biological/physiological environments.
Zdunek, Jolanta; Benito-Peña, Elena; Linares, Ana; Falcimaigne-Cordin, Aude; Orellana, Guillermo; Haupt, Karsten; Moreno-Bondi, María C
2013-07-29
The development and characterization of novel, molecularly imprinted polymer nanofilament-based optical sensors for the analysis of enrofloxacin, an antibiotic widely used for human and veterinary applications, is reported. The polymers were prepared by nanomolding in porous alumina by using enrofloxacin as the template. The antibiotic was covalently immobilized on to the pore walls of the alumina by using different spacers, and the prepolymerization mixture was cast in the pores and the polymer synthesized anchored onto a glass support through UV polymerization. Various parameters affecting polymer selectivity were evaluated to achieve optimal recognition, namely, the spacer arm length and the binding solvent. The results of morphological characterization, binding kinetics, and selectivity of the optimized polymer material for ENR and its derivatives are reported. For sensing purposes, the nanofilaments were incubated in solutions of the target molecule in acetonitrile/HEPES buffer (100 mM, pH 7.5, 50:50, v/v) for 20 min followed by incubation in a 10 mM solution of europium(III) ions to generate a europium(III)-enrofloxacin complex on the polymer surface. The detection event was based on the luminescence of the rare-earth ion (λexc=340 nm; λem=612 nm) that results from energy transfer from the antibiotic excited state to the metal-ion emitting excited state. The limit of detection of the enrofloxacin antibiotic was found to be 0.58 μM. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Faster Synthesis of Beta-Diketonate Ternary Europium Complexes: Elapsed Times & Reaction Yields.
Lima, Nathalia B D; Silva, Anderson I S; Gerson, P C; Gonçalves, Simone M C; Simas, Alfredo M
2015-01-01
β-diketonates are customary bidentate ligands in highly luminescent ternary europium complexes, such as Eu(β-diketonate)3(L)2, where L stands for a nonionic ligand. Usually, the syntheses of these complexes start by adding, to an europium salt such as EuCl3(H2O)6, three equivalents of β-diketonate ligands to form the complexes Eu(β-diketonate)3(H2O)2. The nonionic ligands are subsequently added to form the target complexes Eu(β-diketonate)3(L)2. However, the Eu(β-diketonate)3(H2O)2 intermediates are frequently both difficult and slow to purify by recrystallization, a step which usually takes a long time, varying from days to several weeks, depending on the chosen β-diketonate. In this article, we advance a novel synthetic technique which does not use Eu(β-diketonate)3(H2O)2 as an intermediate. Instead, we start by adding 4 equivalents of a monodentate nonionic ligand L straight to EuCl3(H2O)6 to form a new intermediate: EuCl3(L)4(H2O)n, with n being either 3 or 4. The advantage is that these intermediates can now be easily, quickly, and efficiently purified. The β-diketonates are then carefully added to this intermediate to form the target complexes Eu(β-diketonate)3(L)2. For the cases studied, the 20-day average elapsed time reduced to 10 days for the faster synthesis, together with an improvement in the overall yield from 42% to 69%.
Energy Technology Data Exchange (ETDEWEB)
Aziz, Siti Maisarah; Sahar, M.R., E-mail: mrahim057@gmail.com; Ghoshal, S.K.
2017-02-01
This paper reports the modified optical and magnetic properties of europium (Eu{sup 3+}) ions doped and Manganese nanoparticles (NPs) embedded Magnesium Borotellurite glass synthesized via melt quenching method. The influence of varying Mn NPs concentrations on the magnetic, absorption and emission properties of such glass samples are determined. Stables, transparent and amorphous glasses are obtained. The observed modification of the electronic polarizability is interpreted in terms of the generation of non-bridging oxygen (NBO) and bridging oxygen (BO) in the amorphous network. TEM images manifested the growth of Mn NPs with average diameter 11±1 nm. High-resolution TEM reveals that the lattice spacing of manganese nanoparticles is 0.308 nm at (112) plane. The emission spectra revealed four prominent peaks centered at 587 nm, 610 nm, 651 nm and 700 nm assigned to the transition from {sup 5}D{sub 0} →{sup 7}F{sub J} (J=1, 2, 3, 4) states of Eu{sup 3+} ion. A significant drop in the luminescence intensity due to the incorporation of Mn NPs is ascribed to the enhanced energy transfer from the Eu{sup 3+} ion to NPs. Prepared glass systems exhibited paramagnetic behavior. - Highlights: • The europium doped magnesium borotellurite glasses embedded Mn NPs prepared using the conventional melt-quenching method. • The TEM result reveals the size of Mn NPs while its planar spacing has been determined by HRTEM. • The luminescence properties of TeO{sub 2}–B{sub 2}O{sub 3}–MgO–Eu{sub 2}O{sub 3}–Mn{sub 3}O{sub 4} glasses have been investigated as effect of Mn NPs content. • The magnetization measurement of glass sample is carried out using vibrating sample magnetometer (VSM)
50 CFR 86.137 - What variables should I consider?
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What variables should I consider? 86.137...) PROGRAM How States Will Complete the State Program Plans § 86.137 What variables should I consider? You should consider the following variables: (a) Location of population centers, (b) Boat-based recreation...
14 CFR 1260.137 - Property trust relationship.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Property trust relationship. 1260.137 Section 1260.137 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION GRANTS AND... Property trust relationship. Real property, equipment, intangible property and debt instruments that are...
Accumulation and distribution 137Сs in predators’ organism
Directory of Open Access Journals (Sweden)
A. V. Gulakov
2007-10-01
Full Text Available Data of the long-term research of accumulation and distribution 137Cs radionuclide in organisms of predatory wild animals from the alienation zone of the Chernobyl nuclear power station are presented. Essential fluctuations of the 137Cs contents in muscular tissue are noted. The results have large practical value for management of the hunting facilities on the radioactively polluted territories.
33 CFR 137.33 - General all appropriate inquiries requirements.
2010-07-01
... SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY.... See § 137.60. (4) Visual inspections of the facility, the real property on which the facility is..., tribal, and local government records. See § 137.60. (iv) Visual inspections of the facility, the real...
21 CFR 133.137 - Washed curd cheese for manufacturing.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Washed curd cheese for manufacturing. 133.137... Standardized Cheese and Related Products § 133.137 Washed curd cheese for manufacturing. Washed curd cheese for manufacturing conforms to the definition and standard of identity prescribed for washed curd cheese by § 133.136...
49 CFR 229.137 - Sanitation, general requirements.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Sanitation, general requirements. 229.137 Section... Cab Equipment § 229.137 Sanitation, general requirements. (a) Sanitation compartment. Except as provided in paragraph (b) of this section, all lead locomotives in use shall be equipped with a sanitation...
11 CFR 100.137 - Invitations, food, and beverages.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Invitations, food, and beverages. 100.137...) Exceptions to Expenditures § 100.137 Invitations, food, and beverages. The cost of invitations, food, and... invitations, food and beverages provided by the individual on behalf of the candidate does not exceed $1,000...
Is 137Cs Dating Becoming Obsolete in North America?
Drexler, J. Z.; Fuller, C.; Salas, A.
2016-12-01
Dating of wetland sediments and peat is routinely carried out using 137Cs and 210Pb analysis. Unlike 210Pb, 137Cs is an anthropogenic radionuclide with a history of fallout from nuclear weapons testing. 137Cs is used as a single time marker; its peak is coincident with the height of atmospheric nuclear testing in 1963/4. During its use in the 1970s-90s, 137Cs peaks were usually highly distinct in wetland sediments (e.g., see 137Cs peaks from Louisiana marshes in Feijtel et al., 1988). This enabled its use as a check for dates assigned to a profile by 210Pb and other methods. However, recently, the efficacy of 137Cs dating in North America has deteriorated. In this presentation, we will provide specific examples of 137Cs as well as 210Pb dating in wetland sediments/peats we collected between 2005 and 2015 in Maine, California, Virginia, North Carolina, South Carolina, and Washington. Two main reasons exist for this decline. First, 137Cs activities in our recent cores are 30-40 % of the original activities in 1963/4 due to decay of the original 137Cs in situ (half-life = 30.17 years) and no major new sources. This manifests in lower signal to noise ratio, with some peaks barely recognizable above the noise. Second, 137Cs peaks are much less distinct due to 137Cs migration through time independent of substrate (or sediment) particles. Migration of peaks has resulted in estimated accretion rates being systematically lower or higher than those derived from 210Pb dating. These issues with 137Cs dating have important implications because 137Cs is used with 210Pb dating or even alone to determine rates of recent wetland carbon accumulation. Such rates are required to enter wetland restoration projects into carbon markets and to document IPCC mandated reductions in carbon pollution. Our analysis shows that, although dating by 137Cs alone has always been highly tenuous, now it is especially contraindicated and should be disallowed for the purposes of carbon accounting.
Antuzevics, A.; Kemere, M.; Krieke, G.; Ignatans, R.
2017-10-01
Different compositions of europium doped aluminosilicate oxyfluoride glass ceramics prepared in air atmosphere have been studied by electron paramagnetic resonance (EPR) and optical spectroscopy methods. X-ray diffraction (XRD) and transmission electron microscopy (TEM) measurements show presence of homogenously distributed SrF2 nanocrystals after the heat treatment of the precursor glass. Efficient Eu3+ incorporation in the high symmetry environment of glass ceramics is observed from the photoluminescence spectra. EPR spectra indicate Eu3+ → Eu2+ reduction upon precipitation of crystalline phases in the glass matrix. For composition abundant with Eu2+ in the glassy state such behaviour is not detected. Local structure around europium ions is discussed based on differences in chemical compositions.
Delbianco, Martina; Sadovnikova, Victoria; Bourrier, Emmanuel; Mathis, Gérard; Lamarque, Laurent; Zwier, Jurriaan M; Parker, David
2014-09-26
Luminescent europium complexes are used in a broad range of applications as a result of their particular emissive properties. The synthesis and application of bright, highly water-soluble, and negatively charged sulfonic- or carboxylic acid derivatives of para-substituted aryl-alkynyl triazacyclononane complexes are described. Introduction of the charged solubilizing moieties suppresses cellular uptake or adsorption to living cells making them applicable for labeling and performing assays on membrane receptors. These europium complexes are applied to monitor fluorescent ligand binding on cell-surface proteins with time-resolved Förster resonance energy transfer (TR-FRET) assays in plate-based format and using TR-FRET microscopy. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Optical and spectral studies on pure and europium doped olgite type Na(Sr,Ba)PO4 ceramics.
Jawaher, K Rackesh; Jagannathan, R; Das, S Jerome; Krishnan, S
2015-04-05
Europium ion doped olgite type Na(Sr,Ba)PO4 ceramics, a new generation of light emitting bulb, was prepared by a high temperature solid-state reaction method. The synthesized materials were subjected to various characterizations such as X-ray powder diffraction, Scanning electron microscopy and FT-IR spectra measurements. The EPR spectrum of the sample exhibits a well-resolved hyperfine structure of 151Eu2+ and 153Eu2+ isotopes and the g value has been calculated. Fluorescence spectra revealed that europium ions were present in divalent as well as in the trivalent oxidation states. The critical distance for energy transfer between Eu2+ and Eu2+ ion is calculated as 20Å, which is in good agreement with that of experimental data. The FTIR analysis reveals all the vibrations of PO4(3-) ions. Copyright © 2015 Elsevier B.V. All rights reserved.
{sup 137}Cs accumulation in coastal sediments in Sweden
Energy Technology Data Exchange (ETDEWEB)
Pettersson, H.B.L.; Salih, I. [Linkoeping Univ. (Sweden). Dept. of Radiation Physics; Herrmann, J. [Federal Maritime and Hydrographic Agency, Hamburg (Germany)
2005-09-15
Seabed sediment samples were collected in 1998, 2000 and 2001 at 20 sites located in the Baltic Sea and 4 sites in the Skagerrak. The objectives of the sampling campaigns were (i) to establish the coastal sediment distribution of {sup 137}Cs, (ii) to evaluate the vertical core distribution of {sup 137}Cs, (iii) to study the sediment accumulation rates, and (iv) to assess the sediment inventories of {sup 137}Cs. The results show a very high variation in {sup 137}Cs concentrations and an almost 100-fold difference in inventories, showing predominance of Chernobyl derived {sup 137}Cs in the Baltic Proper compared to the western Baltic and the Skagerrak areas. Sediment accumulation rates were highly dependent on sediment types and ranged from 0.05 to 1.8 cm/y.
Zhang, Panhe; Vemula, Sai Vikram; Zhao, Jiangqin; Du, Bingchen; Mohan, Haleyurgirisetty; Liu, Jikun; El Mubarak, Haja Sittana; Landry, Marie L; Hewlett, Indira
2014-12-01
We report the development of a novel europium nanoparticle-based immunoassay (ENIA) for rapid detection of influenza A and influenza B viruses. The ENIA demonstrated sensitivities of 90.7% (147/162) for influenza A viruses and 81.80% (9/11) for influenza B viruses compared to those for an in-house reverse transcription (RT)-PCR assay in testing of influenza-positive clinical samples. Copyright © 2014, American Society for Microbiology. All Rights Reserved.
Sun, Wei; Yu, Jiangbo; Deng, Ruiping; Rong, Yu; Fujimoto, Bryant; Wu, Changfeng; Zhang, Hongjie; Chiu, Daniel T
2013-10-18
Bright dots: Semiconducting polymer dots (Pdots) doped with europium complexes possess line-like fluorescence emission, high quantum yield, and long fluorescence lifetime. The Pdots successfully labeled receptors on cells. The long fluorescence lifetime of the Pdots was used to distinguish them from other red fluorescence emitting nanoparticles, and improve the signal-to-noise ratio for time-gated cellular imaging. PVK=poly(9-vinylcarbazole). Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Creutzenberg, Otto; Kock, Heiko; Schaudien, Dirk
2016-03-01
Nanoscaled europium oxide (Eu2O3) particles were inhaled by rats after acute exposure and the potential translocation of particles followed by chemical analysis and transmission electron microscopy (TEM) was investigated. An aqueous dispersion (phosphate buffer/bovine serum albumin) of a commercially available Eu2O3 particle fraction consisting partially of nanoscaled particles was aerosolized with pressurized air. After rapid evaporation, rats inhaled the dry aerosol for 6 h in a single exposure resulting in an alveolar calculated dose of approximately 39.5 μg Eu2O3. Using chemical analysis, 36.8 μg Eu2O3 was detected 1 h after lung inhalation. The amount declined slightly to 34.5 μg after 1 day and 35.0 μg after 5 days. The liver showed an increase of Eu2O3 from 32.3 ng 1 h up to 294 ng 5 days after inhalation. Additionally, lung-associated lymph nodes, thymus, kidneys, heart and testis exhibited an increase of europium over the period investigated. In the blood, the highest amount of europium was found 1 h after treatment whereas feces, urine and mesenteric lymph nodes revealed the highest amount 1 day after treatment. Using TEM analysis, particles could be detected only in lungs, and in the liver, no particles were detectable. In conclusion, the translocation of Eu2O3 within 5 days following inhalation could be determined very precisely by chemical analysis. A translocation of Eu2O3 particulate matter to liver was not detectable by TEM analysis; thus, the overproportional level of 0.8% of the lung load observed in the liver after 5 days suggests a filtering effect of dissolved europium with accumulation. Copyright © 2015 John Wiley & Sons, Ltd.
Zhang, Panhe; Zhao, Jiangqin; Du, Bingchen; Mohan, Haleyurgirisetty; Liu, Jikun; El Mubarak, Haja Sittana; Landry, Marie L.
2014-01-01
We report the development of a novel europium nanoparticle-based immunoassay (ENIA) for rapid detection of influenza A and influenza B viruses. The ENIA demonstrated sensitivities of 90.7% (147/162) for influenza A viruses and 81.80% (9/11) for influenza B viruses compared to those for an in-house reverse transcription (RT)-PCR assay in testing of influenza-positive clinical samples. PMID:25297327
Davydov, S Y
2002-01-01
The nature of the electron-stimulated desorption (ESD) of the europium atoms by the E sub e irradiating electrons energies, equal to 50 and 80 eV, as well as peculiarities of the Eu atoms yield dependence on their concentration on the oxidized tungsten surface are discussed. It is shown, that the ESD originates by the electron transition from the interval 5p- or 5s shell of the tungsten surface atom onto the oxygen external unfilled 2p-level
Carron, Sophie; Bloemen, Maarten; Vander Elst, Luce; Laurent, Sophie; Verbiest, Thierry; Parac-Vogt, Tatjana N
2016-03-18
A new prototype consisting of ultrasmall superparamagnetic iron oxide (USPIO) nanoparticles decorated with europium(III) ions encapsulated in a DO3A organic scaffold was designed as a platform for further development of bimodal contrast agents for MRI and optical imaging. The USPIO nanoparticles act as negative MRI contrast agents, whereas the europium(III) ion is a luminophore that is suitable for use in optical imaging detection. The functionalized USPIO nanoparticles were characterized by TEM, DLS, XRD, FTIR, and TXRF analysis, and a full investigation of the relaxometric and optical properties was conducted. The typical luminescence emission of europium(III) was observed and the main red emission wavelength was found at 614 nm. The relaxometric study of these ultrasmall nanoparticles showed r2 values of 114.8 mM(-1) Fes(-1) at 60 MHz, which is nearly double the r2 relaxivity of Sinerem(®). © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
George, T M; Krishna, Mahesh S; Reddy, M L P
2016-11-22
Herein, we report a novel lysosome targetable luminescent bioprobe derived from a europium coordination compound, namely Eu(pfphOCH3IN)3(DDXPO) 4 [where HpfphOCH3IN = 4,4,5,5,5-pentafluoro-3-hydroxy-1-(1-(4-methoxyphenyl)-1H-indol-3-yl)pent-2-en-1-one and DDXPO = 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene oxide]. Notably, the newly designed europium complex exhibits significant quantum yield (Φoverall = 25 ± 3%) and 5D0 excited state lifetime (τ = 398 ± 3 μs) values under physiological pH (7.2) conditions when excited at 405 nm. Hence the developed europium complex has been evaluated for live cell imaging applications using mouse pre-adipocyte cell lines (3T3L1). Colocalization studies of the designed bio-probe with commercial Lysosome-GFP in 3T3L1 cells demonstrated the specific localization of the probe in the lysosome with a high colocalization coefficient (A = 0.83). Most importantly, the developed bioprobe exhibits good cell permeability, photostability and non-cytotoxicity.
Pfau, C; Paßlick, C; Gray, S K; Johnson, J A; Johnson, C E; Schweizer, S
2013-05-22
Eu(2+)-doped fluorochlorozirconate (FCZ) glasses and glass ceramics, which are being developed for medical and photovoltaic applications, have been analysed by Mössbauer spectroscopy. The oxidation state and chemical environment of the europium ions, which are important for the performance of these materials, were investigated. Routes for maximizing the divalent europium content were also investigated. By using EuCl2 instead of EuF2 in the starting material a fraction of about 90% of the europium was maintained in the Eu(2+) state as opposed to about 70% when using EuF2. The glass ceramics produced by subsequent thermal processing contain BaCl2 nanocrystals in which Eu(2+) is incorporated, as shown by the narrower linewidth in the Mössbauer spectrum. Debye temperatures of 147 K and 186 K for Eu(2+) and Eu(3+), respectively, were determined from temperature dependent Mössbauer measurements. The f-factors were used to obtain the Eu(2+)/Eu(3+) ratio from the area ratio of the corresponding absorption lines.
Sources of 137Cs to an Arctic fjord (Hornsund, Svalbard).
Zaborska, Agata
2017-12-01
Although primary sources of anthropogenic 137Cs have decreased nowadays, the Arctic is exposed to a variety of secondary sources. These include riverine run-off, oceanic currents, drifting sea ice, melting glaciers and permafrost. Recent reports underline the role of glaciers, specifically cryoconite holes, in radionuclide accumulation. Therefore, this study investigates the hypothesis that melting glaciers are an important means of delivering 137Cs for Arctic fjord (Hornsund, Svalbard). As marine sediments are the final sink for most contaminants, seven 30-40 cm long sediment cores collected in 2016 were investigated for 137Cs activity concentration. Five were collected in a transect from the central to the outer part of the fjord while two were collected within one km of the different melting tidewater glaciers. Sediment layers were dated using 210Pb to reveal the history of 137Cs accumulation. The measured 137Cs activity concentrations ranged from <0.1 to 7.7 Bq kg-1. The activity concentrations ranging from 0.3 to 3.1 Bq kg-1 were measured in surface (0-2 cm) sediments. The total 137Cs inventories were calculated for five station and ranged from 322 to 908 Bq m-2, of which 29-34 Bq m-2 were deposited within the last decade. At two stations characterized by largest sediment accumulation rates only the last decade inventories were calculated and they ranged from 13 to 444 Bq·m-2. The mean of 137Cs fluxes calculated for last decade ranged from 2.7 to 44.1 Bq m-2yr-1. The history of 137Cs environmental inputs was well revealed in the sediments as the 137Cs penetration depth agreed with the time of its introduction to the Arctic and the most pronounced 137Cs activity concentration peak was found in sediments dated for circa 1963. Although 137Cs fluxes and inventories were largest in the glacial bay (Brepollen), the 137Cs was diluted in a large amount of sedimenting material. Based on the results in this study, the glaciers do not appear to act as
{sup 137}CS in cod from Barents sea; {sup 137}CS in Kabeljau der Barentsee
Energy Technology Data Exchange (ETDEWEB)
Kellermann, H.-J.; Kanisch, G.; Krueger, A. [Bundesforschungsanstalt fuer Fischerei (Germany). Inst. fuer Fischereioekologie
2003-07-01
After publication of the Yablovkov report about dumping of radioactive waste by the former Soviet Union the Institute for Fishery Ecology has analysed fish from Barents Sea for radioactivity. In all studies {sup 137}Cs concentrations in cod fillet showed a clear dependance from fish length. Results from an analysis of covariance for cod of 70 cm length have minor changes within Barents Sea and indicate a rapid decay to a value as is expected for marine fish which is only influenced by global fallout. (orig.)
Plutonium, 137Cs and uranium isotopes in Mongolian surface soils.
Hirose, K; Kikawada, Y; Igarashi, Y; Fujiwara, H; Jugder, D; Matsumoto, Y; Oi, T; Nomura, M
2017-01-01
Plutonium (238Pu and 239,240Pu), 137Cs and plutonium activity ratios (238Pu/239,240Pu) as did uranium isotope ratio (235U/238U) were measured in surface soil samples collected in southeast Mongolia. The 239,240Pu and 137Cs concentrations in Mongolian surface soils (<53 μm of particle size) ranged from 0.42 ± 0.03 to 3.53 ± 0.09 mBq g-1 and from 11.6 ± 0.7 to 102 ± 1 mBq g-1, respectively. The 238Pu/239,240Pu activity ratios in the surface soils (0.013-0.06) coincided with that of global fallout. The 235U/238U atom ratios in the surface soil show the natural one. There was a good correlation between the 239,240Pu and 137Cs concentrations in the surface soils. We introduce the migration depth to have better understanding of migration behaviors of anthropogenic radionuclides in surface soil. We found a difference of the migration behavior between 239,240Pu and 137Cs from 137Cs/239,240Pu - 137Cs plots for the Mongolian and Tsukuba surface soils; plutonium in surface soil is migrated easier than 137Cs. Copyright © 2016 Elsevier Ltd. All rights reserved.
Patra, Santanu; Roy, Ekta; Madhuri, Rashmi; Sharma, Prashant K
2015-05-19
In this study, nanocomposite of graphene oxide and silane modified magnetic nanoparticles (silane@Fe3O4) were synthesized in a form of dendritic structure. For this, silane@Fe3O4 nanoparticle gets sandwiched between two layers of graphene oxide by chemical synthesis route. The synthesized dendritic structure was used as a monomer for synthesis of europium ion imprinted polymer. The synthesis of imprinted polymer was contemplated onto the surface of the vinyl group modified silica fiber by activated generated free radical atom-transfer radical polymerization, that is, AGET-ATRP technique. The synthesized dendritic monomer was characterized by XRD, FT-IR, VSM, FE-SEM, and TEM analyses. The imprinted polymer modified silica fiber was first validated in the aqueous and blood samples for successful extraction and detection of europium ion with limit of detection = 0.050 pg mL(-1) (signal/noise = 3). The imprinted polymer modified silica fiber was also used for preconcentration and separation of europium metal ion from various soil samples of coal mine areas. However, the same silica fiber was also used for wastewater treatment and shows 100% performance for europium removal. The findings herein suggested that dendritic nanocomposite could be potentially used as a highly effective material for the enrichment and preconcentration of europium or other trivalent lanthanides/actinides in nuclear waste management.
Kevadiya, Bhavesh D; Bade, Aditya N; Woldstad, Christopher; Edagwa, Benson J; McMillan, JoEllyn M; Sajja, Balasrinivasa R; Boska, Michael D; Gendelman, Howard E
2017-02-01
The size, shape and chemical composition of europium (Eu3+) cobalt ferrite (CFEu) nanoparticles were optimized for use as a "multimodal imaging nanoprobe" for combined fluorescence and magnetic resonance bioimaging. Doping Eu3+ ions into a CF structure imparts unique bioimaging and magnetic properties to the nanostructure that can be used for real-time screening of targeted nanoformulations for tissue biodistribution assessment. The CFEu nanoparticles (size ∼7.2nm) were prepared by solvothermal techniques and encapsulated into poloxamer 407-coated mesoporous silica (Si-P407) to form superparamagnetic monodisperse Si-CFEu nanoparticles with a size of ∼140nm. Folic acid (FA) nanoparticle decoration (FA-Si-CFEu, size ∼140nm) facilitated monocyte-derived macrophage (MDM) targeting. FA-Si-CFEu MDM uptake and retention was higher than seen with Si-CFEu nanoparticles. The transverse relaxivity of both Si-CFEu and FA-Si-CFEu particles were r2=433.42mM-1s-1 and r2=419.52mM-1s-1 (in saline) and r2=736.57mM-1s-1 and r2=814.41mM-1s-1 (in MDM), respectively. The results were greater than a log order-of-magnitude than what was observed at replicate iron concentrations for ultrasmall superparamagnetic iron oxide (USPIO) particles (r2=31.15mM-1s-1 in saline) and paralleled data sets obtained for T2 magnetic resonance imaging. We now provide a developmental opportunity to employ these novel particles for theranostic drug distribution and efficacy evaluations. A novel europium (Eu3+) doped cobalt ferrite (Si-CFEu) nanoparticle was produced for use as a bioimaging probe. Its notable multifunctional, fluorescence and imaging properties, allows rapid screening of future drug biodistribution. Decoration of the Si-CFEu particles with folic acid increased its sensitivity and specificity for magnetic resonance imaging over a more conventional ultrasmall superparamagnetic iron oxide particles. The future use of these particles in theranostic tests will serve as a platform for
Tuning Eu{sup 3+} emission in europium sesquioxide films by changing the crystalline phase
Energy Technology Data Exchange (ETDEWEB)
Mariscal, A., E-mail: antonio.mariscal@csic.es [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain); Quesada, A. [Ceramics for Smart Systems Group, Instituto de Cerámica y Vidrio, C/ Kelsen 5, 28049 Madrid (Spain); Camps, I. [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain); Palomares, F.J. [Instituto de Ciencia de Materiales de Madrid, C/ Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Fernández, J.F. [Ceramics for Smart Systems Group, Instituto de Cerámica y Vidrio, C/ Kelsen 5, 28049 Madrid (Spain); Serna, R. [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain)
2016-06-30
Highlights: • PLD production of high quality europium sesquioxide (Eu{sub 2}O{sub 3}) films. • The deposition of Al{sub 2}O{sub 3} capping and/or buffer layers modifies the crystallization for Eu{sub 2}O{sub 3} films upon annealing. • The formation of cubic or monoclinic phases can be favored. • Eu{sup 3+} emission tuning is achieved as a consequence of crystal field effects. - Abstract: We report the growth of europium sesquioxide (Eu{sub 2}O{sub 3}) thin films by pulsed laser deposition (PLD) in vacuum at room temperature from a pure Eu{sub 2}O{sub 3} ceramic bulk target. The films were deposited in different configurations formed by adding capping and/or buffer layers of amorphous aluminum oxide (a-Al{sub 2}O{sub 3}). The optical properties, refractive index and extinction coefficient of the as deposited Eu{sub 2}O{sub 3} layers were obtained. X-ray photoelectron spectroscopy (XPS) measurements were done to assess its chemical composition. Post-deposition annealing was performed at 500 °C and 850 °C in air in order to achieve the formation of crystalline films and to accomplish photoluminescence emission. According to the analysis of X-ray diffraction (XRD) spectra, cubic and monoclinic phases were formed. It is found that the relative amount of the phases is related to the different film configurations, showing that the control over the crystallization phase can be realized by adequately designing the structures. All the films showed photoluminescence emission peaks (under excitation at 355 nm) that are attributed to the intra 4f-transitions of Eu{sup 3+} ions. The emission spectral shape depends on the crystalline phase of the Eu{sub 2}O{sub 3} layer. Specifically, changes in the hypersensitive {sup 5}D{sub 0} → {sup 7}F{sub 2} emission confirm the strong influence of the crystal field effect on the Eu{sup 3+} energy levels.
Phenotype abnormality: 137 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 137 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u643i decreased efficiency... during process named unidimensional cell growth ... decreased efficiency ... unidimensional cell growth ...
/sup 137/Cs radioactive dating of Lake Ontario sediment cores
Energy Technology Data Exchange (ETDEWEB)
Ward, T.E.; Breeden, J.; Komisarcik, K.; Porter, R.; Czuczwa, J.; Kaminski, R.; McVeety, B.D.
1987-12-01
The distribution of /sup 137/Cs in sediment cores from Lake Ontario provides estimates of the sediment accumulation rates. Geochronology with /sup 210/Pb dating and distribution of Ambrosia (ragweed) pollen compare well with /sup 137/Cs dating. These methods can determine with precision, changes in sedimentation occurring over the past 100 years or so. Typical sedimentation rates of 0.18-0.36 cm/yr were measured. 16 refs., 3 figs., 2 tabs.
Cs-137 and Sr-90 level in diary products
Energy Technology Data Exchange (ETDEWEB)
Petukhov, V.L.; Dukhanov, Y.A.; Sevryuk, I.Z.; Patrashkov, S.A.; Korotkevich, O.S. [State Agrarian University, Research Institute of Veterinary Genetics and Animal Breeding of Novosibirsk (Russian Federation); Gorb, T.S.; Petukhov, I.V. [Vitebsk State Academy of Veterinary Medicine, Balarus (Russian Federation)
2003-05-01
About 70% of radioactive substances fell on the territory of the Byelorussian Republic after the Chernobyl Atom Power Station Disaster. Cs-137 and Sr-90 accumulation dynamics was studied in milk of the cows from the highest polluted Braginsky area. 408 milk samples of Black and White cows were investigated. In 1995 average Cs-137 and Sr-90 levels were 61.00 and 3.73 Bk/dm{sup 3} respectively. Cs-137 and Sr-90 levels exceeded Byelorussian Republic upper limits RDU - 96 in 10 and 50% of milk samples respectively. After 5 years (by 2000) Cs-137 and Sr-90 levels had become almost 3 and 2 times less (21.70 Bk/dm{sup 3} and 1.72 Bk/dm{sup 3} respectively). Cs-137 and Sr-90 levels exceeded RDU - 96 in 1.5 and 5.5% of milk samples respectively. In the same periods Cs-137 and Sr-90 levels were 7 and 2 times higher than the similar indexes in the relatively clean Novosibirsk area. Thus, radioactive element levels in milk of Black and White cows of the Byelorussian Republic decreased significantly for the past years. (authors)
Uptake of cesium-137 by crops from contaminated soils
Energy Technology Data Exchange (ETDEWEB)
Demirel, H.; Oezer, I.; Celenk, I.; Halitligil, M.B.; Oezmen, A. [Ankara Nuclear Research and Training Center (Turkey)
1994-11-01
The Turkish tea crop was contaminated following the Chernobyl nuclear accident. Finding ways to dispose of the contaminated tea (Camellia sinensis L.) without damaging the environment was the goal of this research conducted at the Turkish Atomic Energy Authority (TAEA). In this study, an investigation was made of {sup 137}Cs activities of the plants and the ratios of transfer of {sup 137}Cs activity to plants when the contaminated tea was applied to the soil. Experiments were conducted in the field and in pots under greenhouse conditions. The activities of the tea applied in the field ranged from 12 500 to 72 800 Bq/m{sup 2}, whereas this activity was constant at 8000 Bq/pot in the greenhouse experiment. The transfer of {sup 137}Cs from soil to the plants was between 0.037 and 1.057% for wheat (Triticum aestivum L.), barley (Hordeum vulgare L.), corn (Zea mays indentata Sturt), bean (Phaseolus vulgaris L.), lettuce (Lactuca sativa L.), and grass (Lolium perenne L.). The ratio of the transfer of {sup 137}Cs activity to plants increased as the activity {sup 137}Cs in tea applied to soil was increased. The activity in the plants increased due to increased uptake of {sup 137}Cs by plants. 12 refs., 2 figs., 2 tabs.
Highly efficient precipitation of phosphoproteins using trivalent europium, terbium, and erbium ions
Energy Technology Data Exchange (ETDEWEB)
Guezel, Yueksel; Rainer, Matthias; Mirza, Munazza Raza; Bonn, Guenther K. [Leopold-Franzens University, Institute of Analytical Chemistry and Radiochemistry, Innsbruck (Austria)
2012-05-15
This study describes a highly efficient method for the selective precipitation of phosphoproteins by trivalent europium, terbium, and erbium metal ions. These metal cations belong to the group of lanthanides and are known to be hard acceptors with an overwhelming preference for oxygen-containing anions such as phosphates to which they form very tight ionic bonds. The method could be successfully applied to specifically precipitate phosphoproteins from complex samples including milk and egg white by forming solid metal-protein complexes. Owing to the low solubility product of the investigated lanthanide salts, the produced metal-protein complexes showed high stability. The protein pellets were extensively washed to remove nonphosphorylated proteins and contaminants. For the analysis of proteins the pellets were first dissolved in 30 % formic acid and subjected to matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) MS. For peptide mass-fingerprint analysis the precipitated phosphoproteins were enzymatically digested using microwave-assisted digestion. The method was found to be highly specific for the isolation and purification of phosphoproteins. Protein quantification was performed by colorimetric detection of total precipitated phosphoproteins and revealed more than 95 % protein recovery for each lanthanide salt. (orig.)
Bicho, Rita C.; Soares, Amadeu M. V. M.; Nogueira, Helena I. S.; Amorim, Mónica J. B.
2016-12-01
Polyoxometalates (POMs) are metal oxo clusters that have been investigated for several applications in material sciences, catalysis, and biomedicine; these gained increasing interest in the field of nanotechnology as nanocarriers for drug delivery. Associated to the increasing applications, there is the need for information regarding the effects on the environment of these compounds, which is completely absent in the literature. In the present study, the effects of europium polyoxometalates encapsulated into silica nanoparticles (Eu-POM/SiO2 NPs) were assessed on the soil representative Enchytraeus crypticus. The individual materials were also assessed (Eu-POMs and SiO2 NPs). Toxicity was evaluated in various test media with increasing complexity: water, soil/water extracts, and soil. Toxicity was only observed for Eu-POM/SiO2 NPs and in the presence of soil components. Despite the fact that effects were observed for concentrations higher than current predicted environmental concentration (PEC), attention should be given to the growing use of these compounds. The present study shows the importance of assessing the effects in soil media, also compared to water. Moreover, results of "no effect" are critically needed and often unpublished. The present study can contribute to the improvement of the OECD guidelines for safety of manufactured nanomaterials on environmental toxicity in the soil compartment providing an improved test alternative.
Tanc, Beril; Kaya, Mustafa; Gumus, Lokman; Kumral, Mustafa
2016-04-01
X-ray fluorescence (XRF) spectrometry is widely used for quantitative and semi quantitative analysis of many major, minor and trace elements in geological samples. Some advantages of the XRF method are; non-destructive sample preparation, applicability for powder, solid, paste and liquid samples and simple spectrum that are independent from chemical state. On the other hand, there are some disadvantages of the XRF methods such as poor sensitivity for low atomic number elements, matrix effect (physical matrix effects, such as fine versus course grain materials, may impact XRF performance) and interference effect (the spectral lines of elements may overlap distorting results for one or more elements). Especially, spectral interferences are very significant factors for accurate results. In this study, semi-quantitative analyzed manganese (II) oxide (MnO, 99.99%) was examined. Samples were pelleted and analyzed with XRF spectrometry (Bruker S8 Tiger). Unexpected peaks were obtained at the side of the major Mn peaks. Although sample does not contain Eu element, in results 0,3% Eu2O3 was observed. These result can occur high concentration of MnO and proximity of Mn and Eu lines. It can be eliminated by using correction equation or Mn concentration can confirm with other methods (such as Atomic absorption spectroscopy). Keywords: Spectral Interferences; Manganese (Mn); Europium (Eu); X-Ray Fluorescence Spectrometry Spectrum.
Juntunen, Etvi; Myyryläinen, Tiina; Salminen, Teppo; Soukka, Tero; Pettersson, Kim
2012-09-01
Lateral flow (LF) immunoassays (i.e., immunochromatographic assays) have traditionally been applied to analytes that do not require very high analytical sensitivity or quantitative results. The selection of potential analytes is often limited by the performance characteristics of the assay technology. Analytes with more demanding sensitivity requirements call for reporter systems enabling high analytical sensitivity. In this study, we systematically compared the performance of fluorescent europium(III) [Eu(III)] chelate dyed polystyrene nanoparticles and colloidal gold particles in lateral flow assays. The effect of time-resolved measurement mode was also studied. Because binder molecules used in immunoassays might not behave similarly when conjugated to different reporter particles, two model assays were constructed to provide reliable technical comparison of the two reporter systems. The comparative experiment demonstrated that the fluorescent nanoparticles yielded 7- and 300-fold better sensitivity compared with colloidal gold in the two test systems, respectively. Although the two reporter particles may induce variable effects using individual binders, overall the high specific activity of Eu(III) nanoparticles has superior potential over colloidal gold particles for the development of robust high-sensitivity bioaffinity assays. Copyright © 2012 Elsevier Inc. All rights reserved.
Carbon nanotube-loaded Nafion film electrochemical sensor for metal ions: europium.
Wang, Tingting; Zhao, Daoli; Guo, Xuefei; Correa, Jaime; Riehl, Bill L; Heineman, William R
2014-05-06
A Nafion film loaded with novel catalyst-free multiwalled carbon nanotubes (MWCNTs) was used to modify a glassy carbon (GC) electrode to detect trace concentrations of metal ions, with europium ion (Eu(3+)) as a model. The interaction between the sidewalls of MWCNTs and the hydrophobic backbone of Nafion allows the MWCNTs to be dispersed in Nafion, which was then coated as a thin film on the GC electrode surface. The electrochemical response to Eu(3+) was found to be ∼10 times improved by MWCNT concentrations between 0.5 and 2 mg/mL, which effectively expanded the electrode surface into the Nafion film and thereby reduced the diffusion distance of Eu(3+) to the electrode surface. At low MWCNT concentrations of 0.25 and 0.5 mg/mL, no significant improvement in signal was obtained compared with Nafion alone. Scanning electron microscopy and electrochemical impedance spectroscopy were used to characterize the structure of the MWCNT-Nafion film, followed by electrochemical characterization with Eu(3+) via cyclic voltammetry and preconcentration voltammetry. Under the optimized conditions, a linear range of 1-100 nM with a calculated detection limit of 0.37 nM (signal/noise = 3) was obtained for determination of Eu(3+) by Osteryoung square-wave voltammetry after a preconcentration time of 480 s.
Energy Technology Data Exchange (ETDEWEB)
Bicho, Rita C., E-mail: ritabicho@ua.pt; Soares, Amadeu M.V.M. [Universidade de Aveiro, Departamento de Biologia & CESAM (Portugal); Nogueira, Helena I.S. [Universidade de Aveiro, Departamento de Química & CICECO (Portugal); Amorim, Mónica J.B. [Universidade de Aveiro, Departamento de Biologia & CESAM (Portugal)
2016-12-15
Polyoxometalates (POMs) are metal oxo clusters that have been investigated for several applications in material sciences, catalysis, and biomedicine; these gained increasing interest in the field of nanotechnology as nanocarriers for drug delivery. Associated to the increasing applications, there is the need for information regarding the effects on the environment of these compounds, which is completely absent in the literature. In the present study, the effects of europium polyoxometalates encapsulated into silica nanoparticles (Eu-POM/SiO{sub 2} NPs) were assessed on the soil representative Enchytraeus crypticus. The individual materials were also assessed (Eu-POMs and SiO{sub 2} NPs). Toxicity was evaluated in various test media with increasing complexity: water, soil/water extracts, and soil. Toxicity was only observed for Eu-POM/SiO{sub 2} NPs and in the presence of soil components. Despite the fact that effects were observed for concentrations higher than current predicted environmental concentration (PEC), attention should be given to the growing use of these compounds. The present study shows the importance of assessing the effects in soil media, also compared to water. Moreover, results of “no effect” are critically needed and often unpublished. The present study can contribute to the improvement of the OECD guidelines for safety of manufactured nanomaterials on environmental toxicity in the soil compartment providing an improved test alternative.
EUROPIUM ION INFLUENCE ON THE FORMATION OF Ag-NANOPARTICLES IN FLUORINE PHOSPHATE GLASSES
Directory of Open Access Journals (Sweden)
R. O. Pysh'ev
2015-05-01
Full Text Available The paper deals with research of formation characteristics of silver nanoparticles in fluorophosphate glasses 0.25 Na2O - 0.5 P2O5 - 0.10 Ga2O3 - 0.075 AlF3 - 0.025 NaF - 0.05 ZnF2 doped with EuF3 (0.8 and 4 wt.% and without them. The synthesis was carried out in closed glassy carbon crucibles in argon atmosphere. Nanoparticles were formed after a low temperature process of Ag+ → Na+ ion-exchange (320 °C and subsequent heat treatment. It was shown that in the initial glasses doped with EuF3, rare earth ions exist in two valence forms (Eu2+ and Eu3+ in dynamic equilibrium and the concentration of Eu2+ increases proportionally to the total concentration of fluoride. It was shown that sizes of molecular clusters or metal nanoparticles depend on the concentration of europium fluoride and duration of ion exchange. The metallic Ag-nanoparticles sizes were defined for different times of heat treatment and ion exchange. The possibility of the stimulating growth of nanoparticles through the introduction of additional EuF3 in the glass was proved. The possibility of obtaining nanoparticles without the heat treatment in glasses with a high concentration of EuF3 was shown. Chemical mechanism for the formation of Ag-nanoparticles during the ion exchange was suggested.
Nanoparticles in the zirconia-europium niobate system via hydrothermal route.
Hirano, Masanori; Dozono, Hayato
2013-10-01
The effect of the composition on the hydrothermal formation, structure, and properties of nanocrystalline luminescent materials in the zirconia (ZrO2)-europium niobate 1/4(Eu3NbO7) system was investigated. In the composition range 40 particles with crystallite size 6.0-7.6 nm that were hydrothermally formed from the precursor solutions of NbCl5, ZrOCI2, and EuCl3 under weakly basic conditions at 240 degrees C showed cubic structure. The lattice parameter when estimated as a single cubic phase linearly decreased as the concentration of ZrO2 increased. The presence of zirconia component effectively promoted the formation of nanocrystals containing the niobate, Eu3NbO7 under hydrothermal condition. The nanocrystalline particles could be excited by ultraviolet light 395 nm (f-f transition) and emitted orange (590 nm) and red light (610 nm) corresponding to 5D0 --> 7F1 and 5D0 --> 7F2 transitions of Eu3+, respectively. The intensity of the electric dipole transition (5D0 --> 7F2) that was expressed in values relative to the magnetic dipole transition (5D0 --> 7F1) increased with increased heat-treatment temperature in the range from 950 to 1200 degrees C.
Energy Technology Data Exchange (ETDEWEB)
Guerrero-Lemus, R; Montesdeoca-Santana, A; Gonzalez-Diaz, B; Diaz-Herrera, B; Hernandez-Rodriguez, C; Jimenez-Rodriguez, E [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida AstrofIsico Francisco Sanchez, 2. 38206 La Laguna, Tenerife (Spain); Velazquez, J J, E-mail: rglemus@ull.es [Departamento de Fisica Fundamental y Experimental, Electronica y Sistemas, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2. 38206 La Laguna, Tenerife (Spain)
2011-08-24
In this work, for the first time, the photoluminescent emission and excitation spectra of non-textured layers and stain-etched porous silicon layers (PSLs) doped with high temperature annealed europium (Eu) are evaluated. The PSLs are evaluated as a host for rare earth ions and as an antireflection coating. The applied doping process, which consists in a simple impregnation method followed by a high-temperature annealing step, is compatible with the standard processes in the fabrication of solar cells. The results show down-shifting processes with a maximum photoluminescent intensity at 615 nm, related to the transition {sup 5}D{sub 0} {yields} {sup 7}F{sub 2}. Different initial concentrations of Eu(NO{sub 3}){sub 3} are evaluated to study the influence of the rare earth concentration on the photoluminescent intensity. The chemical composition and the morphology of Eu-doped PSLs are examined by means of x-ray dispersion spectroscopy, Fourier-transform infrared spectroscopy and scanning electron microscopy. These Eu-doped layers are considered to be applied as energy converters in silicon-based third generation solar cells.
Europium (III) and Uranium (VI) complexation by natural organic matter (NOM): Effect of source.
Kautenburger, Ralf; Sander, Jonas M; Hein, Christina
2017-03-01
For the safe long-term storage of high-level radioactive waste (HLW), detailed information about geo-chemical behavior of radioactive and toxic metal ions under environmental conditions is important. Natural organic matter (NOM) can play a crucial role in the immobilization or mobilization of these metal ions due to its complexation and colloid formation tendency. In this study, the complexation of europium (as chemical homologue of trivalent actinides such as americium) and uranium (as main component of HLW) by ten humic acids (HA) from different sources and Suwannee NOM river extract has been analyzed. Capillary electrophoresis in combination with inductively coupled plasma mass spectrometry has been used for the evaluation of complex stability constants log β. In order to determine the complex stability constants a conservative single site model was used in this study. In dependence of their source and thus of NOM structure the log β values for the analyzed humic acids are in the range of 6.1-7.0 for Eu(III) and 5.2-6.4 for U(VI) (UO 2 2+ ), respectively. In contrast to the results for HA the used Suwannee river NOM reveals log β values in the range of nearly two orders of magnitude lower (4.6 for Eu 3+ and 4.5 for UO 2 2+ ) under the geochemical conditions applied in this study. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Europium incorporated into titanium oxide by the sol-gel method
Directory of Open Access Journals (Sweden)
Lucas Alonso Rocha
2005-09-01
Full Text Available In this work titanium sol was prepared from tetraethylorthotitanate (TEOT in ethanol, stabilized with beta-diketonate 2,4 pentanedione in molar ratio 1:1 homogenized by magnetic stirring, europium ion was add as structural probe. The xerogels were heat treated at 500, 750 and 1000 °C and the characterization was realized by x-ray diffraction (XRD, transmission electron microscopy (TEM, thermogravimetric analysis (TGA/DSC and photoluminescence (PL. The excitation spectra of Eu (III ion present maximum in 394 nm correspondent to 5L6 level and emission spectra present bands characteristic transitions arising from the 5 D0 -> 7F J (J = 0, 1, 2, 3, 4 manifolds to samples treat at 500 and 750 °C. The Eu (III emission disappear, when heated at 1000 °C, probably due to phase transition anatase to rutile and migrations of ions to the external surface that was proved by x-ray diffraction, transmission electronic microscopy and the thermogravimetric analyses of xerogels.
Directory of Open Access Journals (Sweden)
Ishwar Prasad Sahu
2017-03-01
Full Text Available Europium doped strontium meta-silicate (namely SrSiO3:Eu3+ phosphor was prepared by a high temperature solid state reaction method. The sintered SrSiO3:Eu3+ phosphor possesses a monoclinic structure by the XRD. Energy dispersive X-ray spectrum (EDS confirms the presence of elements in the desired sample. Thermoluminescence (TL kinetic parameters such as activation energy (E, order of kinetics (b, and frequency factor (s were calculated by the peak shape method. The orange–red emission was shown to originate from the 5D0–7FJ (J = 0, 1, 2, 3, 4 transitions of Eu3+ ions as the sample was excited at 396 nm. The SrSiO3:Eu3+ phosphor with almost pure orange-red color purity (99.62% shows the quantum efficiency of 10.2% (excited by 396 nm, which is higher than those of commercial red phosphors Y2O3:Eu3+ and Y2O2S:Eu3+ with quantum efficiencies of 9.6% (excited by 394 nm and 4.2% (excited by 395 nm, respectively. Mechanoluminescence (ML intensity of the SrSiO3:Eu3+ phosphor was also found to increase linearly with increasing the impact velocity of the moving piston, suggesting that the discussed phosphor can be used as a stress sensor.
Europium Luminescence Used for Logic Gate and Ions Sensing with Enoxacin As the Antenna.
Lu, Lixia; Chen, Chuanxia; Zhao, Dan; Sun, Jian; Yang, Xiurong
2016-01-19
Luminescent lanthanide ion complexes have received increasing attention because of their unique optical properties. Herein, we discovered that the luminescence of europium(III) (Eu(3+)) could be regulated by Ag(+) and SCN(-) in seconds with enoxacin (ENX) as the antenna. Under given conditions, only the simultaneous introduction of Ag(+) and SCN(-) could remarkably enhance the luminescence intensity of Eu(3+)-ENX complexes. This phenomenon has been exploited to design an "AND" logic gate and specific luminescence turn-on assays for sensitively sensing Ag(+) and SCN(-) for the first time. Furthermore, the addition of S(2-) resulted in efficient luminescence quenching of the Eu(3+)/ENX/Ag(+)/SCN(-) system due to the strong affinity between Ag(+) and S(2-). Thus, a new luminescent sensing platform for S(2-) was established, which exhibited excellent selectivity and high sensitivity. S(2-) could be detected within the concentration range of 100 nM to 12.5 μM with a detection limit of 60 nM. Such sensing system features simplicity, rapidity, and flexibility. Moreover, this proposed Eu(3+)-based luminescent assay could be successfully applied in the real environmental water sample analysis.
Radiation effects on beta 10.6 of pure and europium doped KCl
Grimes, H. H.; Maisel, J. E.; Hartford, R. H.
1975-01-01
Changes in the optical absorption coefficient as a result of X-ray and electron bombardment of pure KCl (monocrystalline and polycrystalline), and divalent europium doped polycrystalline KCl were determined. The optical absorption coefficients were measured by a constant heat flow calorimetric method. Both 300 KV X-irradiation and 2 MeV electron irradiation produced significant increases in beta 10.6, measured at room temperature. The X-irradiation of pure moncrystalline KCl increased beta 10.6 by 0.005/cm for a 113 MR dose. For an equivalent dose, 2 MeV electrons were found less efficient in changing beta 10.6. However, electron irradiation of pure and Eu-doped polycrystalline KCl produced marked increases in adsorption. Beta increased to over 0.25/cm in Eu-doped material for a 30 x 10 to the 14th power electrons/sq cm dose, a factor of 20 increase over unirradiated material. Moreover, bleaching the electron irradiated doped KCl with 649 m light produced and additional factor of 1.5 increase. These findings will be discussed in light of known defect-center properties in KCl.
Wei, Peng-Fei; Zhang, Li; Nethi, Susheel Kumar; Barui, Ayan Kumar; Lin, Jun; Zhou, Wei; Shen, Yi; Man, Na; Zhang, Yun-Jiao; Xu, Jing; Patra, Chitta Ranjan; Wen, Long-Ping
2014-01-01
Autophagy is one of the well-known pathways to accelerate the clearance of protein aggregates, which contributes to the therapy of neurodegenerative diseases. Although there are numerous reports that demonstrate the induction of autophagy with small molecules including rapamycin, trehalose and lithium, however, there are few reports mentioning the clearance of aggregate-prone proteins through autophagy induction by nanoparticles. In the present article, we have demonstrated that europium hydroxide [Eu(III)(OH)3] nanorods can reduce huntingtin protein aggregation (EGFP-tagged huntingtin protein with 74 polyQ repeats), responsible for neurodegenerative diseases. Again, we have found that these nanorods induce authentic autophagy flux in different cell lines (Neuro 2a, PC12 and HeLa cells) through the expression of higher levels of characteristic autophagy marker protein LC3-II and degradation of selective autophagy substrate/cargo receptor p62/SQSTM1. Furthermore, depression of protein aggregation clearance through the autophagy blockade has also been observed by using specific inhibitors (wortmannin and chloroquine), indicating that autophagy is involved in the degradation of huntingtin protein aggregation. Since [Eu(III)(OH)3] nanorods can enhance the degradation of huntingtin protein aggregation via autophagy induction, we strongly believe that these nanorods would be useful for the development of therapeutic treatment strategies for various neurodegenerative diseases in near future using nanomedicine approach. Copyright © 2013 Elsevier Ltd. All rights reserved.
High-resolution Thermal Micro-imaging Using Europium Chelate Luminescent Coatings.
Benseman, Timothy M; Hao, Yang; Vlasko-Vlasov, Vitalii K; Welp, Ulrich; Koshelev, Alexei E; Kwok, Wai-Kwong; Divan, Ralu; Keiser, Courtney; Watanabe, Chiharu; Kadowaki, Kazuo
2017-04-16
Micro-electronic devices often undergo significant self-heating when biased to their typical operating conditions. This paper describes a convenient optical micro-imaging technique which can be used to map and quantify such behavior. Europium thenoyltrifluoroacetonate (EuTFC) has a 612 nm luminescence line whose activation efficiency drops strongly with increasing temperature, due to T-dependent interactions between the Eu3+ ion and the organic chelating compound. This material may be readily coated on to a sample surface by thermal sublimation in vacuum. When the coating is excited with ultraviolet light (337 nm) an optical micro-image of the 612 nm luminescent response can be converted directly into a map of the sample surface temperature. This technique offers spatial resolution limited only by the microscope optics (about 1 micron) and time resolution limited by the speed of the camera employed. It offers the additional advantages of only requiring comparatively simple and non-specialized equipment, and giving a quantitative probe of sample temperature.
Kim, Eun Bee; Seo, Ji Min; Kim, Gi Wook; Lee, Sang Yup; Park, Tae Jung
2016-12-01
Nanotechnology strives to combine new materials for development of noble nanoparticles. As the nanoparticles exhibit unique optical, electronic, and magnetic properties depending on their composition, developing safe, cost-effective and environmentally friendly technologies for the synthesis have become an important issue. In this study, in vivo synthesis of europium selenide (EuSe) nanoparticles was performed using recombinant Escherichia coli cells expressing heavy-metal binding proteins, phytochelatin synthase and metallothionein. The formation of EuSe nanoparticles was confirmed by using UV-vis spectroscopy, spectrofluorometry, X-ray diffraction, energy dispersive X-ray and transmission electron microscopy. The synthesized EuSe nanoparticles exhibited high fluorescence intensities as well as strong magnetic properties. Furthermore, anti-cancer effect of EuSe nanoparticles against cancer cell lines was investigated. This strategy for the biogenic synthesis of nanoparticles has a great potential as bioimaging tools and drug carrying agents in biomedical fields due to its simplicity and nontoxicity. Copyright © 2016 Elsevier Inc. All rights reserved.
Seitz, Michael; Do, King; Ingram, Andrew J.; Moore, Evan G.; Muller, Gilles; Raymond, Kenneth N.
2009-01-01
Abstract: Circulaly polarized luminescence from terbium(III) complexed and excited by chiral antenna ligands gives strong emission The modular synthesis of three new octadentate, enantiopure ligands are reported - one with the bidentate chelating unit 2-hydroxyisophthalamide (IAM) and two with 1-hydroxy-2-pyridinone (1,2-HOPO) units. A new design principle is introduced for the chiral, non-racemic hexamines which constitute the central backbones for the presented class of ligands. The terbium(III) complex of the IAM ligand, as well as the europium(III) complexes of the 1,2-HOPO ligands are synthesized and characterized by various techniques (NMR, UV, CD, luminescence spectroscopy). All species exhibit excellent stability and moderate to high luminescence efficiency (quantum yields ΦEu = 0.05–0.08 and ΦTb = 0.30–0.57) in aqueous solution at physiological pH. Special focus is put onto the properties of the complexes in regard to circularly polarized luminescence (CPL). The maximum luminescence dissymmetry factors (glum) in aqueous solution are high with |glum|max = 0.08 – 0.40. Together with the very favorable general properties (good stability, high quantum yields, long lifetimes), the presented lanthanide complexes can be considered as good candidates for analytical probes based on CPL in biologically relevant environments. PMID:19639983
Complexation and molecular modeling studies of europium(III)-gallic acid-amino acid complexes.
Taha, Mohamed; Khan, Imran; Coutinho, João A P
2016-04-01
With many metal-based drugs extensively used today in the treatment of cancer, attention has focused on the development of new coordination compounds with antitumor activity with europium(III) complexes recently introduced as novel anticancer drugs. The aim of this work is to design new Eu(III) complexes with gallic acid, an antioxida'nt phenolic compound. Gallic acid was chosen because it shows anticancer activity without harming health cells. As antioxidant, it helps to protect human cells against oxidative damage that implicated in DNA damage, cancer, and accelerated cell aging. In this work, the formation of binary and ternary complexes of Eu(III) with gallic acid, primary ligand, and amino acids alanine, leucine, isoleucine, and tryptophan was studied by glass electrode potentiometry in aqueous solution containing 0.1M NaNO3 at (298.2 ± 0.1) K. Their overall stability constants were evaluated and the concentration distributions of the complex species in solution were calculated. The protonation constants of gallic acid and amino acids were also determined at our experimental conditions and compared with those predicted by using conductor-like screening model for realistic solvation (COSMO-RS) model. The geometries of Eu(III)-gallic acid complexes were characterized by the density functional theory (DFT). The spectroscopic UV-visible and photoluminescence measurements are carried out to confirm the formation of Eu(III)-gallic acid complexes in aqueous solutions. Copyright © 2016 Elsevier Inc. All rights reserved.
Luminescent single-walled carbon nanotube-sensitized europium nanoprobes for cellular imaging
Avti, Pramod K; Sitharaman, Balaji
2012-01-01
Lanthanoid-based optical probes with excitation wavelengths in the ultra-violet (UV) range (300–325 nm) have been widely developed as imaging probes. Efficient cellular imaging requires that lanthanoid optical probes be excited at visible wavelengths, to avoid UV damage to cells. The efficacy of europium-catalyzed single-walled carbon nanotubes (Eu-SWCNTs), as visible nanoprobes for cellular imaging, is reported in this study. Confocal fluorescence microscopy images of breast cancer cells (SK-BR-3 and MCF-7) and normal cells (NIH 3T3), treated with Eu-SWCNT at 0.2 μg/mL concentration, showed bright red luminescence after excitation at 365 nm and 458 nm wavelengths. Cell viability analysis showed no cytotoxic effects after the incubation of cells with Eu-SWCNTs at this concentration. Eu-SWCNT uptake is via the endocytosis mechanism. Labeling efficiency, defined as the percentage of incubated cells that uptake Eu-SWCNT, was 95%–100% for all cell types. The average cellular uptake concentration was 6.68 ng Eu per cell. Intracellular localization was further corroborated by transmission electron microscopy and Raman microscopy. The results indicate that Eu-SWCNT shows potential as a novel cellular imaging probe, wherein SWCNT sensitizes Eu3+ ions to allow excitation at visible wavelengths, and stable time-resolved red emission. The ability to functionalize biomolecules on the exterior surface of Eu-SWCNT makes it an excellent candidate for targeted cellular imaging. PMID:22619533
Green, Kayla N.; Viswanathan, Subha; Rojas-Quijano, Federico A.; Kovacs, Zoltan; Sherry, A. Dean
2011-01-01
A series of new 1,4,7,10-tetraazacyclododecane-derivatives having a combination of amide and ketone donor groups as side-arms were prepared and their complexes with europium(III) studied in detail by high resolution NMR spectroscopy. The chemical shift of the Eu3+-bound water resonance, the chemical exchange saturation transfer (CEST) characteristics of the complexes, and the bound water residence lifetimes (τm) were found to vary dramatically with the chemical structure of the side-arms. Substitution of ketone oxygen donor atoms for amide oxygen donor atoms resulted in an increase in residence water lifetimes (τm) and a decrease in chemical shift of the Eu3+-bound water molecule (Δω). These experimental results along with density functional theory (DFT) calculations demonstrate that introduction of weakly donating oxygen atoms in these complexes results in a much weaker ligand field, more positive charge on the Eu3+ ion and an increased water residence lifetime as expected for a dissociative mechanism. These results provide new insights into the design of paramagnetic CEST agents with even slower water exchange kinetics that will make them more efficient for in vivo imaging applications. PMID:21306137
Urinary monitoring of exposure to yttrium, scandium, and europium in male Wistar rats.
Kitamura, Yasuhiro; Usuda, Kan; Shimizu, Hiroyasu; Fujimoto, Keiichi; Kono, Rei; Fujita, Aiko; Kono, Koichi
2012-12-01
On the assumption that rare earth elements (REEs) are nontoxic, they are being utilized as replacements of toxic heavy metals in novel technological applications. However, REEs are not entirely innocuous, and their impact on health is still uncertain. In the past decade, our laboratory has studied the urinary excretion of REEs in male Wistar rats given chlorides of europium, scandium, and yttrium solutions by one-shot intraperitoneal injection or oral dose. The present paper describes three experiments for the suitability and appropriateness of a method to use urine for biological monitoring of exposure to these REEs. The concentrations of REEs were determined in cumulative urine samples taken at 0-24 h by inductively coupled plasma atomic emission spectroscopy, showing that the urinary excretion of REEs is <2 %. Rare earth elements form colloidal conjugates in the bloodstream, which make high REEs accumulation in the reticuloendothelial system and glomeruli and low urinary excretion. The high sensitivity of inductively coupled plasma-argon emission spectrometry analytical methods, with detection limits of <2 μg/L, makes urine a comprehensive assessment tool that reflects REE exposure. The analytical method and animal experimental model described in this study will be of great importance and encourage further discussion for future studies.
Dutra, José Diogo L.; Lima, Nathalia B. D.; Freire, Ricardo O.; Simas, Alfredo M.
2015-09-01
We advance the concept that the charge factors of the simple overlap model and the polarizabilities of Judd-Ofelt theory for the luminescence of europium complexes can be effectively and uniquely modeled by perturbation theory on the semiempirical electronic wave function of the complex. With only three adjustable constants, we introduce expressions that relate: (i) the charge factors to electronic densities, and (ii) the polarizabilities to superdelocalizabilities that we derived specifically for this purpose. The three constants are then adjusted iteratively until the calculated intensity parameters, corresponding to the 5D0→7F2 and 5D0→7F4 transitions, converge to the experimentally determined ones. This adjustment yields a single unique set of only three constants per complex and semiempirical model used. From these constants, we then define a binary outcome acceptance attribute for the adjustment, and show that when the adjustment is acceptable, the predicted geometry is, in average, closer to the experimental one. An important consequence is that the terms of the intensity parameters related to dynamic coupling and electric dipole mechanisms will be unique. Hence, the important energy transfer rates will also be unique, leading to a single predicted intensity parameter for the 5D0→7F6 transition.
Energy Technology Data Exchange (ETDEWEB)
Rakov, Nikifor [PG-Ciência dos Materiais, Universidade Federal do Vale do São Francisco, 48902-300 Juazeiro, BA (Brazil); Guimarães, R. B.; Maciel, Glauco S. [Instituto de Física, Universidade Federal Fluminense, 24210-346 Niterói, RJ (Brazil); Lozano B, W. [Departamento de Física, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil)
2013-07-28
A facile widely spread technique employed to produce low-cost high-yield oxide powders, combustion synthesis, was used to prepare yttrium oxyfluoride crystalline ceramic powders. The structure of the powders was analyzed by X-ray powder diffraction and Rietveld refinement. Samples heat treated at 700 °C had a predominance of vernier orthorhombic Y{sub 6}O{sub 5}F{sub 8} phase, while samples heat treated at 800 °C crystallized in stoichiometric rhombohedral YOF phase. The samples were doped with luminescent europium trivalent ions (Eu{sup 3+}) in different concentrations (1–15 wt.%) and Judd-Ofelt theory was used to probe the distortion from the inversion symmetry of the local crystal field and the degree of covalency between the rare-earth ion and the surrounding ligands. The luminescence lifetime was measured and the luminescence quantum efficiency (LQE) was estimated. We observed that Eu{sup 3+}:Y{sub 6}O{sub 5}F{sub 8} samples presented higher LQE in spite of the larger local crystal field anisotropy found for Eu{sup 3+}:YOF samples.
232Th, 238U, 40K, 137Cs radioactivity concentrations and 137Cs dose rate in Turkish market tea
Kiliç, Önder; Belivermiş, Murat; Topcuoǧlu, Sayhan; Çotuk, Yavuz
In this study, the activity concentrations of 232Th, 238U, 40K and 137Cs were measured in 10 branded tea samples from local Turkish markets using gamma spectrometry with an HPGe detector. The mean activity concentrations of 232Th, 238U, 40K and 137Cs were found to be 2.7 ± 1.0, 0.9 ± 0.4, 501 ± 42 and 45.04 ± 2.6 Bq kg-1, respectively. The average annual effective 137Cs dose as a consequence of tea consumption was found to be 385 nSv for an adult person, which is not hazardous to public health. The correlation coefficient between 137Cs and 40K was found to be-0.82 in these samples. The present data were compared with those found in other studies.
Liu, Jian; Liang, Quan-Bin; Wu, Hong-Bin
2017-05-01
We synthesized a new europium complex [Eu(ecbpd)3 (Phen)] with bis(β-diketone) ligand containing a carbazole group, in which ecbpd and Phen are dehydro-3,3'-(9-ethyl-9H-carbazole-3,6-diyl)bis(1-phenylpropane-1,3-dione) and 1,10-phenanthroline, respectively. Its UV/vis and photoluminescent spectra, quantum yield, luminescence lifetime, electrochemistry, thermal stability and electroluminescent performances were studied. This europium complex showed low efficiency luminescence, which is probably due to the mismatching energy levels of its ligand and Eu3+ , as well as the double Eu3+ core resonance. Copyright © 2016 John Wiley & Sons, Ltd.
Energy Technology Data Exchange (ETDEWEB)
Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Kamjoo, Rahman [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Mohammadhosseini, Majid [Department of Chemistry, Faculty of Basic Sciences, Shahrood Branch, Islamic Azad University, Shahrood (Iran, Islamic Republic of); Zaferoni, Mojdeh; Rafati, Zynab [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Faridbod, Farnoush [Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Meghdadi, Soraia [Department of Chemistry, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of)
2012-04-01
Conductometric study in acetonitrile solution shows the selectivity of PCQ toward europium ion. Therefore, a new europium PVC membrane electrode was prepared based on N-pyridine-2-carboxamido-8-aminoquinoline (PCQ) as an ion carrier. The electrode has a wide concentration range from 1.0 Multiplication-Sign 10{sup -2} and 1.0 Multiplication-Sign 10{sup -6} mol L{sup -1}, Nernstian slope of 19.8 {+-} 0.3 mV per decade and a detection limit of 6.4 Multiplication-Sign 10{sup -7} mol L{sup -1}. The potentiometric response is pH independent in the range of 2.4-7.4. The proposed sensor has a relatively fast response time less than 10 s and it can be used for at least 2 months without any considerable divergence in its potentials. The proposed electrode revealed good selectivity toward europium ion in comparison with variety of other metal ions. The practical utility of the electrodes has been demonstrated by their use as indicator electrodes in the potentiometric titration of Eu{sup 3+} ions with EDTA and for determination of Eu{sup 3+} ion concentration in mixtures of two and three different ions. - Highlights: Black-Right-Pointing-Pointer A new ion carrier is introduced to preparation of a selective sensor for Eu{sup 3+} ions. Black-Right-Pointing-Pointer This technique is very simple and it's not necessary to use sophisticated equipment. Black-Right-Pointing-Pointer The novelty of this work is the high affinity of the ionophore toward the Eu{sup 3+} ions. Black-Right-Pointing-Pointer The sensor is superior to the formerly reported Eu{sup 3+} sensors in terms of selectivity.
Sainz-Gonzalo, F J; Popovici, C; Casimiro, M; Raya-Barón, A; López-Ortiz, F; Fernández, I; Fernández-Sánchez, J F; Fernández-Gutiérrez, A
2013-10-21
A new europium(III) membrane luminescent sensor based on a new tridentate bis(phosphinic acid)phosphine oxide (3) system has been developed. The synthesis of this new ligand is described and its full characterization by NMR, IR and elemental analyses is provided. The luminescent complex formed between europium(III) chloride and ligand 3 was evaluated in solution, observing that its spectroscopic and chemical characteristics are excellent for measuring in polymer inclusion membranes. Included in a Nafion membrane, all the parameters (ligand and ionic additives) that can affect the sensitivity and selectivity of the sensing membrane as well as the instrumental conditions were carefully optimized. The best luminescence signal (λexc = 229.06 nm and λem = 616.02 nm) was exhibited by the sensing film having a Nafion : ligand composition of 262.3 : 0.6 mg mL(-1). The membrane sensor showed a short response time (t95 = 5.0 ± 0.2 min) and an optimum working pH of 5.0 (25 mM acetate buffer solution). The membrane sensor manifested a good selectivity toward europium(III) ions with respect to other trivalent metals (iron, chromium and aluminium) and lanthanide(III) ions (lanthanum, samarium, terbium and ytterbium), although a small positive interference of terbium(III) ions was observed. It provided a linear range from 1.9 × 10(-8) to 5.0 × 10(-6) M with a very low detection limit (5.8 × 10(-9) M) and sensitivity (8.57 × 10(-7) a.u. per M). The applicability of this sensing film has been demonstrated by analyzing different kinds of spiked water samples obtaining recovery percentages of 95-97%.
A Responsive Europium(III) Chelate that Provides a Direct Readout of pH by MRI
Wu, Yunkou; Soesbe, Todd C.; Kiefer, Garry E.; Zhao, Piyu; Sherry, A. Dean
2010-01-01
A europium(III) DO3A-tris(amide) complex is reported for imaging pH by MRI using ratiometric CEST principles. Deprotonation of a single phenolic proton between pH 6 and 7.6 results in an ~5 ppm shift in the water exchange CEST peak that is easily detected by MRI. Collection of two CEST images at two slightly different activation frequencies provides a direct readout of solution pH without the need of a concentration marker. PMID:20853833
Spectroscopic properties and luminescence behaviour of europium doped lithium borate glasses
Energy Technology Data Exchange (ETDEWEB)
Anjaiah, J., E-mail: anjaiah.juluru@gmail.com [Department of Physics, The University of Dodoma, Tanzania, East Africa (Tanzania, United Republic of); Department of Physics, Geethanjali College of Engineering and Technology, Keesara, RR Dist., Hyderabad 501 301 (India); Laxmikanth, C. [Department of Physics, The University of Dodoma, Tanzania, East Africa (Tanzania, United Republic of); Veeraiah, N. [Department of Physics, Acharya Nagarjuna University, Nagarjuna Nagar, Guntur 522 510, AP. (India)
2014-12-01
Li{sub 2}O–MO–B{sub 2}O{sub 3} (MO=ZnO, CaO and CdO) glasses doped with europium are prepared by using the melt quenching technique to study their absorption and luminescence properties to understand their lasing potentialities. The XRD pattern of the glasses confirmed the amorphous nature and the IR spectra reveal the presence of BO{sub 3} and BO{sub 4} units in the glass network. Judd–Ofelt intensity parameters Ω{sub λ} (λ=2, 4, 6) are evaluated from the intensities of various absorption bands of optical absorption spectra. The J–O parameters have been used to calculate transition probabilities (A), lifetime (τ{sub R}), branching ratios (β{sub R}) and stimulated emission cross-section (σ{sub P}) for the {sup 5}D{sub 0}→{sup 7}F{sub J} (J=1–4) transitions of the Eu{sup 3+} ions. The decay from the {sup 5}D{sub 0} level of Eu{sup 3+} ions in these glasses has been measured and analysed. Branching ratios and stimulated emission cross-sections measured for all these glasses show that the {sup 5}D{sub 0}→{sup 7}F{sub 1} transition under investigation has the potential for laser applications. The high stimulated emission cross-section and branching ratios from the present glasses suggests their potential for infra red lasers. The study of the thermoluminescence is also carried out and the data suggests that the CdBEu glass is suitable for thermoluminescence emission output among the three Eu{sup 3+} doped glasses.
Size-dependent cytotoxicity of europium doped NaYF{sub 4} nanoparticles in endothelial cells
Energy Technology Data Exchange (ETDEWEB)
Chen, Shizhu; Zhang, Cuimiao; Jia, Guang; Duan, Jianlei; Wang, Shuxiang, E-mail: wsx@hbu.edu.cn; Zhang, Jinchao, E-mail: jczhang6970@163.com
2014-10-01
Lanthanide-doped sodium yttrium fluoride (NaYF{sub 4}) nanoparticles exhibit novel optical properties which make them be widely used in various fields. The extensive applications increase the chance of human exposure to these nanoparticles and thus raise deep concerns regarding their riskiness. In the present study, we have synthesized europium doped NaYF{sub 4} (NaYF{sub 4}:Eu{sup 3+}) nanoparticles with three diameters and used endothelial cells (ECs) as a cell model to explore the potential toxic effect. The cell viability, cytomembrane integrity, cellular uptake, intracellular localization, intracellular reactive oxygen species (ROS), mitochondrial membrane potential (MMP), apoptosis detection, caspase-3 activity and expression of inflammatory gene were studied. The results indicated that these nanoparticles could be uptaken into ECs and decrease the cell viability, induce the intracellular lactate dehydrogenase (LDH) release, increase the ROS level, and decrease the cell MMP in a size-dependent manner. Besides that, the cells were suffered to apoptosis with the caspase-3 activation, and the inflammation specific gene expressions (ICAM1 and VCAM1) were also increased. Our results suggest that the damage pathway may be related to the ROS generation and mitochondrial damage. The results provide novel evidence to elucidate their toxicity mechanisms and may be helpful for more rational applications of these compounds in the future. - Highlights: • NaYF{sub 4}:Eu{sup 3+} nanoparticles with three diameters have been synthesized. • NaYF{sub 4}:Eu{sup 3+} nanoparticles could be uptaken by endothelial cells (ECs). • NaYF{sub 4}:Eu{sup 3+} nanoparticles show a significant cytotoxicity on ECs. • The size of NaYF{sub 4}:Eu{sup 3+} nanoparticles may be important to their toxicology effect.
Li, H. Harold; Driewer, Joseph P.; Han, Zhaohui; Low, Daniel A.; Yang, Deshan; Xiao, Zhiyan
2014-01-01
Recent research has shown that KCl:Eu2+ has great potential for use in megavoltage radiation therapy dosimetry because this material exhibits excellent storage performance and is reusable due to strong radiation hardness. This work reports the authors’ attempts to fabricate 2D KCl:Eu2+ storage phosphor films (SPFs) using both a physical vapor deposition (PVD) method and a tape casting method. X ray diffraction analysis showed that a 10 µm thick PVD sample was composed of highly crystalline KCl. No additional phases were observed, suggesting that the europium activator had completed been incorporated into the KCl matrix. Photostimulated luminescence and photoluminescence spectra suggested that F (Cl-) centers were the electron storage centers post×ray irradiation and that Eu2+ cations acted as luminescence centers in the photostimulation process. The 150-µm thick casted KCl:Eu2+ SPF showed sub-millimeter spatial resolution. Monte Carlo simulations further demonstrated that the admixture of 20% KCl:Eu2+ and 80% low Z polymer binder exhibited almost no energy dependence in a 6 MV beam. KCl:Eu2+ pellet samples showed a large dynamic range from 0.01 cGy to 60 Gy dose-to-water, and saturated at approximately 500 Gy as a result of KCl’s intrinsic high radiation hardness. Taken together, this work provides strong evidence that KCl:Eu2+ based SPF with associated readout apparatus could result in a novel electronic film system that has all the desirable features associated with classic radiographic film and, importantly, water equivalence and the capability of permanent identification of each detector. PMID:24651448
A Novel Europium Chelate Coated Nanosphere for Time-Resolved Fluorescence Immunoassay
Shen, Yifeng; Xu, Shaohan; He, Donghua
2015-01-01
A novel europium ligand 2, 2’, 2’’, 2’’’-(4, 7-diphenyl-1, 10-phenanthroline-2, 9-diyl) bis (methylene) bis (azanetriyl) tetra acetic acid (BC-EDTA) was synthesized and characterized. It shows an emission spectrum peak at 610 nm when it is excited at 360 nm, with a large Stock shift (250 nm). It is covalently coated on the surface of a bare silica nanosphere containi free amino groups, using 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride and N-Hydroxysuccinimide. We also observed an interesting phenomenon that when BC-EDTA is labeled with a silica nanosphere, the chelate shows different excitation spectrum peaks of about 295 nm. We speculate that the carboxyl has a significant influence on its excitation spectrum. The BC-EDTA/Eu3+coated nanosphere could be used as a fluorescent probe for time-resolved fluorescence immunoassay. We labeled the antibody with the fluorescent nanosphere to develop a nanosphere based hepatitis B surface antigen as a time-resolved fluorescence immunoassay reagent, which is very easy to operate and eliminates potential contamination of Eu3+ contained in the environment. The analytical and functional sensitivities are 0.0037 μg/L and 0.08 μg/L (S/N≥2.0) respectively. The detection range is 0.08-166.67 μg/L, which is much wider than that of ELISA (0.2-5μg/L). It is comparable to the commercial dissociation-enhanced lanthanide fluoro-immunoassay system (DELFIA) reagents (0.2-145μg/L). We propose that it can fulfill clinical applications. PMID:26056826
A Novel Europium Chelate Coated Nanosphere for Time-Resolved Fluorescence Immunoassay.
Directory of Open Access Journals (Sweden)
Yifeng Shen
Full Text Available A novel europium ligand 2,2',2'',2'''-(4,7-diphenyl-1,10-phenanthroline-2,9-diyl bis (methylene bis (azanetriyl tetra acetic acid (BC-EDTA was synthesized and characterized. It shows an emission spectrum peak at 610 nm when it is excited at 360 nm, with a large Stock shift (250 nm. It is covalently coated on the surface of a bare silica nanosphere containi free amino groups, using 1-ethyl-3-(3-dimethylaminopropyl carbodiimide hydrochloride and N-Hydroxysuccinimide. We also observed an interesting phenomenon that when BC-EDTA is labeled with a silica nanosphere, the chelate shows different excitation spectrum peaks of about 295 nm. We speculate that the carboxyl has a significant influence on its excitation spectrum. The BC-EDTA/Eu3+coated nanosphere could be used as a fluorescent probe for time-resolved fluorescence immunoassay. We labeled the antibody with the fluorescent nanosphere to develop a nanosphere based hepatitis B surface antigen as a time-resolved fluorescence immunoassay reagent, which is very easy to operate and eliminates potential contamination of Eu3+ contained in the environment. The analytical and functional sensitivities are 0.0037 μg/L and 0.08 μg/L (S/N≥2.0 respectively. The detection range is 0.08-166.67 μg/L, which is much wider than that of ELISA (0.2-5 μg/L. It is comparable to the commercial dissociation-enhanced lanthanide fluoro-immunoassay system (DELFIA reagents (0.2-145 μg/L. We propose that it can fulfill clinical applications.
Energy Technology Data Exchange (ETDEWEB)
Tshabalala, Modiehi A.; Swart, Hendrik C.; Ntwaeaborwa, Odireleng M., E-mail: ntwaeab@ufs.ac.za [Department of Physics, University of the Free State, P.O Box 339, Bloemfontein 9300 South Africa (South Africa)
2014-03-15
White light emitting terbium (Tb{sup 3+}) and europium (Eu{sup 3+}) codoped strontium silicate (Sr{sub 2}SiO{sub 4}) phosphors were prepared by a solid state reaction process. The structure, particle morphology, chemical composition, ion distribution, photoluminescence (PL), and decay characteristics of the phosphors were analyzed by x-ray diffraction (XRD), scanning electron microscopy (SEM), time-of-flight secondary ion mass spectrometry (TOF-SIMS), and PL spectroscopy, respectively. The XRD data showed that our Sr{sub 2}SiO{sub 4} composed of two phases, namely, β-Sr{sub 2}SiO{sub 4} and α′-Sr{sub 2}SiO{sub 4}, and the α′-Sr{sub 2}SiO{sub 4} phase was more prominent than the β-Sr{sub 2}SiO{sub 4} phase. The SEM micrographs showed that the particles were agglomerated together and they did not have definite shapes. All ions (i.e., negative and positive) present in our materials were identified by TOF-SIMS. In addition, the chemical imaging performed with the TOF-SIMS demonstrated how the individual ions including the dopants (Eu{sup 3+} and Tb{sup 3+}) were distributed in the host lattice. White photoluminescence was observed when the Sr{sub 2}SiO{sub 4}:Tb{sup 3+}, Eu{sup 3+} phosphor was excited at 239 nm using a monochromatized xenon lamp as the excitation source. The phosphor exhibited fast decay lifetimes implying that it is not a good candidate for long afterglow applications.
Thermoluminescence of europium-doped zinc oxide exposed to beta particle irradiation
Energy Technology Data Exchange (ETDEWEB)
Iriqui R, J. L.; Cruz V, C. [Universidad de Sonora, Departamento de Investigacion en Polimeros y Materiales, Apdo. Postal 130, 83000 Hermosillo, Sonora (Mexico); Bernal, R. [Universidad de Sonora, Departamento de Investigacion en Fisica, Apdo. Postal 5-088, 83000 Hermosillo, Sonora (Mexico); Castano, V. M., E-mail: jorgeiriqui@gimmunison.com [UNAM, Instituto de Fisica, Centro de Fisica Aplicada y Tecnologia Avanzada, Apdo. Postal 1-1010, 76000 Queretaro, Qro. (Mexico)
2015-10-15
Full text: Zn O is a promising material for a range of optoelectronics applications, due to its direct wide band gap (E{sub g} ∼3.3 eV at 300 K) and large exciton binding energy (60 MeV). Its applications include UV light emitters, varistors, surface acoustic wave devices, piezoelectric transducers, and chemical and gas sensing. Rare-earth activation of phosphors has long been seen as an effective process since coupling energy into the rare-earth-ion site, either by ionization, charge exchange or a resonance energy process, results in light production. It is reported that Europium modifies the response thermoluminescence (Tl) for pure zinc oxide, when is irradiated with X-ray, created a peak at 365 degrees C. In this work, Zn O:Eu phosphors were synthesized by a chemical method. Some samples were exposed to beta particle irradiation for doses ranging from 1 up to 100 Gy. Tl response as a function of dose is linear throughout the studied dose range. The glow curve exhibits three maxima, centered at 176, 279 and 340 degrees C. The reusability studies obtained after ten repeated cycles of annealing irradiation readout for the Zn O:Eu shows that the variation in the Tl response is ten percent and tends to stabilization. The results indicate that these new Zn O:Eu phosphors are promising detectors and dosimeters for beta radiation. The structural and morphological characterization was carried out by X-ray diffraction and scanning electron microscopy, respectively. (Author)
Environmental application of cesium-137 irradiation technology: Sludges and foods
Sivinski, Jacek S.
Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation.
Household methods to reduce {sup 137}Cs contents of mushrooms
Energy Technology Data Exchange (ETDEWEB)
Kostiainen, E. [Radiation and Nuclear Safety Authority - STUK, Helsinki (Finland)
2005-09-15
High radiocaesium contents in different species of mushrooms have been observed in areas contaminated by radiocaesium deposition after the Chernobyl accident in 1986. There has been no significant reduction in the {sup 137}Cs contents of mushrooms during the past ten years, besides via radioactive decay. The internal radiation dose received via mushrooms can be reduced by processing mushrooms before consumption. Various household methods were studied to find out their efficiency to reduce {sup 137}Cs contents of mushrooms. The methods tested were the same as normally used in cooking. The tests were made for the species of edible mushrooms widely consumed. The retention factors for the treatments tested were in most cases 0.2-0.3. The efficiency of treatments in reducing the {sup 137}Cs contents increased with larger water volumes and prolonged treatment times.
Radiochemical determination of {sup 137}Cs in foods
Energy Technology Data Exchange (ETDEWEB)
Kastner, Geraldo F.; Ferreira, Andrea Vidal; Monteiro, Roberto P.G., E-mail: gfk@cdtn.br, E-mail: avf@cdtn.br, E-mail: rpgm@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2013-07-01
A determination of radionuclides in food samples is important in commodities in order to attend to regulatory requirements for international trade. As a long-lived radioisotope of cesium, {sup 137}Cs is produced as a result of human nuclear activities and than its contamination level evaluation among others radionuclides in foods is necessary. A methodology for the determination of {sup 137}Cs in foods, pork and fish, is described. The procedures covered homogenization and freeze-drying of the samples. The {sup 137}Cs was measured by gamma spectrometry using Canberra 50% HPGe detector. The counting was carried out with Monte Carlo software for detection conditions optimization including geometry and chemical data information. A certified sample, SRM IAEA-375, was analyzed in order to evaluate the reliability of the method, and the results showed good agreement between the measured and certified values. (author)
Characterization and immobilization of cesium-137 in soil at Los Alamos National Laboratory
Energy Technology Data Exchange (ETDEWEB)
Lu, Ningping; Mason, C.F.V.; Turney, W.R.J.R.
1996-06-01
At Los Alamos National Laboratory, cesium-137 ({sup 137}Cs) is a major contaminant in soils of Technical Area 21 (TA-21) and is mainly associated with soil particles {<=}2.00 mm. Cesium-137 was not leached by synthetic groundwater or acid rainwater. Soil erosion is a primary mechanism of {sup 137}Cs transport in TA-21. The methodology that controls soil particle runoff can prevent the transport of {sup 137}Cs.
Dosimetry of a Cesium 137 source; Dosimetria de una fuente de Cesio 137
Energy Technology Data Exchange (ETDEWEB)
Torres R, J.G.; Manzanares A, E.; Vega C, H.R. [Unidades Academicas de Estudios Nucleares, Universidad de Zacatecas (Mexico)
2005-07-01
It was carried out a dosimetric study of a source of Cesium 137 used in investigations of Radiobiology. This radionuclide has a half life of 30.07 years and it emits photons of 661.657 keV with a probability of 85.2%. The source has been used in a series of experiments trending to observe the cellular response before the gamma rays, as well as for the calibration of equipment of radiological protection. For such reason it is important to determine the dosimetric properties. In this work it was determined the absorbed dose that this source takes when being placed in the center from a methylmethacrylate badge to three distances, 5, 10 and 15 cm. The dose was measured with thermoluminescent dosemeters and it was calculated by means of Monte Carlo method, also was derived an expression that allows to determine the dose starting from the information of the activity of the source and of the distance regarding the same one. (Author)
Temporal variations of Cs-137 in Sots Pine; Sweden
Energy Technology Data Exchange (ETDEWEB)
Nylen, T.; Plamboeck, A.H.; Boson, J.
2008-07-01
In this study the temporal changes in 137Cs distribution in a Scots pine (Pinus Sylvestris L.) stand was studied during 1986 to 2006 in Northern Sweden. The Chernobyl fallout provided an excellent possibility to study the uptake and retention in conifer trees of 137Cs, since the deposition lasted for only a few days. The average deposition of 137Cs in the region that originates from the Chernobyl accident in 1986 was 20 +-9 kBq M-2 . Also 137Cs from the atmospheric nuclear weapons tests was present in the area and was only 3 +-2 kBq m-2. Studies show that the redistribution of radioactive caesium still contribute to high activity concentrations in some compartments of the ecosystem. It has been known that certain fungi continue to produce fruit bodies with high amounts of 137Cs. The current study adds another aspect to consider: The high activity concentration in branches and current needles during 2006 indicates an uptake of 137Cs from the soil which could lead to concentrations in Scots Pine that has to be considered in forestry and other kind of utilization of forest products. There are for instance a few game birds such as the capercaillie (Tetrao urogallus) that feed on pine shoots. Another possible effect is on the use of pine branches in the bio fuel industry. Given an activity concentration of 1200 Bq/kg (d.w.) and a concentration factor of 10 during combustion the concentration in ashes would be 12000 bq/kg. According to the recommendations from SSI (the Swedish Radiation Protection Authority) ashes that have concentrations higher than 10 kBq/kg must be stored in special deposits. It would be of interest to investigate the uptake in stands of different ages since the pine stand that was studied was about 30 years old in 1986 and do not represent neither a mature nor a newly established stand (tk)
{sup 137}Cs in a raised bog in central Sweden
Energy Technology Data Exchange (ETDEWEB)
Rosen, K. [Department of Soil and Environment, Swedish University of Agricultural Sciences, SLU, Ulls vag 17, Box 7014, SE-75007, Uppsala (Sweden)], E-mail: klas.rosen@mv.slu.se; Vinichuk, M. [Department of Soil and Environment, Swedish University of Agricultural Sciences, SLU, Ulls vag 17, Box 7014, SE-75007, Uppsala (Sweden); Department of Ecology, Zhytomyr State Technological University, 103 Cherniakhovsky Str., 10005 Zhytomyr (Ukraine); Johanson, K.J. [Department of Soil and Environment, Swedish University of Agricultural Sciences, SLU, Ulls vag 17, Box 7014, SE-75007, Uppsala (Sweden)
2009-07-15
The vertical distribution of {sup 137}Cs activity in peat soil profiles and {sup 137}Cs activity concentration in plants of various species was studied in samples collected at two sites on a raised bog in central Sweden. One site (open bog) was in an area with no trees and only a few sparsely growing plant species, while the other (low pine) was less than 100 m from the open bog site and had slowly growing Scots pine, a field layer dominated by some ericaceous plants and ground well-covered by plants. The plant samples were collected in 2004-2007 and were compared with samples collected in 1989 from the same open bog and low pine sites. Ground deposition of {sup 137}Cs in 2005 was similar at both sites, 23 000 Bq m{sup -2}. In the open bog peat profile it seems to be an upward transport of caesium since a clear peak of {sup 137}Cs activity was found in the uppermost 1-4 cm of Sphagnum layers, whereas at the low pine site {sup 137}Cs was mainly found in deeper (10-12 cm) layers. The migration rate was 0.57 cm yr{sup -1} at the open bog site and the migration centre of {sup 137}Cs was at a depth of 10.7, while the rate at the low pine site was 0.78 cm yr{sup -1} and the migration centre was at 14.9 cm. Heather (Calluna vulgaris) was the plant species with the highest {sup 137}Cs activity concentrations at both sites, 43.5 k Bq{sup -1} DM in 1989 decreasing to 20.4 in 2004-2007 on open bog and 22.3 k Bq kg{sup -1} DM in 1989 decreasing to 11.2 k Bq{sup -1} DM by the period 2004-2007 on the low pine site. {sup 137}Cs transfer factors in plants varied between 0.88 and 1.35 on the open bog and between 0.48 and 0.69 m{sup 2} kg{sup -1} DM at the low pine site.
Energy Technology Data Exchange (ETDEWEB)
Sousa, Fernanda L.C.; Cabral, Alciney M.; Silva, Ademir O.; Oliveiro, Joao B.L., E-mail: nanda_louise@yahoo.com.br [Universidade Federal do Rio Grande do Norte (UFRN), Natal (Brazil). Instituto de Quimica
2013-07-01
This work aims at synthesize and characterize mixed oxides in Barium Titanium matrix in doping with Neodymium and Europium analyzing thermogravimetric curves, characteristic bands at infrared region of the polymer complex, which are intermediates to mixed oxides, and identify the formation thereof, and the crystallinity using XRD analysis.
Energy Technology Data Exchange (ETDEWEB)
Jimenez R, M.; Solache R, M.; Rojas H, A. [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)
2000-07-01
The stability constants of lanthanides complexes with chloride ions which were determined at the same ionic force but in different media, are significantly different. It does not exist a systematic study over these stability constants. The purpose of this work is to determine the stability constants of the europium complexes with chloride ions at 303 K, by the solvents extraction method. (Author)
Scharlach, Constantin; Müller, Larissa; Wagner, Susanne; Kobayashi, Yuske; Kratz, Harald; Ebert, Monika; Jakubowski, Norbert; Schellenberger, Eyk
2016-05-01
The development of iron oxide nanoparticles for biomedical applications requires accurate histological evaluation. Prussian blue iron staining is widely used but may be unspecific when tissues contain substantial endogenous iron. Here we tested whether microscopy by laser ablation coupled to inductively coupled plasma mass spectrometry (LA-ICP-MS) is sensitive enough to analyze accumulation of very small iron oxide particles (VSOP) doped with europium in tissue sections. For synthesis of VSOP, a fraction of Fe3+ (5 wt%) was replaced by Eu3+, resulting in particles with 0.66 mol% europium relative to iron (Eu-VSOP) but with otherwise similar properties as VSOP. Eu-VSOP or VSOP was intravenously injected into ApoE-/- mice on Western cholesterol diet and accumulated in atherosclerotic plaques of these animals. Prussian blue staining was positive for ApoE-/- mice with particle injection but also for controls. LA-ICP-MS microscopy resulted in sensitive and specific detection of the europium of Eu-VSOP in liver and atherosclerotic plaques. Furthermore, calibration with Eu-VSOP allowed calculation of iron and particle concentrations in tissue sections. The combination of europium-doped iron oxide particles and LA-ICP-MS microscopy provides a new tool for specific and quantitative analysis of particle distribution at the tissue level and allows correlation with other elements such as endogenous iron.
Haleyur Giri Setty, Mohan Kumar; Liu, Jikun; Mahtani, Prerna; Zhang, Panhe; Du, Bingchen; Ragupathy, Viswanath; Devadas, Krishnakumar; Hewlett, Indira K
2016-06-01
Accurate detection and quantification of HIV-1 group O viruses have been challenging for currently available HIV assays. We have developed a novel time-resolved fluorescence (TRF) europium nanoparticle immunoassay for HIV-1 group O detection using a conventional microplate enzyme-linked immunosorbent assay (ELISA) and a microchip platform. We screened several antibodies for optimal reactivity with several HIV-1 group O strains and identified antibodies that can detect all the strains of HIV-1 group O that were available for testing. The antibodies were used to develop a conventional ELISA format assay and an in-house developed europium nanoparticle-based assay for sensitivity. The method was evaluated on both microwell plate and microchip platforms. We identified two specific and sensitive antibodies among the six we screened. The antibodies, C65691 and ANT-152, were able to quantify 15 and detect all 17 group O viruses, respectively, as they were broadly cross-reactive with all HIV-1 group O strains and yielded better signals compared with other antibodies. We have developed a sensitive assay that reflects the actual viral load in group O samples by using an appropriate combination of p24 antibodies that enhance group O detection and a highly sensitive TRF-based europium nanoparticle for detection. The combination of ANT-152 and C65690M in the ratio 3:1 was able to give significantly higher signals in our europium-based assay compared with using any single antibody.
Zaïm, Amir; Eliseeva, Svetlana V; Guénée, Laure; Nozary, Homayoun; Petoud, Stéphane; Piguet, Claude
2014-09-15
This work, based on the synthesis and analysis of chemical compounds, describes a kinetic approach for identifying intramolecular intermetallic energy-transfer processes operating in discrete polynuclear lanthanide complexes, with a special emphasis on europium-containing entities. When all coordination sites are identical in a (supra)molecular complex, only heterometallic communications are experimentally accessible and a Tb → Eu energy transfer could be evidenced in [TbEu(L5)(hfac)6] (hfac = hexafluoroacetylacetonate), in which the intermetallic separation amounts to 12.6 Å. In the presence of different coordination sites, as found in the trinuclear complex [Eu3(L2)(hfac)9], homometallic communication can be induced by selective laser excitation and monitored with the help of high-resolution emission spectroscopy. The narrow and non-degenerated character of the Eu((5)D0 ↔ (7)F0) transition excludes significant spectral overlap between donor and acceptor europium cations. Intramolecular energy-transfer processes in discrete polynuclear europium complexes are therefore limited to short distances, in agreement with the Fermi golden rule and with the kinetic data collected for [Eu3(L2)(hfac)9] in the solid state and in solution. Consequently, trivalent europium can be considered as a valuable local structural probe in discrete polynuclear complexes displaying intermetallic separation in the sub-nanometric domain, a useful property for probing lanthanido-polymers. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Bonsall, Steven D.; Houcheime, Mona; Straus, Daniel A.; Muller, Gilles
2009-01-01
The synthesis of two optical isomers of N,N′-bis(1-phenylethyl)-2,6-pyridinedicarboxamide and the constant circularly polarized luminescence (CPL) activity of their acetonitrile trivalent europium complex solutions over a long period of time open new perspectives for performing accurate routine CPL calibration tests at low cost. PMID:17728891
Wang, Dunjia; Zheng, Chunyang; Fan, Ling; Hu, Yanjun; Zheng, Jing
2014-01-03
Three novel europium complexes with 1-(4-tert-butylphenyl)-3-(2-naphthyl)-propane-1,3-dione (TNPD) and 2,2-dipyridine (Bipy) or 1,10-phenan-throline (Phen) were synthesized and confirmed by FT-IR, (1)H NMR, UV-vis absorption and elemental analysis. Photoluminescence behavior of complexes Eu(TNPD)3, Eu(TNPD)3·Bipy and Eu(TNPD)3·Phen were investigated in detail. Their emission spectra exhibited the characteristic emission bands that arise from the (5)D0→(7)FJ (J=0-4) transitions of the europium ion in solid state. Meanwhile, the results of their lifetime decay curves indicated that only one chemical environment existed around the europium ion. The intrinsic luminescence quantum efficiency (η) and the experimental intensity parameters (Ωt) of europium complexes were determined according to the emission spectra and luminescence decay curves in solid state. The complex Eu(TNPD)3·Phen showed much longer lifetime (τ) and higher luminescence quantum efficiency (η) than complexes Eu(TNPD)3 and Eu(TNPD)3·Bipy. Copyright © 2013 Elsevier B.V. All rights reserved.
Tanase, S.; Gallego, P.M.; Gelder, R. de; Fu, W.T.
2007-01-01
The reactions of pyridine-2,6-dicarboxamide with europium(III) and terbium(III) triflates led to the formation of mononuclear complexes of formula [Ln(pcam)(3)](CF3SO3)(3) (Ln = Eu 1, Tb 2; pcam stands for pyridine-2,6-dicarboxamide). From single-crystal X-ray diffraction analysis, the complexes
Souza, E R; Mazali, I O; Sigoli, F A
2014-01-01
This work reports on the synthesis, crystallographic determination and spectroscopic characterization of gadolinium(III), terbium(III) and europium(III) 3-mercaptopropionate complexes, aqua-tris(3-mercaptopropionate)lanthanide(III)--[Ln(mpa)3(H2O)]. The Judd-Ofelt intensity parameters were experimentally determined from emission spectrum of the [Eu(mpa)3(H2O)]complex and they were also calculated from crystallographic data. The complexes are coordination polymers, where the units of each complex are linked together by carboxylate groups leading to an unidimensional and parallel chains that by chemical interactions form a tridimensional framework. The emission spectrum profile of the [Eu(mpa)3(H2O)] complex is discussed based on point symmetry of the europium(III) ion, that explains the bands splitting observed in its emission spectrum. Photoluminescent analysis of the [Gd(mpa)3(H2O)] complex show no efficient ligand excitation but an intense charge transfer band. The excitation spectra of the [Eu(mpa)3(H2O)] and [Tb(mpa)3(H2O)] complexes do not show evidence of energy transfer from the ligand to the excited levels of these trivalent ions. Therefore the emission bands are originated only by direct f-f intraconfigurational excitation of the lantanide(III) ions.
Secco, Henrique de L.; Ferreira, Fabio F.; Péres, Laura O.
2018-03-01
The combination of materials to form hybrids with unique properties, different from those of the isolated components, is a strategy used to prepare functional materials with improved properties aiming to allow their application in specific fields. The doping of lanthanum fluoride with other rare earth elements is used to obtain luminescent particles, which may be useful to the manufacturing of electronic devices' displays and biological markers, for instance. The application of the powder of nanoparticles has limitations in some fields; to overcome this, the powder may be incorporated in a suitable polymeric matrix. In this work, lanthanum fluoride nanoparticles, undoped and doped with cerium and europium, were synthesized through the co-precipitation method in aqueous solution. Aiming the formation of solid state films, composites of nanoparticles in an elastomeric matrix, the nitrile rubber (NBR), were prepared. The flexibility and the transparency of the matrix in the regions of interest are advantages for the application of the luminescent composites. The composites were applied as films using the casting and the spin coating techniques and luminescent materials were obtained in the samples doped with europium and cerium. Scanning electron microscopy images showed an adequate dispersion of the particles in the matrix in both film formation techniques. Aggregates of the particles were detected in the samples which may affect the uniformity of the emission of the composites.
Wagner, Darcy E; Eisenmann, Kathryn M; Nestor-Kalinoski, Andrea L; Bhaduri, Sarit B
2013-09-01
Biocompatible nanoparticles possessing fluorescent properties offer attractive possibilities for multifunctional bioimaging and/or drug and gene delivery applications. Many of the limitations with current imaging systems center on the properties of the optical probes in relation to equipment technical capabilities. Here we introduce a novel high aspect ratio and highly crystalline europium-doped calcium phosphate nanowhisker produced using a simple microwave-assisted solution combustion synthesis method for use as a multifunctional bioimaging probe. X-ray diffraction confirmed the material phase as europium-doped hydroxyapatite. Fluorescence emission and excitation spectra and their corresponding peaks were identified using spectrofluorimetry and validated with fluorescence, confocal and multiphoton microscopy. The nanowhiskers were found to exhibit red and far red wavelength fluorescence under ultraviolet excitation with an optimal peak emission of 696 nm achieved with a 350 nm excitation. Relatively narrow emission bands were observed, which may permit their use in multicolor imaging applications. Confocal and multiphoton microscopy confirmed that the nanoparticles provide sufficient intensity to be utilized in imaging applications. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.
Talha, Sheikh M; Salminen, Teppo; Juntunen, Etvi; Spangar, Anni; Gurramkonda, Chandrasekhar; Vuorinen, Tytti; Khanna, Navin; Pettersson, Kim
2016-03-01
Hepatitis B infection, caused by hepatitis B virus (HBV), presents a huge global health burden. Serological diagnosis of HBV mainly relies on the detection of hepatitis B surface antigen (HBsAg). Although there are high sensitivity commercial HBsAg enzyme immunoassays (EIAs) available, many low-resource laboratories lacking trained technicians continue to use rapid point-of-care assays with low sensitivities for HBsAg detection, due to their simplicity to operate. We developed a time-resolved fluorometric dry-reagent HBsAg immunoassay which meets the detection limit of high sensitivity EIAs but is simple to operate. To develop the assay, anti-HBsAg monoclonal antibody coated on europium nanoparticles was dried atop of biotinylated anti-HBsAg polyclonal antibody immobilized on streptavidin-coated microtiter wells. To test a sample in dry-reagent assay, serum sample and assay buffer were added to the wells, incubated, washed and europium signals were measured. The assay showed a detection limit of 0.25 ng/ml using HBsAg spiked in serum sample. When evaluated with 24 HBV positive and 37 negative serum samples, assay showed 100% sensitivity and specificity. Assay wells are stable for at least 26 weeks when stored at 4°C, and can tolerate elevated temperatures of up to 35°C for two weeks. The developed assay has high potential to be used in low-resource laboratories. Copyright © 2016 Elsevier B.V. All rights reserved.
Butler, Stephen J; McMahon, Brian K; Pal, Robert; Parker, David; Walton, James W
2013-07-15
A series of five europium(III) complexes has been prepared from heptadentate N5O2 ligands that possess a brightness of more than 10 mM(-1) cm(-1) in water, following excitation over the range λ=330-355 nm. Binding of several oxy anions has been assessed by emission spectral titrimetric analysis, with the binding of simple carboxylates, lactate and citrate involving a common ligation mode following displacement of the coordinated water. Selectivity for bicarbonate allows the rapid determination of this anion in human serum, with K(d)=37 mM (295 K). The complexes are internalised quickly into mammalian cells and exhibit a mitochondrial localisation at early time points, migrating after a few hours to reveal a predominant lysosomal distribution. Herein, we report the synthesis and complexation behaviour of strongly emissive europium (III) complexes that bind oxy-anions in aqueous media with an affinity and selectivity profile that is distinctively different from previously studied systems. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Senthil Kumar, Kuppusamy; Schäfer, Bernhard; Lebedkin, Sergei; Karmazin, Lydia; Kappes, Manfred M; Ruben, Mario
2015-09-21
We report on the synthesis of tridentate-nitrogen pyrazole-pyridine-tetrazole (L(1)H) and pyrazole-pyridine-triazole (L(2)H) ligands and their complexation with lanthanides (Ln = Gd(iii), Eu(iii) and Tb(iii)) resulting in stable, charge-neutral complexes Ln(L(1))3 and Ln(L(2))3, respectively. X-ray crystallographic analysis of the complexes with L(1) ligands revealed tricapped trigonal coordination geometry around the lanthanide ions. All complexes show bright photoluminescence (PL) in the solid state, indicating efficient sensitization of the lanthanide emission via the triplet states of the ligands. In particular, the terbium complexes show high PL quantum yields of 65 and 59% for L(1) and L(2), respectively. Lower PL efficiencies of the europium complexes (7.5 and 9%, respectively) are attributed to large energy gaps between the triplet states of the ligands and accepting levels of Eu(iii). The triplet state energy can be reduced by introducing an electron withdrawing (EW) group at the 4 position of the pyridine ring. Such substitution of L(1)H with a carboxylic ester (COOMe) EW group leads to a europium complex with increased PL quantum yield of 31%. A comparatively efficient PL of the complexes dissolved in ethanol indicates that the lanthanide ions are shielded against nonradiative deactivation via solvent molecules.
Energy Technology Data Exchange (ETDEWEB)
Cai, Huan; Zhao, Fang; Si, Hailin; Zhang, Shuaishuai; Wang, Chunchun; Qi, Peirong [Shihezi Univ., Shihezi (China)
2012-12-15
A novel and simple method of luminescence enhancement effect for the determination of trace amounts of bile acid was proposed. The procedure was based on the luminescence intensity of the balofloxacin-europium(III) complex that could be strongly enhanced by bile acid in the presence of sodium dodecyl benzene sulfonate (SDBS). Under the optimum conditions, the enhanced luminescence intensity of the system exhibited a good linear relationship with the bile acid concentration in the range 5.0 Χ 10{sup -9} - 7.0 Χ 10{sup -7} mol L{sup -1} with a detection limit of 1.3 Χ 10{sup -9} mol L.1 (3σ). The relative standard deviation (RSD) was 1.7% (n = 11) for 5.0 Χ 10{sup -8} mol L{sup -1} bile acid. The applicability of the method to the determination of bile acid was demonstrated by investigating the effect of potential interferences and by analyzing human serum and urine samples. The possible enhancement mechanism of luminescence intensity in balofloxacin-europium(III)-bile acid-SDBS system was also discussed briefly.
Energy Technology Data Exchange (ETDEWEB)
Jimenez, J.A. [Department of Chemistry, University of Puerto Rico, Mayagueez, PR 00681 (United States); Lysenko, S. [Department of Physics, University of Puerto Rico, Mayagueez, PR 00681 (Puerto Rico); Liu, H., E-mail: hliu@uprm.ed [Department of Physics, University of Puerto Rico, Mayagueez, PR 00681 (Puerto Rico); Fachini, E.; Cabrera, C.R. [Center for Nanoscale Materials, University of Puerto Rico, Rio Piedras, PR 00931 (Puerto Rico)
2010-01-15
Europium-doped aluminophosphate glasses prepared by the melt-quenching technique have been studied by photoluminescence (PL) and X-ray photoelectron spectroscopy (XPS). The effects of silver and tin doping, and of further thermal processing on Eu{sup 3+} ions luminescence have been assessed. For the glass system containing only europium, Eu{sup 3+} PL observed under UV excitation is suggested to occur through energy transfer from the excited glass host. After silver and tin doping, an enhanced UV excited Eu{sup 3+} PL has been indicated to occur essentially due to radiative energy transfer from isolated Ag{sup +} ions and/or two fold-coordinated Sn centers. Since thermal processing of the material leads to a quenching effect on Eu{sup 3+} PL and Ag nanoparticles (NPs) formation due to reduction of silver ions by tin, XPS was employed in order to investigate the possibility for Eu{sup 3+}->Eu{sup 2+} reduction during HT as a potential source of the PL decrease. The data points towards Ag NPs as main responsible for the observed weakening of Eu{sup 3+} PL.
{sup 137}Cs in the population in inland north Sweden; {sup 137}Cs i befolkningen i Norrlands inland
Energy Technology Data Exchange (ETDEWEB)
Johansson, L.; Lindstroem, J.; Aagren, G. [Umeaa Univ. (Sweden). Dept. of Radiation Physics
1993-12-01
Whole-body measurements off {sup 134}Cs and {sup 137}Cs were performed on samples of the population at three localities in northern Sweden, that suffered different degrees of contamination at the Chernobyl accident. The localities all have significant populations of lapps, who due to their high intake of reindeer-meat have much higher levels of Cesium than the population in general. It was found that; the mean whole-body content of {sup 137}Cs is ten times higher for lapps than for the general population in areas with high contamination; the ratio between the whole-body content and the ground contamination is lower in areas with high contamination, indicating that mitigation measures have had effect; measurements on urine samples can be used to get a quick estimate of the mean {sup 137}Cs concentration of a population group. Results from the measurements are presented in several tables.
Energy Technology Data Exchange (ETDEWEB)
Jimenez-Reyes, M. [Inst. Nacional de Investigaciones Nucleares, Dept. de Quimica, Mexico, D. F. (Mexico); Univ. Autonoma Metropolitana-Iztapalapa, Area de Electroquimica, Mexico, D. F. (Mexico); Solache-Rios, M. [Inst. Nacional de Investigaciones Nucleares, Dept. de Quimica, Mexico, D. F. (Mexico); Rojas-Hernandez, A. [Univ. Autonoma Metropolitana-Iztapalapa, Area de Electroquimica, Mexico, D. F. (Mexico)
1999-07-01
The behaviour of europium in the solvent extraction system Eu{sup 3+}-water-2 M NaCl-HDBM-benzene was studied, taking into account the pC{sub H} and the carbonate ion concentration in the solutions. The stability constants for the hydrolysis and carbonate complexes of europium were determined at 303 K in the same medium by pH titration followed by a computational refinement. The obtained data were: log {beta}{sub Eu,H} = -8.29 {+-} 0.02, log {beta}{sub Eu,2H} = -16.37 {+-} 0.02, log {beta}{sub Eu,3H} = -24.54 {+-} 0.11, log {beta}{sub Eu,4H} = -34.91 {+-} 0.26, log {beta}{sub CO{sub 2}{sup 2-},H} = 9.30 {+-} 0.05, log {beta}{sub Eu,CO{sub 3}{sup 2-}} = 5.96 {+-} 0.03, log {beta}{sub Eu,CO{sub 3}{sup 2-},H} = -1.24 {+-} 0.05 and log {beta}{sub Eu,CO{sub 3}{sup 2-},2H} = -11.39 {+-} 0.11. Log K{sub W} was -13.78 {+-} 0.06. The behaviour of europium in this solvent extraction system was simulated, taking into account the hydrolysis and carbonate complexes plus the formation of Eu(DBM){sub 3}(OH){sup 1-} and Eu(DBM){sub 3}(CO{sub 3}){sup 2-} in the aqueous phase. The only europium species considered in the organic phase was Eu(DBM){sub 3}. The first hydrolysis constant of europium was also determined by using this solvent extraction system under the same conditions. A good conformity was found with the results obtained by both techniques. (orig.)
Azab, Hassan A; Hussein, Belal H M; El-Azab, Mona F; Gomaa, Mohamed; El-Falouji, Abdullah I
2013-01-01
New bis(acridine-9-carboxylate)-nitro-europium(III) dihydrate complex was synthesized and characterized. In vivo anti-angiogenic activities of bis(acridine-9-carboxylate)-nitro-europium(III) dihydrate complex against Ehrlich ascites carcinoma (EAC) cells are described. The newly synthesized complex resulted in inhibition of proliferation of EAC cells and ascites formation. The anti-tumor effect was found to be through anti-angiogenic activity as evident by the reduction of microvessel density in EAC solid tumors. The anti-angiogenic effect is mediated through down-regulation of VEGF receptor type-2 (Flk-1). The complex was also found to significantly increase the level of caspase-3 in laboratory animals compared to the acridine ligand and to the control group. This was also consistent with the DNA fragmentation detected by capillary electrophoresis that proved the apoptotic effect of the new complex. Our complex exhibited anti-angiogenic and apoptotic activity in vivo, a thing that makes it a potential effective chemotherapeutic agent. The interaction of calf thymus DNA (ct-DNA) with bis(acridine-9-carboxylate)-nitro-europium(III) dihydrate complex has been investigated using fluorescence technique. A competitive experiment of the europium(III)-acridine complex with ethidium bromide (EB) to bind DNA revealed that interaction between the europium(III)-acridine and DNA was via intercalation. The interaction of the synthesized complex with tyrosine kinases was also studied using molecular docking simulation to further substantiate its mode of action. Copyright © 2012 Elsevier Ltd. All rights reserved.
40 CFR 1.37 - Office of External Affairs.
2010-07-01
... environmental impact statements, in relation to proposed legislation and reports on legislation. The Office... Section 1.37 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL STATEMENT OF ORGANIZATION... program manager for five major programs that include: (1) The review of other agency environmental impact...
Page 1 Arabian Sea planktonic processes and organic flux 137 ...
Indian Academy of Sciences (India)
Arabian Sea planktonic processes and organic flux 137. DCM, and in traps with the benthic assemblage (s), where also differential dissolution of frustules ... plankton pigment concentrations, especially during the NE monsoon in the north. (areas 4b, 4c and Banse and English 1994b), marked interannual variability of animal.
49 CFR 37.137 - Paratransit plan development.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Paratransit plan development. 37.137 Section 37... development. (a) Survey of existing services. Each submitting entity shall survey the area to be covered by... development of its paratransit plan, including at least the following: (1) Outreach. Each submitting entity...
Energy Technology Data Exchange (ETDEWEB)
Piechotowski, I.; Jaroni, J. [Landesgesundheitsamt Baden-Wuerttemberg, Stuttgart (Germany); Link, B. [Arbeits- und Sozialministerium des Landes Baden-Wuerttemberg, Stuttgart (Germany); Groezinger, O. [Ministerium fuer Umwelt und Verkehr des Landes Baden-Wuerttemberg, Stuttgart (Germany)
2000-07-01
In 47 forest clerks from the regions Ortenau and Oberschwaben in south-west Germany the incorporation of cesium 137 and potassium 40 was measured in autumn 1994. Soil burden as well as burden of nutrition with cesium 137 are different in these regions for geological reasons and as a result of the nuclear accident of Chernobyl. Caused by low content of clay in Oberschwaben, the transfer of cesium to plants is assisted. Heavy rainfall after the nuclear accident led to an additional increase of burden. The median of the concentration of cesium 137 was 1.4 Bq/kg body weight. The median for potassium 40 was 58 Bq/kg body weight. For cesium 137 regional differences were observed. For persons from Oberschwaben the median for cesium 137 was with 2.8 Bq/kg body weight clearly higher than for persons from Ortenau with 0,6 Bq/kg body weight. Concerning nutrition habits, the clearest difference was found comparing persons who had ate a minimum of four portions of deer from the surroundings within the last four weeks with persons who had ate less than four portions of deer from the surroundings within the last four weeks. The difference was greater in Oberschwaben than in Ortenau. The effective dose of cesium 137 calculated on the basis of the incorporation is very low compared to natural radiation. This is also valid for persons from Oberschwaben. (orig.) [German] Im Herbst 1994 wurde bei insgesamt 47 Bediensteten der Forstverwaltung aus den Regionen Ortenaukreis und Oberschwaben die Inkorportation an Caesium 137 und Kalium 40 gemessen. Sowohl die Bodenbelastung als auch die Belastung von Nahrungsmitteln mit Caesium 137 unterscheiden sich in diesen Gebieten bedingt durch geologische Besonderheiten und in Folge des Reaktorunfalls von Tschernobyl. Aufgrund eines geringen Anteils an Tonerden wird in Oberschwaben der Caesiumtransfer in Pflanzen beguenstigt, eine zusaetzliche Erhoehung der Belastung erfolgte durch starke Niederschlaege nach dem Reaktorunfall. Die Konzentration fuer
Europium(III) reduction and speciation within a Wells-Dawson heteropolytungstate.
Jing, Jing; Burton-Pye, Benjamin P; Francesconi, Lynn C; Antonio, Mark R
2008-08-04
The redox speciation of Eu(III) in the 1:1 stoichiometric complex with the alpha-1 isomer of the Wells-Dawson anion, [alpha-1-P 2W 17O 61] (10-), was studied by electrochemical techniques (cyclic voltammetry and bulk electrolysis), in situ XAFS (X-ray absorption fine structure) spectroelectrochemistry, NMR spectroscopy ( (31)P), and optical luminescence. Solutions of K 7[(H 2O) 4Eu(alpha-1-P 2W 17O 61)] in a 0.2 M Li 2SO 4 aqueous electrolyte (pH 3.0) show a pronounced concentration dependence to the voltammetric response. The fully oxidized anion and its reduced forms were probed by Eu L 3-edge XANES (X-ray absorption near edge structure) measurements in simultaneous combination with controlled potential electrolysis, demonstrating that Eu(III) in the original complex is reduced to Eu(II) in conjunction with the reduction of polyoxometalate (POM) ligand. After exhaustive reduction, the heteropoly blue species with Eu(II) is unstable with respect to cluster isomerization, fragmentation, and recombination to form three other Eu-POMs as well as the parent Wells-Dawson anion, alpha-[P 2W 18O 62] (6-). EXAFS data obtained for the reduced, metastable Eu(II)-POM before the onset of Eu(II) autoxidation provides an average Eu-O bond length of 2.55(4) A, which is 0.17 A longer than that for the oxidized anion, and consistent with the 0.184 A difference between the Eu(II) and Eu(III) ionic radii. The reduction of Eu(III) is unusual among POM complexes with Lindqvist and alpha-2 isomers of Wells-Dawson anions, that is, [Eu(W 5O 18) 2] (9-) and [Eu(alpha-2-As 2W 17O 61) 2] (17-), but not to the Preyssler complex anion, [EuP 5W 30O 110] (12-), and fundamental studies of materials based on coupling Eu and POM redox properties are still needed to address new avenues of research in europium hydrometallurgy, separations, and catalysis sciences.
Energy Technology Data Exchange (ETDEWEB)
Kusrini, Eny, E-mail: ekusrini@che.ui.ac.id [Department of Chemical Engineering, Faculty of Engineering, Universitas Indonesia, 16424 Depok (Indonesia); Saleh, Muhammad I.; Adnan, Rohana [School of Chemical Sciences, Universiti Sains Malaysia, 11800 Penang (Malaysia); Yulizar, Yoki [Department of Chemistry, Faculty of Mathematics and Natural Sciences, Universitas Indonesia, 16424 Depok (Indonesia); Sha Shiong, Ng; Fun, H.K. [School of Physics, Universiti Sains Malaysia, 11800 Penang (Malaysia); Adhha Abdullah, M.A.; Mamat, Mazidah [Department of Chemical Sciences, Faculty of Science and Technology, Universiti Malaysia Terengganu, 21030 Kuala Terengganu, Terengganu Darul Iman (Malaysia); Za' aba, N.K.; Abd. Majid, W.H. [Solid State Research Laboratory, Department of Physics, Universiti Malaya, 50603 Kuala Lumpur (Malaysia)
2012-01-15
A new europium complex [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75H{sub 2}O was synthesized and used as the emission material for the single layer device structure of ITO/EO4-Eu-Pic/Al, using a spin-coating technique. Study on the optical properties of the [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75H{sub 2}O complex where EO4=tetraethylene glycol and Pic=picrate anion, had to be undertaken before being applicable to the study of an organic light emitting diode (OLED). The electrical property of an OLED using current-voltage (I-V) measurement was also studied. In complex, the Eu(III) ion was coordinated with the EO4 ligand as a pentadentate mode, one water molecule, and with two Pic anions as bidentate and monodentate modes, forming a nine-coordination number. The photoluminescence (PL) spectra of the crystalline complex in the solid state and its thin film showed a hypersensitive peak at 613.5-614.9 nm that assigned to the {sup 5}D{sub 0}{yields}{sup 7}F{sub 2} transition. A narrow band emission from the thin film EO4-Eu-Pic was obtained. The typical semiconductor I-V curve of device ITO/EO4-Eu-Pic/Al showed the threshold and turn on voltages at 1.08 and 4.6 V, respectively. The energy transfer process from the ligand to the Eu(III) ion was discussed by investigating the excitation and PL characteristics. Effect of the picrate anion on the device performance was also studied. - Highlights: > The [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75(H{sub 2}O) is crystallized in triclinic with space group P-1. > The complex is applied as a emissive center in single layer device structure of ITO/EO4-Eu-Pic/Al. > The complex displays a red luminescence in both the crystalline complex and its thin film state. > The low turn on voltage of the device (4.6 V), indicating that this material is suitable for OLED. > The roughness and morphology of the thin film affects luminance and electrical properties of OLED.
Distribution of 137Cs Radionuclide in Industrial Wastes Effluents of Gresik, East Java, Indonesia
Directory of Open Access Journals (Sweden)
Muslim
2015-04-01
Full Text Available The distribution of anthropogenic radionuclides 137Cs was measured from industrial waste effluent of Gresik to Gresik Sea in east Java, Indonesia. The activity of 37Cs detected at all stations was much lower than in northeast Japan both before and after NPP Fukushima accident. This indicated that in Gresik industrials waste did not consist of 137Cs. The lowest activity 137Cs occurred at the station nearest to the industrial waste effluent that contained some particle ions that were able to scavenge 137Cs and then precipate this radionuclide. Furthermore, the greatest 137Cs occured at the station that has high current speeds that stirred up sediment to release 137Cs in seawater as a secondary source. The lowest salinity did not effect on the activity of 137Cs even though the lowest salinity and activity 137Cs occured at the same station
Contribution of Asian dust to atmospheric deposition of radioactive cesium ((137)Cs).
Fukuyama, Taijiro; Fujiwara, Hideshi
2008-11-01
Both Asian dust (kosa) transported from the East Asian continent and locally suspended dust near monitoring sites contribute to the observed atmospheric deposition of (137)Cs in Japan. To estimate the relative contribution of these dust phenomena to the total (137)Cs deposition, we monitored weekly deposition of mineral particles and (137)Cs in spring. Deposition of (137)Cs from a single Asian dust event was 62.3 mBq m(-2) and accounted for 67% of the total (137)Cs deposition during the entire monitoring period. Furthermore, we found high (137)Cs specific activity in the Asian dust deposition sample. Although local dust events contributed to (137)Cs deposition, their contribution was considerably smaller than that of Asian dust. We conclude that the primary source of atmospheric (137)Cs in Japan is dust transported from the East Asian continent.
Synthesis of Luminescent Ink from Europium-Doped Y2O3 Dispersed in Polyvinyl Alcohol Solution
Directory of Open Access Journals (Sweden)
Astuti
2009-01-01
Full Text Available Luminescent ink from europium-doped Y2O3 ( Y2O3:Eu has been synthesized by two steps method: first, synthesis of luminescent powder of Y2O3:Eu by simple heating of metallic nitrates in a polymer solution and second, dispersing the powder in a polyvinyl alcohol (PVA solution. The stability of the ink (luminescent colloid was strongly affected by mixing process of the powder and the solution. Mixing process must be performed for a long time (about 8 hours at above room temperature to product stable colloids. We observed that mixing at 30–40∘C resulted in a stable and highly dispersed colloid. The writing test was performed on a white paper to show the potential use of the colloid for making security codes.
Neil, Emily R; Fox, Mark A; Pal, Robert; Parker, David
2016-05-17
Two bright, europium(iii) complexes based on an achiral heptadentate triazacyclononane ligand bearing two strongly absorbing chromophores have been evaluated for the selective emission and CPL signalling of various chiral O-phosphono-anions. Binding of O-phosphono-Ser and Thr gives rise to a strong induced CPL signature and a favoured Δ complex configuration is adopted. A similarly large induced CPL signal arises when [Eu·](2+) binds to lysophosphatidic acid (LPA), where the strong binding (log K 5.25 (295 K)) in methanol allowed its detection over the range 5 to 40 μM. Strong and chemoselective binding to the phosphorylated amino-acid residues was also observed with a set of four structurally related hexapeptides: in one case, the sign of the gem value in the ΔJ = 1 transition allowed differentiation between the binding to O-P-Ser and O-P-Tyr residues.
A new europium(III)-β-diketonate complex based on diphenylethyne as red phosphors applied in LED
Energy Technology Data Exchange (ETDEWEB)
Shao, Guang, E-mail: shaog@mail.sysu.edu.cn [School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou 510275 (China); Zhang, Na; Lin, Duan [School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou 510275 (China); Feng, Kenjun [Department of Chemical Engineering, Hui-Zhou University, Huizhou 516007 (China); Cao, Rihui, E-mail: caorihui@mail.sysu.edu.cn [School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou 510275 (China); Gong, Menglian [School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou 510275 (China)
2013-06-15
A new europium(III) ternary complex based on a fluorinated β-diketonate ligand and 1,10-phenanthroline as an ancillary ligand has been prepared and evaluated as a candidate for light-emitting diode (LED). The complex exhibits a high decomposition temperature (316 °C). Photophysical properties such as FT-IR spectra, UV–vis absorption spectra, excitation and emission spectra, luminescence decay curve and quantum yield were investigated. The excitation band is well matched with the characteristic emission of 395 nm-emitting InGaN chips. The complex exhibits an efficient energy transfer pathway from the ligands to the central Eu{sup 3+} ion via a ligand-sensitized luminescence process. An intense red-emitting LED was fabricated by coating the complex onto a 395 nm-emitting InGaN chip, and its Commission International de I'Eclairage (CIE) chromaticity coordinate (x=0.6389, y=0.3255) is close to the National Television Standard Committee (NTSC) standard value for red color. Meanwhile, the energy transfer from the InGaN chip to the complex is very efficient. All the findings demonstrate the potential application of the Eu(III) complex as red-emitting phosphors for UV-based white LEDs. -- Highlights: ► A new europium(III)-β-diketonate complex was synthesized and characterized. ► Thermal stability and photophysical properties were investigated in detail. ► PL mechanism was proposed to involve a ligand-sensitized luminescence process. ► An intense red-emitting LED was fabricated by using the complex. ► CIE chromaticity coordinate is close to NTSC standard value for red color.
Sun, Jingyan; Song, Bo; Ye, Zhiqiang; Yuan, Jingli
2015-12-21
Singlet oxygen ((1)O2) plays a key role in the photodynamic therapy (PDT) technique of neoplastic diseases. In this work, by using a 9,10-dimethyl-2-anthryl-containing β-diketone, 1,1,1,2,2-pentafluoro-5-(9',10'-dimethyl-2'-anthryl)-3,5-pentanedione (Hpfdap), as a (1)O2-recognition ligand, a novel β-diketonate-europium(III) complex that can act as a luminescence probe for (1)O2, [Eu(pfdap)3(tpy)] (tpy = 2,2',2″-terpyridine), has been designed and synthesized for the time-gated luminescence detection of (1)O2 in living cells. The complex is weakly luminescent due to the quenching effect of 9,10-dimethyl-2-anthryl groups. After reaction with (1)O2, accompanied by the formation of endoperoxides of 9,10-dimethyl-2-anthryl groups, the luminescence quenching disappears, so that the long-lived luminescence of the europium(III) complex is switched on. The complex showed highly selective luminescence response to (1)O2 with a remarkable luminescence enhancement. Combined with the time-gated luminescence imaging technique, the complex was successfully used as a luminescent probe for the monitoring of the time-dependent generation of (1)O2 in 5-aminolevulinic acid (a PDT drug) loaded HepG2 cells during the photodynamic process. In addition, by coloading the complex and a mitochondrial indicator, Mito-Tracker Green, into HepG2 cells, the specific localization of [Eu(pfdap)3(tpy)] molecules in mitochondria of HepG2 cells was demonstrated by confocal fluorescence imaging measurements.
Surface erosion assessment using 137 Cs: examples from New Zealand
Basher, L. R.
2000-01-01
The 137Cs technique has provided the first quantitative, medium-term data on rates of soil redistribution by surface erosion on both cropland and rangeland in New Zealand. Use of the technique has demonstrated: high rates of soil redistribution by water erosion at two cropland sites under intensive vegetable production; a slow rate of net loss of soil by wind erosion associated with arable farming; a strong association between vegetation depletion and wind erosion on grazed rangeland. Re...
21 CFR 137.290 - Self-rising yellow corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Self-rising yellow corn meal. 137.290 Section 137... Cereal Flours and Related Products § 137.290 Self-rising yellow corn meal. Self-rising yellow corn meal conforms to the definition and standard of identity prescribed by § 137.270 for self-rising white corn meal...
Observation of the Nuclear Magnetic Octupole Moment of 137Ba+
Hoffman, Matthew
Single trapped ions are ideal systems in which to test atomic physics at high precision, which can in turn be used for searches for violations of fundamental symmetries and physics beyond the standard model, in addition to quantum computation and a number of other applications. The ion is confined in ultra-high vacuum, is laser cooled to mK temperatures, and kept well isolated from the environment which allows these experimental efforts. In this thesis, a few diagnostic techniques will be discussed, covering a method to measure the linewidth of a narrowband laser in the presence of magnetic field noise, as well as a procedure to measure the ion's temperature using such a narrowband laser. This work has led to two precision experiments to measure atomic structure in 138Ba+, and 137Ba+ discussed here. First, employing laser and radio frequency spectroscopy techniques in 138Ba+, we measured the Lande- gJ factor of the 5D5/2 level at the part-per-million level, the highest precision to date. Later, the development of apparatus to efficiently trap and laser cool 137Ba+ has enabled a measurement of the hyperfine splittings of the 5D3/2 manifold, culminating in the observation of the nuclear magnetic octupole moment of 137Ba+.
42 CFR 137.32 - Is a compact required to participate in self-governance?
2010-10-01
...-governance? 137.32 Section 137.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.32 Is a compact required to participate in self-governance? Yes, Tribes must have a...
29 CFR 780.137 - Practices must be performed in connection with farmer's own farming.
2010-07-01
... farming. 780.137 Section 780.137 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION... FAIR LABOR STANDARDS ACT General Scope of Agriculture âsuch Farming Operationâ-of the Farmer § 780.137 Practices must be performed in connection with farmer's own farming. “Practices * * * performed by a farmer...
42 CFR 137.246 - How does a Self-Governance Tribe retrocede a PSFA?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false How does a Self-Governance Tribe retrocede a PSFA? 137.246 Section 137.246 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Retrocession § 137...
42 CFR 137.133 - What does a final offer contain?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What does a final offer contain? 137.133 Section 137.133 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Final Offer § 137.133 What does a...
42 CFR 137.132 - How does the Indian Tribe submit a final offer?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false How does the Indian Tribe submit a final offer? 137.132 Section 137.132 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Final Offer § 137...
42 CFR 137.130 - What is covered by this subpart?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What is covered by this subpart? 137.130 Section 137.130 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Final Offer § 137.130 What is...
42 CFR 137.247 - What is the effective date of a retrocession?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What is the effective date of a retrocession? 137.247 Section 137.247 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Retrocession § 137...
42 CFR 137.236 - When does a withdrawal become effective?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false When does a withdrawal become effective? 137.236 Section 137.236 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Withdrawal § 137.236 When does a...
42 CFR 137.31 - What is included in a compact?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What is included in a compact? 137.31 Section 137.31 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.31 What is...
42 CFR 137.131 - When should a final offer be submitted?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false When should a final offer be submitted? 137.131 Section 137.131 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Final Offer § 137.131 When should...
42 CFR 137.134 - When does the 45 day review period begin?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false When does the 45 day review period begin? 137.134 Section 137.134 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Final Offer § 137.134 When does...
14 CFR 137.42 - Fastening of safety belts and shoulder harnesses.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fastening of safety belts and shoulder harnesses. 137.42 Section 137.42 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... AGRICULTURAL AIRCRAFT OPERATIONS Operating Rules § 137.42 Fastening of safety belts and shoulder harnesses. No...
45 CFR 13.7 - Studies, exhibits, analyses, engineering reports, tests and projects.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Studies, exhibits, analyses, engineering reports, tests and projects. 13.7 Section 13.7 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT IN AGENCY PROCEEDINGS General Provisions § 13.7 Studies, exhibits, analyses,...
42 CFR 137.301 - How are project and program environmental review costs identified?
2010-10-01
... development to identify program and project related costs associated with carrying out environmental... costs identified? 137.301 Section 137.301 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND... Construction Nepa Process § 137.301 How are project and program environmental review costs identified? (a) The...
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-10-26
This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137
Energy Technology Data Exchange (ETDEWEB)
Ancellin, J.; Michon, G.; Vilquin, A. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1965-07-01
The authors describe first of all the technique used for the determination of cesium 137 concentration factors in the pink shrimp (Leander Serratus Pennant). Experiments over three months have shown that the specific activity of the shrimps becomes stable between the thirtieth and the fortieth day. The concentration factors then have values between 30 and 40. These results are similar to those obtained by other authors. (authors) [French] Les auteurs decrivent tout d'abord la technique utilisee pour la determination des facteurs de concentration du Cesium 137 chez la crevette rose (Leander Serratus Pennant). Le resultat des experimentations menees pendant trois mois montre que l'activite specifique des crevettes se stabilise entre le trentieme et le quarantieme jour. Les facteurs de concentration se situent alors entre 30 et 40, Ces donnees sont comparables a celles obtenues par d'autres auteurs. (auteur)
Energy Technology Data Exchange (ETDEWEB)
Vianello, E.A.; Almeida, C.E. de [Laboratorio de Ciencias Radiologicas- LCR-DBB (UERJ). R. Sao Francisco Xavier, 524- Pav. HLC, sala 136 terreo- CEP 20.550- 013. Rio de Janeiro (Brazil)
1998-12-31
In this work the experimental determination of correction factor for fluence divergence (kln) of linear Cs-137 sources CDCS J4, with Farmer ionization chamber model 2571 in a central and perpendicular plan to source axis, for distances range from 1 to 7 cm., has been presented. The experimental results were compared to calculating by Kondo and Randolph (1960) isotropic theory and Bielajew (1990) anisotropic theory. (Author)
Smirnova, T. D.; Shtykov, S. N.; Kochubei, V. I.; Khryachkova, E. S.
2011-01-01
The complexation of Eu3+ with doxycycline (DC) antibiotic in the presence of several second ligands and surfactant micelles of different types is studied by the spectrophotometric and luminescence methods. It is found that the efficiency of excitation energy transfer in Eu3+-DC chelate depends on the nature of the second ligand and surfactant micelles. Using thenoyltrifluoroacetone (TTA) as an example, it is shown that the second ligand additionally sensitizes the europium fluorescence, and the possibility of intermediate sensitization of DC and then of europium is shown by the example of 1,10-phenanthroline. In all cases, the excitation energy transfer efficiency was increased due to the so-called antenna effect. The decay kinetics of the sensitized fluorescence of the binary and mixed-ligand chelates in aqueous and micellar solutions of nonionic surfactants is studied and the relative quantum yields and lifetimes of fluorescence are determined.
Li, Hongguang; Xie, Chen; Lan, Rongfeng; Zha, Shuai; Chan, Chi-Fai; Wong, Wing-Yan; Ho, Ka-Lok; Chan, Brandon Dow; Luo, Yuxia; Zhang, Jing-Xiang; Law, Ga-Lai; Tai, William C S; Bünzli, Jean-Claude G; Wong, Ka-Leung
2017-11-09
A unique, dual-function, photoactivatable anticancer prodrug, RuEuL, has been tailored that features a ruthenium(II) complex linked to a cyclen-europium chelate via a π-conjugated bridge. Under irradiation at 488 nm, the dark-inactive prodrug undergoes photodissociation, releasing the DNA-damaging ruthenium species. Under evaluation-window irradiation (λirr = one-photon 350 nm or two-photon 700 nm), the drug delivery process can be quantitatively monitored in real-time because of the long-lived red europium emission. Linear relationships between released drug concentration and ESI-MS or luminescence responses are established. Finally, the efficiency of the new prodrug is demonstrated both in vitro RuEuL anticancer prodrug over some existing ones and open the way for decisive improvements in multipurpose prodrugs.
Energy Technology Data Exchange (ETDEWEB)
Dubey, Vikas, E-mail: jsvikasdubey@gmail.com [Department of Physics, Bhilai Institute of Technology Raipur, 493661 (India); Tiwari, Neha [Department of Physics, Govt. Model Science College, Jabalpur (India)
2016-05-06
Behavior displayed by europium doped AZrO{sub 3} phosphor which was synthesized by solid state reaction method. For synthesis of BaZrO{sub 3}, SrZrO{sub 3} and CaZrO{sub 3} phosphor with fixed concentration of europium ion was calcination at 1000°C and sintered at 1300°C following intermediate grinding. Synthesized sample was characterized by X-ray diffraction analysis and crystallite sized was calculated by Scherer’s formula. From PL spectra of prepared phosphors shows intense emission centred at 612nm (red emission) with high intensity for SrZrO{sub 3}:Eu{sup 3+}. For europium doped BaZrO{sub 3} and CaZrO{sub 3} (613nm) phosphor shows less intense PL spectra as compared to SrZrO{sub 3}:Eu{sup 3+}. The strong emission peak of AZrO{sub 3}:Eu{sup 3+} phosphor is due to forced electric dipole transition of {sup 5}D{sub 0} to {sup 7}F{sub 2} centered at 612 and 613nm. It is characteristic red emission for europium ion. The excitation spectra of AZrO{sub 3}:Eu{sup 3+} phosphor mainly consists of the charge transfer and (CTB) of Eu{sup 3+} located in 200–350 nm centred at 254nm. The present phosphors can act as single host for red light emission in display devices. The CIE coordinates were calculated by Spectrophotometric method using the spectral energy distribution of the AZrO{sub 3}:Eu{sup 3+} sample.
Rybak, Jens-Christoph; Hailmann, Michael; Matthes, Philipp R; Zurawski, Alexander; Nitsch, Jörn; Steffen, Andreas; Heck, Joachim G; Feldmann, Claus; Götzendörfer, Stefan; Meinhardt, Jürgen; Sextl, Gerhard; Kohlmann, Holger; Sedlmaier, Stefan J; Schnick, Wolfgang; Müller-Buschbaum, Klaus
2013-05-08
The rare case of a metal-triggered broad-band yellow emitter among inorganic-organic hybrid materials was achieved by in situ codoping of the novel imidazolate metal-organic framework ∞(3)[Ba(Im)2] with divalent europium. The emission maximum of this dense framework is in the center of the yellow gap of primary light-emitting diode phosphors. Up to 20% Eu2+ can be added to replace Ba2+ as connectivity centers without causing observable phase segregation. High-resolution energy-dispersive X-ray spectroscopy showed that incorporation of even 30% Eu2+ is possible on an atomic level, with 2-10% Eu2+ giving the peak quantum efficiency (QE = 0.32). The yellow emission can be triggered by two processes: direct excitation of Eu2+ and an antenna effect of the imidazolate linkers. The emission is fully europium-centered, involving 5d → 4f transitions, and depends on the imidazolate surroundings of the metal ions. The framework can be obtained by a solvent-free in situ approach starting from barium metal, europium metal, and a melt of imidazole in a redox reaction. Better homogeneity for the distribution of the luminescence centers was achieved by utilizing the hydrides BaH2 and EuH2 instead of the metals.
Directory of Open Access Journals (Sweden)
Jorge García-Glez
2017-09-01
Full Text Available α-Ti(HPO42·H2O (α-TiP and its propylamine intercalation product, Ti(HPO42·2C3H7NH2·H2O (α-TiPPr, have been synthesized and characterized. Later, their sorption capacity for europium(III was investigated, and this purpose was accomplished by treating α-TiP and α-TiPPr with europium(III nitrate solutions at different concentrations until the equilibrium is reached. All samples were characterized, among others, by powder X-ray diffraction (PXRD, scanning and transmission electron microscopies (SEM, TEM, STEM-EDX, SAED, thermogravimetric analysis (TGA, and photoluminescence (PL measurements. The results show that the Eu3+ uptake is limited to surface when α-TiP is used as sorbent. Nevertheless, the Eu-retention is considerably enhanced with α-TiPPr as a consequence of an ion-exchange process into the interlayer space of the layered titanium phosphate (involving propylammonium cations, C3H7NH3+, and hexahydrate europium(III species, [Eu(H2O6]3+, and the crystal structure of a hypothetical final product, α-[Eu(H2O6]2/3Ti(PO42·[(H2O6]1/3, has been proposed by using DFT calculations.
Fukushima 137Cs at the base of planktonic food webs off Japan
Baumann, Z.; Fisher, N. S.; Gobler, C. J.; Buesseler, K. O.; George, J. A.; Breier, C. F.; Nishikawa, J.
2015-12-01
The potential bioaccumulation of 137Cs in marine food webs off Japan became a concern following the release of radioactive contaminants from the damaged Fukushima nuclear power plant into the coastal ocean. Previous studies suggest that 137Cs activities increase with trophic level in pelagic food webs, however, the bioaccumulation of 137Cs from seawater to primary producers, to zooplankton has not been evaluated in the field. Since phytoplankton are frequently the largest component of suspended particulate matter (SPM) we used SPM concentrations and particle-associated 137Cs to understand bioaccumulation of 137Cs in through trophic pathways in the field. We determined particle-associated 137Cs for samples collected at 20 m depth from six stations off Japan three months after the initial release from the Fukushima nuclear power plant. At 20 m SPM ranged from 0.65 to 1.60 mg L-1 and rapidly declined with depth. The ratios of particulate organic carbon to chlorophyll a suggested that phytoplankton comprised much of the SPM in these samples. 137Cs activities on particles accounted for on average 0.04% of the total 137Cs in seawater samples, and measured concentration factors of 137Cs on small suspended particles were comparatively low (∼102). However, when 137Cs in crustacean zooplankton was derived based only on modeling dietary 137Cs uptake, we found predicted and measured 137Cs concentrations in good agreement. We therefore postulate the possibility that the dietary route of 137Cs bioaccumulation (i.e., phytoplankton ingestion) could be largely responsible for the measured levels in the copepod-dominated (%) zooplankton assemblages in Japanese coastal waters. Finally, our data did not support the notion that zooplankton grazing on phytoplankton results in a biomagnification of 137Cs.
Phenotype-gene: 137 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 137 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1135i decreased leng...th in organ named hypocotyl for AT1G48380 Sugimoto-Shirasu Keiko et al. 2005 Dec. Proc. Natl. Acad. Sci. U.S....A. 102(51):18736-41. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16339310i decreased length i
Yamaji, Keiko; Nagata, Satoshi; Haruma, Toshikatsu; Ohnuki, Toshihiko; Kozaki, Tamotsu; Watanabe, Naoko; Nanba, Kenji
2016-03-01
We found that root endophytes of (137)Cs accumulator plant produce siderophores, resulting in the desorption of (137)Cs from the contaminated soil collected at Fukushima, Japan. We selected an endemic Japanese deciduous tree, Eleutherococcus sciadophylloides (Franch. et Sav), that accumulates high concentrations of (137)Cs and Mn. Root endophytic bacteria were isolated from E. sciadophylloides and microbial siderophore production was evaluated via chrome azurol S (CAS) Fe and CAS Al assays. Of the 463 strains that we isolated, 107 (23.1%) produced the siderophores. Using eight strains that showed high siderophore production in our assays, we examined desorption of (137)Cs, Mn, Fe and Al by the bacterial culture filtrates from (137)Cs-contaminated soil after decomposing the soil organic matter using hydrogen peroxide. We found (137)Cs and Mn desorption concomitant with Al and Fe desorption, as well as a decrease of pH. We also detected succinic acid, a well-known siderophore, in the bacterial culture filtrates of our two root endophytic bacteria. Our results strongly suggest that the root endophytic bacteria of E. sciadophylloides produce the siderophores that enhance (137)Cs and Mn desorption in the rhizosphere, making the resulting (137)Cs and Mn ions easier for E. sciadophylloides to absorb from the rhizosphere. Copyright © 2015 Elsevier Ltd. All rights reserved.
Electron tunneling transport across heterojunctions between europium sulfide and indium arsenide
Kallaher, Raymond L.
This dissertation presents research done on utilizing the ferromagnetic semiconductor europium sulfide (EuS) to inject spin polarized electrons into the non-magnetic semiconductor indium arsenide (InAs). There is great interest in expanding the functionality of modern day electronic circuits by creating devices that depend not only on the flow of charge in the device, but also on the transport of spin through the device. Within this mindset, there is a concerted effort to establish an efficient means of injecting and detecting spin polarized electrons in a two dimensional electron system (2DES) as the first step in developing a spin based field effect transistor. Thus, the research presented in this thesis has focused on the feasibility of using EuS, in direct electrical contact with InAs, as a spin injecting electrode into an InAs 2DES. Doped EuS is a concentrated ferromagnetic semiconductor, whose conduction band undergoes a giant Zeeman splitting when the material becomes ferromagnetic. The concomitant difference in energy between the spin-up and spin-down energy bands makes the itinerant electrons in EuS highly spin polarized. Thus, in principle, EuS is a good candidate to be used as an injector of spin polarized electrons into non-magnetic materials. In addition, the ability to adjust the conductivity of EuS by varying the doping level in the material makes EuS particularly suited for injecting spins into non-magnetic semiconductors and 2DES. For this research, thin films of EuS have been grown via e-beam evaporation of EuS powder. This growth technique produces EuS films that are sulfur deficient; these sulfur vacancies act as intrinsic electron donors and the resulting EuS films behave like heavily doped ferromagnetic semiconductors. The growth parameters and deposition procedures were varied and optimized in order to fabricate films that have minimal crystalline defects. Various properties and characteristics of these EuS films were measured and compared to
Energy Technology Data Exchange (ETDEWEB)
Lestaevel, P.; Racine, R.; Bensoussan, H.; Rouas, C.; Gueguen, Y.; Dublineau, I.; Bertho, J.M.; Gourmelon, P.; Jourdain, J.R.; Souidi, M. [Institut de Radioprotection et de Surete Nucleaire, IRSN, laboratoire de radiotoxicologie experimentale, direction de la radioprotection de l' homme, 92 - Fontenay-aux-Roses (France)
2010-02-15
Caesium-137 ({sup 137}Cs) is a radionuclide present in the environment mainly as the result of the atmospheric nuclear weapons testing and accidents arising in nuclear power plants like the Chernobyl accident in 1986. Nowadays, the health consequences resulting from a chronic exposure to this radionuclide remain unknown. After absorption, the caesium is distributed relatively homogeneously within the body, with a more important load in children than in adults. The toxicity of {sup 137}Cs is mainly due to its radiological properties. A high dose of {sup 137}Cs is responsible for a medullar dystrophy, disorders of the reproductive function, and effects on liver and renal functions. Disorders of bone mineralization and brain damages were also described in human beings. At lowest dose, {sup 137}Cs induces disturbances of wakefulness-sleep cycle, but not accompanied with behavioural disorders. The cardiovascular system was also perturbed. Biological effects of {sup 137}Cs on the metabolisms of the vitamin D, cholesterol and steroid hormones were described, but do not lead to clinical symptoms. In human beings, {sup 137}Cs leads to an immune deficiency, congenital and foetal deformations, an increased of thyroid cancer, as well as neurological disorders. It seems that children are more sensitive to the toxic effects of caesium than the adults. At present, the only effective treatment for the decorporation of the ingested {sup 137}Cs is the Prussian Blue (Radiogardase). The use of pectin to de-corporate the ingested {sup 137}Cs, in children notably, is sometimes proposed, but its administration still remains an open question. To conclude, the available scientific data suggest that {sup 137}Cs could affect a number of physiological and metabolic functions and consequently, could participate in the health risks associated to the presence of other contaminants in the environment. (authors)
Nandal, Poonam; Khatkar, S P; Kumar, Rajesh; Khatkar, Avni; Taxak, V B
2017-01-01
Synthesis and photoluminescence behaviour of six novel europium complexes with novel β-hydroxyketone ligand, 2-(4-chlorophenyl)-1-(2-hydroxy-4-methoxyphenyl)ethan-1-one (CHME) and 2,2'-bipyridine (bipy) or neocuproine (neo) or 1,10-phenanthroline (phen) or 5,6-dimethyl-1,10-phenanthroline (dmphen) or bathophenanthroline (bathophen) were reported in solid state. The free ligand CHME and europium complexes, Eu(CHME)3.2H2O [1] Eu(CHME)3.bipy [2], Eu(CHME)3.neo [3], Eu(CHME)3.phen [4], Eu(CHME)3.dmphen [5] and Eu(CHME)3.bathophen [6]were characterized by elemental analysis, FT-IR and 1H-NMR. The photoluminescence emission spectra exhibited four characteristic peaks arising from the 5D0 → 7FJ (J = 1-4) transitions of the europium ion in the solid state on monitoring excitation at λex = 395 nm. The luminescence decay curves of these europium complexes possess single exponential behaviour indicating the presence of a single luminescent species and having only one site symmetry in the complexes. The luminescence quantum efficiency (η) and the experimental intensity parameters, Ω 2 and Ω 4 of europium complexes have also been calculated on the basis of emission spectra and luminescence decay curves. In addition, the antimicrobial and antioxidant activities were also studied of the investigated complexes.
90Sr and 137Cs in Arctic echinoderms.
Saniewski, Michał; Borszcz, Tomasz
2017-11-15
Radionuclides in the Arctic echinoderms have seldom been studied despite their considerable environmental importance. This manuscript covers the results of 90Sr and 137Cs measurements in common echinoderm taxa collected from the Svalbard Bank in the Barents Sea and from two High-Arctic fjords (Isfjorden and Magdalenefjorden). We focused on the echinoid, Strongylocentrotus droebachiensis, the asteroid, Henricia sanguinolenta, and the ophiuroid, Ophiopolis aculeata. For all echinoderms, the analysis revealed a negative correlation between 90Sr activity and the mass. Thus, we concluded that metals are accumulated faster at a young age when the growth is most rapid. The highest average activities of 137Cs followed the order O. aculeata>H. sanguinolenta>S. droebachiensis. This suggests that bioaccumulation was highly taxon-dependent and could reflect differences in the isotope exposures associated with the diet of echinoderms. The study provides a baseline for understanding radionuclide processes in the High-Arctic benthic echinoderm communities. Copyright © 2017 Elsevier Ltd. All rights reserved.
Isoniazid toxicosis in dogs: 137 cases (2004-2014).
Schmid, Dustin R; Lee, Justine A; Wismer, Tina A; Diniz, Pedro Paulo V P; Murtaugh, Robert J
2017-09-15
OBJECTIVE To establish the minimum toxic dose of isoniazid in dogs, characterize the clinical signs and outcomes for dogs following isoniazid ingestion, and determine whether IV administration of pyridoxine to dogs with isoniazid toxicosis is protective against death. DESIGN Retrospective case series. ANIMALS 137 dogs with isoniazid toxicosis. PROCEDURES The electronic database of the American Society for the Prevention of Cruelty to Animals Animal Poison Control Center was reviewed from January 2004 through December 2014 to identify dogs with isoniazid toxicosis. For each dog identified, information extracted from the medical record included signalment, estimated dose of isoniazid ingested, clinical signs, treatment, and outcome. Follow-up communication with pet owners or primary care veterinarians was performed when necessary to obtain missing information. RESULTS Clinical signs of isoniazid toxicosis were observed in 134 of 137 (98%) dogs and included seizures (n = 104), CNS signs without seizures (94), and gastrointestinal (41), cardiovascular (19), urogenital (4), and respiratory (1) abnormalities. Of the 87 dogs for which the outcome was available, 61 survived, 18 died, and 8 were euthanized. Probability of survival was positively associated with body weight and IV administration of pyridoxine and negatively associated with dose of isoniazid ingested and presence of seizures. Dogs that received pyridoxine IV were 29 times as likely to survive as dogs that did not receive pyridoxine IV. CONCLUSIONS AND CLINICAL RELEVANCE Results indicated rapid diagnosis of isoniazid toxicosis and prompt treatment of affected dogs with pyridoxine and other supportive care were imperative for achieving a successful outcome.
Estimates of soil erosion using cesium-137 tracer models.
Saç, M M; Uğur, A; Yener, G; Ozden, B
2008-01-01
The soil erosion was studied by 137Cs technique in Yatagan basin in Western Turkey, where there exist intensive agricultural activities. This region is subject to serious soil loss problems and yet there is not any erosion data towards soil management and control guidelines. During the soil survey studies, the soil profiles were examined carefully to select the reference points. The soil samples were collected from the slope facets in three different study areas (Kirtas, Peynirli and Kayisalan Hills). Three different models were applied for erosion rate calculations in undisturbed and cultivated sites. The profile distribution model (PDM) was used for undisturbed soils, while proportional model (PM) and simplified mass balance model (SMBM) were used for cultivated soils. The mean annual erosion rates found using PDM in undisturbed soils were 15 t ha(-1) year(-1) at the Peynirli Hill and 27 t ha(-1) year(-1) at the Kirtas Hill. With the PM and SMBM in cultivated soils at Kayişalan, the mean annual erosion rates were obtained to be 65 and 116 t ha(-1) year(-1), respectively. The results of 137Cs technique were compared with the results of the Universal Soil Loss Equation (USLE).
Energy Technology Data Exchange (ETDEWEB)
Soares, Carolina Chaves [Goias Univ., Goiania, GO (Brazil)
1997-12-31
The study of the juridical-penal aspects of the Cesium-137 accident, has, as a base, the police inquiry and the penal lawsuit concerning to the episode. Due to the lack of a law which typified activities related with radioisotope material as crime, the responsible were sentenced according to the penalties of body injury crime and homicide. Among the 10 investigated people, only 5 were condemned by the Judiciary and only 4 serve the sentence. (author) 5 refs.; e-mail: mariliag at netline.com.br
Distribution of 137Cs in surface soil of Fraser's Hill, Pahang, Malaysia
Bakar, Ahmad Sanadi Abu; Hamzah, Zaini; Saat, Ahmad
2017-01-01
Caesium-137 (137Cs) in an anthropogenic radionuclide originated from the fission of fissile materials. Nuclear weapons testing during the 1960s and the Chernobyl disaster introduced substantial amount of 137Cs into the atmosphere that are then eventually deposited back to earth's surface. Caesium-137 can be used as tracer to study soil movements since it adsorbs to soil particles. This paper aims to describe the distribution of 137Cs in surface soil of Fraser's Hill, Pahang, determine the levels of 137Cs here compared to other areas, and to check correlation of 137Cs levels to physical data. A series of sampling were carried out between February 2014 and August 2015. Soil samples were taken from 31 locations using soil scraper. The samples were then taken to the laboratory to be dried, homogenized, grinded and sieved. The activity concentration of 137Cs in the samples was determined using gamma spectroscopy. The activity concentration was found to be between 0.26 Bq/kg and 5.14 Bq/kg. Although this paper only studies surface soil, 137Cs is expected to be present within the soil body. Further study of 137Cs in the soil body can be used to predictive model for soil erosion.
Inhibition of GPR137 suppresses proliferation of medulloblastoma cells in vitro.
Wang, Chengfeng; Liang, Qinchuan; Chen, Guangming; Jing, Junjie; Wang, Shousen
2015-01-01
Medulloblastoma is the most common malignant pediatric brain tumor in children. GPR137 is a ubiquitously expressed gene in the central nervous system. It has been reported that GPR137 modulates malignant proliferation of glioma cells. However, the relationship between GPR137 and medulloblastoma is still unknown. In this study, we knocked down GPR137 in the medulloblastoma cell line Daoy via a lentivirus-based RNA interference system to explore its role in medulloblastoma. Functional analyses showed that cell proliferation and colony formation were obviously restrained in Daoy cells after GPR137 knockdown. Furthermore, knockdown of GPR137 in Daoy cells led to a significant increase in cell percentage in the G0/G1 phase but a decrease in the S phase. Additionally, the cell population in the sub-G1 phase, which represents apoptotic cells, was remarkably increased in GPR137 knockdown cells. GPR137 inhibition induced a strong proapoptotic effect in Daoy cells, as confirmed by annexin V-APC/7-AAD double staining. In conclusion, GPR137 knockdown inhibited growth of Daoy medulloblastoma cells via disturbing cell cycle progression and inducing apoptosis. Our investigation suggested that GPR137 could be a potential oncogene in medulloblastoma cells and might serve as a target for the treatment of medulloblastoma. © 2014 International Union of Biochemistry and Molecular Biology, Inc.
Energy Technology Data Exchange (ETDEWEB)
Martins, Joao P. [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Serviço de Medicina Nuclear, SESARAM E.P.E., Avenida Luís de Camões 57, Funchal 9004-514, Madeira (Portugal); Martín-Ramos, Pablo [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Higher Technical School of Telecommunications Engineering, Universidad de Valladolid, Campus Miguel Delibes, Paseo Belén 15, Valladolid 47011 (Spain); Coya, Carmen, E-mail: carmen.coya@urjc.es [Escuela Superior de Ciencias Experimentales y Tecnología (ESCET), Universidad Rey Juan Carlos, Madrid 28933 (Spain); Silva, Manuela Ramos [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Eusebio, M. Ermelinda S. [Chemistry Department, Faculdade de Ciências e Tecnologia, Universidade de Coimbra, Coimbra P-3004-535 (Portugal); Andrés, Alicia de [Instituto de Ciencia de Materiales de Madrid, Consejo Superior de Investigaciones Científicas (CSIC), Cantoblanco, Madrid 28049 (Spain); Álvarez, Ángel L. [Escuela Superior de Ciencias Experimentales y Tecnología (ESCET), Universidad Rey Juan Carlos, Madrid 28933 (Spain); Martín-Gil, Jesús [Advanced Materials Laboratory, ETSIIAA, Universidad de Valladolid, Avenida de Madrid 44, Palencia 34004 (Spain)
2015-03-15
Current manufacturing technologies for OLEDs involve the use of expensive high vacuum techniques and call for thermal stability requirements which are not fulfilled by many materials. These problems disappear when the OLED films are deposited directly from solution. In this study, we have designed, synthesized and characterized a novel octacoordinated complex, Tris(1-(4-chlorophenyl)-4,4,4-trifluoro-1, 3-butanedionate)mono(bathophenanthroline) europium(III), to be used as a “complex-only” emissive layer in wet-processed OLEDs. Upon excitation in the UV region, very efficient energy transfer from the ligands to Eu{sup 3+} takes place, giving rise to intense red emission with very high monochromaticity (R=19), both in powder and as a thin film. The decay times of 754 µs (powder) and 620 µs (thin film) are comparable to those of the most efficient Eu{sup 3+} β-diketonate complexes reported to date. The same energy transfer leading to saturated red and narrow emission is also observed in the OLED device (glass/ITO/PEDOT:PSS/[Eu(cbtfa){sub 3}(bath)]/Ca/Al) when biased at >5.2 V. Its high quantum efficiency (∼60%), good thermal stability up to 200 °C and adequate thin film forming properties make this material a promising chromophore for cost-effective OLEDs. - Highlights: • A highly fluorinated europium(III) octacoordinated complex, [Eu(cbtfa)3(bath)], has been synthesized and its structure elucidated by single crystal X-ray diffraction. • The chosen coordination environment is well-suited for sensitizing the luminescence of the Eu{sup 3+} ion, achieving very efficient energy transfer from the organic ligands (excited in the UV region) to the rare earth ion, leading to highly efficient (Q∼60% in crystalline powder and Q∼50% in thin film) and saturated red photoluminescence. • The material has also been integrated into a single active layer, full solution-processed OLED, with ITO/PEDOT:PSS/[Eu(cbtfa)3(bath)]/ Ca/Al structure.
Simultaneous analysis of free and humic acid complexed europium and gadolinium species by CE-ICP-MS
Energy Technology Data Exchange (ETDEWEB)
Kautenburger, R.; Nowotka, K.; Beck, H.P. [Institut fuer Anorganische und Analytische Chemie und Radiochemie, Universitaet des Saarlandes, P.O. Box 151150, 66041 Saarbruecken (Germany)
2005-07-01
Full text of publication follows: For the long-term safety assessment of waste repositories, detailed information about geo-chemical behaviour of radioactive and toxic metal ions under environmental conditions (geological matrix and aquifer systems) is necessary. It includes knowledge about the mechanism of relevant geochemical reactions, as well as thermodynamic and kinetic data. Several previous studies have shown that humic acid can play an important role in the immobilisation or mobilization of metal ions due to complexation and colloid formation. In this project we investigate the complexation behaviour of humic acid (purified Aldrich humic acid) and its influence on the migration of the lanthanides europium and gadolinium (homologues of the actinides americium and curium) in the the ternary system consisting of these heavy metals, humic acid and kaolinite (KGa-1b) as geological model system under conditions close to nature. Capillary electrophoresis (CE, Beckman Coulter P/ACE MDQ), with its excellent separation performance, was coupled to Inductively Coupled Plasma Mass Spectrometry (ICP-MS, VG Elemental Plasma Quad 3) to obtain a high sensitivity for the determination of the rare earth elements europium (Eu{sup 3+}) and gadolinium (Gd{sup 3+}) and their complexes with humic acid. Additionally, the used humic acid was halogenated with iodine as ICP-MS marker. A fused-silica capillary was flexibly fitted into a MicroMist 50 {mu}l nebulizer with a Cinnabar cyclonic spray chamber. The chamber was chilled to a temperature of 4 deg. C for best sensitivity. 200 ppb of caesium were added to the CE separation buffer to observe the capillary flow. A make-up fluid including 4 ppb Ho as an internal standard was combined with the flow from the capillary within the interface to obtain a fluid throughput high enough to maintain a continuous nebulization. Very low detection limits were achieved, 100 ppt for {sup 153}Eu and 125 ppt for {sup 158}Gd. With this optimized CE
Energy Technology Data Exchange (ETDEWEB)
Andrello, Avacir Casanova
2004-02-15
The soil erosion processes acceleration and the increase of soil erosion rates due to anthropogenic perturbation in soil-weather-vegetation equilibrium has influenced in the soil quality and environment. So, the possibility to assess the amplitude and severity of soil erosion impact on the productivity and quality of soil is important so local scale as regional and global scale. Several models have been developed to assess the soil erosion so qualitative as quantitatively. {sup 137}Cs, an anthropogenic radionuclide, have been very used to assess the superficial soil erosion process Empirical and theoretical models were developed on the basis of {sup 137} Cs redistribution as indicative of soil movement by erosive process These models incorporate many parameters that can influence in the soil erosion rates quantification by {sup 137} Cs redistribution. Statistical analysis was realized on the models recommended by IAEA to determinate the influence that each parameter generates in results of the soil redistribution. It was verified that the most important parameter is the {sup 137} Cs redistribution, indicating the necessity of a good determination in the {sup 137} Cs inventory values with a minimum deviation associated with these values. After this, it was associated a 10% deviation in the reference value of {sup 137} Cs inventory and the 5% in the {sup 137} Cs inventory of the sample and was determinate the deviation in results of the soil redistribution calculated by models. The results of soil redistribution was compared to verify if there was difference between the models, but there was not difference in the results determinate by models, unless above 70% of {sup 137} Cs loss. Analyzing three native forests and an area of the undisturbed pasture in the Londrina region, can be verified that the {sup 137} Cs spatial variability in local scale was 15%. Comparing the {sup 137} Cs inventory values determinate in the three native forest with the {sup 137} Cs inventory
Rasco, B. C.; Rykaczewski, K. P.; Fijałkowska, A.; Karny, M.; Wolińska-Cichocka, M.; Grzywacz, R. K.; Gross, C. J.; Stracener, D. W.; Zganjar, E. F.; Blackmon, J. C.; Brewer, N. T.; Goetz, K. C.; Johnson, J. W.; Jost, C. U.; Hamilton, J. H.; Miernik, K.; Madurga, M.; Miller, D.; Padgett, S.; Paulauskas, S. V.; Ramayya, A. V.; Spejewski, E. H.
2017-05-01
Background: An assessment done under the auspices of the Nuclear Energy Agency in 2007 suggested that the β decays of abundant fission products in nuclear reactors may be incomplete. Many of the nuclei are potentially affected by the so called pandemonium effect and their β -γ decay heat should be restudied using the total absorption technique. The fission products 137I and 137Xe were assigned highest priority for restudy due to their large cumulative fission branching fractions. In addition, measuring β -delayed neutron emission probabilities is challenging and any new technique for measuring the β -neutron spectrum and the β -delayed neutron emission probabilities is an important addition to nuclear physics experimental techniques. Purpose: To obtain the complete β -decay pattern of 137I and 137Xe and determine their consequences for reactor decay heat and ν¯e emission. Complete β -decay feeding includes ground state to ground state β feeding with no associated γ rays, ground state to excited states β transitions followed by γ transitions to the daughter nucleus ground state, and β -delayed neutron emission from the daughter nucleus in the case of 137I. Method: We measured the complete β -decay intensities of 137I and 137Xe with the Modular Total Absorption Spectrometer at Oak Ridge National Laboratory. We describe a technique for measuring the β -delayed neutron energy spectrum, which also provides a measurement of the β -neutron branching ratio, Pn. Results: We validate the current Evaluated Nuclear Structure Data File (ENSDF) evaluation of 137Xeβ decay. We find that major changes to the current ENSDF assessment of 137Iβ -decay intensity are required. The average γ energy per β decay for 137Iβ decay (γ decay heat) increases by 19%, from 1050-1250 keV, which increases the average γ energy per 235U fission by 0.11 % . We measure a β -delayed neutron branching fraction for 137Iβ decay of 7.9 ±0.2 (fit )±0.4 (sys )% and we provide a
Energy Technology Data Exchange (ETDEWEB)
Finck, N
2006-10-15
Temperature should remain higher than 25 C in the near field environment of a nuclear waste repository for thousands years. In this context, the aim of this work is to study the temperature influence on the interaction mechanisms between europium (III) and uranyl ions and zirconium diphosphate, as well as the influence of a complexing medium (nitrate) on the sorption of the lanthanide. The experimental definition of the equilibria was achieved by combining a structural investigation with the macroscopic sorption data. Surface complexes were characterized at all temperatures (25 C to 90 C) by TRLFS experiments carried out on dry and in situ samples using an oven. This characterization was completed by XPS experiments carried out at 25 C on samples prepared at 25 C and 90 C. The reaction constants (surface hydration and cations sorption) were obtained by simulating the experimental data with the constant capacitance surface complexation model. The reaction constants temperature dependency allowed one to characterize thermodynamically the different reactions by application of the van't Hoff relation. The validity of this law was tested by performing microcalorimetric measurements of the sorption heat for both cations. (author)
Tsumune, Daisuke; Aoyama, Michio; Tsubono, Takaki; Tateda, Yutaka; Misumi, Kazuhiro; Hayami, Hiroshi; Toyoda, Yasuhiro; Maeda, Yoshiaki; Yoshida, Yoshikatsu; Uematsu, Mitsuo
2014-05-01
A series of accidents at the Fukushima Dai-ichi Nuclear Power Plant following the earthquake and tsunami of 11 March 2011 resulted in the release of radioactive materials to the ocean by two major pathways, direct release from the accident site and atmospheric deposition. We reconstructed spatiotemporal variability of 137Cs activity in the ocean by the comparison model simulations and observed data. We employed a regional scale and the North Pacific scale oceanic dispersion models, an atmospheric transport model, a sediment transport model, a dynamic biological compartment model for marine biota and river runoff model to investigate the oceanic contamination. Direct releases of 137Cs were estimated for more than 2 years after the accident by comparing simulated results and observed activities very close to the site. The estimated total amounts of directly released 137Cs was 3.6±0.7 PBq. Directly release rate of 137Cs decreased exponentially with time by the end of December 2012 and then, was almost constant. The daily release rate of 137Cs was estimated to be 3.0 x 1010 Bq day-1 by the end of September 2013. The activity of directly released 137Cs was detectable only in the coastal zone after December 2012. Simulated 137Cs activities attributable to direct release were in good agreement with observed activities, a result that implies the estimated direct release rate was reasonable, while simulated 137Cs activities attributable to atmospheric deposition were low compared to measured activities. The rate of atmospheric deposition onto the ocean was underestimated because of a lack of measurements of dose rate and air activity of 137Cs over the ocean when atmospheric deposition rates were being estimated. Observed 137Cs activities attributable to atmospheric deposition in the ocean helped to improve the accuracy of simulated atmospheric deposition rates. Although there is no observed data of 137Cs activity in the ocean from 11 to 21 March 2011, observed data of
Concentration factors for {sup 137}Cs in Japanese coastal fish (1984-1990)
Energy Technology Data Exchange (ETDEWEB)
Tateda, Yutaka [Central Research Inst. of Electric Power Industry, Abiko, Chiba (Japan). Abiko Research Lab.; Koyanagi, Taku
1996-06-01
Concentration factors (CFs; Bq kg{sup -1} wet in fish muscle/Bq kg{sup -1} in filtered seawater) for {sup 137}Cs were determined in Japanese coastal fish collected from 1984 to 1990. {sup 137}Cs/Cs (stable) atom ratios were also examined to clarify the distribution equilibrium of {sup 137}Cs-between marine fish and seawater. The geometric mean of CF in Japanese coastal fish was 52{+-}4 (standard error of the mean), with values ranging from 14 to 133. {sup 137}Cs/Cs atom ratios both in marine fish and seawater indicate that the distribution of {sup 137}Cs was in equilibrium between fish muscle and seawater. Therefore, CF values obtained in the present study can be regarded as equilibrated. Our results show that the CFs for {sup 137}Cs in Japanese coastal fish were within the range of Japanese guidelines, but were below the recommended IAEA value. (author)
Study on transfer model of {sup 137}Cs in lake Hinuma
Energy Technology Data Exchange (ETDEWEB)
Takeishi, Minoru [Japan Nuclear Cycle Development Institute, Tsuruga, Fukui (Japan)
1999-03-01
A transfer model has been developed to facilitate the environmental monitoring of fallout (Cesium-137) in lake Hinuma. The lake Hinuma is located near the Pacific Ocean in Ibaraki-prefecture in Japan. Transfer of {sup 137}Cs between zones (i.e., catchment area, lake water, lake bed sediment) was modeled using standard differential equations based on the results of observations such as fluctuation of {sup 137}Cs concentration in the lake water and sediments since 1986. Transfer velocities of {sup 137}Cs between zones on the model were determined from expressed as a function of rainfall intensity. The effects of rainfall intensity (i.e., increasing inflow-flux of {sup 137}Cs from catchment area and rolling-up of particles of sediments carrying {sup 137}Cs) were investigated on this model. (author)
a Biokinetic Model for CESIUM-137 in the Fetus
Jones, Karen Lynn
1995-01-01
Previously, there was no method to determine the dose to the embryo, fetus, fetal organs or placenta from radionuclides within the embryo, fetus, or placenta. In the past, the dose to the fetus was assumed to be equivalent to the dose to the uterus. Watson estimated specific absorbed fractions from various maternal organs to the uterine contents which included the fetus, placenta, and amniotic fluid and Sikov estimated the absorbed dose to the embryo/fetus after assuming 1 uCi of radioactivity was made available to the maternal blood.^{1,2} However, this method did not allow for the calculation of a dose to individual fetal organs or the placenta. The radiation dose to the embryo or fetus from Cs-137 in the fetus and placenta due to a chronic ingestion by the mother was determined. The fraction of Cs-137 in the maternal plasma crossing the placenta to the fetal plasma was estimated. The absorbed dose from Cs-137 in each modelled fetal organ was estimated. Since there has been more research regarding potassium in the human body, and particularly in the pregnant woman, a biokinetic model for potassium was developed first and used as a basis and confirmation of the cesium model. Available pertinent information in physiology, embryology, biokinetics, and radiation dosimetry was utilized. Due to the rapid growth of the fetus and placenta, the pregnancy was divided into four gestational periods. The numerous physiological changes that occurred during pregnancy were considered and an appropriate biokinetic model was developed for each of the gestational periods. The amount of cesium in the placenta, embryo, and fetus was estimated for each period. The dose to the fetus from cesium deposited in the embryo or fetus and in the placenta was determined for each period using Medical Internal Radiation Dosimetry (MIRD) methodology. An uncertainty analysis was also performed to account for the variability of the parameters in the biokinetic model based on the experimental data
Energy Technology Data Exchange (ETDEWEB)
Paganini, Paula P.; Felinto, Maria Claudia F.C., E-mail: paulapaganini@usp.b, E-mail: mfelinto@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Brito, Hermi F., E-mail: hefbrito@iq.usp.b [Universidade de Sao Paulo (IQ/USP), Sao Paulo, SP (Brazil). Inst. de Quimica. Lab. de Elementos do Bloco f
2011-07-01
Special luminescence biomarkers have been developed to find more sensitive fluoroimmunoassay methods. A new generation of these biomarkers is the semiconductors nanocrystals, known as quantum dots, doped with lanthanides. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. The protein sol-gel is a modification of conventional method, in which the coconut water replacing the alkoxides normally used. The advantage is that, the proteins present in coconut water bind chemically with metal salts forming a polymer chain. This work presents nanoparticles based on tin/titanium mixed oxide doped with 3% of europium synthesized by protein sol-gel method. The nanoparticles were burned at 300 deg C, 500 deg C, 800 deg C and 1100 deg C. The samples were analyzed and characterized by thermal analysis, X-ray powder diffraction (XRD), infrared spectroscopy (IR) and scanning electron microscopy (SEM). The synthesis was effective and the nanoparticles showed nanometric size and structural differences with the annealing. To be used in the fluoroimmunoassays tests, these particles need to be functionalized before be connect with biological molecules and after this process, these nanoparticles going to be submitted at gamma radiation for sterilization. (author)
Rodenko, Olga; Fodgaard, Henrik; Tidemand-Lichtenberg, Peter; Pedersen, Christian
2017-02-01
In immunoassay analyzers for in-vitro diagnostics, Xenon flash lamps have been widely used as excitation light sources. Recent advancements in UV LED technology and its advantages over the flash lamps such as smaller footprint, better wall-plug efficiency, narrow emission spectrum, and no significant afterglow, have made them attractive light sources for gated detection systems. In this paper, we report on the implementation of a 340 nm UV LED based time-resolved fluorescence system based on europium chelate as a fluorescent marker. The system performance was tested with the immunoassay based on the cardiac marker, TnI. The same signal-to-noise ratio as for the flash lamp based system was obtained, operating the LED below specified maximum current. The background counts of the system and its main contributors were measured and analyzed. The background of the system of the LED based unit was improved by 39% compared to that of the Xenon flash lamp based unit, due to the LEDs narrower emission spectrum and longer pulse width. Key parameters of the LED system are discussed to further optimize the signal-to-noise ratio and signal-to-background, and hence the sensitivity of the instrument.
Energy Technology Data Exchange (ETDEWEB)
Sabau, A. [Agence Nationale pour la gestion des Déchets RAdioactifs, 1-7 rue J. Monnet, Parc de la Croix Blanche, 92298 Châtenay-Malabry Cedex (France); Université de Nice Sophia Antipolis, Ecosystèmes Côtiers Marins et Réponses aux Stress (ECOMERS), 28 avenue Valrose, 06108 Nice Cedex 2 (France); Pipon, Y., E-mail: pipon@ipnl.in2p3.fr [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); Institut Universitaire de Technologie (IUT) Lyon-1, Université Claude Bernard Lyon 1, 69 622 Villeurbanne Cedex (France); Toulhoat, N. [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); CEA/DEN, Saclay, 91191 Gif sur Yvette (France); Lomenech, C. [Université de Nice Sophia Antipolis, Ecosystèmes Côtiers Marins et Réponses aux Stress (ECOMERS), 28 avenue Valrose, 06108 Nice Cedex 2 (France); Jordan, N. [Helmholtz Zentrum Dresden Rossendorf (HZDR), Institute of Resource Ecology (IRE) (Germany); Moncoffre, N. [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); Barkleit, A. [Helmholtz Zentrum Dresden Rossendorf (HZDR), Institute of Resource Ecology (IRE) (Germany); and others
2014-08-01
This study aims at elucidating the mechanisms regulating the interaction of Eu and Ni with calcite (CaCO{sub 3}). Calcite powders or single crystals (some mm sized) were put into contact with Eu or Ni solutions at concentrations ranging from 10{sup −3} to 10{sup −5} mol L{sup −1} for Eu and 10{sup −3} mol L{sup −1} for Ni. The sorption durations ranged from 1 week to 1 month. Rutherford Backscattering Spectrometry (RBS) well adapted to discriminate incorporation processes such as: (i) adsorption or co precipitation at the mineral surfaces or, (ii) incorporation into the mineral structure (through diffusion for instance), has been carried out. Moreover, using the fluorescence properties of europium, the results have been compared to those obtained by Time-Resolved Laser Fluorescence Spectroscopy (TRLFS) on calcite powders. For the single crystals, complementary SEM observations of the mineral surfaces at low voltage were also performed. Results showed that Ni accumulates at the calcite surface whereas Eu is also incorporated at a greater depth. Eu seems therefore to be incorporated into two different states in calcite: (i) heterogeneous surface accumulation and (ii) incorporation at depth greater than 160 nm after 1 month of sorption. Ni was found to accumulate at the surface of calcite without incorporation.
Sahu, Ishwar Prasad
2017-05-01
In the present article we report europium-doped strontium ortho-silicates, namely Sr 2 SiO 4 :xEu 3+ (x = 1.0, 1.5, 2.0, 2.5 or 3.0 mol%) phosphors, prepared by solid state reaction method. The crystal structures of the sintered phosphors were consistent with orthorhombic crystallography with a Pmna space group. The chemical compositions of the sintered phosphors were confirmed by energy dispersive X-ray spectroscopy (EDS). Thermoluminescence (TL) kinetic parameters such as activation energy, order of kinetics and frequency factors were calculated by the peak shape method. Orange-red emission originating from the 5 D 0 - 7 F J (J = 0, 1, 2, 3) transitions of Eu 3+ ions could clearly be observed after samples were excited at 395 nm. The combination of these emissions constituted orange-red light as indicated on the Commission Internationale de l'Eclairage (CIE) chromaticity diagram. Mechanoluminescence (ML) intensity of the prepared phosphor increased linearly with increasing impact velocity of the moving piston that suggests that these phosphors can also be used as sensors to detect the stress of an object. Thus, the present investigation indicates that the piezo-electricity was responsible for producing ML in the prepared phosphor. Copyright © 2016 John Wiley & Sons, Ltd.
Wu, Dan; Xin, Xia; Pang, Xuehui; Pietraszkiewicz, Marek; Hozyst, Robert; Sun, Xian'ge; Wei, Qin
2015-06-17
A novel electrochemiluminescent (ECL) aptasensor was proposed for the determination of thrombin (TB) using exonuclease-catalyzed target recycling and hybridization chain reaction (HCR) to amplify the signal. The capture probe was immobilized on an Au-GS-modified electrode through a Au-S bond. Subsequently, the hybrid between the capture probe and the complementary thrombin binding aptamer (TBA) was aimed at obtaining double-stranded DNA (dsDNA). The interaction between TB and its aptamer led to the dissociation of dsDNA because TB has a higher affinity to TBA than the complementary strands. In the presence of exonuclease, aptamer was selectively digested and TB could be released for target recycling. Extended dsDNA was formed through HCR of the capture probe and two hairpin DNA strands (NH2-DNA1 and NH2-DNA1). Then, numerous europium multiwalled carbon nanotubes (Eu-MWCNTs) could be introduced through amidation reaction between NH2-terminated DNA strands and carboxyl groups on the Eu-MWCNTs, resulting in an increased ECL signal. The multiple amplification strategies, including the amplification of analyte recycling and HCR, and high ECL efficiency of Eu-MWCNTs lead to a wide linear range (1.0×10(-12)-5.0×10(-9) mol/L) and a low detection limit (0.23 pmol/L). The method was applied to serum sample analysis with satisfactory results.
Dayan Elshan, N. G. R.; Patek, Renata; Vagner, Josef; Mash, Eugene A.
2014-01-01
Europium chelates conjugated with peptide ligands are routinely used as probes for conducting in vitro binding experiments. The presence of unchelated Eu ions in these formulations gives high background luminescence and can lead to poor results in binding assays. In our experience, the reported methods for purification of these probes do not achieve adequate removal of unchelated metal ions in a reliable manner. In this work, a xylenol orange-based assay for the quantification of unchelated metal ions was streamlined and used to determine levels of metal ion contamination, as well as the success of metal ion removal upon attempted purification. We compared the use of Empore™ chelating disks and Chelex® 100 resin for the selective removal of unchelated Eu ions from several Eu-diethylenetriaminepentaacetic acid chelate-peptide conjugates. Both purification methods gave complete and selective removal of the contaminant metal ions. However, Empore™ chelating disks were found to give much higher recoveries of the probes under the conditions utilized. Related to the issue of probe recovery, we also describe a significantly more efficient method for the synthesis of one such probe using Rink amide AM resin in place of Tentagel S resin. PMID:25058927
Lapaev, Dmitry V.; Nikiforov, Victor G.; Lobkov, Vladimir S.; Knyazev, Andrey A.; Galyametdinov, Yury G.
2018-01-01
We have proposed a novel temperature-sensitive luminescent material which is a 20 μm thick vitrified film (sandwiched between two quartz plates) fabricated from an amorphous powder of a mesogenic europium(III) β-diketonate complex through a melt-processing technique. The film photoexcited by a 337 nm pulsed nitrogen laser displays a typical Eu3+ ion luminescence bands with the strongest peak at 612 nm and with the decay time of 537 μs at 298 K. It is obtained that both the mean luminescence intensity and the luminescence decay time at 612 nm decrease significantly with temperature increasing from 298 to 348 K; the average values of the relative and absolute temperature sensitivities of the luminescence decay time in the range of 298-348 K are -1.2%·K-1 and -6.5 μs·K-1, respectively. The thermal quenching mechanism of the luminescent properties was analyzed and discussed. The experiments showed that, the luminescent properties of the film is insensitive to oxygen, the film is photostable under UV light, there is full reversibility of the temperature-dependent luminescence intensity and the decay time, and the high luminescence brightness of the film can be observed with violet light excitation. These factors indicated that the film is promising material for reusable luminescent thermometers, suitable for long-term monitoring in the range of 298-348 K.
Wei, Peng-Fei; Jin, Pei-Pei; Barui, Ayan Kumar; Hu, Yi; Zhang, Li; Zhang, Ji-Qian; Shi, Shan-Shan; Zhang, Hou-Rui; Lin, Jun; Zhou, Wei; Zhang, Yun-Jiao; Ruan, Ren-Quan; Patra, Chitta Ranjan; Wen, Long-Ping
2015-12-01
Accelerating the clearance of intracellular protein aggregates through elevation of autophagy represents a viable approach for the treatment of neurodegenerative diseases. In our earlier report, we have demonstrated the enhanced degradation of mutant huntingtin protein aggregates through autophagy process induced by europium hydroxide nanorods [EHNs: Eu(III)(OH)3], but the underlying molecular mechanism of EHNs mediated autophagy was unclear. The present report reveals that EHNs induced autophagy does not follow the classical AKT-mTOR and AMPK signaling pathways. The inhibition of ERK1/2 phosphorylation using the specific MEK inhibitor U0126 partially abrogates the autophagy as well as the clearance of mutant huntingtin protein aggregates mediated by EHNs suggesting that nanorods stimulate the activation of MEK/ERK1/2 signaling pathway during autophagy process. In contrast, another mTOR-independent autophagy inducer trehalose has been found to induce autophagy without activating ERK1/2 signaling pathway. Interestingly, the combined treatment of EHNs and trehalose leads to more degradation of mutant huntingtin protein aggregates than that obtained with single treatment of either nanorods or trehalose. Our results demonstrate the rational that further enhanced clearance of intracellular protein aggregates, needed for diverse neurodegenerative diseases, may be achieved through the combined treatment of two or more autophagy inducers, which stimulate autophagy through different signaling pathways. Copyright © 2015 Elsevier Ltd. All rights reserved.
de Schellenberger, Angela Ariza; Hauptmann, Ralf; Millward, Jason M; Schellenberger, Eyk; Kobayashi, Yuske; Taupitz, Matthias; Infante-Duarte, Carmen; Schnorr, Jörg; Wagner, Susanne
2017-10-10
Intrinsic iron in biological tissues frequently precludes unambiguous the identification of iron oxide nanoparticles when iron-based detection methods are used. Here we report the full methodology for synthesizing very small iron oxide nanoparticles (VSOP) doped with europium (Eu) in their iron oxide core (Eu-VSOP) and their unambiguous qualitative and quantitative detection by fluorescence. The resulting Eu-VSOP contained 0.7 to 2.7% Eu relative to iron, which was sufficient for fluorescent detection while not altering other important particle parameters such as size, surface charge, or relaxivity. A customized enhancer solution with high buffer capacity and nearly neutral pH was developed to provide an antenna system that allowed fluorescent detection of Eu-VSOP in cells and histologic tissue slices as well as in solutions even under acidic conditions as frequently obtained from dissolved organic material. This enhancer solution allowed detection of Eu-VSOP using a standard fluorescence spectrophotometer and a fluorescence microscope equipped with a custom filter set with an excitation wavelength (λex) of 338 nm and an emission wavelength (λem) of 616 nm. The fluorescent detection of Eu-doped very small iron oxide nanoparticles (Eu-VSOP) provides a straightforward tool to unambiguously characterize VSOP biodistribution and toxicology at tissue, and cellular levels, providing a sensitive analytical tool to detect Eu-doped IONP in dissolved organ tissue and biological fluids with fluorescence instruments.
Liu, Jian; Miao, Jing-Sheng; Wu, Hong-Bin
2015-06-01
A new europium complex EuL3 (Phen) was used as guest dopant, and a blend of Polyvinylcarbazole and 2-(biphenyl-4-yl)-5-(4-tert-butylphenyl)-1,3,4-oxadiazole (PVK and PBD) as host matrix. Efficient red organic light-emitting devices (OLEDs) with double-layer structures were manufactured via a solution-processed technique. The guest-doped levels were 1, 3 and 5 wt% relative to the blend mass, respectively. For the 1 wt% doping-level device, the luminous efficiency and luminance were up to 2.96 cd/A and 635.78 cd/m(2) with emissions from both EuL3 (Phen) and from the host; for the 3 wt% doping-level device, the maximum luminous efficiency and luminance were 1.01 cd/A and 370.91 cd/m(2) for the single emission from EuL3 (Phen) only. Copyright © 2014 John Wiley & Sons, Ltd.
Wang, Du; Zhang, Zhaowei; Li, Peiwu; Zhang, Qi; Ding, Xiaoxia; Zhang, Wen
2015-12-02
Immunochromatographic (IC) assays are considered suitable diagnostic tools for the determination of mycotoxins. A europium nanospheres-based time-resolved fluorescence immunoassay (Eu-Nano-TRFIA), based on a monoclonal antibody and a portable TRFIA reader, was developed to determine total aflatoxin (including aflatoxins B1, B2, G1, and G2) levels in feed samples. Under optimized conditions, the Eu-Nano-TRFIA method detected total aflatoxin within 12 min. It showed good linearity (R(2) > 0.985), LOD of 0.16 μg/kg, a wide dynamic range of 0.48-30.0 μg/kg, recovery rates of 83.9-113.9%, and coefficients of variation (CVs) of 3.5-8.8%. In the 397 samples from company and livestock farms throughout China, the detection rate was 78.3%, concentrations were 0.50-145.30 μg/kg, the highest total aflatoxin content was found in cottonseed meal, and corn was found to be the most commonly contaminated feed. This method could be a powerful alternative for the rapid and ultrasensitive determination of total aflatoxin in quality control and meet the required Chinese maximum residue limits.
Elshan, N G R Dayan; Patek, Renata; Vagner, Josef; Mash, Eugene A
2014-11-01
Europium chelates conjugated with peptide ligands are routinely used as probes for conducting in vitro binding experiments. The presence of unchelated Eu ions in these formulations gives high background luminescence and can lead to poor results in binding assays. In our experience, the reported methods for purification of these probes do not achieve adequate removal of unchelated metal ions in a reliable manner. In this work, a xylenol orange-based assay for the quantification of unchelated metal ions was streamlined and used to determine levels of metal ion contamination as well as the success of metal ion removal on attempted purification. We compared the use of Empore chelating disks and Chelex 100 resin for the selective removal of unchelated Eu ions from several Eu-diethylenetriaminepentaacetic acid chelate-peptide conjugates. Both purification methods gave complete and selective removal of the contaminant metal ions. However, Empore chelating disks were found to give much higher recoveries of the probes under the conditions used. Related to the issue of probe recovery, we also describe a significantly more efficient method for the synthesis of one such probe using Rink amide AM resin in place of Tentagel S resin. Copyright © 2014 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Phil Liebing
2017-12-01
Full Text Available The reaction of EuI2(THF2 with potassium hydrotris(3,5-diisopropylpyrazolylborate (K[HB(3,5-iPr2pz3] (= KTpiPr2, pz = pyrazolyl in a molar ratio of 1:1.5 resulted in extensive ligand fragmentation and formation of the europium(II mono(scorpionate complex bis(3,5-diisopropyl-1H-pyrazole[hydrotris(3,5-diisopropylpyrazolylborato]iodidoeuropium(II, [Eu(C27H46BN6I(C9H16N22] or (TpiPr2(3,5-iPr2pzH2EuIII, 1, in high yield (78%. As a typical by-product, small amounts of the sterically crowded pyrazabole derivative trans-4,8-bis(3,5-diisopropylpyrazol-1-yl-1,3,5,7-tetraisopropylpyrazabole, C36H62B2H8 or trans-{(3,5-iPr2pzHB(μ-3,5-iPr2pz}2, 2, were formed. Both title compounds have been structurally characterized through single-crystal X-ray diffraction. In 1, two isopropyl groups are each disordered over two orientations with occupancy ratios of 0.574 (10:0.426 (10 and 0.719 (16:0.281 (16. In 2, one isopropyl group is similarly disordered, occupancy ratio 0.649 (9:0.351 (9.
Kamruzzaman, Mohammad; Alam, Al-Mahmnur; Lee, Sang Hak; Ragupathy, Dhanusuraman; Kim, Young Ho; Park, Sang-Ryoul; Kim, Sung Hong
2012-02-01
A sensitive spectrofluorimetric method has been developed for the determination of moxifloxacin (MOX) using europium(III)-MOX complex as a fluorescence probe in the presence of an anionic surfactant, sodium dodecyl benzene sulfonate (SDBS). The fluorescence (FL) intensity of Eu 3+ was enhanced by complexation with MOX at 614 nm after excitation at 373 nm. The FL intensity of the Eu 3+-MOX complex was significantly intensified in the presence of SDBS. Under the optimum conditions, it was found that the enhanced FL intensity of the system showed a good linear relationship with the concentration of MOX over the range of 1.8 × 10 -11-7.3 × 10 -9 g mL -1 with a correlation coefficient of 0.9998. The limit of detection of MOX was found to be 2.8 × 10 -12 g mL -1 with relative standard deviation (RSD) of 1.25% for 5 replicate determination of 1.5 × 10 -8 g mL -1 MOX. The proposed method is simple, offers higher sensitivity with wide linear range and can be successfully applied to determine MOX in pharmaceutical and biological samples with good reproducibility. The luminescence mechanism is also discussed in detail with ultraviolet absorption spectra.
Directory of Open Access Journals (Sweden)
Ishwar Prasad Sahu
2015-01-01
Full Text Available Europium doped di-strontium magnesium di-silicate phosphor namely (Sr2MgSi2O7:Eu3+ was prepared by the traditional high temperature solid state reaction method. The phase structure of sintered phosphor was akermanite type structure which belongs to the tetragonal crystallography with space group P42¯1m, this structure is a member of the melilite group and forms a layered compound. The EDX and FTIR spectra confirm the present elements in Sr2MgSi2O7:Eu3+ phosphor. Photoluminescence measurements showed that the phosphor exhibited strong emission peak with good intensity, corresponding to 5D0 → 7F2 (613 nm red emission and weak 5D0 → 7F1 (590 nm orange emission. The excitation spectra monitored at 613 nm show broad band from 220 to 300 nm ascribed to O–Eu charge-transfer band (CTB centered at about 269 nm, and the other peaks in the range of 300–400 nm originated from f–f transitions of Eu3+ ions. The strongest band at 395 nm can be assigned to 7F0 / 5L6 transition of Eu3+ ions due to the typical f–f transitions within Eu3+ of 4f6 configuration.
Energy Technology Data Exchange (ETDEWEB)
Xia, Tifeng; Zhu, Fengliang; Cui, Yuanjing, E-mail: cuiyj@zju.edu.cn; Yang, Yu; Wang, Zhiyu; Qian, Guodong, E-mail: gdqian@zju.edu.cn
2017-01-15
A water-stable metal-organic framework (MOF) EuNDC has been synthesized for selective detection of the well-known contaminant and toxicant picric acid (PA) in aqueous solution. Due to the photo-induced electron transfer and self-absorption mechanism, EuNDC displayed rapid, selective and sensitive detection of PA with a detection limit of 37.6 ppb. Recyclability experiments revealed that EuNDC retains its initial luminescent intensity and same quenching efficiency in each cycle, suggesting high photostability and reusability for long-term sensing applications. The excellent detection performance of EuNDC makes it a promising PA sensing material for practical applications. - Graphical abstract: A water-stable europium-based metal-organic framework has been reported for highly selective sensing of picric acid (PA) with a detection limit of 37.6 ppb in aqueous solution. - Highlights: • A water-stable metal-organic framework (MOF) EuNDC was synthesized. • The highly selective detection of picric acid with a detection limit of 37.6 ppb was realized. • The detection mechanism were also presented and discussed.
Li Liu, Meng; Chen, Bin Bin; Yang, Tong; Wang, Jian; Liu, Xi Dong; Zhi Huang, Cheng
2017-03-01
The detection of tetracycline is of great significance because of its damaging effects on human health, such as renal toxicity and hemolytic anemia. Any release of tetracycline into the surrounding environment can produce bacterial drug resistance. We develop a new sensitive and selective detection approach for tetracycline in complex water samples by preparing europium-doped carbon quantum dots (Eu-CQDs) through a simple and rapid carbonization method operating at 200 °C for 5 min. The Eu-CQDs are characterized by blue photoluminescence, excitation-wavelength-dependent emission and excellent stability. Importantly, the fluorescence of the Eu-CQDs can be quenched efficiently by tetracycline, based on the strong inner filter effect mechanism between Eu-CQDs and tetracycline, making the fluorescence intensity ratio (I 0/I) of the Eu-CQDs at 465 nm correlate linearly with the concentration of tetracycline in the range of 0.5-200 μM, with a limit of detection of 0.3 μM. This shows the broad applicability of the Eu-CQDs in pursuing the concepts of simplicity and specificity for analytical purposes.
Chen, Kuan-Chou; Dutta, Saikat; Yamauchi, Yusuke; Alshehri, Saad M; Nguyen, Mai Thanh; Yonezawa, Tetsu; Shen, Kun-Hung; Wu, Kevin C W
2015-12-01
Monodisperse and mesoporous europium (Eu)-doped titania nanoparticles (denoted as Eu-MTNs) were prepared by a co-synthesis method with the presence of a cationic surfactant (i.e., CTAB). A maximum loading amount of 8 mol% of Eu could be successfully incorporated into the framework of MTNs. The synthesized Eu-MTNs samples were characterized with X-ray diffraction (XRD) and scanning electron microscopy (SEM), with their luminescent property examined by photoluminescence (PL). Under ultraviolet irradiation, the Eu-MTNs samples exhibit several characteristic luminescence corresponding to 5D0-7F(j) for Eu+3 ions, which can be attributed to the energy transfer from titania nanocrystallite to Eu3+ ions dispersed in amorphous mesoporous titania region. The potential intracellular bio-imaging application of the synthesized Eu-MTN nanoparticles was demonstrated with a breast cancer cell line (i.e., BT-20). High biocompatibility and strong luminescence of the Eu-MTNs show great potential in biomedical applications.
miR-137 acts as a tumor suppressor in astrocytoma by targeting RASGRF1.
Deng, Danni; Xue, Lian; Shao, Naiyuan; Qu, Hongtao; Wang, Qiang; Wang, Suinuan; Xia, Xiwei; Yang, Yilin; Zhi, Feng
2016-03-01
Astrocytoma is one of the most common primary central nervous system tumors and has both high mortality and a poor 5-year survival rate. MicroRNAs (miRNAs) play important roles in carcinogenesis by acting on multiple signaling pathways. Although we have demonstrated that miR-137 is downregulated in astrocytoma tissues, the role of miR-137 in astrocytoma still remains unknown. In the present study, we aimed to investigate the function of miR-137 and its possible target genes in astrocytoma. miR-137 was significantly downregulated in astrocytoma tissues, and its expression level was inversely correlated with the clinical stage. Restoring miR-137 was able to dramatically inhibit cell proliferation, migration, and invasion and enhance apoptosis in vitro, whereas silencing its expression inhibited these processes. By overexpressing or inhibiting miR-137 in cancer cells, we experimentally confirmed that miR-137 directly recognized the 3'-UTR (3'-untranslated region) of the RASGRF1 (Ras protein-specific guanine nucleotide-releasing factor 1) transcript and regulated RASGRF1 expression. Furthermore, an inverse correlation was observed between miR-137 levels and RASGRF1 protein levels, but not mRNA levels, in astrocytoma samples. The silencing of RASGRF1 resulted in similar effects to miR-137 restoration in cancer cells. Finally, overexpression of RASGRF1 rescued the inhibitory effects of miR-137. Taken together, our results indicate that miR-137 acts as a tumor suppressor in astrocytoma by targeting RASGRF1. These findings suggest that miR-137 may serve as a novel therapeutic target in astrocytoma treatment.
21 CFR 137.270 - Self-rising white corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Self-rising white corn meal. 137.270 Section 137... Cereal Flours and Related Products § 137.270 Self-rising white corn meal. (a) Self-rising white corn meal is an intimate mixture of white corn meal, sodium bicarbonate, and one or both of the acid-reacting...
CD137 is a Useful Marker for Identifying CD4+ T Cell Responses to Mycobacterium tuberculosis.
Yan, Z-H; Zheng, X-F; Yi, L; Wang, J; Wang, X-J; Wei, P-J; Jia, H-Y; Zhou, L-J; Zhao, Y-L; Zhang, H-T
2017-05-01
Upregulation of CD137 on recently activated CD8+ T cells has been used to identify rare viral and tumour antigen-specific T cells from the peripheral blood. We aimed to evaluate the accuracy of CD137 for identifying Mycobacterium tuberculosis (Mtb)-reactive CD4+ T cells in the peripheral blood of infected individuals by flow cytometry and to investigate the characteristics of these CD137+ CD4+ T cells. We initially enrolled 31 active tuberculosis (TB) patients, 31 individuals with latent TB infection (LTBI) and 25 healthy donors. The intracellular CD137 and interferon-γ (IFN-γ) production by CD4+ T cells was simultaneously detected under unstimulated and CFP10-stimulated (culture filtrate protein 10, a Mtb-specific antigen) conditions. In unstimulated CD4+ T cells, we found that the CD137 expression in the TB group was significantly higher than that in the LTBI group. Stimulation with CFP10 largely increased the CD4+ T cell CD137 expression in both the TB and LTBI groups. After CFP10 stimulation, the frequency of CD137+ CD4+ T cells was higher than that of IFN-γ+ CD4+ T cells in both the TB and LTBI groups. Most of the CFP10-activated IFN-γ-secreting cells were CD137-positive, but only a small fraction of the CD137-positive cells expressed IFN-γ. An additional 20 patients with TB were enrolled to characterize the CD45RO+ CCR7+ , CD45RO+ CCR7- and CD45RO- subsets in the CD137+ CD4+ T cell populations. The Mtb-specific CD137+ CD4+ T cells were mainly identified as having an effector memory phenotype. In conclusion, CD137 is a useful marker that can be used for identifying Mtb-reactive CD4+ T cells by flow cytometry. © 2017 The Foundation for the Scandinavian Journal of Immunology.
Role of CD137 signaling in dengue virus-mediated apoptosis
Energy Technology Data Exchange (ETDEWEB)
Nagila, Amar [Medical Molecular Biology Unit, Office for Research and Development, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Department of Biochemistry, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Netsawang, Janjuree [Faculty of Medical Technology, Rangsit University, Bangkok (Thailand); Srisawat, Chatchawan [Department of Biochemistry, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Noisakran, Sansanee [Dengue Hemorrhagic Fever Research Unit, Office for Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok (Thailand); Medical Biotechnology Unit, National Center for Genetic Engineering and Biotechnology, National Science and Technology Development Agency, Bangkok (Thailand); Morchang, Atthapan; Yasamut, Umpa [Medical Molecular Biology Unit, Office for Research and Development, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Department of Immunology, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Puttikhunt, Chunya [Dengue Hemorrhagic Fever Research Unit, Office for Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok (Thailand); Medical Biotechnology Unit, National Center for Genetic Engineering and Biotechnology, National Science and Technology Development Agency, Bangkok (Thailand); Kasinrerk, Watchara [Division of Clinical Immunology, Department of Medical Technology, Faculty of Associated Medical Sciences, Chiang Mai University, Chiang Mai (Thailand); Biomedical Technology Research Center, National Center for Genetic Engineering and Biotechnology, National Science and Technology Development Agency at Chiang Mai University, Chiang Mai (Thailand); and others
2011-07-08
Highlights: {yields} For the first time the role of CD137 in dengue virus (DENV) infection. {yields} Induction of DENV-mediated apoptosis by CD137 signaling. {yields} Sensitization to CD137-mediated apoptosis by dengue virus capsid protein (DENV C). {yields} Nuclear localization of DENV C is required for CD137-mediated apoptosis. -- Abstract: Hepatic dysfunction is a well recognized feature of dengue virus (DENV) infection. However, molecular mechanisms of hepatic injury are still poorly understood. A complex interaction between DENV and the host immune response contributes to DENV-mediated tissue injury. DENV capsid protein (DENV C) physically interacts with the human death domain-associated protein Daxx. A double substitution mutation in DENV C (R85A/K86A) abrogates Daxx interaction, nuclear localization and apoptosis. Therefore we compared the expression of cell death genes between HepG2 cells expressing DENV C and DENV C (R85A/K86A) using a real-time PCR array. Expression of CD137, which is a member of the tumor necrosis factor receptor family, increased significantly in HepG2 cells expressing DENV C compared to HepG2 cells expressing DENV C (R85A/K86A). In addition, CD137-mediated apoptotic activity in HepG2 cells expressing DENV C was significantly increased by anti-CD137 antibody compared to that of HepG2 cells expressing DENV C (R85A/K86A). In DENV-infected HepG2 cells, CD137 mRNA and CD137 positive cells significantly increased and CD137-mediated apoptotic activity was increased by anti-CD137 antibody. This work is the first to demonstrate the contribution of CD137 signaling to DENV-mediated apoptosis.
Caesium-137 distribution, inventories and accumulation history in the Baltic Sea sediments.
Zaborska, Agata; Winogradow, Aleksandra; Pempkowiak, Janusz
2014-01-01
The Baltic Sea is susceptible to pollution by hazardous substances due to limited water exchange, shallowness, and the large catchment area. Radionuclides, particularly (137)Cs, are one of the most hazardous anthropogenic substances present in the Baltic environment. This study was conducted to present (137)Cs present contamination that should further be a subject of reliable monitoring when the new Nuclear Power Plant is put into operation in the northern Poland. The sea-wide, up to date distribution of (137)Cs activities and inventories in the Baltic Sea bottom sediments are presented. The (137)Cs activity concentrations were measured in 30 cm long sediment cores collected at 22 sampling stations. Sediment accumulation rates were quantified by (210)Pb geochronology to follow the history of (137)Cs accumulation. The (137)Cs inventories and fluxes were calculated. Most of the Baltic Sea sediments accumulated (137)Cs in the range from 750 to 2675 Bq m(-2). The Bothnian Bay is severely contaminated by (137)Cs with inventories up to 95,191 Bq m(-2). This region is moreover characterized by extremely large patchiness of (137)Cs inventories. The (137)Cs annual fluxes are highest at the two stations located at the Bothnian Bay (342 Bq m(-2) and 527 Bq m(-2)) due to large Chernobyl (137)Cs contamination of that region and high sediment accumulation rates. When these stations are excluded, the recent, annual mean value of (137)Cs load to the Baltic Sea deposits is 38 ± 22 Bq m(-2). The distribution of radio-caesium inventories over the Baltic Sea nowadays reflects the pattern of Chernobyl contamination. The radio-caesium deposited in surface sediments is not permanently buried, but may be resuspended and redeposited by currents, bioturbation or anthropogenic activities. Copyright © 2013 Elsevier Ltd. All rights reserved.
Heikura, Ilkka
2007-01-01
Tämän insinöörityön aiheena oli suunnitella ja rakentaa ra diolähetin taajuusvälille 135,7–137,8 kHz. Tämä taajuusalue on varattu radioamatöörikäyttöön ja sitä käytetään sähkötykseen. Lähettimen vähimmäislähetysteho täytyi olla 50 W 50 W:n kuormaan. Insinöörityön tilaajana toimi Kajaanin ammattikorkeakoulu. Laitteisto koostuu pääosiltaan oskillaattorista, kahdesta taajuusjakajasta, avainnuksesta, pääteasteesta ja LCsuodattimesta. Oskillaattorissa muodostetaan taajuus, joka syötetä...
137Cs uptake with cafeteria food after the Chernobyl accident
Energy Technology Data Exchange (ETDEWEB)
Voigt, G.; Paretzke, H.G. (GSF-Institut fuer Strahlenschutz, Neuherberg (Germany))
1992-11-01
After the Chernobyl accident, the activity concentrations of radiocesium were measured in both the meals served at the cafeteria of a research center and in the employees eating there. The time-dependent means of monthly 137Cs activities in meals and people show a similar distribution pattern with highest values between March and July 1987, i.e., only 1 y after the accident. In meals, the highest activities were found when the menu consisted of pork, milk, or milk products. The 50-y cumulative effective dose calculated from the whole-body measurements is 0.21 mSv for male and 0.15 mSv for female employees. Cafeteria food contributed only a small share to this exposure.
137Cs uptake with cafeteria food after the Chernobyl accident.
Voigt, G; Paretzke, H G
1992-11-01
After the Chernobyl accident, the activity concentrations of radiocesium were measured in both the meals served at the cafeteria of a research center and in the employees eating there. The time-dependent means of monthly 137Cs activities in meals and people show a similar distribution pattern with highest values between March and July 1987, i.e., only 1 y after the accident. In meals, the highest activities were found when the menu consisted of pork, milk, or milk products. The 50-y cumulative effective dose calculated from the whole-body measurements is 0.21 mSv for male and 0.15 mSv for female employees. Cafeteria food contributed only a small share to this exposure.
Long-term behaviours of {sup 137}Cs in simulated crop fields
Energy Technology Data Exchange (ETDEWEB)
Lim, K. M.; Choi, Y. H.; Park, H. K.; Park, D. W.; Lee, W. Y. [KAERI, Taejon (Korea, Republic of)
1999-10-01
In order to understand the long-term behaviour of {sup 137}Cs in crop fields, root uptake and underground distribution of {sup 137}Cs were investigated through a greenhouse experiment where {sup 137}Cs was mixed with topsoil in culture boxes and rice, soybean and Chinese cabbage were grown for 4 years. Soil-to-plant transfer factors of {sup 137}Cs for hulled rice, rice straw, soybean seed and Chinese cabbage reduced by factors of 3-10 depending on crops, and leaching of {sup 137}Cs from the rice culture box decreased by a factor of about 7, in 3 years. The {sup 137}Cs transfer factor for soybean seed were several times higher than that for hulled rice. The amount of {sup 137}Cs leaching during the growing season of rice was as low as 0.025% of applied activity even in the 1st year. The uniformity of {sup 137}Cs distribution in topsoil tended to improve year by year. The present results may be utilized as basic information for the environmental impact assessment and the counter-measure decision when crop fields are contaminated with {sup 137}Cs.
miR-137 suppresses tumor growth of malignant melanoma by targeting aurora kinase A
Energy Technology Data Exchange (ETDEWEB)
Chang, Xiao; Zhang, Haiping [Department of Dermatology and Venereal Disease, Xuanwu Hospital, Capital Medical University, Beijing 100053 (China); Lian, Shi [Department of Dermatology and Venereal Disease, Capital Medical University, Beijing 100069 (China); Zhu, Wei, E-mail: zhuwei_2020@163.com [Department of Dermatology and Venereal Disease, Xuanwu Hospital, Capital Medical University, Beijing 100053 (China)
2016-07-01
As an oncogene, aurora kinase A (AURKA) is overexpressed in various types of human cancers. However, the expression and roles of AURKA in malignant melanoma are largely unknown. In this study, a miR-137-AURKA axis was revealed to regulate melanoma growth. We found a significant increase in levels of AURKA in melanoma. Both genetic knockdown and pharmacologic inhibition of AURKA decreased tumor cell growth in vitro and in vivo. Further found that miR-137 reduced AURKA expression through interaction with its 3′ untranslated region (3′UTR) and that miR-137 was negatively correlated with AURKA expression in melanoma specimens. Overexpression of miR-137 decreased cell proliferation and colony formation in vitro. Notably, re-expression of AURKA significantly rescued miR-137-mediated suppression of cell growth and clonality. In summary, these results reveal that miR-137 functions as a tumor suppressor by targeting AURKA, providing new insights into investigation of therapeutic strategies against malignant melanoma. -- Highlights: •First reported overexpression of AURKA in melanoma. •Targeting AURKA inhibits melanoma growth in vitro and in vivo. •Further found miR-137 suppressed cell growth by binding to AURKA 3′UTR. •Re-expression of AURKA rescued miR-137-mediated suppression. •miR-137-AURKA axis may be potential therapeutic targets of melanoma.
Arbuscular mycorrhizal fungi mediated uptake of {sup 137}Cs in leek and ryegrass
Energy Technology Data Exchange (ETDEWEB)
Rosen, Klas; Weiliang, Zhong; Maertensson, Anna [Department of Soil Sciences, Swedish University of Agricultural Sciences P.O. Box 7014, SE-750 07 Uppsala (Sweden)
2005-02-15
In a first experiment of soil contaminated with {sup 137}Cs, inoculation with a mixture of arbuscular mycorrhizae enhanced the uptake of {sup 137}Cs by leek under greenhouse conditions, while no effect on the uptake by ryegrass was observed. The mycorrhizal infection frequency in leek was independent of whether the {sup 137}Cs-contaminated soil was inoculated with mycorrhizal spores or not. The lack of mycorrhizae-mediated uptake of {sup 137}Cs in ryegrass could be due to the high root density, which was about four times that of leek, or due to a less well functioning mycorrhizal symbiosis than of leek. In a second experiment, ryegrass was grown for a period of four cuts. Additions of fungi enhanced {sup 137}Cs uptake of all harvests, improved dry weight production in the first cut, and also improved the mycorrhizal infection frequencies in the roots. No differences were obtained between the two fungal inoculums investigated with respect to biomass production or {sup 137}Cs uptake, but root colonization differed. We conclude that, under certain circumstances, mycorrhizae affect plant uptake of {sup 137}Cs. There may be a potential for selecting fungal strains that stimulate {sup 137}Cs accumulation in crops. The use of ryegrass seems to be rather ineffective for remediation of {sup 137}Cs-contaminated soil.
Kanasashi, Tsutomu; Takenaka, Chisato; Sugiura, Yuki
2016-05-15
We hypothesized that the water-soluble (ionic) and water-insoluble (stable) radiocesium from the initial fallout of the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident was distributed in various proportions in the surrounding areas and that this distribution was reflected in the trees that suffered deposition from the initial fallout. This study attempted to evaluate local variations in the chemical form of (137)Cs derived from the initial fallout of the FDNPP accident and whether its chemical form affected the radiocesium concentration in the tissues currently growing in trees, even after the initial fallout ceased. For these estimations, the ratio between the (137)Cs concentration in Cryptomeria japonica needle leaves in the tree crown, which existed before the FDNPP accident and subsequently directly exposed to the initial fallout ((137)Cs pre-accident N), and the amount of (137)Cs in the initial fallout itself ((137)Cs fallout) was determined ((137)Cs pre-accident N/(137)Cs fallout) at 66 sites. In addition, the (137)Cs ratios between the male cones produced in 2012 ((137)Cs male cone) and needle leaves that had elongated in the spring of 2011 ((137)Cs 2011N) was determined at 82 sites ((137)Cs male cone/(137) Cs 2011N). Most of the sites with lower (137)Cs pre-accident N /(137)Cs fallout ratios were distributed in eastern Fukushima, relatively close to the Pacific Ocean coastline. Lower (137)Cs pre-accident N/(137)Cs fallout and higher (137)Cs malecone/(137)Cs 2011N were found to be associated with higher proportions of (137)Cs in ionic forms. These observations are consistent with the hypothesis, and likely reflect regional variations in the chemical form of the deposited radiocesium. Copyright © 2016 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Jimenez R, M.; Lopez G, H.; Solache R, M.; Rojas H, A. [Instituto Nacional de Investigaciones Nucleares, Departamento de quimica, A.P. 18-1027, 11801 Mexico D.F. (Mexico)
1998-07-01
It was studied the europium and praseodymium hydrolysis in a 2M NaCl ion force environment at 303 K, through two methods: this one extraction with dissolvents (lanthanide-water-NaCl-dibenzoylmethane) in presence of a competitive ligand (diglycolic acid) and that one direct potentiometric titration, of soluble species, followed by a computer refining. The values of one or another techniques of the first hydrolysis constants obtained were similar, which demonstrates that the results are reliable. The set of data obtained on the stability constants of hydrolysis products allowed to draw up the distribution diagrams of chemical species, as europium as praseodymium in aqueous environment. (Author)
Energy Technology Data Exchange (ETDEWEB)
Penteado Filho, Azor Camargo; Derisio, Jose Carlos; Albuquerque, Antonio Martins de [CETESB, Sao Paulo, SP (Brazil)
1991-12-31
This work presents several actions performed by CETESB, the sanitary engineering agency of Sao Paulo State - Southeast Brazil, in what concerns the accident involving cesium-137 in Goiania, Goias State - Center Brazil. The adopted procedures are described in details
{sup 137}Cs in mushrooms in the Alpine environment; {sup 137}Cs in Pilzen im alpinen Raum
Energy Technology Data Exchange (ETDEWEB)
Lettner, Herbert; Kagerer, Stephan; Hubmer, Alexander [Salzburg Univ. (Austria). Abt. Physik und Biophysik; Bossew, Peter; Witzani, Josef
2009-07-01
Mushrooms tend to accumulate radionuclides due to their physiological peculiarities and their predominant occurrence in nutrient deficient forest ecosystems. For some species, and under certain conditions, radionuclide concentrations may exceed the EC limits of 600 Bq/kg for radionuclides in mushrooms. Still in 2006, in a large scale survey in Salzburg, Upper Austria and in the region of the Koralpe in many edible species, i.e. in xerocomus badius in more than 65% of the collected samples, this limit was exceeded. The contribution gives an overview on the contamination of edible wild mushrooms with {sup 137}Cs, its dependency on the local soil contamination, the spatial distribution in the investigated areas and the preparation of a risk map based on these data. (orig.)
Okutani, Kazuhiro; Nozaki, Koichi; Iwamura, Munetaka
2014-06-02
The circularly polarized luminescence (CPL) from [Eu(pda)2](-) (pda = 1,10-phenanthroline-2,9-dicarboxylic acid) and [Eu(bda)2](-) (bda = 2,2'-bipyridine-6,6'-dicarboxylic acid) in aqueous solutions containing various amino acids was investigated. The europium(III) complexes exhibited bright-red luminescence assignable to the f-f transition of the Eu(III) ion when irradiated with UV light. Although the luminescence was not circularly polarized in the solid state or in aqueous solutions, in accordance with the achiral crystal structure, the complexes exhibited detectable induced CPL (iCPL) in aqueous solutions containing chiral amino acids. In the presence of L-pyrrolidonecarboxylic acid, both [Eu(pda)2](-) and [Eu(bda)2](-) showed similar iCPL intensity (glum ∼ 0.03 for the (5)D0 → (7)F1 transition at 1 mol·dm(-3) of the amino acid). On the other hand, in the presence of L-histidine or L-arginine, [Eu(pda)2](-) exhibited intense CPL (glum ∼ 0.08 for the (5)D0 → (7)F1 transition at 0.10 mol·dm(-3) of the amino acid), whereas quite weak CPL was observed for [Eu(bda)2](-) under the same conditions (glum europium(III) complexes possess coordination structures similar to that in the crystal with slight distortion to form a chiral structure due to specific interaction with two zwitterionic amino acids. This mechanism was in stark contrast to that of the europium(III) complex-pyrrolidonecarboxylic acid system in which one amino acid coordinates to the Eu(III) ion to yield an achiral coordination structure.
Zhang, Wei-Jie; Jiang, Qian; Wang, Xin-Yi; Song, Ge; Shao, Xiao-Xia; Guo, Zhan-Yun
2013-06-01
Relaxin family peptides have important biological functions, and so far, four G-protein-coupled receptors have been identified as their receptors (RXFP1-4). A chimeric relaxin family peptide R3/I5, containing the B-chain of relaxin-3 and the A-chain of INSL5, is a selective agonist for both RXFP3 and RXFP4. In a previous study, europium-labeled R3/I5, as a nonradioactive and low-background receptor-binding tracer, was prepared through a chemical synthesis approach. In the present study, we established a convenient alternative approach for preparing the europium-labeled R3/I5 tracer based on a recombinant R3/I5 designed to carry a solubilizing tag at the A-chain N-terminus and a pyroglutamate residue at the B-chain N-terminus. Because of the presence of a single primary amine moiety, the recombinant R3/I5 peptide was site-specifically mono-labeled at the A-chain N-terminus by a diethylenetriaminepentaacetic acid/europium moiety through a convenient one-step procedure. The diethylenetriaminepentaacetic acid/Eu3+-labeled R3/I5 bound both receptors RXFP3 and RXFP4 with high binding affinities and low nonspecific binding. Thus, we have presented a valuable nonradioactive tracer for future interaction studies on RXFP3 and RXFP4 with various natural or designed ligands. The present approach could also be adapted for preparing and labeling of other chimeric relaxin family peptides. Copyright © 2013 European Peptide Society and John Wiley & Sons, Ltd.
{sup 137}Cs in marine sediments of Admiralty Bay, King George Island, Antarctica
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Paulo Alves de Lima [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil); Ribeiro, Andreza Portella, E-mail: andrezpr@usp.br [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil); Mestrado de Gestão Ambiental e Sustentabilidade, Universidade Nove de Julho (UNINOVE), Avenida Francisco Matarazzo, 612, prédio C, andar térreo, Água Branca, São Paulo, SP, 05001 100 (Brazil); Nascimento, Mylene Giseli do; Martins, Cesar de Castro [Centro de Estudos do Mar, Universidade Federal do Paraná (CEM-UFPR), Av. Beira-mar, no number, Balneário Pontal do Sul, Pontal do Paraná, PR, 83255 971 (Brazil); Mahiques, Michel Michaelovitch de; Montone, Rosalinda Carmelo; Figueira, Rubens Cesar Lopes [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil)
2013-01-15
The radionuclide cesium-137 ({sup 137}Cs) is produced exclusively by anthropogenic processes and primarily by nuclear explosions. This study determined the reference inventory that is {sup 137}Cs associated with the element's original input, and utilized the levels of activity of this radionuclide previously measured in five sediment profiles collected from Admiralty Bay, Antarctica, to investigate the mobility of this element in the environment. {sup 137}Cs has a half-life of 30 years. Because of this, it is environmentally persistent and has been shown to accumulate in marine organisms. The mean reference inventory of this radionuclide in Admiralty Bay sediments, determined using high resolution gamma ray spectrometry, was 20.23 ± 8.94 Bq m{sup −2}, and within the ambient {sup 137}Cs activity range. A model of {sup 137}Cs diffusion–convection was applied to data collected from 1 cm intervals in sediment cores with the aim of providing insights with respect to this element's behavior in sediments. Model results showed a significant correlation between measured and modeled values using the concentrations of {sup 137}Cs, and estimated input into the system from the global fallout of past nuclear tests and expected values based on local sedimentation rates. Results highlight the importance of accounting for the vertical diffusion of {sup 137}Cs in marine sediments when used as a tracer for environmental processes and for assessing potential bioavailability. - Highlights: ► Cesium-137 ({sup 137}Cs) is produced exclusively by anthropogenic processes. ► A model of diffusion–convection simulated {sup 137}Cs environmental behavior. ► This is important for assessing the bioavailability of this toxic element. ► In Antarctica ice cover influenced the input to the sediments.
Energy Technology Data Exchange (ETDEWEB)
Mitrovic, Branislava M.; Vitorovic, Gordana; Lazarevic-Macanovic, Mirjana [University of Belgrade, Faculty of Veterinary Medicine, Department of Radiology and Radiation Hygiene, Belgrade (Serbia); Vicentijevic, Mihajlo [Insititute of Veterinary Medicine Serbia, Laboratory of Radiation Hygiene, Belgrade (Serbia); Vitorovic, Dusko [University of Belgrade, Faculty of Agriculture, Department of Animal Science, Belgrade (Serbia); Pantelic, Gordana [Institute of Nuclear Sciences-Vinca, Belgrade (Serbia)
2012-03-15
The aim of the present study was to investigate distribution of {sup 137}Cs in leg and breast meat of broilers and pheasants following single alimentary contamination and administration of two protectors (AFCF and clinoptilolite). The birds were administered a single dose of {sup 137}CsCl, with an activity of 750 Bq. Protectors were given via gastric tube or mixed in the forage pellets. AFCF given via gastric tube decreased the {sup 137}Cs concentration by a factor of 7.8 in broilers leg meat and 7.4 in broilers breast meat. When AFCF was mixed in pellets, the {sup 137}Cs concentration was 19.5 times lower in broilers leg meat and 22.1 times lower in broilers breast meat, than in the control group. In pheasants, AFCF administered via gastric tube decreased the {sup 137}Cs concentration by a factor of 12.4 in leg meat and by a factor of 13.7 in breast meat, respectively. In group 4, where pheasants were administered AFCF mixed in pellets, the {sup 137}Cs concentration was 3.7 times lower in leg and breast meat, than in the control group. For comparison, clinoptilolite administered via gastric tube decreased the {sup 137}Cs concentration 1.8 times in broilers leg meat and 2.0 times in breast meat, compared to the control group. In pheasants, {sup 137}Cs concentration was 2.9 times lower in leg meat and 2.6 times lower in breast meat. Clinoptilolite mixed in the feed had relatively low efficiency of protection in broilers ({sup 137}Cs concentration was 1.4 times lower in leg meat and 1.6 lower in breast meat). A similar trend was observed in pheasants ({sup 137}Cs concentration was 1.6 lower in leg and breast meat). (orig.)
Down-regulation of GPR137 expression inhibits proliferation of colon cancer cells.
Zhang, Kai; Shen, Zhen; Liang, Xianjun; Liu, Tongjun; Wang, Tiejun; Jiang, Yang
2014-11-01
G protein-coupled receptors (GPRs) are highly related to oncogenesis and cancer metastasis. G protein-coupled receptor 137 (GPR137) was initially reported as a novel orphan GPR about 10 years ago. Some orphan GPRs have been implicated in human cancers. The aim of this study is to investigate the role of GPR137 in human colon cancer. Expression levels of GRP137 were analyzed in different colon cancer cell lines by quantitative polymerase chain reaction and western blot analysis. Lentivirus-mediated short hairpin RNA was specifically designed to knock down GPR137 expression in colon cancer cells. Cell viability was measured by methylthiazoletetrazolium and colony formation assays. In addition, cell cycle characteristic was investigated by flow cytometry. GRP137 expression was observed in all seven colon cancer cell lines at different levels. The mRNA and protein levels of GPR137 were down-regulated in both HCT116 and RKO cells after lentivirus infection. Lentivirus-mediated silencing of GPR137 reduced the proliferation rate and colonies numbers. Knockdown of GPR137 in both cell lines led to cell cycle arrest in the G0/G1 phase. These results indicated that GPR137 plays an important role in colon cancer cell proliferation. A better understanding of GPR137's effects on signal transduction pathways in colon cancer cells may provide insights into the novel gene therapy of colon cancer. © The Author 2014. Published by ABBS Editorial Office in association with Oxford University Press on behalf of the Institute of Biochemistry and Cell Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences.
Ribeiro, Maria Elenir N P; Vieira, Icaro G P; Cavalcante, Igor Marques; Ricardo, Nágila M P S; Attwood, David; Yeates, Stephen G; Booth, Colin
2009-08-13
The solubilisation of two poorly soluble flavonoids, quercetin and rutin, in micellar solutions of mixtures of a block copolymer of ethylene oxide and styrene oxide (E(137)S(18)E(137)) with one of ethylene oxide and propylene oxide (E(62)P(39)E(62)) has been studied at 25 and 37 degrees C. Solubilisation capacities were higher than those for the model poorly water-soluble drug griseofulvin and comparable with published values for the solubilisation of rutin by beta-cyclodextrin.
Energy Technology Data Exchange (ETDEWEB)
Miyake, Sadaaki [Saitama Inst. of Public Health (Japan); Nakamura, Fumio; Izumo, Yoshiro
2000-02-01
In order to investigate in more detail on the {sup 137}Cs concentration in pond sediments, we have carried out analysis on the bonding forms of {sup 137}Cs in pond sediments. The existing rate of different bonding forms of {sup 137}Cs in pond sediments was found to be below 5% for F1: exchangeable and F2: bound to carbonates, 18-24% for F3: bound to iron and manganese oxides, 14-17% for F4: bound to organic matter and 54-60% for F5: residual (mainly, bound to silicate minerals). Furthermore, we have investigated the relations among the {sup 137}Cs concentration in each place, the ignition loss, the total carbon and the carbon exchange capacity of pond sediment, respectively. We have found a tendency that the larger the ignition loss, the total carbon and the cation exchange capacity are, the higher the {sup 137}Cs concentration is. On the other hand, about 90% of {sup 40}K in pond sediments is in the form of F5, and the bonding forms of {sup 137}Cs and {sup 40}K are obviously different regardless of the fact that both are alkaline metals. (author)
Comanzo, Holly Ann; Setlur, Anant Achyut; Srivastava, Alok Mani; Manivannan, Venkatesan
2004-07-13
Europium-activated phosphors comprise oxides of at least a rare-earth metal selected from the group consisting of gadolinium, yttrium, lanthanum, and combinations thereof and at least a Group-IIIB metal selected from the group consisting of aluminum, gallium, indium, and combinations thereof. A method for making such phosphors comprises adding at least a halide of at least one of the selected Group-IIIB metals in a starting mixture. The method further comprises firing the starting mixture in an oxygen-containing atmosphere. The phosphors produced by such a method exhibit improved absorption in the UV wavelength range and improved quantum efficiency.
Haugaard-Kedström, Linda M; Wong, Lilian L L; Bathgate, Ross A D; Rosengren, K Johan
2015-06-01
Relaxin-3 and its endogenous receptor RXFP3 are involved in fundamental neurological signalling pathways, such as learning and memory, stress, feeding and addictive behaviour. Consequently, this signalling system has emerged as an attractive drug target. Development of leads targeting RXFP3 relies on assays for screening and ligand optimization. Here, we present the synthesis and in vitro characterization of a fluorescent europium-labelled antagonist of RXFP3. This ligand represents a cheap and safe but powerful tool for future mechanistic and cell-based receptor-ligand interaction studies of the RXFP3 receptor.
Bis{[6-methoxy-2-(4-methylphenyliminiomethyl]phenolate-κ2O,O′}tris(nitrato-κ2O,O′europium(III
Directory of Open Access Journals (Sweden)
Hang-Ming Guo
2010-11-01
Full Text Available The crystal structure of title compound, [Eu(NO33(C15H15NO22], contains two Schiff base 6-methoxy-2-[(4-methylphenyliminomethyl]phenolate (L ligands and three independent nitrate ions that chelate to the europium(III ion via the O atoms. The coordination number of the EuIII ion is ten. The L ligands chelate with a strong Eu—O(deprotonated phenolate bond and a weak Eu—O(methoxy contact, the latter can be interpreted as the apices of the bicapped square-antiprismatic EuIII polyhedron. Intramolecular N—H...O hydrogen bonds occur.
Concentrations of {sup 137}Cs in lynx (Lynx lynx) in relation to prey choice
Energy Technology Data Exchange (ETDEWEB)
Skuterud, Lavrans [Norwegian Radiation Protection Authority, PO Box 55, NO-1332 Osteraas (Norway)]. E-mail: lavrans.skuterud@nrpa.no; Gaare, Eldar [Norwegian Institute for Nature Research, Tungasletta 2, NO-7485 Trondheim (Norway); Kvam, Tor [Nord-Troendelag University College, Servicebox 2501, NO-7729 Steinkjer (Norway); Hove, Knut [Department of Animal Science, Agricultural University of Norway, NO-1432 Aas (Norway); Steinnes, Eiliv [Department of Chemistry, Norwegian University of Science and Technology, NO-7491 Trondheim (Norway)
2005-07-01
Concentrations of {sup 137}Cs were determined in 747 lynxes killed in Norway during the period 1986-2001. Highly variable {sup 137}Cs concentrations and aggregated transfer coefficient values were observed, probably caused by variable {sup 137}Cs concentrations in prey and the lynx's extensive home ranges and roaming distances. Adult lynxes had higher {sup 137}Cs concentrations than sub-adults, and lynxes killed in regions with extensive reindeer grazing areas were more contaminated than others. A model with {sup 137}Cs deposition density, the year lynxes were killed, age, and extent of reindeer grazing area accounted for 50% of the variability in observed {sup 137}Cs concentrations. The analyses were equivocal regarding the influence of stomach content on {sup 137}Cs concentrations in lynx muscle, i.e., on the lynx's specialization in prey species. Gender was not significant. Information on caesium retention in lynx and better estimates of deposition densities in lynxes' home ranges are important for further elucidation of factors influencing {sup 137}Cs contamination in lynxes.
9 CFR 3.137 - Primary enclosures used to transport live animals.
2010-01-01
... live animals. 3.137 Section 3.137 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... live animals. No dealer, research facility, exhibitor, or operator of an auction sale shall offer for transportation or transport, in commerce, any live animal in a primary enclosure which does not conform to the...
42 CFR 137.30 - What is a self-governance compact?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What is a self-governance compact? 137.30 Section... SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.30 What is a self-governance compact? A self-governance compact is a legally binding and mutually...
42 CFR 137.35 - What is the term of a self-governance compact?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What is the term of a self-governance compact? 137... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.35 What is the term of a self-governance compact? Upon approval and execution of a self-governance...
42 CFR 137.15 - Who may participate in Tribal Self-Governance?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Who may participate in Tribal Self-Governance? 137... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Selection of Indian Tribes for Participation in Self-Governance § 137.15 Who may participate in Tribal Self-Governance? Those...
ESTIMATION OF THE DECREASING OF 137 CS SEDIMENT IN THE SOIL DUE TO HORIZONTAL FLOWING
Directory of Open Access Journals (Sweden)
O. N. Prokof'ev
2008-01-01
Full Text Available The purpose of work is to estimate the possible decreasing of the density of 137 Cs sediment in the soil influenced by the horizontal flowing basing on the analysis of on location observations on the density of 137 Cs sediment in the soil after the Chernobyl accident.
42 CFR 137.25 - Are planning and negotiation grants available?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Are planning and negotiation grants available? 137... for Participation in Self-Governance Planning Phase § 137.25 Are planning and negotiation grants... planning and negotiation grants available, an explanation of the application process for such grants, and...
31 CFR 103.137 - Anti-money laundering programs for insurance companies.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Anti-money laundering programs for insurance companies. 103.137 Section 103.137 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering...
2011-03-16
... Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1, Jetstream Series 200, Jetstream Series 3101, and... issued British Aerospace Jetstream Series 3100 & 3200 Service Bulletin 32-JA090240, Revision 1, dated... British Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1, Jetstream Series 200, Jetstream Series...
21 CFR 516.137 - Notification of decision regarding eligibility for indexing.
2010-04-01
... indexing. 516.137 Section 516.137 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... Notification of decision regarding eligibility for indexing. (a) Within 90 days after the filing of a request for a determination of eligibility for indexing based on § 516.129(c)(7)(i), or 180 days for a request...
42 CFR 137.226 - How does a Self-Governance Tribe request a waiver?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false How does a Self-Governance Tribe request a waiver? 137.226 Section 137.226 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Regulation Waiver...
MicroRNA-137 promoter methylation in oral lichen planus and oral squamous cell carcinoma
DEFF Research Database (Denmark)
Dang, Jun; Bian, Yong-qian; Sun, Jian-yong
2013-01-01
Oral lichen planus (OLP) is a common oral mucosal disease, which is generally considered a potentially malignant lesion. To identify efficiently prognostic biomarker, we investigated the microRNA-137 (miR-137) promoter methylation in OLP and compared with the samples from healthy volunteers and p...
42 CFR 137.353 - What is contained in a construction project financial report?
2010-10-01
... financial concerns of the Self-Governance Tribe, if any. Roles of the Secretary in Establishing and... financial report? 137.353 Section 137.353 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE...
14 CFR 91.137 - Temporary flight restrictions in the vicinity of disaster/hazard areas.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Temporary flight restrictions in the vicinity of disaster/hazard areas. 91.137 Section 91.137 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES GENERAL OPERATING AND FLIGHT RULES Flight Rules General §...
Compartmental Model For Uptake Of 137cs By Pine In Forest Soil ...
African Journals Online (AJOL)
A compartmental model of soil to pine tree transfer of 137Cs following the Chernobyl nuclear accident is presented. The model was validated using data collected in 1996 at five sites in Northern Ukraine. The transfer constants of 137Cs between model compartments are estimated using a semi-empirical method.
Biological effects of cesium-137 injected in beagle dogs of different ages
Energy Technology Data Exchange (ETDEWEB)
Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C. [and others
1995-12-01
The toxicity of cesium-137 ({sup 137}Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of {sup 137}Cs are important to understand because {sup 137}Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy.
Hu, Allen H; Kuo, Chien-Hung; Huang, Lance H; Su, Chao-Chin
2017-02-01
Rare earth elements are key raw materials in high-technology industries. Mining activities and manufacturing processes of such industries have caused considerable environmental impacts, such as soil erosion, vegetation destruction, and various forms of pollution. Sustaining the long-term supply of rare earth elements is difficult because of the global shortage of rare earth resources. The diminishing supply of rare earth elements has attracted considerable concern because many industrialized countries regarded such elements as important strategic resources for economic growth. This study aims to explore the carbon footprints of yttrium and europium recovery techniques from phosphor. Two extraction recovery methods, namely, acid extraction and solvent extraction, were selected for the analysis and comparison of carbon footprints. The two following functional units were used: (1) the same phosphor amounts for specific Y and Eu recovery concentrations, and (2) the same phosphor amounts for extraction. For acid extraction method, two acidic solutions (H2SO4 and HCl) were used at two different temperatures (60 and 90°C). For solvent extraction method, acid leaching was performed followed by ionic liquid extraction. Carbon footprints from acid and solvent extraction methods were estimated to be 10.1 and 10.6kgCO2eq, respectively. Comparison of the carbon emissions of the two extraction methods shows that the solvent extraction method has significantly higher extraction efficiency, even though acid extraction method has a lower carbon footprint. These results may be used to develop strategies for life cycle management of rare earth resources to realize sustainable usage. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Ishwar Prasad Sahu
2015-07-01
Full Text Available A new orange–red europium doped di-calcium magnesium di-silicate (Ca2MgSi2O7:Eu3+ phosphor was prepared by the traditional high temperature solid state reaction method. The prepared Ca2MgSi2O7:Eu3+ phosphor was characterized by X-ray diffractometer (XRD, transmission electron microscopy (TEM, field emission scanning electron microscopy (FESEM with energy dispersive x-ray spectroscopy (EDX, fourier transform infrared spectra (FTIR, photoluminescence (PL and decay characteristics. The phase structure of sintered phosphor was akermanite type structure which belongs to the tetragonal crystallography with space group P4¯21m, this structure is a member of the melilite group and forms a layered compound. The chemical composition of the sintered Ca2MgSi2O7:Eu3+ phosphor was confirmed by EDX spectra. The PL spectra indicate that Ca2MgSi2O7:Eu3+ can be excited effectively by near ultraviolet (NUV light and exhibit bright orange–red emission with excellent color stability. The fluorescence lifetime of Ca2MgSi2O7:Eu3+ phosphor was found to be 28.47 ms. CIE color coordinates of Ca2MgSi2O7:Eu3+ phosphor is suitable as orange-red light emitting phosphor with a CIE value of (X = 0.5554, Y = 0.4397. Therefore, it is considered to be a new promising orange–red emitting phosphor for white light emitting diode (LED application.
Bollu, Vishnu Sravan; Nethi, Susheel Kumar; Dasari, Rama Krishna; Rao, Soma Shiva Nageshwara; Misra, Sunil; Patra, Chitta Ranjan
2016-01-01
Our group already demonstrated that europium hydroxide nanorods (EHNs) show none or mild toxicity in C57BL/6 mice even at high dose and exhibited excellent pro-angiogenic activity towards in vitro and in vivo models. In the present study, we evaluated the in vivo cytogenetic toxicity of intraperitoneally administered EHNs (12.5-250 mg/kg/b.w.) in male and female Swiss albino mice by analyzing chromosomal aberrations (CAs), mitotic index (MI), micronucleus (MN) from bone marrow and peripheral blood. Furthermore, we performed the cytogenetic toxicity study of EHNs towards Chinese hamster ovary (CHO) cells, in order to compare with the in vivo results. The results of CA assay of mice treated with EHNs (12.5-125 mg/kg/b.w.) showed no significant change in the formation of aberrant metaphases compared to the control group. Also, there was no significant difference in the number of dividing cells between the control group and EHNs-treated groups observed by MI study, suggesting the non-cytotoxicity of EHNs. Additionally, FACS study revealed that EHNs do not arrest cells at any phase of cell cycle in the mouse model. Furthermore, MN test of both bone marrow and peripheral blood showed no significant differences in the induction of MNs when compared with the control group. In vitro results from CHO cells also support our in vivo observations. Considering the role of angiogenesis by EHNs and the absence of its genotoxicity in mouse model, we strongly believe the future application of EHNs in treating various diseases, where angiogenesis plays an important role such as cardiovascular diseases, ischemic diseases and wound healing.
Estimation of vertical migration velocity of (137)Cs in the Mount IDA/Kazdagi, Turkey.
Karadeniz, Özlem; Çakır, Rukiye; Karakurt, Hidayet
2015-08-01
This paper presents the results obtained from a radioecological study carried out in the forest sites of Mount IDA (Kazdagi)/Edremit, Turkey. For 118 soil profiles, the depth distribution of (137)Cs activity was established by fitting the experimental points to an exponential, a gaussian or a log-normal function. The relaxation lengths were in the range of 1.09-16.7 cm with a mean of 5.73 cm, showing a slow transport and a strong retention capacity of (137)Cs even after the 26-y period of Chernobyl accident. From the data for the vertical distribution of (137)Cs in soil profiles, the mean annual migration velocity of (137)Cs was in the range of 0.11-0.62 cm year(-1) with a mean of 0.30 cm year(-1). Statistically significant correlations between the thickness of the humus layer and the mean annual velocity of (137)Cs were found for both coniferous and mixed forest sites. The mean annual velocity of (137)Cs in the forests sites with Pinus nigra var pallasiana was significantly higher than sites with Pinus brutia. External dose-rates from the (137)Cs in forest soils were estimated using a conversion factor used in many studies and comprised with the external dose-rates determined according to the vertical distribution of (137)Cs within the soil depth profiles. It is clearly seen that both levels and spatial distribution patterns of the external dose-rates from (137)Cs were influenced considerably with the vertical migration rate and the vertical distribution of (137)Cs. Copyright © 2015 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Remy, J.; Philippon, A.; Lafuma, J.; Walter, C. [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Departement de la Protection Sanitaire, Laboratoire de Radiopathologie
1967-07-01
The authors carry out research into the distribution kinetics, the metabolism and the excretion of {sup 137}Cs - {sup 137}Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [French] Les auteurs etudient experimentalement la cinetique de distribution, le metabolisme et l
Karakterisasi ekstrak kasar lipase Rhizopus stolonifer UICC 137
Directory of Open Access Journals (Sweden)
Sri Sumiarsih
2001-12-01
Full Text Available There is an increasing commercial interest in enzymatic production of biologically active component, because there are a number of well-known advantages compared to chemical synthesis. One of the most valuable synthetic features of enzyme is their ability to discriminate between enantiomers of racemic substrates. Lipase have become of great interest to the chemical industries wing their usefulness in both hydrolytic and synthesis reactions. The aim of this work was to study the production of lipase by Rhizopus stolonifer UICC 137, and determine the crude lipase preparation characteristics. The lipolytic activity was determined by titrimetric method toward oil-arabic gum emultion as a substrate. The strain produced lipase at appreciable lipolytic when cultivated for 72 hours in medium containing 3% glucose and 1% olive oil. Our data suggest that the strain produced lipase since the exponential phase of its growth. Lipase with optimum lipolytic activity was obtained at late stationary phase. The optimum condition for lipolytic activity measurement were pH of 7.5 and temperature 37oC, the crude enzyme had a specific activity 20.2 unit/ mg protein, the Vmax was 15.1 mol/ min and KM was 12.5 mg/ ml. The crude enzyme retained 79.9%, 68.0% and 52.6% of its lipolytic activity, when incubated for 90 minutes at temperature of 40, 50, and 60oC respectively.
Alfi, Nafiseh; Khorasani-Motlagh, Mozhgan; Rezvani, Ali Reza; Noroozifar, Meissam; Molčanov, Krešimir
2017-06-01
A heteroleptic europium coordination compound formulated as [Eu(phen)2(OH2)2(Cl)2](Cl)(H2O) (phen = 1,10-phenanthroline), has been synthesized and characterized by elemental analysis, FT-IR spectroscopy, and single-crystal X-ray diffractometer. Crystal structure analysis reveals the complex is crystallized in orthorhombic system with Pca21 space group. Electronic absorption and various emission methods for investigation of the binding system of europium(III) complex to Fish Salmon deoxyribonucleic acid (FS-DNA) and Bovamin Serum Albumin (BSA) have been explored. Furthermore, the binding constants, binding sites and the corresponding thermodynamic parameters of the interaction system based on the van't Hoff equation for FS-DNA and BSA were calculated. The thermodynamic parameters reflect the exothermic nature of emission process (ΔH°DNA by non-intercalative mode which the groove binding is preferable mode. Also, the complex exhibits a brilliant antimicrobial activity in vitro against standard bacterial strains.
Si, Hailin; Zhao, Fang; Cai, Huan
2013-01-01
A novel luminescence, enhancement phenomenon in the europium(III)-dopamine-sodium dodecylbenzene sulfonate system was observed when lanthanum(III) was added. Based on this, a sensitive co-luminescence method was established for the determination of dopamine. The luminescence signal for the europium (III)-lanthanum(III)-dopamine-sodium dodecylbenzene sulfonate system was monitored at λ(ex) = 300 nm, λ(em) = 618 nm and pH 8.3. Under optimized conditions, the enhanced luminescence signal responded linearly to the concentration of dopamine in the range 1.0 × 10(-10)-5.0 × 10(-7) mol/L with a correlation coefficient of 0.9993 (n = 11). The detection limit (3σ) was 2.7 × 10(-11) mol/L and the relative standard deviation for 11 parallel measurements of 3.0 × 10(-8) mol/L dopamine was 1.9%. The presented method was successfully applied for the estimation of dopamine in samples of pharmaceutical preparations, human serum and urine. The possible luminescence enhancement mechanism of the system is discussed briefly. Copyright © 2013 John Wiley & Sons, Ltd.
Zhu, Wei; Liang, Shuang; Wang, Jing; Yang, Zhe; Zhang, Li; Yuan, Tianmeng; Xu, Zushun; Xu, Haibo; Li, Penghui
2017-05-01
Multifunctional nanocomposites based on BaGdF5 nanoparticles (NPs) and metal phenolic network (MPN) have been engineered as novel contrast agents for potential applications in X-ray computed tomography, magnetic resonance and luminescence imaging. The BaGdF5@MPN nanocomposites were synthesized at room temperature by coating BaGdF5 NPs with europium-phenolic network, which was obtained by the coordination of europium (III) with tannic acid (TA). The in vitro cytotoxicity assays against HepG2 cells revealed that the BaGdF5@MPN nanocomposites presented better cytocompatibility and lower cytotoxity than pure BaGdF5 NPs. In addition, vivid red and green luminescence can be observed by confocal laser scanning microscope (CLSM) from the BaGdF5@MPN nanocomposites laden HepG2 cells under the excitation of UV (390 nm) and visible light (440 nm), respectively. The longitudinal relaxivity value (r1) of the nanocomposites was 2.457 mM-1s-1. Moreover, the nanocomoposites exhibited X-ray computed tomography (CT) and T1-weighted magnetic resonance (MR) imaging capacities, and the intensities of the enhanced signals of in vitro CT and MR images were proportional to the concentrations of the nanocomposites. These results indicated that the as-prepared BaGdF5@MPN nanocomposites are promising contrast agents for CT/MR/luminescence imaging.
Wang, Min; Che, Yinsheng; Niu, Chao; Dang, Mingyan; Dong, Duo
2013-11-15
Eu-B co-doped BiVO4 visible-light-driven photocatalysts have been synthesized using the sol-gel method. The resulting materials were characterized by a series of joint techniques, including XPS, XRD, SEM, BET, and UV-vis DRS analyses. Compared with BiVO4 and B-BiVO4 photocatalysts, the Eu-B-BiVO4 photocatalysts exhibited much higher photocatalytic activity for methyl orange (MO) degradation under visible light irradiation. The optimal Eu doping content is 0.8 mol%. It was revealed that boron and europium were doped into the lattice of BiVO4 and this led to more surface oxygen vacancies, high specific surface areas, small crystallite size, a narrower band gap and intense light absorbance in the visible region. The doped Eu(III) cations can help in the separation of photogenerated electrons. The synergistic effects of boron and europium in doped BiVO4 were the main reason for improving visible light photocatalytic activity. Copyright © 2013 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Farias, Aline M.; Sandrini, Marcelo; Viana, José Renato M.; Baesso, Mauro L.; Bento, Antônio C.; Rohling, Jurandir H. [Departamento de Física, Universidade Estadual de Maringá, Av Colombo, 5790, 87020-900, Maringá, PR (Brazil); Guyot, Yannick [Laboratoire de Physico–Chimie des Matériaux Luminescents, Université de Lyon, Université Claude Bernard Lyon 1, Villeurbanne, UMR 5620 CNRS 69622 (France); De Ligny, Dominique [Department of Materials Science and Engineering, University of Erlangen Nürnberg, Martens str. 5, 91058, Erlangen (Germany); Nunes, Luiz Antônio O. [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador São-Carlense400, 13566-590, São Carlos, SP (Brazil); Gandra, Flávio G. [Instituto de Física Gleb Wataghin, Universidade Estadual de Campinas, 13083-859, Campinas, SP (Brazil); Sampaio, Juraci A. [Lab Ciências Físicas, Universidade Estadual Norte Fluminense, 28013-602, Campos Dos Goytacazes, RJ (Brazil); Lima, Sandro M.; Andrade, Luis Humberto C. [Grupo de Espectroscopia Óptica e Fototérmica, Universidade Estadual de Mato Grosso do Sul-UEMS, Dourados, MS, C. P. 351, CEP 79804-970 (Brazil); and others
2015-04-15
The relationship between emission tunability and the local environment of europium ions in OH{sup −}-free calcium aluminosilicate glasses was investigated, focusing on the development of devices for artificial lighting. Significant conversion of Eu{sup 3+} to Eu{sup 2+} was obtained by means of melting the glasses under a vacuum atmosphere and controlling the silica content, resulting in broad, intense, and tunable luminescence ranging from blue to red. Electron spin resonance and X-ray absorption near edge structure measurements enabled correlation of the luminescence behavior of the material with the Eu{sup 2+}/Eu{sup 3+} concentration ratio and changes in the surrounding ions' crystal field. The coordinates of the CIE 1931 chromaticity diagram were calculated from the spectra, and the contour maps showed that the light emitted from Eu{sup 2+} presented broad bands and enhanced color tuning, ranging from reddish-orange to blue. The results showed that these Eu doped glasses can be used for tunable white lighting by combining matrix composition and the adjustment of the pumping wavelength. - Highlights: • Eu{sup 2+}-doped OH{sup −} free calcium aluminosilicate glass as a new source for white lighting. • Correlation between emission tunability and local environment of europium ions. • Significant reduction of Eu{sup 3+} to Eu{sup 2+} by melting the glasses under vacuum atmosphere. • Broad, intense and tunable luminescence ranging from blue to red.
Energy Technology Data Exchange (ETDEWEB)
Kanasashi, Tsutomu, E-mail: kanasashi.tsutomu@g.mbox.nagoya-u.ac.jp [Graduate School of Bioagricultural Sciences, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi 464-8601 (Japan); Takenaka, Chisato [Graduate School of Bioagricultural Sciences, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi 464-8601 (Japan); Sugiura, Yuki [Japan Atomic Energy Agency, 765-1 Funaishikawa, Tokai-mura, Naka-gun, Ibaraki 319-1184 (Japan)
2016-05-15
We hypothesized that the water-soluble (ionic) and water-insoluble (stable) radiocesium from the initial fallout of the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident was distributed in various proportions in the surrounding areas and that this distribution was reflected in the trees that suffered deposition from the initial fallout. This study attempted to evaluate local variations in the chemical form of {sup 137}Cs derived from the initial fallout of the FDNPP accident and whether its chemical form affected the radiocesium concentration in the tissues currently growing in trees, even after the initial fallout ceased. For these estimations, the ratio between the {sup 137}Cs concentration in Cryptomeria japonica needle leaves in the tree crown, which existed before the FDNPP accident and subsequently directly exposed to the initial fallout ({sup 137}Cs{sub pre-accident} {sub N}), and the amount of {sup 137}Cs in the initial fallout itself ({sup 137}Cs{sub fallout}) was determined ({sup 137}Cs{sub pre-accident} {sub N}/{sup 137}Cs{sub fallout}) at 66 sites. In addition, the {sup 137}Cs ratios between the male cones produced in 2012 ({sup 137}Cs{sub male} {sub cone}) and needle leaves that had elongated in the spring of 2011 ({sup 137}Cs{sub 2011N}) was determined at 82 sites ({sup 137}Cs{sub male} {sub cone}/{sup 137} Cs{sub 2011N}). Most of the sites with lower {sup 137}Cs{sub pre-accident} {sub N}/{sup 137}Cs{sub fallout} ratios were distributed in eastern Fukushima, relatively close to the Pacific Ocean coastline. Lower {sup 137}Cs{sub pre-accidentN}/{sup 137}Cs{sub fallout} and higher {sup 137}Cs{sub malecone}/{sup 137}Cs{sub 2011N} were found to be associated with higher proportions of {sup 137}Cs in ionic forms. These observations are consistent with the hypothesis, and likely reflect regional variations in the chemical form of the deposited radiocesium. - Highlights: • Study of spatial variation of ionic and stable {sup 137}Cs in the initial
{sup 137}Cs in the population of northern Sweden; {sup 137}Cs i befolkningsgrupper i norra Sverige
Energy Technology Data Exchange (ETDEWEB)
Aagren, G.; Bjoereland, A.; Johansson, Lennart
1996-12-01
The activity of Cs 137 has been studied in several different population groups in northern Sweden after the Chernobyl accident. Special attention has been given to the Saami (Lapp) population from which we have measured a group of volunteers regularly between 1986 and 1990. In 1991 we started a study on randomly chosen groups from the general population and members of the Saami communities from three regions in northern Sweden with different deposition levels. The results from these measurements have shown an effective half-time of Cs whole-body content in the Saami groups of about five years. The measurements in 1996 show decreasing levels of activities in the different population groups with half-times between 4 and 12 years. Another exposed group is breast-fed babies. We have measured the transfer of Cs from mother to baby via the breast milk in 12 cases. The activity in breast milk was measured to be 14% of the activity in the mother (calculated using specific activity - Bq/kg). The corresponding activity in the baby was 90% of the activity in the mother. 13 refs.
Evaluation of DNA damage induced by Auger electrons from 137Cs.
Watanabe, Ritsuko; Hattori, Yuya; Kai, Takeshi
2016-11-01
To understand the biological effect of external and internal exposure from 137Cs, DNA damage spectrum induced by directly emitted electrons (γ-rays, internal conversion electrons, Auger electrons) from 137Cs was compared with that induced by 137Cs γ-rays. Monte Carlo track simulation method was used to calculate the microscopic energy deposition pattern in liquid water. Simulation was performed for the two simple target systems in microscale. Radiation sources were placed inside for one system and outside for another system. To simulate the energy deposition by directly emitted electrons from 137Cs placed inside the system, the multiple ejections of electrons after internal conversion were considered. In the target systems, induction process of DNA damage was modeled and simulated for both direct energy deposition and the water radical reaction on the DNA. The yield and spatial distribution of simple and complex DNA damage including strand breaks and base lesions were calculated for irradiation by electrons and γ-rays from 137Cs. The simulation showed that the significant difference in DNA damage spectrum was not caused by directly ejected electrons and γ-rays from 137Cs. The result supports the existing perception that the biological effects by internal and external exposure by 137Cs are equivalent.
Cs-137 in terrestrial environment in Loviisa, Olkiluoto and Maenttae areas (Finland)[Radioecology
Energy Technology Data Exchange (ETDEWEB)
Vartti, V.P.; Ikaeheimonen, T.K.; Klemola, S.; Ilus, E.; Mattila, J. [STUK - Radiation and Nuclear Safety Authority, Helsinki (Finland)
2006-04-15
The aim of the study was to clarify how Cs-137 is accumulated in different biota species in Finnish terrestrial environment. The study was carried out in three different areas. The Maenttae area was one of the areas in Finland with the highest contamination by the Chernobyl fallout. The other areas (Loviisa and Olkiluoto) represent the environs of the Finnish NPPs located in the South and West coast of Finland, respectively (Fig. 1). The sampling was carried out in 2000 in Loviisa, in 2001 in Olkiluoto and in 2003 in Maenttae. Altogether over 120 samples from over 50 species were taken including soil profiles, mushrooms, lichens, mosses, ferns, twigs, needles, leaves and berries. All the samples were dried and homogenized and Cs-137 was measured with HPGe gamma spectrometers. The highest Cs-137 concentrations and Tagg values were found in mushrooms. The Cs-137 concentrations in needles, twigs and ferns were clearly lower than in mushrooms. The activity concentration of Cs-137 in lichens, mosses and leaves were at the same level as in needles and ferns. The concentrations of Cs-137 in berries Vaccinium vitis-idaea, Vaccinium myrtillus and Empetrum nigrum varied from 160 to 1200 Bq/kg d.w. In other berries the concentrations were very low. The best indicator species seemed to be mushrooms. The results of Hypogymnia physodes sampled in Loviisa in 2000 showed that Cs-137 concentrations can vary greatly within a small area. (LN)
miR-137 inhibits glutamine catabolism and growth of malignant melanoma by targeting glutaminase.
Luan, Wenkang; Zhou, Zhou; Zhu, Yan; Xia, Yun; Wang, Jinlong; Xu, Bin
2018-01-01
Glutamine catabolism is considered to be an important metabolic pathway for cancer cells. Glutaminase (GLS) is the important rate-limiting enzyme of glutamine catabolism. miR-137 functions as a tumor suppressor in many human malignant tumors. However, the role and molecular mechanism of miR-137 and GLS in malignant melanoma has not been reported. In this study, we showed that miR-137 was decreased in melanoma tissue, and the low miR-137 level and high GLS expression are independent risk factor in melanoma. miR-137 suppressed the proliferation and glutamine catabolism of melanoma cells. GLS is crucial for glutamine catabolism and growth of malignant melanoma. We also demonstrated that miR-137 acts as a tumor suppressor in melanoma by targeting GLS. This result elucidates a new mechanism for miR-137 in melanoma development and provides a survival indicator and potential therapeutic target for melanoma patients. Copyright © 2017 Elsevier Inc. All rights reserved.
Senile gluteal dermatosis: a clinical study of 137 cases.
Liu, Han-Nan; Wang, Wen-Jen; Chen, Chih-Chiang; Lee, Ding-Dar; Chang, Yun-Ting
2014-01-01
Senile gluteal dermatosis (SGD) is a common genital dermatosis but has gained little attention before. A large-scale clinical study of this disease is lacking. We examined 162 consecutive outpatients with gluteal skin diseases of different causes. Fourteen skin biopsies were performed. Patient's age, gender, body mass index (BMI), way of sitting or lying, treatment response, and underlying systemic diseases were recorded. About 137 (85%) patients could be defined as SGD. These patients, with a mean age of 79.4 ± 40.7 years and a mean BMI of 21.7 ± 10.8, presented with either partial (n = 43, 31%) or full-blown (n = 94, 69%) SGD lesions characterized by the sign of so-called "three corners of a triangle": brownish plaques on the gluteal cleft and each side of the buttocks. Male/female ratio was 130/7. Itching or pain of varying intensity was reported by 50 patients (36%) and 14 patients (10%), respectively. Eighty-six patients (53%) presented with horizontal hyperkeratotic ridges, a characteristic sign of SGD. Most patients spent most of the day sitting but reported no special way of sitting or lying. More than half of patients with SGD claimed no response to topical steroids and/or keratolytics. In comparison with patients with SGD, SGD-free patients were younger (61.3 ± 36 years, P = 0.0005) and heavier (BMI 26.2 ± 15.6, P dermatosis, mostly affecting the thinner elderly. Friction, pressures and long hours sitting seemed to be important factors to trigger this dermatosis. © 2013 The International Society of Dermatology.
Iodine-129 and Caesium-137 in Chernobyl contaminated soil and their chemical fractionation
DEFF Research Database (Denmark)
Hou, Xiaolin; Fogh, C.L.; Kucera, J.
2003-01-01
and (CS)-C-137 in the Chernobyl soil and Irish Sea sediment was investigated by a sequential extraction method. Similar speciation of I-129 in the Chernobyl soil and Irish Sea sediment was found. Approximately 70% of I-129 is bound to oxides and organic matter, and 10-20% is in the readily available phase......Soil samples from areas in Belarus, Russia and Sweden contaminated by the Chernobyl accident were analysed for I-129 by radiochemical neutron activation analysis, as well as for Cs-137 by gamma-spectrometry. The atomic ratio of I-129/(CS)-C-137 in the upper layer of the examined soil cores ranged...
42 CFR 137.16 - What if more than 50 Indian Tribes apply to participate in self-governance?
2010-10-01
... participate in self-governance? 137.16 Section 137.16 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF...-GOVERNANCE Selection of Indian Tribes for Participation in Self-Governance § 137.16 What if more than 50 Indian Tribes apply to participate in self-governance? The first Indian Tribes who apply and are...
42 CFR 137.336 - What is the difference between fixed-price and cost-reimbursement agreements?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What is the difference between fixed-price and cost-reimbursement agreements? 137.336 Section 137.336 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND... Construction Project Assumption Process § 137.336 What is the difference between fixed-price and cost...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false May a Self-Governance Tribe make agreements with... § 137.178? 137.179 Section 137.179 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE...
42 CFR 137.401 - What role does Tribal consultation play in the IHS annual budget request process?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What role does Tribal consultation play in the IHS annual budget request process? 137.401 Section 137.401 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF...-GOVERNANCE Secretarial Responsibilities Budget Request § 137.401 What role does Tribal consultation play in...
42 CFR 137.295 - May Self-Governance Tribes elect to develop their own environmental review process?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false May Self-Governance Tribes elect to develop their own environmental review process? 137.295 Section 137.295 Public Health PUBLIC HEALTH SERVICE... SELF-GOVERNANCE Construction Nepa Process § 137.295 May Self-Governance Tribes elect to develop their...
Energy Technology Data Exchange (ETDEWEB)
Tillander, M.; Jaakkola, T. [Helsingfors Univ., Kemiska Inst., Lab. foer radiokemi (Finland)
2002-04-01
The whole-body activity of a selected group of Finnish Lapps was measured in 1962 to 1977 and in 1986 to 1997 using mobile whole-body counters. For the most exposed group - the male reindeer breeders - the mean value of the body activity 137CS increased to 53 kBq/person for the year 1965 and 14 kBq/person for 1997. The effective half-time for {sup 137}Cs was 7 years in the seventies and 4,4 years in the nineties. In the summer of 2000 another measurement using bending geometry was carried out. The result corroborated the trend, which was observed earlier. (au)
Energy Technology Data Exchange (ETDEWEB)
Alvarado B, A.; Jimenez R, M.; Solache R, M. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)
1999-07-01
This work was made with the purpose to complete information about the hydrolysis constants of Europium (III) in high ion strength media. So it was determined at a ion forces media 4, 5 and 6 M of sodium perchlorate at 303 K. The method used was the potentiometric with the aid of the Super quad computer program. In high ion strength media, the measurements of p H do not correspond directly to negative logarithm of the concentration of hydrogen ions, by this it is necessary to calibrate the electrode in these conditions. The Europium was hydrolized at pC{sub H} values greater 6 in all cases. The potentiometric method used under the described experimental conditions is adequate to determine the hydrolysis constants of Europium (III). According to the results and diagrams of chemical species of Europium obtained we can conclude that the hydrolysis constants, differ by its distribution but not in its identity. (Author)
Directory of Open Access Journals (Sweden)
Mohammed Najeeb Al Hallak
2009-08-01
Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center
Dantas de Araujo, Aline; Wu, Chongyang; Wu, Kai-Chen; Reid, Robert C; Durek, Thomas; Lim, Junxian; Fairlie, David P
2017-06-21
Measuring ligand affinity for a G protein-coupled receptor is often a crucial step in drug discovery. It has been traditionally determined by binding putative new ligands in competition with native ligand labeled with a radioisotope of finite lifetime. Competing instead with a lanthanide-based fluorescent ligand is more attractive due to greater longevity, stability, and safety. Here, we have chemically synthesized the 77 residue human C3a protein and conjugated its N-terminus to europium diethylenetriaminepentaacetate to produce a novel fluorescent protein (Eu-DTPA-hC3a). Time-resolved fluorescence analysis has demonstrated that Eu-DTPA-hC3a binds selectively to its cognate G protein-coupled receptor C3aR with full agonist activity and similar potency and selectivity as native C3a in inducing calcium mobilization and phosphorylation of extracellular signal-regulated kinases in HEK293 cells that stably expressed C3aR. Time-resolved fluorescence analysis for saturation and competitive binding gave a dissociation constant (Kd) of 8.7 ± 1.4 nM for Eu-DTPA-hC3a and binding affinities for hC3a (pKi of 8.6 ± 0.2 and Ki of 2.5 nM) and C3aR ligands TR16 (pKi of 6.8 ± 0.1 and Ki of 138 nM), BR103 (pKi of 6.7 ± 0.1 and Ki of 185 nM), BR111 (pKi of 6.3 ± 0.2 and Ki of 544 nM) and SB290157 (pKi of 6.3 ± 0.1 and Ki of 517 nM) via displacement of Eu-DTPA-hC3a from hC3aR. The macromolecular conjugate Eu-DTPA-hC3a is a novel nonradioactive probe suitable for studying ligand-C3aR interactions with potential value in accelerating drug development for human C3aR in physiology and disease.
Najeeb Al Hallak, Mohammed; McCurdy, Matt; Zouain, Nicolas; Hayes, Justin
2009-08-28
(153)Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate) and Samarium-153 [1]. (153)Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of (153)Sm-EDTMP leads to contamination with (154)Eu (Europium-154) [2]. A previous study only alluded to the retention of (154)Eu in the bones after receiving treatment with (153)Sm-EDTMP [2]. Activation of the alarm at security checkpoints after (153)Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received (153)Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA) activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing the American-Canadian border. We assume that the (154)Eu which remained in the patients' bones activated the sensors. METHODS: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received (153)Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. RESULTS: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of (154)Eu emissions. CONCLUSION: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of (154)Eu retained in patients who received (153)Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of (153)Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with (153)Sm-EDTMP at Roger Maris Cancer
[Color distribution of the anterior teeth in 137 elder people].
Yang, Dan-Ling; Qian, Hai-Xin; Gan, Hong; Qian, Cheng-Hui; Zhang, Xiu-Yin
2008-06-01
To study the color distribution of the anterior teeth in elder people. 612 anterior teeth from 137 people aging from 60 to 81 years and 200 anterior teeth from 100 young people aging from 20 to 40 years were collected. A digital colorimeter was used to measure the value of L*,a*,b* of the teeth, and the chromatism (deltaE) was calculated according to the formula deltaE=(deltaL*(2)+deltaa*(2)+deltab*(2))1/2. All data were analyzed with SAS 6.12 software package for Student's t test. Totally, there were 612 vital anterior teeth from elder people, including 201 central incisors,199 lateral incisors and 212 canines, were collected. No difference was found between the teeth on the right side and the left side in terms of L*,a*,b*value(P>0.05). The mean value of L*,a*,b* of the central incisors was 71.2+/-6.22,0.97+/-1.12,15.9+/-5.04, respectively and that of the lateral incisors and the canines were 69.6+/-5.52,0.6+/-1.18,13.9+/-4.15 and 68.4+/-5.99,0.15+/-1.02,19.6+/-4.87, respectively.The mean value of L*,a*,b* of the central incisors and the canines from the youngster was 75.82,-0.11,12.68 and 72.07,1.22,17.92, respectively.There were significant differences between the central incisors and the lateral incisors as well as the canines (Pelder people demonstrated a lower L* and a* value, but a higher b* value (Pelder people, the central incisors look much brighter than the lateral incisors and canines, while the canines have more redness and yellowness than the incisors, and the color of the lateral incisors exhibits lighter than the central incisors and the canines. Compared to the teeth from younger people, the teeth from elder people look much darker and yellower but less red. Supported by Shanghai Leading Academic Discipline Project (Grant No.T0202).
Floodplain data: ecosystem characteristics and /sup 137/Cs concentrations in biota and soil. [ORNL
Energy Technology Data Exchange (ETDEWEB)
Van Voris, P.; Dahlman, R.C.
1976-11-01
Radiocesium (/sup 137/Cs) distribution was determined in soil, roots, ground vegetation, overstory, litter, mammals, feces, and insects for a floodplain ecosystem contaminated by radioactive wastes from Manhattan Project operations in 1944. The 2-ha research site was located on the ERDA reservation, Oak Ridge, Tennessee, in a drained holding pond between Oak Ridge National Laboratory and White Oak Lake. Maximum /sup 137/Cs concentrations in soil occurred near the old retention pond dam (84,400 pCi/g) and at the upper portion of the floodplain boundary (70,500 pCi/g). This bimodal distribution pattern of /sup 137/Cs was evident for all samples collected. Large amounts of data have been collected since the summer of 1974. This report documents the data on ecosystem characteristics and /sup 137/Cs concentrations in biota and soil.
HH137 and 138: Discovering New Knots and a Molecular Outflow with Gemini and APEX
Ferrero, L. V.; Cappa, C. E.; Gomez, M.
2017-07-01
We present a multi-frequency study of HH 137 and HH 138 using Gemini images and APEX molecular line data, as well as Spitzer images. Several 2.12 micron knots linked to HH137 are identified in the Gemini image. 12^CO(3-2), 13^CO(3-2), and C18^O(3-2) line data reveal the molecular counterpart of HH 137. Spitzer combined images suggest the location of the exciting source of HH 137, almost coincident with a high-density molecular clump detected in C18^O. We derive the main physical parameters of the molecular clump and the molecular outflow, and propose a simple scenario for the whole complex.
A comparison of {sup 137}Cs radioactivity in localized evergreen and deciduous plant species
Energy Technology Data Exchange (ETDEWEB)
Rangel, R.C.
1996-05-01
A vegetation study at the Comanche Peak Steam Electric Station (CPSES) near Glen Rose, Texas was conducted in 1991 and 1992. The CPSES is a commercial nuclear power plant owned and operated by Texas Utilities Electric of Dallas, Texas. The US Nuclear Regulatory Commission (USNRC) requires the CPSES to routinely sample broadleaf vegetation in place of milk samples. Few commercial dairies exist in the vicinity. Broadleaf tree species are scarce because the climate and local limestone geology have produced a dry rolling hill topography. An evergreen juniper is the dominant tree species. Few broadleaves during the winter season have hindered year-round sampling. This study compares the environmental {sup 137}Cs concentrations between broadleaf and evergreen foliage at CPSES. Soil {sup 137}Cs concentrations from each vegetation location were also compared to the foliage {sup 137}Cs concentrations. The study`s objective was to determine if the deciduous and evergreen vegetation {sup 137}Cs concentrations are statistically the same.
Chitosan-ferrocyanide sorbent for Cs-137 removal from mineralized alkaline media
Energy Technology Data Exchange (ETDEWEB)
Egorin, Andrei [Far Eastern Federal Univ., Vladivostok (Russian Federation); Institute of Chemistry FEBRAS, Vladivostok (Russian Federation); Ozyorsk Technical Institute MEPHI, Ozersk (Russian Federation); Tokar, Eduard [Far Eastern Federal Univ., Vladivostok (Russian Federation); Zemskova, Larisa [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation)
2016-11-01
An organomineral sorbent based on mixed nickel-potassium ferrocyanide and chitosan to be used in removal of Cs-137 radionuclide from highly mineralized media with high pH has been fabricated. The synthesized sorbent was applied to remove Cs-137 from model solutions under static and dynamic conditions. The effects of contact time, pH, and presence of sodium ions and complexing agents in the process of Cs-137 removal have been investigated. The sorbent is distinguished by increased stability to the impact of alkaline media containing complexing agents, whereas the sorbent capacity in solutions with pH 11 exceeds 1000 bed volumes with the Cs-137 removal efficiency higher than 95%.
Detritivores enhance the mobilization of {sup 137}Cs from leaf-litter
Energy Technology Data Exchange (ETDEWEB)
Murakami, Masashi; Suzuki, Takahiro [Community Ecology Lab., Biology Course, Faculty of Science, Chiba University, Chiba, 263-8522 (Japan); Ishii, Nobuyoshi [National Institute of Radiological Sciences, Chiba, 263-8555 (Japan); Ohte, Nobuhito [Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo, 113-8657 (Japan)
2014-07-01
A large amount of radioactive material was released from the Fukushima Daiichi Nuclear Power Plant (FDNPP) accident after the disastrous earthquake and subsequent tsunami of March 2011. Since most of the Japanese land area is covered by forest ecosystems, {sup 137}Cs was mostly deposited and accumulated on the land surface of forest. The fate of radioactive materials accumulated on the leaf litters should be conscientiously monitored to understand the future distribution and the spread to the surrounding landscapes. Because the accident took place on 11 March 2011, just before the bud-break of deciduous trees, the {sup 137}Cs are highly accumulated on the surface of leaf litter on the forest floor. This accumulated {sup 137}Cs had transferred to higher trophic organisms mainly through the detritus food chain. However, on the litter surface, {sup 137}Cs considered to be strongly and immediately fixed and highly immobilized. Decomposition processes in the forest floor can re-mobilise the nutritional elements which are contained within detritus and make them available for the organisms. In the present study, the feeding effect of detritivore soil arthropods on the mobilization of {sup 137}Cs from leaf litter was experimentally examined. Furthermore, the effect of detritivores on the plant uptake of {sup 137}Cs was examined by small-scale nursery experiment. Decomposition experiment in the small microcosms was performed using a larvae of Trypoxylus dichotomus, whichis a detritivores feeding on dead plant materials such as wood debris and leaf litters. Contaminated leaf litters were collected in a forest of the Kami-Oguni River catchment in the northern part of Fukushima Prefecture. The leaf litters at A0 layers which are highly contaminated by {sup 137}Cs were utilized for the experiment. The contaminated leaf litter was fed to the larvae for ten days. The litter with larvae excreta was washed by 2 M KCl and deionized water. The {sup 137}Cs concentration was measured
Directory of Open Access Journals (Sweden)
Jinchuan Yan
2013-01-01
Full Text Available OBJECTIVES: Atherosclerosis is a chronic inflammatory disease. Research has focused on identifying specific serum biomarkers to detect vulnerable plaques. These markers serve as diagnostic tools for acute coronary syndrome and assist in identifying high-risk patients. However, the existing data are limited and conflicting. This study tested the hypothesis that CD137 levels identify patients with acute coronary syndrome who are at a heightened risk for recurrent cardiac events. METHODS: The levels of soluble CD137 (sCD137 were measured using ELISA in 180 patients with acute coronary syndrome and 120 patients with acute chest pain. Platelet activation was assessed by flow cytometry. Receiver operating characteristic curve analysis was performed to evaluate the prognostic characteristics of sCD137. RESULTS: The levels of sCD137 were elevated in 75 patients with acute coronary syndromes and 20 patients with acute chest pain (>35.0 ng/ml. In patients with acute coronary syndrome, elevated sCD137 levels (>35.0 ng/ml indicated an increased risk for major adverse cardiovascular events (OR =1.93, 95% CI: 1.39-2.54. Elevated serum levels of sCD137 and cTnT were correlated with a significantly increased risk of major adverse cardiovascular events in both groups after 30 days, six months and nine months of follow-up. The increased sCD137 levels were significantly correlated with the levels of troponin I (r = 0.4799, p<0.001. Importantly, 26 patients with normal cTnI levels had acute coronary syndrome. However, elevated sCD137 levels identified these patients as a being high-risk subgroup (OR = 2.14, 95% CI: 1.25-4.13. CONCLUSIONS: Elevated sCD137 levels indicate an increased risk of cardiovascular events in patients with acute coronary syndrome. Soluble CD137 may be a useful prognostic marker or indicator for adverse events in patients with acute coronary syndrome.
Energy Technology Data Exchange (ETDEWEB)
Dossantos-Uzarralde, P.; Le Luel, C.; Bauge, E. [CEA Bruyeres le Chatel, 91 (France). Dept. de Physique Theorique et Appliquee
2004-07-01
This paper presents neutron cross section evaluations of Europium isotopes. The cross sections are evaluated in 1 keV - 30 MeV energy range for the isotopes {sup 146}Eu, {sup 147}Eu, {sup 148}Eu, {sup 149}Eu, {sup 150}Eu, {sup 151}Eu, {sup 152}Eu, {sup 153}Eu, {sup 154}Eu in their ground state. This evaluation includes cross section productions of the long life isomeric states. Special attention is put on the options used for the description of the files written in ENDF-6 format. The final issue is a proposal of a new breed of ENDF-6 formatted neutron activation file. (authors)
Directory of Open Access Journals (Sweden)
JONG KUK LEE
2014-08-01
Six variations of cesium-137 (137Cs dispersion test were simulated under severe accident condition. The 137Cs dispersion was strongly influenced by the direction and speed of the main wind. A virtual receptor was set and calculated for observation of the 137Cs movement and accumulation. The results of the surface roughness effect demonstrated that the deposition of 137Cs was affected by surface condition. The results of these studies offer useful information for developing environmental radiation monitoring systems (ERMSs for the BNPP and can be used to assess the environmental effects of new nuclear power plant.
Reconstruction of Long-Lived Radionuclide Intakes for Techa Riverside Residents: Cesium-137
Energy Technology Data Exchange (ETDEWEB)
Tolstykh, E. I.; Degteva, M. O.; Peremyslova, L. M.; Shagina, N. B.; Vorobiova, M. I.; Anspaugh, L. R.; Napier, Bruce A.
2013-05-01
Radioactive contamination of the Techa River (Southern Urals, Russia) occurred from 1949–1956 due to routine and accidental releases of liquid radioactive wastes from the Mayak Production Association. The long-lived radionuclides in the releases were 90Sr and 137Cs. Contamination of the components of the Techa River system resulted in chronic external and internal exposure of about 30,000 residents of riverside villages. Data on radionuclide intake with diet are used to estimate internal dose in the Techa River Dosimetry System (TRDS), which was elaborated for the assessment of radiogenic risk for Techa Riverside residents. The 90Sri ntake function was recently improved taking into account the recently available archival data on radionuclide releases and in-depth analysis of the extensive data on 90Sr measurements in Techa Riverside residents. The main purpose of this paper is to evaluate the dietary intake of 137Cs by Techa Riverside residents. The 137Cs intake with river water used for drinking was reconstructed on the basis of the 90Sr intake-function and the concentration ratio 137Cs/90Sr in river water. Intake via 137Cs transfer from floodplain soil to grass and cows’ milk was evaluated for the first time. As a result, the maximal 137Cs intake level was indicated near the site of releases in upper-Techa River settlements (8,000–9,000 kBq). For villages located on the lower Techa River the 137Cs intake was significantly less (down to 300 kBq). Cows’ milk was the main source of 137Cs in diet in the upper-Techa.
Immunotherapy of melanoma with the immune costimulatory monoclonal antibodies targeting CD137
Directory of Open Access Journals (Sweden)
Li SY
2013-09-01
Full Text Available Shi-Yan Li, Yizhen Liu Cancer Research Institute, Scott and White Healthcare, Temple, TX, USA Abstract: Knowledge of how the immune system recognizes and attempts to control cancer growth and development has improved dramatically. The advent of immunotherapies for cancer has resulted in robust clinical responses and confirmed that the immune system can significantly inhibit tumor progression. Until recently, metastatic melanoma was a disease with limited treatment options and a poor prognosis. CD137 (also known as 4-1BB a member of the tumor necrosis factor (TNF receptor superfamily, is an activation-induced T cell costimulator molecule. Growing evidence indicates that anti-CD137 monoclonal antibodies possess strong antitumor properties, the result of their powerful capability to activate CD8+ T cells, to produce interferon (IFN-γ, and to induce cytolytic markers. Combination therapy of anti-CD137 with other anticancer agents, such as radiation, has robust tumor-regressing abilities against nonimmunogenic or poorly immunogenic tumors. Of importance, targeting CD137 eliminates established tumors, and the fact that anti-CD137 therapy acts in concert with other anticancer agents and/or radiation therapy to eradicate nonimmunogenic and weakly immunogenic tumors is an additional benefit. Currently, BMS-663513, a humanized anti-CD137 antibody, is in clinical trials in patients with solid tumors, including melanoma, renal carcinoma, ovarian cancer, and B-cell malignancies. In this review, we discuss the basis of the therapeutic potential of targeting CD137 in cancer treatment, focusing in particular, on BMS-663513 as an immune costimulatory monoclonal antibody for melanoma immunotherapy. Keywords: anti-CD137 monoclonal antibodies, immune costimulator molecule, BMS-663513
Introduce lichen Lepraria incana as biomonitor of Cesium-137 from Ramsar, northern Iran.
Dalvand, Amin; Jahangiri, Ahmad; Iranmanesh, Jalil
2016-08-01
Lichens have been used as biomonitors of airborne radionuclides released in conjunction with nuclear bomb testing as well as nuclear power plant accidents. The potential of lichens for monitoringof radionuclides has been well documented. However, there are no studies that determine natural and artificial radionuclide monitoring by lichens, in Iran. Thus, as a first step, we have conducted a comparison of (137)Csactivity concentration capacity of three epiphytic lichen species including Lepraria incana, Xanthoria parietina and Ramalina farinacea from Ramsar Northern Iran. In this work, accumulation capacity of (137)Cs was determined in 36 lichen samples using a gamma spectrometer equipped with a high purity germanium (HPGe) detector. The results showed that highest accumulation capacity of (137)Cs in the lichen species was found in Lepraria incana and Xanthoria parietina, 30.2, 9.8 Bq/kg respectively, and lowest average accumulation capacity were found in Ramalina farinacea 2.7 Bq/kg (dry weight). This study showed that activity concentration (137)Cs is in crustose > foliose > fruticose lichens in the same biotope. Thus, crustose lichens are capable to accumulate higher (137)Cs than foliose and fruticose species because of different factors such as special morphological characteristics in these species and large surface/volume ratio or longer biological half-life of (137)Cs in lichen Lepraria incana. Therefore, Lepraria incana due to high concentration capability of (137)Cs (approximately 3 and 11 time higher than Xanthoria parietina and Ramalina farinacea, respectively), is introduced as biomonitor of Cesium-137 from Ramsar, North of Iran. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Soukhova, N.V.; Fesenko, S.V.; Klein, D.; Spiridonov, S.I.; Sanzharova, N.I.; Badot, P.M. E-mail: pierre-marie.badot@univ-fcomte.fr
2003-07-01
The distributions of {sup 137}Cs among annual rings of Pinus sylvestris and Betula pendula at four experimental sites located in the most contaminated areas in the Russian territory after the Chernobyl accident in 1986 were studied. Trees of different ages were sampled from four forest sites with different tree compositions and soil properties. The data analysis shows that {sup 137}Cs is very mobile in wood and the 1986 rings do not show the highest contamination. The difference between pine and birch in the pattern of radial {sup 137}Cs distribution can be satisfactorily explained by the difference in radial ray composition. {sup 137}Cs radial distribution in the wood can be described as the sum of two exponential functions for both species. The function parameters are height, age and species dependent. The distribution of {sup 137}Cs in birch wood reveals much more pronounced dependence on site characteristics and/or the age of trees than pines. The data obtained can be used to assess {sup 137}Cs content in wood.
Influence on the mouse immune system of chronic ingestion of {sup 137}Cs
Energy Technology Data Exchange (ETDEWEB)
Bertho, Jean-Marc; Faure, Marie-Cecile; Louiba, Sonia; Tourlonias, Elie; Stefani, Johanna; Siffert, Baptiste; Paquet, Francois; Dublineau, Isabelle, E-mail: Jean-marc.bertho@irsn.fr [IRSN, Laboratoire de Radiotoxicologie Experimentale, Fontenay aux Roses (France)
2011-03-01
The aim of this work was to determine the possible occurrence of damage to the immune system during the course of chronic ingestion of {sup 137}Cs. BALB/C mice were used, with {sup 137}Cs intake via drinking water at a concentration of 20 kBq l{sup -1}. Adults received {sup 137}Cs before mating and offspring were sacrificed at various ages between birth and 20 weeks. Phenotypic analysis of circulating blood cells and thymocytes did not show any significant modification of immune cell populations in animals ingesting {sup 137}Cs as compared with control animals, with the exception of a slight increase in Treg percentage at the age of 12 weeks. Functional tests, including proliferative response to mitogens such as phytohaemagglutinin, response to alloantigens in mixed lymphocyte reaction and immunoglobulin response to vaccine antigens such as tetanus toxin and keyhole limpet haemocyanin did not show any significant functional modification of the immune system in {sup 137}Cs-ingesting animals as compared with control animals. Overall, our results suggest that chronic ingestion of a low concentration of {sup 137}Cs in drinking water in the long term does not have any biologically relevant effect on the immune system.
Distribution of 137Cs In the Surface Soil of Serpong Nuclear Site
Directory of Open Access Journals (Sweden)
E. Lubis
2011-08-01
Full Text Available The distribution of 137Cs in the surface soil layer of Serpong Nuclear Site (SNS was investigated by field sampling. The Objectives of the investigation is finding the profile of 137Cs distribution in the surface soil and the Tf value that can be used for estimation of radiation dose from livestock product-man pathways. The results indicates that the 137Cs activity in surface soil of SNS is 0.80 ± 0,29 Bq/kg, much lower than in the Antarctic. The contribution value of 137Cs from the operation of G.A.Siwabessy Reactor until now is undetectable. The Tf of 137Cs from surface soil to Panisetum Purpureum, Setaria Spha Celata and Imperata Cylindrica grasses were 0.71 ± 0.14, 0.84 ± 0.27 and 0.81 ± 0.11 respectively. The results show that value of the transfer factor of 137Cs varies between cultivated and uncultivated soil and also with the soils with thick humus
Dermatophytoses in children: study of 137 cases Dermatofitoses na criança: estudo de 137 casos
Directory of Open Access Journals (Sweden)
Nurimar C. FERNANDES
2001-04-01
Full Text Available Dermatophytoses are common fungal infections caused by dermatophytes but there are few data about this condition in the childhood. 137 children below the age of 12 and clinically diagnosed as tineas were investigated prospectively at Instituto de Puericultura e Pediatria, Rio de Janeiro, from 1994 to 1999. Hair, skin/nails scraping and pus swabs were collected from lesions and processed for fungus. Male children from 2 to 12 years were mostly affected; tinea capitis (78 cases mainly caused by Microsporum canis (46 cases was the most common clinical form. Tinea corporis (43 cases mainly caused by Trichophyton rubrum (17 cases accounted for the second most frequent clinical form. Tinea cruris (10 cases with Trichophyton rubrum (5 cases as the most common etiologic agent accounted for the third most frequent clinical form. Tinea pedis and tinea unguium were much less frequent (3 cases each. Trichophyton rubrum was the most common etiologic agent isolated in these cases (3 cases.As dermatofitoses são infecções fúngicas freqüentes causadas por dermatófitos mas há poucos relatos sobre esta condição na infância. Cento e trinta e sete crianças abaixo de 12 anos e clinicamente diagnosticadas como tinhas, foram investigadas prospectivamente no Instituto de Puericultura e Pediatria, Rio de Janeiro, no período de 1994 a 1999. Foram submetidas ao exame micológico de raspado de pele e unhas, pelos e pus das lesões. Meninos na faixa etária de 2 a 12 anos foram mais afetados; tinea capitis (78 casos por Microsporum canis (46 casos foi a forma clínica mais freqüente. Tinea corporis (43 casos por Trichophyton rubrum (17 casos foi a segunda forma clínica mais freqüente. Tinea cruris (10 casos por Trichophyton rubrum (5 casos como o agente mais comum foi a terceira forma clínica mais freqüente. Nas Tinea pedis e tinea unguium (3 casos cada, o Trichophyton rubrum foi o agente mais isolado (3 casos.
Energy Technology Data Exchange (ETDEWEB)
Antunes, Patrik Diogo, E-mail: pdantunes@yahoo.com.b [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Ciencias do Solo; Sampaio, Everardo Valadares de Sa Barretto; Ferreira Junior, Antonio Luiz Goncalves; Salcedo, Ignacio Hernan, E-mail: esampaio@ufpe.b, E-mail: antonio.ferreira@ariano.nlink.com.b, E-mail: salcedo@ufpe.b [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Energia Nuclear; Galindo, Izabel Cristina Luna, E-mail: iclgalindo@uol.com.b [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Agronomia
2010-05-15
Contents of {sup 137}Cs have been used to quantify soil loss or accumulations, based on values of reference sites with little soil disturbance in the last decades. In Northeastern Brazil no such sites have been evaluated yet. Three areas with flat topography, native vegetation and undisturbed soil were selected in of Goiania, Araripina and Sertania counties, state of Pernambuco. Four points in each area were marked at a distance of 20 to 50 m away from each other and soil samples were collected in 3 cm depth intervals, down to 30 cm. The {sup 137}Cs activities were determined using gamma spectrometry with a hyper pure germanium detector. Average contents of {sup 137}Cs (Bq m{sup -2}) were 71.6 +- 6.3 in Goiania, 64.0 +- 13.8 in Araripina and 95.5 +- 9.8 in Sertania. Values in this range have been reported in Paraiba and Bahia, and higher ones in the Southeastern region, confirming the reduction of stocks in areas closer to the equator. The highest activities occurred in the surface layers, ranging from 0.5 to 1.6 Bq kg{sup -1}, and decreased linearly with depth until the detection limits: 18 cm in Araripina, 15 cm in Goiania, and 9 cm in Sertania. In Goiania, the activity was highest (2.06 +- 1.0 Bq kg{sup -1}) in an organic horizon above a inorganic horizon. The high activities and stock and lower depth in Sertania could be explained by the predominance of 2:1 clay minerals versus 1:1 clay minerals in the other areas. {sup 137}Cs activities were positively correlated with water and KCl pH values and negatively correlated with Al concentrations. The results confirm that, in the reference areas, {sup 137}Cs activities are highest in the surface layers, decreasing regularly down the soil profile. (author)
Tian, Guoxin; Martin, Leigh R; Rao, Linfeng
2010-11-15
The complexation of neodymium(III) and europium(III) with lactate was studied at variable temperatures by potentiometry, absorption spectrophotometry, luminescence spectroscopy, and microcalorimetry. The stability constants of three successive lactate complexes (ML(2+), ML(2)(+), and ML(3)(aq), where M stands for Nd and Eu and L stands for lactate) at 10, 25, 40, 55, and 70 °C were determined. The enthalpies of complexation at 25 °C were determined by microcalorimetry. Thermodynamic data show that the complexation of trivalent lanthanides (Nd(3+) and Eu(3+)) with lactate is exothermic and the complexation becomes weaker at higher temperatures. Results from optical absorption and luminescence spectroscopy suggest that the complexes are inner-sphere chelate complexes in which the protonated α-hydroxyl group of lactate participates in the complexation.
Williams, Neil J; Dehaudt, Jérémy; Bryantsev, Vyacheslav S; Luo, Huimin; Abney, Carter W; Dai, Sheng
2017-02-28
Bis-triazine phenanthrolines have shown great promise for f-block metal separations, attributable to their highly preorganized structure, nitrogen donors, and more enhanced covalent bonding with actinides over lanthanides. However, their limited solubility in traditional solvents remains a technological bottleneck. Herein we report our recent work using a simple 2,9-bis(triazine)-1,10-phenanthroline (Me-BTPhen) dissolved in an ionic liquid (IL), demonstrating the efficacy of IL extraction systems for the selective separation of americium from europium, achieving separation factors in excess of 7500 and selectively removing up to 99% of the americium. Characterization of the coordination environment was performed using a combination of X-ray absorption fine structure spectroscopy (XAFS) and density functional theory (DFT) calculations.
Directory of Open Access Journals (Sweden)
João P. Martins
2015-01-01
Full Text Available Two novel europium(III complexes, a monomer and a homodimer, with 1-(4-chlorophenyl-4,4,4-trifluoro-1,3-butanedione (Hcbtfa and 5-chloro-1,10-phenanthroline (cphen ligands, formulated as [Eu(cbtfa3(cphen] and [Eu2(cbtfa4(cphen2(CH3O2], have been synthesized. Their structures have been elucidated by X-ray diffraction and their absorption and emission properties have been studied in the solid state. The experimental data has then been used to test the recently released LUMPAC software, a promising tool which can facilitate the design of more efficient lanthanide light-conversion molecular devices by combining ground state geometry, excited state energy, and luminescent properties calculations.
Directory of Open Access Journals (Sweden)
Hung T. LAM
2010-08-01
Full Text Available The measurement of temperature is essential in defining the physical and chemical properties of any system. This is particularly true in dynamic systems where the temperature may fluctuate during the process. In this paper we investigated the potential of tris-(dibenzoylmethane mono (5-amino-1, 10-phenanthroline-europium(III ( Eu[tdap] as an optical temperature probe. The principle of the measurement is based on the temperature dependence of the fluorescence decay time of Eu(tdap embedded in polystyrene. Within the investigated temperature range between 3 and 70°C a linear correlation between temperature and decay time was found. The probe is accurate and repeatable and there is no cross-sensitivity to pH changes. Continuous measurement for more than 2.5 hours at which the temperature is switched between two different temperatures shows no signal drift. The relative standard deviation is less than 0.65 percent.
Li, X.; Zheng, X.; Jin, L.; Lu, S.; Qin, W.
2000-02-01
The structure of the complex [Eu( m-MOBA) 3·2H 2O]1/2(4,4'-bpy) ( m-MOBA: m-methoxybenzoate, 4,4'-bpy: 4,4'-bipyridine) was determined by single crystal X-ray diffraction. The bonding around each europium consists of two oxygen atoms of the chelated carboxyl group, two oxygen atoms of two water molecules and four oxygen atoms of the bidentate bridging carboxylate groups, forming an infinite polymeric chain structure. The luminescence behaviour of Eu 3+ in {[Eu( m-MOBA) 3·2H 2O]1/2(4,4'-bpy)} ∞ was observed at 77 K. The emission spectra of 5D 1→ 7F J ( J=1-3) and 5D 0→ 7F J ( J=0-4) transitions were recorded. The complex displays intense luminescence which may be related to the m-MOBA ligand and the polymeric coordination.
Energy Technology Data Exchange (ETDEWEB)
Li, Wen-Xian, E-mail: nmglwx@163.com [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China); Guo, Feng [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China); Zheng, Yu-Shan [Inner Mongolia Autonomous Region Product Quality Inspection Institute, Hohhot 010010 (China); Cao, Xiao-Fang; Feng, Shu-Yan; Bai, Juan; Xin, Xiao-Dong [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China)
2014-09-15
Two novel binary and ternary Europium (III) perchlorate complexes were synthesized. The binary complex was prepared with bis(benzylsulfinyl)methane as ligand, and the ternary complex was with bis(benzylsulfinyl)methane as first ligand and 1,10-Phenanthroline as second ligand. They were characterized by element analysis, molar conductivity, coordination titration analysis, IR, TG-DSC, {sup 1}HNMR and UV spectra. The results indicated that the composition of binary and ternary complexes was EuL{sub 2.5}·(ClO{sub 4}){sub 3}·3H{sub 2}O and Eu{sub 2}L{sub 4}·phen·(ClO{sub 4}){sub 6}·12H{sub 2}O (L=C{sub 6}H{sub 5}CH{sub 2}SOCH{sub 2}SOCH{sub 2}C{sub 6}H{sub 5}), respectively. The fluorescent spectra illustrated that the complexes displayed characteristic Europium (III) ion fluorescence in solid state, indicating the ligands favored energy transfer to the excitation state energy level of it. The strongest characteristic fluorescence emission intensity of the ternary system was 1.87 times as strong as that of the binary system. The fluorescent quantum yields of the Eu (III) ternary and binary complexes were also calculated. Additionally, the phosphorescence spectra and the luminescence mechanisms of the complexes were studied and explained. - Highlights: • Two rare earth complexes are new. And they are stabilized. • The intensities of the two rare earth complexes were all stronger and the lifetimes were longer. • The introduction of the second organic ligand1,10-Phenanthroline enhanced the fluorescence intensity. • The fluorescent quantum yields of two complexes being calculated are both very high.
Assessment of 137Cs and 90Sr Fluxes in the Barents Sea
Matishov, Gennady; Usiagina, Irina; Kasatkina, Nadezhda; Ilin, Gennadii
2014-05-01
On the basis of published and own data the annual balance of radionuclide income/outcome was assessed for 137Cs and 90Sr in the Barents Sea for the period from 1950s to the presnt. The scheme of the isotope balance calculation in the Barents Sea included the following processes:atmospheric fallout; river run-off; liquid radioactive wastes releases, income from the Norwegian and the White Seas; outflow to the adjacent areas through the Novaya Zemlya straits and the transects Svalbard-Franz Josef Land and Franz Josef Land-Novaya Zemlya; radioactive decay. According to the multiyear dynamics, the inflow of 137Cs and 90Sr to the Barents Sea was significantly preconditioned by currents from the Norwegian Sea. Three peaks of 137Cs and 90Sr isotope concentrations were registered for the surface waters on the western border of the Barents Sea. The first one was observed in the mid-1960s and was conditioned by testing of nuclear weapons. The increase of isotope concentrations in 1975 and 1980 was preconditioned by the discharge of atomic waste by the Sellafield nuclear reprocessing plant. Nowadays, after the sewage disposal plant was built, the annual discharge of nuclear waste from Sellafield plant is low. The Norwegian Sea was a major source of 137Cs and 90Sr isotope income into the Barents Sea for the period of 1960-2014. Currently, the transborder transfer of 90Sr and 137Cs from the Norwegian Sea into the Barents Sea constitutes about 99% of income for each element. Atmospheric precipitation had a major impact in the 1950-1960s after the testing of the nuclear weapons, and in 1986 after the accident at Chernobyl Nuclear Power Station. In 1963, the atmospheric precipitation of 137Cs reached 1050 TBq; and that of 90Sr, 630 TBq. In 1986, a significant amount of 137Cs inflow (up to 1010 TBq/year) was registered. The 137Cs isotope income exceeded the 90Sr income in the 1960s-1980s, and equal amounts penetrated into the Barents Sea from the Norwegian Sea in the 1990s. Before
{sup 137}Cs and {sup 9}Sr uptake by sunflower cultivated under hydroponic conditions
Energy Technology Data Exchange (ETDEWEB)
Soudek, Petr [Department of Plant Tissue Cultures, Institute of Organic Chemistry and Biochemistry, Academy of Sciences of the Czech Republic, Flemingovo nam. 2, CZ-166 10 Prague 6 (Czech Republic); Valenova, Sarka [Department of Plant Tissue Cultures, Institute of Organic Chemistry and Biochemistry, Academy of Sciences of the Czech Republic, Flemingovo nam. 2, CZ-166 10 Prague 6 (Czech Republic); Vavrikova, Zuzana [Department of Plant Tissue Cultures, Institute of Organic Chemistry and Biochemistry, Academy of Sciences of the Czech Republic, Flemingovo nam. 2, CZ-166 10 Prague 6 (Czech Republic); Vanek, Tomas [Department of Plant Tissue Cultures, Institute of Organic Chemistry and Biochemistry, Academy of Sciences of the Czech Republic, Flemingovo nam. 2, CZ-166 10 Prague 6 (Czech Republic)]. E-mail: vanek@uochb.cas.cz
2006-07-01
The {sup 9}Sr and {sup 137}Cs uptake by the plant Helianthus annuus L. was studied during cultivation in a hydroponic medium. The accumulation of radioactivity in plants was measured after 2, 4, 8, 16 and 32 days of cultivation. About 12% of {sup 137}Cs and 20% of {sup 9}Sr accumulated during the experiments. We did not find any differences between the uptake of radioactive and stable caesium and strontium isotopes. Radioactivity distribution within the plant was determined by autoradiography. {sup 137}Cs was present mainly in nodal segments, leaf veins and young leaves. High activity of {sup 9}Sr was localized in leaf veins, stem, central root and stomata. The influence of stable elements or analogues on the transfer behaviour was investigated. The percentage of non-active caesium and strontium concentration in plants decreased with the increasing initial concentration of Cs or Sr in the medium. The percentage of {sup 9}Sr activity in plants decreased with increasing initial activity of the nuclide in the medium, but the activity of {sup 137}Cs in plants increased. The influence of K{sup +} and NH{sub 4} {sup +} on the uptake of {sup 137}Cs and the influence of Ca{sup 2+} on the uptake of {sup 9}Sr was tested. The highest accumulation of {sup 137}Cs (24-27% of the initial activity of {sup 137}Cs) was found in the presence of 10 mM potassium and 12 mM ammonium ions. Accumulation of about 22% of initial activity of {sup 9}Sr was determined in plants grown on the medium with 8 mM calcium ions.
Iwasaki, T; Nabi, M; Shimizu, Y; Kimura, I
2015-01-01
A numerical model capable of simulating the transfer of (137)Cs in rivers associated with transport of fine sediment is presented. The accident at Fukushima Dai-ichi Nuclear Power Plant (FDNPP) released radionuclides into the atmosphere, and after fallout several radionuclides in them, such as radiocesium ((134)Cs, (137)Cs) and radioiodine ((131)I) were adsorbed on surface soil particles around FDNPP and transported by surface water. To understand the transport and deposition of the radioactive contaminant along with surface soil particles and its flux to the ocean, we modeled the transport of the (137)Cs contaminant by computing the water flow and the associated washload and suspended load transport. We have developed a two-dimensional model to simulate the plane flow structure, sediment transport and associated (137)Cs contaminant transport in rivers by combining a shallow water flow model and an advection-diffusion equation for the transport of sediment. The proposed model has been applied to the lower reach of Abukuma River, which is the main river in the highly contaminated area around FDNPP. The numerical results indicate that most (137)Cs supplied from the upstream river reach with washload would directly reach to Pacific Ocean. In contrast, washload-oriented (137)Cs supplied from the upstream river basin has a limited role in the radioactive contamination in the river. The results also suggest that the proposed framework of computational model can be a potential tool for understanding the sediment-oriented (137)Cs behavior in rivers. Copyright © 2014 Elsevier Ltd. All rights reserved.
Bayesian approach to model CD137 signaling in human M. tuberculosis in vitro responses.
Directory of Open Access Journals (Sweden)
Darío A Fernández Do Porto
Full Text Available Immune responses are qualitatively and quantitatively influenced by a complex network of receptor-ligand interactions. Among them, the CD137:CD137L pathway is known to modulate innate and adaptive human responses against Mycobacterium tuberculosis. However, the underlying mechanisms of this regulation remain unclear. In this work, we developed a Bayesian Computational Model (BCM of in vitro CD137 signaling, devised to fit previously gathered experimental data. The BCM is fed with the data and the prior distribution of the model parameters and it returns their posterior distribution and the model evidence, which allows comparing alternative signaling mechanisms. The BCM uses a coupled system of non-linear differential equations to describe the dynamics of Antigen Presenting Cells, Natural Killer and T Cells together with the interpheron (IFN-γ and tumor necrosis factor (TNF-α levels in the media culture. Fast and complete mixing of the media is assumed. The prior distribution of the parameters that describe the dynamics of the immunological response was obtained from the literature and theoretical considerations Our BCM applies successively the Levenberg-Marquardt algorithm to find the maximum a posteriori likelihood (MAP; the Metropolis Markov Chain Monte Carlo method to approximate the posterior distribution of the parameters and Thermodynamic Integration to calculate the evidence of alternative hypothesis. Bayes factors provided decisive evidence favoring direct CD137 signaling on T cells. Moreover, the posterior distribution of the parameters that describe the CD137 signaling showed that the regulation of IFN-γ levels is based more on T cells survival than on direct induction. Furthermore, the mechanisms that account for the effect of CD137 signaling on TNF-α production were based on a decrease of TNF-α production by APC and, perhaps, on the increase in APC apoptosis. BCM proved to be a useful tool to gain insight on the mechanisms of CD
Energy Technology Data Exchange (ETDEWEB)
Suzuki, Takahiro; Murakami, Masashi [Community Ecology Lab., Biology Course, Faculty of Science, Chiba University, Chiba, 263-8522 (Japan); Ishii, Nobuyoshi [National Institute of Radiological Sciences, Chiba, 263-8555 (Japan); Tanoi, Keitaro; Hirose, Atsushi; Ohte, Nobuhito [Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo, 113-8657 (Japan)
2014-07-01
A large amount of radionuclides was released from the Fukushima Daiichi Nuclear Power Plant (FDNPP) accident after the disastrous earthquake and subsequent tsunami of March 2011. Among the variety of radionuclides released from FDNPP, cesium 137 ({sup 137}Cs) is the most worrying radionuclide in the environment, with a half-life of 30 years. Since most of the Japanese land area is covered by forest, the distribution and transportation of radioactive materials within forest ecosystems should be conscientiously monitored. In Europe, many studies reported that the {sup 137}Cs deposition caused by the Chernobyl accident has still been distributed in the litter and soil layers and has become a source for the soil-to-plant transfer. Most of these studies emphasize the 'stability' of {sup 137}Cs within forest ecosystems, because {sup 137}Cs are considered to be strongly and immediately fixed in clay minerals. Even though there are many studies of the soil-to-plant transfer of {sup 137}Cs in forest after several years of Chernobyl accident, very initial distribution and transfer of {sup 137}Cs in food web within one to two years after the deposition in forest ecosystems have never been examined. The evaluation of the initial dynamics of {sup 137}Cs in forest ecosystems should be quite important because of the increasing stability of {sup 137}Cs after the deposition. The accumulation and transfer of {sup 137}Cs through food web within forest ecosystems were examined by collecting various organisms at forests in Fukushima. The {sup 137}Cs concentrations, natural Cs and K concentrations, and delta {sup 15}N of the specimens were measured to evaluate the occurrence of bioaccumulation or bio-diffusion of {sup 137}Cs through tropic interaction within forest ecosystem. {sup 137}Cs was highly concentrated on leaf litters which had been deposited in autumn 2010, before the accident. This accumulated {sup 137}Cs had transferred to higher trophic organisms mainly through
Energy Technology Data Exchange (ETDEWEB)
Hamilton, T; Kehl, S; Brown, T; Martinelli, R; Hickman, D; Jue, T; Tumey, S; Langston, R
2007-06-08
This report contains individual radiological protection surveillance data developed during 2006 for adult members of a select group of families living on Utrok Atoll. These Group I volunteers all underwent a whole-body count to determine levels of internally deposited cesium-137 ({sup 137}Cs) and supplied a bioassay sample for analysis of plutonium isotopes. Measurement data were obtained and the results compared with an equivalent set of measurement data for {sup 137}Cs and plutonium isotopes from a second group of adult volunteers (Group II) who were long-term residents of Utrok Atoll. For the purposes of this comparison, Group II volunteers were considered representative of the general population on Utrok Atoll. The general aim of the study was to determine residual systemic burdens of fallout radionuclides in each volunteer group, develop data in response to addressing some specific concerns about the preferential uptake and potential health consequences of residual fallout radionuclides in Group I volunteers, and generally provide some perspective on the significance of radiation doses delivered to volunteers (and the general Utrok Atoll resident population) in terms of radiological protection standards and health risks. Based on dose estimates from measurements of internally deposited {sup 137}Cs and plutonium isotopes, the data and information developed in this report clearly show that neither volunteer group has acquired levels of internally deposited fallout radionuclides specific to nuclear weapons testing in the Marshall Islands that are likely to have any consequence on human health. Moreover, the dose estimates are well below radiological protection standards as prescribed by U.S. regulators and international agencies, and are very small when compared to doses from natural sources of radiation in the Marshall Islands and the threshold where radiation health effects could be either medically diagnosed in an individual or epidemiologically discerned in a
Dasari, Srikanth; Patra, Ashis K
2015-12-14
The europium(III) and terbium(III) complexes, namely [Eu(dpq)(DMF)2(NO3)3] (1), [Eu(dppz)2(NO3)3] (2), [Tb(dpq)(DMF)2Cl3] (3), and [Tb(dppz)(DMF)2Cl3] (4), where dipyrido[3,2-d:2',3'-f]quinoxaline (dpq in 1 and 3), dipyrido[3,2-a:2',3'-c]phenazine (dppz in 2 and 4) and N,N'-dimethylformamide (DMF) have been isolated, characterized from their physicochemical data, luminescence studies and their interaction with DNA, serum albumin protein and photo-induced DNA cleavage activity are studied. The X-ray crystal structures of complexes 1-4 show discrete mononuclear Ln(3+)-based structures. The Eu(3+) in [Eu(dpq)(DMF)2(NO3)3] (1) and [Eu(dppz)2(NO3)3] (2) as [Eu(dppz)2(NO3)3]·dppz (2a) adopts a ten-coordinated bicapped dodecahedron structure with a bidentate N,N-donor dpq ligand, two DMF and three NO3(-) anions in 1 and two bidentate N,N-donor dppz ligands and three NO3(-) anions in 2. Complexes 3 and 4 show a seven-coordinated mono-capped octahedron structure where Tb(3+) contains bidentate dpq/dppz ligands, two DMF and three Cl(-) anions. The complexes are highly luminescent in nature indicating efficient photo-excited energy transfer from the dpq/dppz antenna to Ln(3+) to generate long-lived emissive excited states for characteristic f → f transitions. The time-resolved luminescence spectra of complexes 1-4 show typical narrow emission bands attributed to the (5)D0 → (7)F(J) and (5)D4 → (7)F(J) f-f transitions of Eu(3+) and Tb(3+) ions respectively. The number of inner-sphere water molecules (q) was determined from luminescence lifetime measurements in H2O and D2O confirming ligand-exchange reactions with water in solution. The complexes display significant binding propensity to the CT-DNA giving binding constant values in the range of 1.0 × 10(4)-6.1 × 10(4) M(-1) in the order 2, 4 (dppz) > 1, 3 (dpq). DNA binding data suggest DNA groove binding with the partial intercalation nature of the complexes. All the complexes also show binding propensity (K(BSA)
Energy Technology Data Exchange (ETDEWEB)
Moutiers, G.; Mekki, S. [CEA Saclay, Dept. de Physico-Chimie, Service de Chimie Physique, 91 - Gif sur Yvette (France); Billard, I. [IN2P3/CNRS, 69 - Villeurbanne (France)
2007-07-01
One of the solutions proposed for the optimization of the long term storage and conditioning of spent nuclear fuel is to separate actinide and lanthanide both from each other and from other less radioactive metallic species. The industrial proposed processes, based on liquid liquid extraction steps, involve solvents with non negligible vapour pressure and may generate contaminated liquid wastes that will have to be reprocessed. During the last decade, some room-temperature ionic liquids have been studied and integrated into industrial processes. The interest on this class of solvent came out from their 'green' properties (non volatile, non flammable, recyclable, etc...), but also from the variability of their physico-chemical properties (stability, hydrophobicity, viscosity) as a function of the RTIL chemical composition. Indeed, it has been shown that classical chemical industrial processes could be transferred into those media, even more improved, while a certain number of difficulties arising from using traditional solvent can be avoided. In this respect, it could be promising to investigate the ability to use room temperature ionic liquid into the spent nuclear fuel reprocessing field. The aim of this this study is to test the ability of the specific ionic liquid bumimTf{sub 2}N to allow trivalent europium extraction. The choice of this metal is based on the chemical analogy with trivalent minor actinides Curium and Americium which are contributing the greatest part of the long-lived high level radioactive wastes. Handling these elements needs to be very cautious for the safety and radioprotection aspect. Moreover, europium is a very sensitive luminescent probe to its environment even at the microscopic scale. The report is structured with four parts. In a first chapter, we present the main physico-chemical properties of an imidazolium-based ionic liquid family, and then we choose the ionic liquid bumimTf{sub 2}N for the whole thesis and start with
PEMISAHAN DAN ANALISIS 137Cs DARI LARUTAN PELAT ELEMEN BAKAR U-7%Mo/Al
Directory of Open Access Journals (Sweden)
Dian Anggraini
2017-01-01
Full Text Available ABSTRAK PEMISAHAN DAN ANALISIS 137Cs DARI LARUTAN PELAT ELEMEN BAKAR U-7%Mo/Al. Pemisahan cesium dari larutan pelat elemen bakar (PEB U-7Mo/Al telah dilakukan dengan menggunakan metode pengendapan dan penukar kation. Tujuan penelitian adalah mendapatkan metode yang valid untuk pemisahan cesium dari larutan PEB U-7Mo/Al melalui penentuan parameter unjuk kerja metode yaitu akurasi, presisi dan rekoveri. Metode pengendapan dan metode penukar kation yang digunakan mengacu kepada metode ASTM 690-000 dan kepada hasil penelitian U3Si2/Al. Penentuan parameter unjuk kerja metode pengendapan dilakukan dengan menggunakan larutan sampel PEB U-7%Mo/Al sebanyak 150 μL, larutan standar 137Cs sebanyak 50 μL dalam 2 mL HCl 0,1N. Larutan dikenakan proses pengendapan dengan menggunakan pereaksi HClO4 pekat dan penambahan senyawa carrier CsNO3 seberat 225 mg pada temperatur 0oC selama 1 jam, sedangkan proses penukar kation dilakukan dengan menggunakan resin zeolit Lampung sebanyak 400 mg. Proses penukar kation dilakukan secara batch dengan pengocokan selama 1 jam. Hasil proses pengendapan diperoleh endapan CsClO4 dan penukar kation diperoleh berupa padatan cesium - zeolit serta supernatan. Pengukuran dan analisis radionuklida137Cs dalam endapan CsClO4 dan padatan 137Cs-zeolit dilakukan dengan spektrometer gamma. Hasil pengukuran diperoleh nilai cacahan radionuklida 137Cs per detik (cps. Perhitungan rekoveri metode dilakukan dengan perbandingan nilai cacahan radionuklida 137Cs sebelum dan sesudah proses pemisahan. Hasil pemisahan radionuklida 137Cs dari larutan PEB U-7Mo/Al menggunakan metode pengendapan diperoleh rekoveri sebesar 95,56 % dengan akurasi dan presisi pengukuran masing-masing sebesar 0,375 % dan 1,875 %, sedangkan rekoveri pemisahan radionuklida 137Cs dengan metode penukar kation diperoleh rekoveri sebesar 26,73 %. Hal ini menunjukkan bahwa metode pengendapan lebih baik dari pada metode penukar kation untuk pemisahan 137Cs dari larutan bahan bakar
Martinez, C.; Hancock, G. R.; Kalma, J. D.
2009-04-01
The soil carbon pool is a key element within the global carbon cycle. Almost twice the size of the atmospheric carbon pool, and approximately three times that of all living things (biosphere), the soil carbon pool is a significant sink or reservoir for organic carbon. The impact of soil redistribution processes (i.e. soil erosion and deposition) on the movement, storage and loss of soil organic carbon (SOC) has become a subject of debate amongst the scientific community. One school of thought claims soil erosion promotes the storage or sequestration of C (i.e. erosion is a net atmospheric C sink), while others suggest that soil erosion leads to the removal of SOC from the landscape through reduced productivity and soil degradation (i.e. erosion is a net atmospheric C source). Recently, studies have investigated the effects of soil redistribution on SOC using the caesium-137 (137Cs) radio-isotope method. The 137Cs method provides an opportunity to trace the fate of soil (and SOC) in a spatially distributed fashion. Strong and statistically significant relationships between SOC and 137Cs have been observed in heavily cultivated (i.e. highly disturbed) landscapes. These findings have lead to a number of common conclusions, namely that 137Cs and SOC are moving by the same physical processes and the same physical pathways, leading to the possibility of using 137Cs as tool by which to determine SOC distribution patterns. While the literature regarding the relationship between SOC and 137Cs within highly disturbed, cultivated landscapes appears to be reasonably established, there has been a dearth of studies in uncultivated (i.e. largely undisturbed) environments. In this study, we use the 137Cs method to quantify soil redistribution patterns (vertical and lateral) and examine the relationship with SOC for a 150ha catchment in the Upper Hunter region of New South Wales, Australia. The study site has a number of areas which are subject to different land use histories
Determination of {sup 135}Cs and {sup 137}Cs in environmental samples: A review
Energy Technology Data Exchange (ETDEWEB)
Russell, B.C., E-mail: ben.russell@npl.co.uk [GAU-Radioanalytical, Ocean and Earth Science, University of Southampton, National Oceanography Centre, Southampton, SO14 3ZH (United Kingdom); National Physical Laboratory, Hampton Road, Teddington, Middlesex, TW11 0LW (United Kingdom); Croudace, Ian W.; Warwick, Phil E. [GAU-Radioanalytical, Ocean and Earth Science, University of Southampton, National Oceanography Centre, Southampton, SO14 3ZH (United Kingdom)
2015-08-26
Radionuclides of caesium are environmentally important since they are formed as significant high yield fission products ({sup 135}Cs and {sup 137}Cs) and activation products ({sup 134}Cs and {sup 136}Cs) during nuclear fission. They originate from a range of nuclear activities such as weapons testing, nuclear reprocessing and nuclear fuel cycle discharges and nuclear accidents. Whilst {sup 137}Cs, {sup 134}Cs and {sup 136}Cs are routinely measurable at high sensitivity by gamma spectrometry, routine detection of long-lived {sup 135}Cs by radiometric methods is challenging. This measurement is, however, important given its significance in long-term nuclear waste storage and disposal. Furthermore, the {sup 135}Cs/{sup 137}Cs ratio varies with reactor, weapon and fuel type, and accurate measurement of this ratio can therefore be used as a forensic tool in identifying the source(s) of nuclear contamination. The shorter-lived activation products {sup 134}Cs and {sup 136}Cs have a limited application but provide useful early information on fuel irradiation history and have importance in health physics. Detection of {sup 135}Cs (and {sup 137}Cs) is achievable by mass spectrometric techniques; most commonly inductively coupled plasma mass spectrometry (ICP-MS), as well as thermal ionisation (TIMS), accelerator (AMS) and resonance ionisation (RIMS) techniques. The critical issues affecting the accuracy and detection limits achievable by this technique are effective removal of barium to eliminate isobaric interferences arising from {sup 135}Ba and {sup 137}Ba, and elimination of peak tailing of stable {sup 133}Cs on {sup 135}Cs. Isobaric interferences can be removed by chemical separation, most commonly ion exchange chromatography, and/or instrumental separation using an ICP-MS equipped with a reaction cell. The removal of the peak tailing interference is dependent on the instrument used for final measurement. This review summarizes and compares the analytical procedures
Cs-137 in aquatic organisms in the southern Lake Keurusselkae (Finland)[Radioecology
Energy Technology Data Exchange (ETDEWEB)
Ilus, E.; Klemola, S.; Vartti, V.P.; Mattila, J.; Ikaeheimonen, T.K. [STUK - Radiation and Nuclear Safety Authority, Helsinki (Finland)
2006-04-15
The results of a study carried out in Lake Keurusselkae, in the Finnish Lake District, are reported. The aim of the study was to collect biota samples for the INDOFERN Project from an area that was rather highly contaminated (70 kBq m{sup -2} of {sup 137}Cs in 1986) with the Chernobyl fallout in Finland. The samples were taken from a relatively small area surrounding the island of Iso Riihisaari in the southern part of the Keurusselkae water course. In total 15 samples of aquatic plants, 6 samples of aquatic animals, 1 water sample and 2 sediment cores were taken. In August 2003, the activity concentration of {sup 137}Cs in the surface water of the southern Lake Keurusselkae was 49 Bq m{sup -3}, whereas it was 310 Bq m{sup -3} in 1988, two year after the Chernobyl accident. In the relatively shallow area surrounding the island of Iso Riihisaari, the total amount of {sup 137}Cs in sediments was 32-37 kBq m{sup -2} in 2003, but in a deeper basin close to this area the total amount of {sup 137}Cs was 130 kBq m{sup -2} in 1990. The clearly highest activity concentration and concentration factor of {sup 137}Cs was found in one sample of Water horsetail (Equisetum fluviatile), 1 430 Bq kg{sup -1} dry wt; CF 29 200, whereas in another sample of the same species the concentration was only 174 Bq kg{sup -1} dry wt. In addition, the Water lily (Nymphaea candida), Spiked water millfoil (Myriophyllum spicatum), Broad-leaved pondweed (Potamogeton natans) and Yellow water lily (Nuphar lutea) seemed to be good indicators for {sup 137}Cs. The tall freshwater clam (Anodonta sp.) seemed to be a modest accumulator of {sup 137}Cs. Contrary to our results from the coastal areas of the Baltic Sea, many aquatic plants demonstrated in fresh water similar accumulation capacity of {sup 137}Cs as fish (perch and roach), while in the sea the uptake of {sup 137}Cs in fish seemed to be more efficient than in aquatic plants. (LN)
Pharmacokinetic and Pharmacodynamic Characteristics of Subcutaneously Applied PTH-1-37
Directory of Open Access Journals (Sweden)
Wolf-Georg Forssmann
2016-08-01
Full Text Available Background/Aims: Parathyroid hormone (PTH derivatives exert pronounced renal and osteoanabolic properties when given intermittently. The current study was performed to assess the pharmacokinetic and pharmacodynamic properties as well as safety of subcutaneously applied PTH-1-37 after repeated dosing in healthy subjects. Methods: This randomized, double-blind, dose-escalating, placebo and active comparator controlled study was conducted in 33 healthy postmenopausal women. Subjects were allocated to one of five treatment options: 10, 20, or 40 µg PTH-1-37, 20 µg PTH-1-34 or placebo, administered as once daily subcutaneous doses for three days. Plasma drug concentrations and serum levels of endogenous PTH-1-84, and calcium as markers of biological activity were monitored during the treatment. Results: PTH was absorbed rapidly from the subcutaneous tissue with a median tmax of 30 minutes for 20 and 40 µg of PTH-1-37. tmax was 45 minutes for 20 µg PTH-1-34. Elimination half-lives were estimated as 76 ± 34 min and 70 ± 13 min for 20 µg and 40 µg PTH-1-37 (mean ± SD, and 78 ± 34 for 20 µg PTH-1-34. Both PTH fragments (PTH-1-37 and PTH-1-34 increased serum calcium. For PTH-1-37 the effect on serum calcium was dose-dependent. Suppression of endogenous PTH-1-84 was seen after the application of both PTH-1-37 and PTH-1-34. During the study period, the subjects experienced no unexpected or serious adverse events. Conclusions: PTH-1-37 is rapidly absorbed after s.c. injection, has a short plasma elimination half-life, and does not accumulate during multiple dosing. Biological activity was demonstrated by rising serum calcium and decreasing endogenous PTH-1-84 in blood plasma. The study drugs were well tolerated and safe. Our investigation presents data that PTH-1-37 is an excellent drug candidate for intervening with syndromes of dysregulation of calcium metabolism.
The effect of Cs-137 short-range spatial variability on soil after the Chernobyl disaster
Martynenko, Vladimir; Vakulovsky, Sergey; Linnik, Vitaly
2014-05-01
After the Chernobyl accident of 1986, large areas of Russia were contaminated by 137Cs. Post-depositional redistribution of 137Cs fallout across the land surface resulting from mechanical, physical, chemical, and biological processes operating in the soil system and the grain size selectivity associated with soil erosion and sediment transport processes. Therefore of uppermost importance are data on evaluating 137Cs variability at short distances, obtained at the early period after the accident. Measurements of 137Cs deposit at the territory of Russia exposed to radioactive contamination were mainly conducted with the help of air-gamma survey, and were verified by soil sampling on test plots with size 10x10 m with control soil sampling using "envelope" method of fivefold soil sampling (1 sampling at the centre and 4 along the edges of the plot under study). Presented here are evaluation data of 137Cs contamination, obtained in the Bryansk, Yaroslav and Rostov regions in 1991. Test plots were selected at the distance of 50-100 m away from a road on matted areas with undisturbed soil structure. Test routes of sampling were made perpendicularly to directions crossing basic traces of radioactive contamination. Sampling measurements were carried out at Canberra and Ortec gamma spectrometers. Each of the 5 samples of the "envelope" was measured separately, soil mixing was not applied. 137Cs value for the Bryansk Region varied from 2,6 kBq/m2 to 2294 kBq/m2, at the territories of the Yaroslav and Rostov regions 137Cs value varied from 0,44 kBq/m2 to 5,1 kBq/m2 and 0,56 kBq/m2 to 22,2 kBq/m2, respectively. Statistical analysis of 137Cs deposit at different plots is a solid argumentation in favour of nonuniform distribution in various landscapes and at a different distance from the Chernobyl NPP. Such nonuniformity of 137Cs soil contamination in the limits of 10 m of the plot is most likely to be related to initial aerosol contamination nonuniformity at the moment of
Korobova, Elena; Romanov, Sergey; Baranchukov, Vladimir; Berezkin, Victor; Moiseenko, Fedor; Kirov, Sergey
2017-04-01
Investigations performed after the Chernobyl accident showed high spatial variation of radionuclide contamination of the soil cover in elementary landscape geochemical systems (ELGS) that characterize catena's structure. Our studies of Cs-137 distribution along and cross the slopes of local ridges in natural forested key site revealed a cyclic character of variation of the radionuclide surface activity along the studied transections (Korobova et al, 2008; Korobova, Romanov, 2009; 2011). We hypothesized that the observed pattern reflects a specific secondary migration of Cs-137 with water, and that this process could have taken place in any ELGS. To test this hypothesis a detailed field measurement of Cs-137 surface activity was performed in ELGS in agricultural area cultivated after the Chernobyl accident but later withdrawn from land-use. In situ measurements carried out by field gamma-spectrometry were accompanied by soil core sampling at the selected points. Soil samples were taken in increments of 2 cm down to 20 cm and of 5 cm down to 40 cm. The samples were analyzed for Cs-137 in laboratory using Canberra gamma-spectrometer with HP-Ge detector. Obtained results confirmed the fact of area cultivation down to 20 cm that was clearly traced by Cs-137 profile in soil columns. At the same time, the measurements also showed a cyclic character of Cs-137 variation in a sequence of ELGS from watershed to the local depression similar to that found in woodland key site. This proved that the observed pattern is a natural process typical for matter migration in ELGS independently of the vegetation type and ploughing. Therefore, spatial aspect is believed to be an important issue for development of adequate technique for a forecast of contamination of agricultural production and remediation of the soil cover on the local scale within the contaminated areas. References Korobova, E.M., Romanov, S.L., 2009. A Chernobyl 137Cs contamination study as an example for the spatial
In vivo effects of chronic contamination with 137 cesium on testicular and adrenal steroidogenesis
Energy Technology Data Exchange (ETDEWEB)
Grignard, Elise; Gueguen, Yann; Grison, Stephane; Gourmelon, Patrick; Souidi, Maamar [Institute for Radiological Protection and Nuclear Safety, Radiological Protection and Human Health Division, Radiobiology and Epidemiology Department, Laboratory of Experimental Toxicology, BP no 17, Fontenay-aux-Roses Cedex (France); Lobaccaro, Jean-Marc A. [UMR Universite Blaise Pascal-CNRS 6547, Physiologie Comparee et Endocrinologie Moleculaire, Centre de Recherche en Nutrition Humaine d' Auvergne, Aubiere Cedex (France)
2008-09-15
More than 20 years after Chernobyl nuclear power plant explosion, radionuclids are still mainly bound to the organic soil layers. The radiation exposure is dominated by the external exposure to gamma-radiation following the decay of {sup 137}Cs and by soil-to-plant-to-human transfer of {sup 137}Cs into the food chain. Because of this persistence of contamination with {sup 137}Cs, questions regarding public health for people living in contaminated areas were raised. We investigated the biological effects of chronic exposure to {sup 137}Cs on testicular and adrenal steroidogenesis metabolisms in rat. Animals were exposed to radionuclide in their drinking water for 9 months at a dose of 6,500 Bq/l (610 Bq/kg/day). Cesium contamination decreases the level of circulating 17{beta}-estradiol, and increases corticosterone level. In testis, several nuclear receptors messenger expression is disrupted; levels of mRNA encoding Liver X receptor {alpha} (LXR{alpha}) and LXR{beta} are increased, whereas farnesoid X receptor mRNA presents a lower level. Adrenal metabolism presents a paradoxical decrease in cyp11a1 gene expression. In conclusion, our results show for the first time molecular and hormonal modifications in testicular and adrenal steroidogenic metabolism, induced by chronic contamination with low doses of {sup 137}Cs. (orig.)
Diamond, Marc I; Cai, Shirong; Boudreau, Aaron; Carey, Clifton J; Lyle, Nicholas; Pappu, Rohit V; Swamidass, S Joshua; Bissell, Mina; Piwnica-Worms, Helen; Shao, Jieya
2015-04-03
The actin-binding protein profilin-1 (Pfn1) inhibits tumor growth and yet is also required for cell proliferation and survival, an apparent paradox. We previously identified Ser-137 of Pfn1 as a phosphorylation site within the poly-l-proline (PLP) binding pocket. Here we confirm that Ser-137 phosphorylation disrupts Pfn1 binding to its PLP-containing ligands with little effect on actin binding. We find in mouse xenografts of breast cancer cells that mimicking Ser-137 phosphorylation abolishes cell cycle arrest and apoptotic sensitization by Pfn1 and confers a growth advantage to tumors. This indicates a previously unrecognized role of PLP binding in Pfn1 antitumor effects. Spatial restriction of Pfn1 to the nucleus or cytoplasm indicates that inhibition of tumor cell growth by Pfn1 requires its nuclear localization, and this activity is abolished by a phosphomimetic mutation on Ser-137. In contrast, cytoplasmic Pfn1 lacks inhibitory effects on tumor cell growth but rescues morphological and proliferative defects of PFN1 null mouse chondrocytes. These results help reconcile seemingly opposed cellular effects of Pfn1, provide new insights into the antitumor mechanism of Pfn1, and implicate Ser-137 phosphorylation as a potential therapeutic target for breast cancer. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
(137)Cs, (40)K and (210)Po in marine mammals from the southern Baltic Sea.
Ciesielski, Tomasz; Góral, Marta; Szefer, Piotr; Jenssen, Bjørn Munro; Bojanowski, Ryszard
2015-12-15
This study provides information on baseline concentrations of the radionuclides Cesium-137, Potassium-40 and Polonium-210 in sea mammals from the Baltic Sea. The radionuclides were analyzed in the liver, kidney and muscle of harbor porpoises, striped dolphins, and gray and ringed seals from the Polish coast by γ- and α-spectrometry. Median (137)Cs activities were 14.8, 13.2 and 23.2 Bq kg(-1) w.w. in the liver, kidney and muscles, respectively. Activities of (40)K and (210)Po in the respective tissues were found to be 79.1, 79.8 and 111 Bq kg(-1) for (40)K and 58.1, 59.2 and 32.9 Bq kg(-1) for (210)Po. The measured (137)Cs concentrations were extraordinarily high in comparison to those reported in sea mammals from other locations. However, dose assessments did not imply health effects from (137)Cs exposure in Baltic Sea mammals. Correlations between (137)Cs tissue activities and reported sea water concentrations highlight the potential use of marine mammals for biomonitoring purposes. Copyright © 2015 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Egorin, Andrei; Tokar, Eduard; Tutov, Mikhail; Avramenko, Valentin [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation); Far Eastern Federal Univ., Vladivostok (Russian Federation); Palamarchuk, Marina; Marinin, Dmitry [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation)
2017-04-01
A method of preconcentrating cesium-137 from seawater using a resorcinol-formaldehyde resin, which enables one to optimize the ecological monitoring procedure, has been suggested. Studies of sorption of cesium-137 from seawater by resorcinol-formaldehyde resin have been performed, and it has been demonstrated that the cation exchanger is characterized by high selectivity with respect to cesium-137. It was found that the selectivity depended on the temperature of resin solidification and the seawater pH value. The maximal value of the cesium-137 distribution coefficient is equal to 4.1-4.5 x 10{sup 3} cm{sup 3} g{sup -1}. Under dynamic conditions, the ion-exchange resin capacity is 310-910 bed volumes depending on the seawater pH, whereas the efficiency of cesium removal exceeds 95%. The removal of more than 95% of cesium-137 has been attained using 1-3 M solutions of nitric acid: here, the eluate volume was 8-8.4 bed volumes. Application of 3 M solution of nitric acid results in resin degradation with the release of gaseous products.
Determination of {sup 137}Cs in the water system of a pre-Alpine lake
Energy Technology Data Exchange (ETDEWEB)
Erlinger, Ch. [Abtlg. Physik und Biophysik, Fachbereich Materialwissenschaften und Physik, Universitaet Salzburg, Hellbrunnerstrasse 34, 5020 Salzburg (Austria)], E-mail: christian.erlinger@sbg.ac.at; Lettner, H.; Hubmer, A.; Hofmann, W.; Steinhaeusler, F. [Abtlg. Physik und Biophysik, Fachbereich Materialwissenschaften und Physik, Universitaet Salzburg, Hellbrunnerstrasse 34, 5020 Salzburg (Austria)
2009-04-15
The aim of this study was to measure the {sup 137}Cs activity derived from the Chernobyl accident in the water system of Lake Wallersee, a pre-Alpine lake in Austria within an area highly contaminated by the Chernobyl fallout. For this purpose, water and sediment samples of the inflows and the outflow of Lake Wallersee and lake water at different depths were collected in 2005. The obtained {sup 137}Cs activity depth profile in the water body shows an exponential increase of {sup 137}Cs activity in the lake water with increasing depth. Inflow and outflow sediment analyses exhibit a clear negative correlation between particle size and specific activity for {sup 137}Cs and {sup 40}K in sediment samples following a power function. In a first approach it was tried to calculate the catchment run-off factor of {sup 137}Cs during a period without heavy rainfalls. The result is in good agreement with run-off factors determined in other similar investigations in Austria.
Modulation of trinucleotide repeat instability by DNA polymerase β polymorphic variant R137Q
Ren, Yaou; Lai, Yanhao; Laverde, Eduardo E.; Lei, Ruipeng; Rein, Hayley L.
2017-01-01
Trinucleotide repeat (TNR) instability is associated with human neurodegenerative diseases and cancer. Recent studies have pointed out that DNA base excision repair (BER) mediated by DNA polymerase β (pol β) plays a crucial role in governing somatic TNR instability in a damage-location dependent manner. It has been shown that the activities and function of BER enzymes and cofactors can be modulated by their polymorphic variations. This could alter the function of BER in regulating TNR instability. However, the roles of BER polymorphism in modulating TNR instability remain to be elucidated. A previous study has shown that a pol β polymorphic variant, polβR137Q is associated with cancer due to its impaired polymerase activity and its deficiency in interacting with a BER cofactor, proliferating cell nuclear antigen (PCNA). In this study, we have studied the effect of the pol βR137Q variant on TNR instability. We showed that pol βR137Q exhibited weak DNA synthesis activity to cause TNR deletion during BER. We demonstrated that similar to wild-type pol β, the weak DNA synthesis activity of pol βR137Q allowed it to skip over a small loop formed on the template strand, thereby facilitating TNR deletion during BER. Our results further suggest that carriers with pol βR137Q polymorphic variant may not exhibit an elevated risk of developing human diseases that are associated with TNR instability. PMID:28475635
G-protein-coupled receptor 137 accelerates proliferation of urinary bladder cancer cells in vitro.
Du, Yiheng; Bi, Wenhuan; Zhang, Fei; Wu, Wenbo; Xia, Shujie; Liu, Haitao
2015-01-01
Urinary bladder cancer is a worldwide concern because of its level of incidence and recurrence. To search an effective therapeutic strategy for urinary bladder cancer, it is important to identify proteins involved in tumorigenesis that could serve as potential targets for diagnosis and treatment. G-protein-coupled receptors (GPRs) constitute a large protein family of receptors that sense molecules outside the cell and activate signal transduction pathways and cellular responses inside the cell. GPR137 is a newly discovered human gene encoding orphan GPRs. In this study, we aimed to investigate the physiological role of GPR137 in urinary bladder cancer. The effect of GPR137 on cell growth was examined via an RNA interference (RNAi) lentivirus system in two human urinary bladder cancer cell lines BT5637 and T24. Lentivirus-mediated RNAi could specifically suppressed GPR137 expression in vitro, resulting in alleviated cell viability and impaired colony formation, as well as blocks G0/G1 and S phases of the cell cycle. These results suggested GPR137 as an essential player in urinary bladder cancer cell growth, and it may serve as a potential target for gene therapy in the treatment of urinary bladder cancer. © 2014 International Union of Biochemistry and Molecular Biology, Inc.
Adsorption of Cs-137 and U-238 in semi-arid soils; Adsorcion de Cs-137 y U-238 en suelos semiaridos
Energy Technology Data Exchange (ETDEWEB)
Hernandez T, U. O. [Instituto Tecnologico de Toluca, Av. Tecnologico s/n, 52140 Metepec, Estado de Mexico (Mexico); Monroy G, F.; Anguiano A, J. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Fernandez R, E., E-mail: uohtrejo@gmail.com [Universidad Politecnica del Valle de Toluca, Carretera Toluca-Almoloya de Juarez Km. 5.6, Santiaguito Tlalcilalcali, Estado de Mexico (Mexico)
2013-10-15
Is of great importance to determine the adsorption properties of the soils where radioactive wastes are stored, fundamentally of the radioisotopes contained in these wastes, with the purpose of knowing like will be their behavior in the event of happening radionuclide migration toward the surrounding means. Therefore, in this work the adsorption properties of {sup 137}Cs{sup +} and {sup 238}UO{sub 2}{sup 2+} in soils coming from the Storage Center of Radioactive Wastes are studied. Was studied the effect of the soil type and the particle size of the soil in the adsorption properties of Cs (I) and U (Vi). 13 soil samples and six different particle sizes were analyzed. The adsorption studies were carried out by the radiotracers technique in static way. The results indicate an important adsorption affinity toward the Cs-137 and a very vulnerable affinity for the {sup 238}UO{sub 2}{sup 2+}. (author)
Directory of Open Access Journals (Sweden)
Rahpita Windriani
2014-10-01
Full Text Available Study of deposit Cesium-137 (137Cs activity as a result of the fission product of Fukushima Daiichi Nuclear Power Plant after earthquake and tsunami in 2011 has been done. The purpose of the present research is to study the deposit 137Cs activity on the land and the Sea of Japan and then to estimate a model of 137Cs distribution on the earth's surface of Japan. The stability of nuclei decay equation is used to obtain a deposit 137Cs activity depending on time, theoretically. The Pasquill-Gifford equation is used to estimate a distribution of 137Cs activity on the earth surface from the original source. The results suggested that Hatachinaka city, the largest measurement point, for about 60 years forward, 137Cs activity levels reach about 54 Bq. In the Sea of Japan at the point of sensor C47, which it has the largest value, the accumulation of deposit 137Cs activity gives about 0.69 Bq at the time of the next 60 years. For the distribution of 137Cs activity, the concentration values at a distance of 200 m from the original source obtained maximum for all case.
Violence and hatred in Psalm 137: The psalm in its ancient social context
Directory of Open Access Journals (Sweden)
Y Steenkamp
2004-10-01
Full Text Available Psalm 137 has become notorious for the brutality and bloodthirstiness that characterise its last verses. In the face of many past criticisms which rejected the Old Testament as a book of violence, both Christians� and� Jews need to take texts such as Psalm 137 seriously and interpret them against the� social� and cultural customs of their time. Before Psalm 137 can be judged against the ethical norms of modern societies, the text must first be understood in its ancient context. The aim of this paper is to show that a better understanding of the socio-cultural background of the Psalm may enhance our understanding of vv. 7-9, as well as of the Psalm as a whole. The hypothesis is that the social values of honour and shame feature so prominently in the Psalm that they form a key to the interpretation of the poem.
First Results on the Concentration of 137Cs in Seaweed at the South of Spain
Manjon, G.; Garcia-Leon, M.
First results on 137Cs in seaweed samples collected along the coast of the South of Spain during 1988 and 1989 are presented in this work. 137Cs was determined by direct HPGe γ-spectrometry. Typical 137Cs levels between 0.6 and 3.1 mBq/g dry weight have been found in a wide variety of seaweed species (Fucus, Ulva, Halopteris, Codium, Corallina, etc.). Such results are in close agreement with activities obtained by another researchers at the coasts of Galicia (NW of Spain). They ranged from 0.7 to 1.7 mBq/g dry weight in Fucus species, and were attributed essentially to fallout. On the other hand, the comparison of our data with others shows that they are, respectively, 10 and 100 times lower than activities found at Sweden after the Chernobyl event, and in the vicinity of Sellafield nuclear fuel reprocessing plant…
Airborne fallout mapping of {sup 137}Cs Finnish defence forces team
Energy Technology Data Exchange (ETDEWEB)
Kettunen, M.; Heininen, T. [Finnish Defence Forces Research Centre, Lakiala (Finland); Pulakka, M. [Finnish Air Force Depot, Tampere (Finland)
1997-12-31
The main task of the team was to create a fallout map of {sup 137}Cs in a specified area in Padasjoki Auttoinen village. The team used an MI-8 helicopter of the Finnish Air Force. The team had an HPGe system (relative efficiency 70%) to measure nuclide specific ground contamination level. For navigation the team took advantage of the DGPS service provided by Finnish Broadcasting company utilizing the RDS-channel to get position accuracy within 2 meters. The correction signal is reachable nationwide on the FM transmitter network. The system produced a distribution map for {sup 40}K and fallout maps for {sup 134,137}Cs using a Micro Station Program with TerraModeler application. The maximum measured {sup 137}Cs ground contamination exceeded 130-140 kBqm{sup -2}. (au).