WorldWideScience

Sample records for europium 134

  1. Moessbauer studies of {sup 151}Eu in europium oxalate, europium bissalen ammonium and europium benzoate

    Energy Technology Data Exchange (ETDEWEB)

    Wynter, C. I., E-mail: wynterc@ncc.edu [Nassau Community College, Department of Chemistry (United States); Ryan, D. H. [McGill University, Centre for the Physics Materials, Department of Physics (Canada); Taneja, S. P. [Maharshi Dayanand University, Department of Physics (India); May, L. [Catholic University of America, Department of Chemistry (United States); Oliver, F. W. [Morgan State University, Department of Physics (United States); Brown, D. E. [Northern Illinois University, Department of Physics (United States); Iwunzie, M. [Morgan State University, Department of Chemistry (United States)

    2005-11-15

    Although a number of europium water insoluble chelates have been prepared for several decades, the covalent nature of these compounds has never been established in any quantitative fashion. Shifts in the I.R. bands and conductivity measurements of these salts were hitherto used to qualitatively compare their molecular nature. In this communique we have used temperature coefficients of {sup 151}Eu Moessbauer spectra to determine the Debye temperatures ({theta}{sub D}) of three europium chelates: namely europium oxalate, europium bissalen ammonium (recently reported) and europium benzoate and compared their {theta}{sub D} with the measured {theta}{sub D} of the known ionic EuF{sub 3}. Additionally, the mean square amplitude (europium bissalen ammonium (133 {+-} 5 K) and lastly the europium benzoate with a {theta}{sub D} of (105 {+-} 5 K).

  2. Europium-155 in Debris from Nuclear Weapons

    DEFF Research Database (Denmark)

    Aarkrog, Asker; Lippert, Jørgen Emil

    1967-01-01

    The lithium-drifted germanium detector enables determination of europium-155 on a routine basis in environmental samples contaminated with debris from nuclear weapons. From measurements of europium-155, cesium-144, and strontium-90 in air filters collected between 1961 and 1966, the yield...

  3. Resonance ionization scheme development for europium

    Energy Technology Data Exchange (ETDEWEB)

    Chrysalidis, K., E-mail: katerina.chrysalidis@cern.ch; Goodacre, T. Day; Fedosseev, V. N.; Marsh, B. A. [CERN (Switzerland); Naubereit, P. [Johannes Gutenberg-Universität, Institiut für Physik (Germany); Rothe, S.; Seiffert, C. [CERN (Switzerland); Kron, T.; Wendt, K. [Johannes Gutenberg-Universität, Institiut für Physik (Germany)

    2017-11-15

    Odd-parity autoionizing states of europium have been investigated by resonance ionization spectroscopy via two-step, two-resonance excitations. The aim of this work was to establish ionization schemes specifically suited for europium ion beam production using the ISOLDE Resonance Ionization Laser Ion Source (RILIS). 13 new RILIS-compatible ionization schemes are proposed. The scheme development was the first application of the Photo Ionization Spectroscopy Apparatus (PISA) which has recently been integrated into the RILIS setup.

  4. Europium-151 Moessbauer spectroscopic and XANES investigation of europium-exchanged Y-zeolite

    International Nuclear Information System (INIS)

    Berry, F.J.; Marco, J.F.; Steel, A.T.

    1994-01-01

    Eu 3+ in ca. 10 wt% europium-exchanged Y-zeolite is partially reduced by treatment in hydrogen at 600 C to Eu 2+ . The reduction of Eu 3+ is more readily achieved in Y-zeolite than in europium(III) oxide. The discrepancy in the extent of reduction as revealed by 151 Eu Moessbauer spectroscopy and near edge X-ray absorption fine structure (XANES) is associated with any difference in the recoil free fractions of Eu 2+ and Eu 3+ which may exist at 298 K and the enhanced sensitivity of the XANES to changes in the europium oxidation state. (orig.)

  5. Synthesis of samarium, europium and ytterbium acetylenides

    International Nuclear Information System (INIS)

    Bochkarev, M.N.; Fedorova, E.A.; Glushkova, N.V.; Protchenko, A.V.; Druzhkov , O.N.; Khorshev, S.Ya.

    1995-01-01

    Ethynyl complexes of samarium, europium and ytterbium were prepared by interaction of naphthalinides of metals with acetylene in tetrahydrofuran. The compounds are isolated in the form of dark-coloured pyrophore powders. Data of magnetic measurements suggest that in the course of the reaction Sm(2) is oxidized completely to Sm(3), Yb(2) transforms into Yb(3) partially, whereas europium preserves its initial bivalent state. Hydrolysis of the compounds prepared provides acetylene, ethylene, ethane and hydrogen which indicates the presence of acethylenide Ln 2 C 2 and hydride LnH groupings (Ln = Sm, Eu, Yb). 9 refs., 2 tabs

  6. Organophosphate Nerve Agent Detection with Europium Complexes

    Directory of Open Access Journals (Sweden)

    Jake R. Schwierking

    2004-01-01

    Full Text Available We explore the detection of paraoxon, a model compound for nonvolatile organophosphate nerve agents such as VX. The detection utilizes europium complexes with 1,10 phenanthroline and thenoyltrifluoroacetone as sensitizing ligands. Both europium luminescence quenching and luminescence enhancement modalities are involved in the detection, which is simple, rapid, and sensitive. It is adaptable as well to the more volatile fluorophosphate nerve agents. It involves nothing more than visual luminescence observation under sample illumination by an ordinary hand-held ultraviolet lamp.

  7. Fermi Surface and Antiferromagnetism in Europium Metal

    DEFF Research Database (Denmark)

    Andersen, O. Krogh; Loucks, T. L.

    1968-01-01

    of the nearly cubical part of the hole surface at P, and we also discuss the effects of the electron surface at H. Since it is likely that barium and europium have similar Fermi surfaces, we have presented several extremal areas and the corresponding de Haas-van Alphen frequencies in the hope that experimental...

  8. Synthesis and spectral properties of europium phthalocyanine complexes

    International Nuclear Information System (INIS)

    Maksimova, K.N.; Bazyakina, N.L.; Kutyreva, V.V.; Suvorova, O.N.; Domrachev, G.A.

    2008-01-01

    Synthesis of europium monophthalocyanic complexes with thenoyltrifluroacetonate (tta) and ferrocenoyltrifluoroacetate (fta) ligands has been considered. Spectral characteristics of complexes PcEu(tta)(ttaH) and PcEu(fta)(ftaH) (Pc - phthalocyanine ligand) have been investigated. One of β-diketonate ligand is proposed to bind with europium ion covalently, and the second ligand saturates coordination sphere of europium due to donor-acceptor binding [ru

  9. Temperature effects in the valence fluctuation of europium intermetallic compounds

    International Nuclear Information System (INIS)

    Menezes, O.L.T. de; Troper, A.; Gomes, A.A.

    1978-03-01

    A previously reported model for valence fluctuations in europium compound in order to account for thermal occupation effect. Experimental results are critically discussed and new experiments are suggested

  10. On the composition of nonstoichiometric europium monoxide

    International Nuclear Information System (INIS)

    Ignat'eva, N.I.

    1990-01-01

    Consideration is given to results of of investigation into chemical composition, homogeneity region, type of disordering of nonstoichiometric europium monoxide. Precision methods of X-ray diffraction, electron-microscopic, atomic-absorption chemical analysis were used. It is shown that lattice volume reduces with increase of oxygen content in the oxide. For monocrystal of EuO 1.01 composition a=5.146 A. All samples of europium monoxide are characterized by low conductivity. Conductivity value changes by two orders (from 10 -8 to 10 -6 Θ -1 ·cm -1 ) when passing from the sample of stoichiometric composition to maximally disordered one. The disordering is considered according to the type of charged cation vacancies, leading to occurrence of equivalent number of electron defects of positive holes. 4 refs.; 1 tab

  11. Formation of americium and europium humate complexes

    International Nuclear Information System (INIS)

    Minai, Y.; Tominaga, T.; Meguro, Y.

    1991-01-01

    Binding constants of americium and europium with a humic acid were determined to study if complex formation of trivalent actinide-humates affects dissolved species of the actinides in hydrosphere. The purified humic acid was characterized by means of UV-vis, IR, and pH titration, indicating high carboxylate capacity and low aromaticity. Binding constants of americium and europium humates were determined at pH 4.6 and 6.0 by solvent extraction using 241 Am or 152 Eu as a tracer. The binding constants for americium-humate obtained preliminarily suggest that complexes with humic acid are not negligible in speciation of trivalent actinides in hydrosphere. The obtained binding constants were nearly identical with those determined previously by the same procedures, but with humic acids of different origin and compositions. (author)

  12. APW research of europium monochalcogenides. 1

    International Nuclear Information System (INIS)

    Farberovich, O.V.; Vlasov, S.V.

    1981-01-01

    The augmented plane wave method (APW) is used for a theoretical study of the electron properties of europium monochalcogenides. Spin-polarized energy band calculations of the ferromagnetic EuO, EuS, and EuSe explain qualitatively the exchange interactions therein. Based on the APW data in the frame of perturbation theory the Coulomb electron-electron interaction at the 4f shell of europium is taken into account for EuO and EuS. The band structures and the multiplet terms of the f 6 d and 3d 9 4f 8 excited states gives a new interpretation of a known experimental spectra for these compounds. (author)

  13. The migrant 152Eu as europium humate

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de

  14. Europium enabled luminescent nanoparticles for biomedical applications

    Energy Technology Data Exchange (ETDEWEB)

    Syamchand, S.S., E-mail: syamchand.ss@gmail.com; Sony, G., E-mail: emailtosony@gmail.com

    2015-09-15

    Lanthanide based nanoparticles are receiving great attention ought to their excellent luminescent and magnetic properties and find challenging biomedical applications. Among the luminescent lanthanide NPs, europium based NPs (Eu-NPs) are better candidates for immunoassay and imaging applications. The Eu-NPs have an edge over quantum dots (QDs) by means of their stable luminescence, long fluorescence lifetime, sharp emission peaks with narrow band width, lack of blinking and biocompatibility. This review surveys the synthesis and properties of a variety of Eu-NPs consolidated from different research articles, for their applications in medicine and biology. The exquisite luminescent properties of Eu-NPs are explored for developing biomedical applications such as immunoassay and bioimaging including multimodal imaging. The biomedical applications of Eu-NPs are mostly diagnostic in nature and mainly focus on various key analytes present in biological systems. The luminescent properties of europium enabled NPs are influenced by a number of factors such as the site symmetry, the metal nanoparticles, metal ions, quantum dots, surfactants, morphology of Eu-NPs, crystal defect, phenomena like antenna effect and physical parameters like temperature. Through this review we explore and assimilate all the factors which affect the luminescence in Eu-NPs and coil a new thread of parameters that control the luminescence in Eu-NPs, which would provide further insight in developing Eu-based nanoprobes for future biomedical prospects. - Highlights: • The review describes 14 major factors that influence the luminescence properties of europium enabled luminescent nanoparticles (Eu-NPs). • Surveys different types of europium containing nanoparticles that have been reported for their biomedical applications. • Eu-NPs are conveniently divided into four different categories, based on the type of the substrates involved. The four categories are (1) virgin Eu-substrate based NPs; (2

  15. Europium enabled luminescent nanoparticles for biomedical applications

    International Nuclear Information System (INIS)

    Syamchand, S.S.; Sony, G.

    2015-01-01

    Lanthanide based nanoparticles are receiving great attention ought to their excellent luminescent and magnetic properties and find challenging biomedical applications. Among the luminescent lanthanide NPs, europium based NPs (Eu-NPs) are better candidates for immunoassay and imaging applications. The Eu-NPs have an edge over quantum dots (QDs) by means of their stable luminescence, long fluorescence lifetime, sharp emission peaks with narrow band width, lack of blinking and biocompatibility. This review surveys the synthesis and properties of a variety of Eu-NPs consolidated from different research articles, for their applications in medicine and biology. The exquisite luminescent properties of Eu-NPs are explored for developing biomedical applications such as immunoassay and bioimaging including multimodal imaging. The biomedical applications of Eu-NPs are mostly diagnostic in nature and mainly focus on various key analytes present in biological systems. The luminescent properties of europium enabled NPs are influenced by a number of factors such as the site symmetry, the metal nanoparticles, metal ions, quantum dots, surfactants, morphology of Eu-NPs, crystal defect, phenomena like antenna effect and physical parameters like temperature. Through this review we explore and assimilate all the factors which affect the luminescence in Eu-NPs and coil a new thread of parameters that control the luminescence in Eu-NPs, which would provide further insight in developing Eu-based nanoprobes for future biomedical prospects. - Highlights: • The review describes 14 major factors that influence the luminescence properties of europium enabled luminescent nanoparticles (Eu-NPs). • Surveys different types of europium containing nanoparticles that have been reported for their biomedical applications. • Eu-NPs are conveniently divided into four different categories, based on the type of the substrates involved. The four categories are (1) virgin Eu-substrate based NPs; (2

  16. Study of the europium behavior in aqueous media

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.; Martinez M, V.

    1999-01-01

    Europium as waste can produce a pollution problem in water that is in contact with it, what would has a heavy environmental impacts, because of the possibilities of diffusion of these wastes from their place of confinement or storage until the geo and biosphere. The solution of such problem requires of a lot of knowledge over the behavior of several chemical elements such as europium in aqueous solutions. In this work it was used a low ion force (0.02 M). The data set will allow extrapolate the hydrolytic behavior of europium in too much minors ion force media, such as the ground waters, including in ion force zero

  17. Synthesis and characterization of europium aluminophosphate

    International Nuclear Information System (INIS)

    Araujo, A.S.; Diniz, J.C.; Silva, A.O.S.

    1998-01-01

    Full text: Aluminophosphate molecular sieves (ALPO) represents a class of materials formed by AlO 2+ and PO 2- tetrahedra linked together through b the oxygen atom. The incorporation of metal cations, specifically rare earths, in the ALPO matrix, gives rise to generation of new materials that can be used as acid catalysts in chemical processes. In this work, it was synthesized hydrothermally a molecular sieve type Eu-ALPO-11, starting from an hydrated alumina (pseudobohemite), phosphoric acid solution, europium chloride, water, and di-isopropylamine (DIPA) as organic template. The gel of synthesis presented the following composition: 1.0 DIPA: 0.05 Eu 2 O 3 :0.95 Al 2 O 3 : 1.0 P 2 O 5 : 80 H 2 O The hydrogel was autoclaved at 170 deg C for a period of 3 days. After that the obtained solid was filtered, washed, dried and calcined at 500 deg C to remove the template. The sample was characterized by several physico-chemical methods, such a atomic absorption, FT-IR spectroscopy, X-ray diffraction, thermal analysis, scanning electron microscopy. Its spectroscopic properties was investigated by europium luminescence. The physico-chemical characterization of the Eu-ALPO-11 showed very good crystallinity, with AEL structure, and orthorhombic symmetry. Also, the material presents excellent thermal stability, with no structural collapse until 950 deg C. Through the luminescence spectra in the visible region, it was observed that the emission of the Eu 3+ is strongly influenced by the increasing of the 5d0 7f0 transition (Electric Dipole), as compared to the 5d0 7f1 transition (Magnetic Dipole) between the levels of 4f configuration perturbed by the crystalline field. The ED/MD ratio to the as synthesized sample was ca. 2.1, against ca. 1.1 relative to the calcined sample. The FT-IR spectra presented well defined absorption bands relative to Al-O and P-O bonds, of the structural internal tetrahedra (IT) and external links (EL): 1250- 950 cm -1 , symmetric stretching due to

  18. Preparation and spectral properties of europium hydrogen squarate microcrystals

    Science.gov (United States)

    Kolev, T.; Danchova, N.; Shandurkov, D.; Gutzov, S.

    2018-04-01

    A simple scheme for preparation of europium hydrogen squarate octahydrate microcrystals, Eu(HSq)3·8H2O is demonstrated. The microcrystalline powders obtained have a potential application as non-centrosymmetric and UV radiation - protective hybrid optical material. The site-symmetry of the Eu - ion is C2V or lower, obtained from diffuse reflectance spectra. The formation of europium hydrogen squarate is supported by IR - spectroscopy, UV-vis spectroscopy, chemical analysis and X-ray diffraction. A detailed analysis of the UV-vis and IR spectra of the micropowders prepared is presented. The reaction between europium oxide and squaric acid leads to formation of microcrystalline plate-like crystals of europium hydrogen squarate Eu(HSq)3·8H2O, a non-centrosymmetric hybrid optical material with a potential application as UV radiation - protective coatings.

  19. Sorption of Europium in zirconium silicate

    International Nuclear Information System (INIS)

    Garcia R, G.

    2004-01-01

    Some minerals have the property of sipping radioactive metals in solution, that it takes advantage to manufacture contention barriers that are placed in the repositories of nuclear wastes. The more recent investigations are focused in the development of new technologies guided to the sorption of alpha emissors on minerals which avoid their dispersion in the environment. In an effort to contribute to the understanding of this type of properties, some studies of sorption of Europium III are presented like homologous of the americium, on the surface of zirconium silicate (ZrSiO 4 ). In this work the results of sorption experiences are presented as well as the interpretation of the phenomena of the formation of species in the surface of the zirconium silicate. (Author)

  20. Electronic structure and superconductivity of europium

    International Nuclear Information System (INIS)

    Nixon, Lane W.; Papaconstantopoulos, D.A.

    2010-01-01

    We have calculated the electronic structure of Eu for the bcc, hcp, and fcc crystal structures for volumes near equilibrium up to a calculated 90 GPa pressure using the augmented-plane-wave method in the local-density approximation. The frozen-core approximation was used with a semi-empirical shift of the f-states energies in the radial Schroedinger equation to move the occupied 4f valence states below the Γ 1 energy and into the core. This shift of the highly localized f-states yields the correct europium phase ordering with lattice parameters and bulk moduli in good agreement with experimental data. The calculated superconductivity properties under pressure for the bcc and hcp structures are also found to agree with and follow a T c trend similar to recent measurement by Debessai et al.

  1. Metal plasmon enhanced europium complex luminescence

    International Nuclear Information System (INIS)

    Liu Feng; Aldea, Gabriela; Nunzi, Jean-Michel

    2010-01-01

    The plasmon enhanced luminescence of a rare-earth complex Tris(6, 6, 7, 7, 8, 8, 8-heptafluoro-2, 2-dimethyl-3, 5-octanedionato) europium (Eu(fod) 3 ) was investigated. A polyvinyl alcohol (PVA) thin film was successfully adopted as a spacer to separate the Eu complex from the silver island film (SIF), and five-fold enhancement of the radiative decay rate of the Eu complex on SIF was demonstrated based on the luminescence intensity and lifetime measurement. Investigation of the distance dependent luminescence indicates that 7 nm is an optimal distance for SIF enhanced Eu luminescence. Plasmon enhanced rare-earth luminescence based on an organic film spacer would find potential applications in plasmon enhanced organic light emitting diode (OLED) devices.

  2. Europium polyoxometalates encapsulated in silica nanoparticles - characterization and photoluminescence studies

    Energy Technology Data Exchange (ETDEWEB)

    Neves, Cristina S.; Granadeiro, Carlos M.; Cunha-Silva, Luis; Eaton, Peter; Balula, Salete S.; Pereira, Eulalia [REQUIMTE/Departamento de Quimica e Bioquimica, Faculdade de Ciencias, Universidade do Porto (Portugal); Ananias, Duarte [CICECO, Departamento de Quimica, Universidade de Aveiro (Portugal); Gago, Sandra [REQUIMTE, Departamento de Quimica, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Monte de Caparica (Portugal); Feio, Gabriel [CENIMAT/I3N, Departamento de Ciencia dos Materiais, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Monte de Caparica (Portugal); Carvalho, Patricia A. [ICEMS/Departamento de Bioengenharia, Instituto Superior Tecnico, Lisboa (Portugal)

    2013-06-15

    The incorporation of europium polyoxometalates into silica nanoparticles can lead to a biocompatible nanomaterial with luminescent properties suitable for applications in biosensors, biological probes, and imaging. Keggin-type europium polyoxometalates Eu(PW{sub 11}){sub x} (x = 1 and 2) with different europium coordination environments were prepared by using simple methodologies and no expensive reactants. These luminescent compounds were then encapsulated into silica nanoparticles for the first time through the water-in-oil microemulsion methodology with a nonionic surfactant. The europium polyoxometalates and the nanoparticles were characterized by using several techniques [FTIR, FT-Raman, {sup 31}P magic angle spinning (MAS) NMR, and TEM/energy-dispersive X-ray spectroscopy (TEM-EDS), AFM, dynamic light scattering (DLS), and inductively coupled plasma MS (ICP-MS) analysis]. The stability of the material and the integrity of the europium compounds incorporated were also examined. Furthermore, the photoluminescence properties of the Eu(PW{sub 11}){sub x} rate at SiO{sub 2} nanomaterials were evaluated and compared with those of the free europium polyoxometalates. The silica surface of the most stable nanoparticles was successfully functionalized with appropriate organosilanes to enable the covalent binding of oligonucleotides. (Copyright copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. Statistical optimization of synthesis procedure and characterization of europium (III) molybdate nano-plates

    Energy Technology Data Exchange (ETDEWEB)

    Pourmortazavi, Seied Mahdi [Malek Ashtar University of Technology, Faculty of Material and Manufacturing Technologies, P. O. Box 16765-3454, Tehran (Iran, Islamic Republic of); Rahimi-Nasrabadi, Mehdi [Imam Hossein University, Nano Science Center, Tehran (Iran, Islamic Republic of); Fazli, Yousef [Islamic Azad University, Department of Chemistry, Faculty of Science, Arak Branch, Arak (Iran, Islamic Republic of); Mohammad-Zadeh, Mohammad [Sabzevar University of Medical Sciences, Department of Physiology and Pharmacology, School of Medicine, Sabzevar (Iran, Islamic Republic of)

    2015-06-15

    Europium (III) molybdate nano-plates were synthesized in this work via chemical precipitation route involving adding of europium (III) ion solution to the aqueous solution of molybdate reagent. Effects of some reaction variables such as concentrations of europium and molybdate ions, flow rate of europium reagent, and reactor temperature on the diameter of the synthesized europium (III) molybdate nano-plates were experimentally investigated by orthogonal array design. The results showed that the size of europium (III) molybdate nano-plates can be optimized by adjusting the concentrations of europium (III) and molybdate ions, as well as the reactional temperature. Europium (III) molybdate nano-plates prepared under the optimum conditions were characterized by X-ray powder diffraction, scanning electron microscopy, and Fourier transform infrared spectroscopy. (orig.)

  4. On the existence of europium aluminum oxynitrides with a magnetoplumbite or beta-alumina type structure

    NARCIS (Netherlands)

    Hintzen, H.T.J.M.; Hanssen, R.; Jansen, S.R.; Metselaar, R.

    1999-01-01

    In the literature confusion exists concerning the structure type, the valence of europium, and the amount of nitrogen incorporation of the compound europium aluminum oxynitride. By using X-ray diffraction and luminescence measurements, we show that europium aluminum oxynitride has the

  5. Europium ion as a probe for binding sites to carrageenans

    Energy Technology Data Exchange (ETDEWEB)

    Ramos, Ana P.; Goncalves, Rogeria R.; Serra, Osvaldo A. [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, Ribeirao Preto, Sao Paulo 14040-901 (Brazil); Zaniquelli, Maria Elisabete D. [Departamento de Quimica, Faculdade de Filosofia, Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, Ribeirao Preto, Sao Paulo 14040-901 (Brazil)], E-mail: medzaniquelli@ffclrp.usp.br; Wong, Kenneth [Laboratorio de Fisico-Quimica, Centro de Pesquisas de Paulinia, Rhodia Brasil, Paulinia, Sao Paulo (Brazil)

    2007-12-15

    Carrageenans, sulfated polysaccharides extracted from red algae, present a coil-helix transition and helix aggregation dependence on the type and concentration of counterions. In this study, we focus attention on a mixed valence counterion system: Eu{sup 3+}/Na{sup +} or K{sup +} with different gel-forming carrageenans: kappa, iota, and kappa-2. Results of stationary and time-dependent luminescence showed to be a suitable tool to probe ion binding to both the negatively charged sulfate group and the hydroxyl groups present in the biopolymer. For lower europium ion concentrations, a single longer decay emission lifetime was detected, which was attributed to the binding of europium ion to the carrageenan sulfate groups. An additional decay ascribed to europium binding to hydroxyl groups was observed above a threshold concentration, and this decay was dependent on the carrageenan charge density. Symmetry of the europium ion microenvironment was estimated by the ratio between the intensities of its emission bands, which has been shown to depend on the concentration of europium ions and on the specificity of the monovalent counterion bound to the carrageenan.

  6. Europium ion as a probe for binding sites to carrageenans

    International Nuclear Information System (INIS)

    Ramos, Ana P.; Goncalves, Rogeria R.; Serra, Osvaldo A.; Zaniquelli, Maria Elisabete D.; Wong, Kenneth

    2007-01-01

    Carrageenans, sulfated polysaccharides extracted from red algae, present a coil-helix transition and helix aggregation dependence on the type and concentration of counterions. In this study, we focus attention on a mixed valence counterion system: Eu 3+ /Na + or K + with different gel-forming carrageenans: kappa, iota, and kappa-2. Results of stationary and time-dependent luminescence showed to be a suitable tool to probe ion binding to both the negatively charged sulfate group and the hydroxyl groups present in the biopolymer. For lower europium ion concentrations, a single longer decay emission lifetime was detected, which was attributed to the binding of europium ion to the carrageenan sulfate groups. An additional decay ascribed to europium binding to hydroxyl groups was observed above a threshold concentration, and this decay was dependent on the carrageenan charge density. Symmetry of the europium ion microenvironment was estimated by the ratio between the intensities of its emission bands, which has been shown to depend on the concentration of europium ions and on the specificity of the monovalent counterion bound to the carrageenan

  7. X-ray structural analysis of plasma sprayed europium oxide

    Energy Technology Data Exchange (ETDEWEB)

    Gorshkov, B.N.; Loskutov, V.S.; Gavrish, A.A.; Shakh, G.E.

    1981-12-01

    An X-ray structure microanalysis is made for europium oxide powder produced by sintering and plasmic spheroidization for plasma spraying. The technique of concern is shown not to alter chemical composition of the powder. It is stated that a rise in the plasma jet enthalpy while spraying does not result in dissociation of europium oxide and its interaction with the plasma flux. The coating (to 15.2 kWxs/g) is found to have only a high-temperature (monoclinic) europium oxide phase and there appears a low-temperature (cubic) phase with a subsequent increase in the enthalpy. The plasma jet enthalpy increasing the grain size and the crystal lattice c parameter of the sprayed europium oxide are shown to decrease; the a parameter reduces with an enthalpy growth to 16.2 kW s/g and then smoothly increases with the enthalpy further growth. It is noticed that the europium oxide coating does not interact with an aluminium D16 alloy substrate.

  8. Chloride, bromide and iodide scintillators with europium

    Science.gov (United States)

    Zhuravleva, Mariya; Yang, Kan

    2016-09-27

    A halide scintillator material is disclosed where the halide may comprise chloride, bromide or iodide. The material is single-crystalline and has a composition of the general formula ABX.sub.3 where A is an alkali, B is an alkali earth and X is a halide which general composition was investigated. In particular, crystals of the formula ACa.sub.1-yEu.sub.yI.sub.3 where A=K, Rb and Cs were formed as well as crystals of the formula CsA.sub.1-yEu.sub.yX.sub.3 (where A=Ca, Sr, Ba, or a combination thereof and X=Cl, Br or I or a combination thereof) with divalent Europium doping where 0.ltoreq.y.ltoreq.1, and more particularly Eu doping has been studied at one to ten mol %. The disclosed scintillator materials are suitable for making scintillation detectors used in applications such as medical imaging and homeland security.

  9. A novel photoluminescent and photochromic europium complex

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A ternary europium complex of 4-aminobutyric acid (ABA) with 1,10-phenanthroline (phen) [Eu2(ABA)4 (phen)4](phen)4(ClO4)6 was synthesized and characterized by X-ray single crystal diffraction. The result shows that 4-aminobutyric acid exists in zwitterion form in the binuclear complex and that the carboxylates coordinate with Eu3+ ion in bidentate bridging and tridentate chelating-bridging modes. There are two types of phen molecules, one is coordinated and the other is uncoordinated. When excited by YAG: Nd laser with 355 nm light, the title complex can emit strong red fluorescence, and its high-resolution emission spectrum was recorded at 77 K. The Eu3+ ion site is in low symmetry, which is in agreement with the result of X-ray single crystal diffraction analysis. When irradiated with a mercury lamp, the aqueous solution of the title complex can perform photochromism with the color change from colorless to green and the green color can fade away in the dark. The photochromic response time is related to the concentration and pH of the solution, the temperature and the light intensity.

  10. First-Principles Investigations on Europium Monoxide

    KAUST Repository

    Wang, Hao

    2011-05-01

    Europium monoxide is both an insulator and a Heisenberg ferromagnet (Tc=69 K). In the present thesis, the author has investigated the electronic structure of different types of EuO by density functional theory. The on-site Coulomb interaction of the localized Eu 4f and 5d electrons, which is wrongly treated in the standard generalized gradient approximation method, is found to be crucial to obtain the correct insulating ground state as observed in experiments. Our results show that the ferromagnetism is stable under pressure, both hydrostatic and uniaxial. For both types of pressure an insulator-metal transition is demonstrated. Moreover, the experimentally observed insulator-metal transition in oxygen deficient and gadolinium-doped EuO is reproduced in our calculations for impurity concentrations of 6.25% and 25%. Furthermore, a 10- layer EuO thin film is theoretically predicted to be an insulator with a narrow band gap of around 0.08 eV, while the Si/EuO interface shows metallic properties with the Si and O 2p as well as Eu 5d bands crossing the Fermi level.

  11. Investigations of white light emitting europium doped zinc oxide nanoparticles

    International Nuclear Information System (INIS)

    Ashtaputre, S S; Nojima, A; Marathe, S K; Matsumura, D; Ohta, T; Tiwari, R; Dey, G K; Kulkarni, S K

    2008-01-01

    Europium doped zinc oxide nanoparticles have been synthesized using a chemical route. The amount of doped europium was varied which shows the changes in the photoluminescence (PL) intensity. The post synthesis annealing effect on the properties of ZnO nanoparticles has also been investigated. In general, PL is broad and a white light is emitted which originates from ZnO and the intra-4f transitions of Eu 3+ ions. The x-ray diffraction patterns do not show any Eu-related peaks for as-synthesized ZnO nanoparticles as well as for annealed samples. X-ray absorption spectroscopy reveals that europium ions are present on the surface of the core of ZnO and inside the shell of zinc hydroxide [Zn(OH 2 )] after annealing

  12. Excess europium content in Precambrian sedimentary rocks and continental evolution

    Science.gov (United States)

    Jakes, P.; Taylor, S. R.

    1974-01-01

    It is proposed that the europium excess in Precambrian sedimentary rocks, relative to those of younger age, is derived from volcanic rocks of ancient island arcs, which were the source materials for the sediments. Precambrian sedimentary rocks and present-day volcanic rocks of island arcs have similar REE patterns, total REE abundances, and excess Eu, relative to the North American shale composite. The present upper crustal REE pattern, as exemplified by that of sediments, is depleted in Eu, relative to chondrites. This depletion is considered to be a consequence of development of a granodioritic upper crust by partial melting in the lower crust, which selectively retains europium.

  13. 13 CFR 134.402 - Appeal petition.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Appeal petition. 134.402 Section 134.402 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.402 Appeal petition. In addition to the requirements of § 134.203, an appeal petition must state...

  14. Enantioselective cellular localisation of europium(iii) coordination complexes.

    Science.gov (United States)

    Frawley, Andrew T; Linford, Holly V; Starck, Matthieu; Pal, Robert; Parker, David

    2018-01-28

    The selective mitochondrial localisation of the Λ enantiomer of three different emissive europium(iii) complexes in NIH 3T3 and MCF7 cells contrasts with the behaviour of the Δ enantiomer, for which a predominant lysosomal localisation was observed by confocal microscopy. In each case, cell uptake occurs via macropinocytosis.

  15. Stability constants of the Europium complexes with the chloride ions

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.; Rojas H, A.

    2000-01-01

    The stability constants of lanthanides complexes with chloride ions which were determined at the same ionic force but in different media, are significantly different. It does not exist a systematic study over these stability constants. The purpose of this work is to determine the stability constants of the europium complexes with chloride ions at 303 K, by the solvents extraction method. (Author)

  16. White OLED with a single-component europium complex.

    Science.gov (United States)

    Law, Ga-Lai; Wong, Ka-Leung; Tam, Hoi-Lam; Cheah, Kok-Wai; Wong, Wing-Tak

    2009-11-16

    A new direction for white organic light-emitting devices is shown, fabricated from a novel europium complex; this single component contains a double emission center of bluish-green and red, combined to a give a pure white emission (CIE x = 0.34 and y = 0.35).

  17. Sorption of europium by Haro river sand in aqueous solution

    International Nuclear Information System (INIS)

    Syed Moosa Hasany; Syed Javaid Khurshid

    1997-01-01

    The sorption of Eu(III) on Haro river sand has been investigated. Influences include composition of the sorptive medium, the concentration of sorbent and sorbate, and shaking time. Haro river sand can be exploited for the preconcentration and removal of europium from very dilute solutions, for the decontamination and treatment of radioactive waste water and effluents from nuclear installations. (Author)

  18. Synthesis and electroluminescence properties of europium (III) complexes with new second ligands

    International Nuclear Information System (INIS)

    Liu Ze; Wen Fushan; Li Wenlian

    2005-01-01

    Two novel second ligands, 9,9-Di-(4-methoxyphenyl)-9-H-4,5-' (OMe-Spiro-DF) and 9,9-Di-(2-(4-(4-butyloxy)phenyl)-5-phenyl-1,3,4-oxadiazolyl)-phenyl-9-H-4, 5-Diazafluorene (OXD-Spiro-DF), were successfully prepared. Europium complexes, Eu(DBM) 3 (OMe-Spiro-DF) and Eu(DBM) 3 (OXD-Spiro-DF) (DBM=dibenzolylmethane) based on the two ligands were designed and synthesized. For a double-layer device with configuration of indium tin oxide (ITO)/N, N'-diphenyl-N,N'-bis(3-methylphenyl)-1,1'-biphenyl-4,4'-diamine (TPD)/Eu(DBM) 3 (OXD-Spiro-DF) or Eu(DBM) 3 (OMe-Spiro-DF)/Mg/Ag, compared with the device based on complex Eu(DBM) 3 (OMe-Spiro-DF), the brightness and electroluminescent (EL) efficiency of device based on complex Eu(DBM) 3 (OXD-Spiro-DF) with oxadiazole-functionalized ligand OXD-Spiro-DF are significantly improved due to the improvement of electron-transporting ability. A maximum brightness of 154 cd/m 2 was obtained at 17 V in the complex Eu(DBM) 3 (OXD-Spiro-DF), about four times brighter than the corresponding complex Eu(DBM) 3 (OMe-Spiro-DF)

  19. SEPARATION OF EUROPIUM FROM OTHER LANTHANIDE RAE EARTHS BY SOLVENT EXTRACTION

    Science.gov (United States)

    Peppard, D.F.; Horwitz, E.P.; Mason, G.W.

    1963-02-12

    This patent deals with a process of separating europium from other lanthanides present in aqueous hydrochloric or sulfuric acid solutions. The europium is selectively reduced to the divalent state with a divalent chromium salt formed in situ from chromium(III) salt plus zinc amalgam. The other trivalent lanthanides are then extracted away from the divalent europium with a nitrogen-flushed phosphoric acid ester or a phosphonic acid ester. (AEC)

  20. Extraction of europium (3) ions with stearic acid

    International Nuclear Information System (INIS)

    Lobanov, F.I.; Gladyshchev, V.P.; Nurtaeva, A.K.; Andreeva, N.N.

    1981-01-01

    Extraction of europium (3) in nitric acid solutions with the melts of stearic acid and its mixtures with paraffin at (80+-1) deg C is studied. The constant of stearic acid dimerization in paraffin K 2 =9.6+-0.6 and the constant of stearic acid distribution in the paraffin-water system Ksub(D,HA)=(1.06+-0.07)x10sub(3) are determined. The diagram of europium ion extraction at initial concentrations of metal in the aqueous phase of 10 -4 -10 -3 mol/l is suggested. The compound extracted has the EuA 3 composition with extraction constant of lg Ksub(ex)=-7.58 [ru

  1. 22 CFR 134.25 - Settlement.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Settlement. 134.25 Section 134.25 Foreign... Considering Applications § 134.25 Settlement. The applicant and the Department of State may agree on a proposed settlement of the award before final action on the application, either in connection with a...

  2. 13 CFR 134.217 - Settlement.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.217 Settlement. At any... have settled the case, and may file with such motion a copy of the settlement agreement. If the Judge...

  3. 13 CFR 134.203 - The petition.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false The petition. 134.203 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.203 The petition. (a) A petition must contain the following: (1) The basis of OHA's jurisdiction; (2) A copy of the SBA...

  4. 19 CFR 134.53 - Examination packages.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 134.53 Section 134.53... TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.53 Examination packages. (a) Site of marking—(1) Customs custody. Articles (or containers) in examination packages may be marked by...

  5. 6 CFR 13.4 - Investigation.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Investigation. 13.4 Section 13.4 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.4 Investigation. (a) If an Investigating Official concludes that a subpoena pursuant to the Authority conferred by...

  6. 24 CFR 13.4 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reports. 13.4 Section 13.4 Housing... PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 13.4 Reports. HUD shall compile and submit... report on its experience in implementing S. 1195 Official Mail Use in the Location and Recovery of...

  7. 13 CFR 134.213 - Discovery.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.213 Section 134.213... OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.213 Discovery. (a) Motion. A party may obtain discovery only upon motion, and for good cause shown. (b) Forms. The forms of discovery...

  8. 13 CFR 134.310 - Discovery.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.310 Section 134.310 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE... Designations § 134.310 Discovery. Discovery will not be permitted in appeals from size determinations or NAICS...

  9. Bioenvironmental aspects of europium and rhodium: a selected bibliography

    International Nuclear Information System (INIS)

    Fore, C.S.; Carrier, R.F.; Talmage, S.S.; Fielden, J.M.; Daniel, E.W.

    1983-09-01

    This bibliography of 428 abstracted references represents a summary of the domestic and foreign literature relevant to the biological and environmental aspects of europium and rhodium. The collected data are organized by current NAEG interests - research highlighting inventory and distribution of the radionulcides, ecological studies covering terrestrial and aquatic systems, and biological studies in both man and animals. Studies that focus directly on research conducted at specific sites (e.g., the Nevada Test Site) are emphasized throughout the bibliography

  10. Synthesis and luminescence properties for europium oxide nanotubes

    International Nuclear Information System (INIS)

    Mo Zunli; Deng Zhepeng; Guo Ruibin; Fu Qiangang; Feng Chao; Liu Pengwei; Sun Yu

    2012-01-01

    Highlights: ► A novel high temperature sensitive fluorescent CNTs/Eu 2 O 3 nanocomposite was fabricated. ► The nanocomposite showed strong fluorescent emission peaks at around 540 and 580 nm after calcined beyond 620 °C for 4 h. ► The ultrahigh fluorescence intensity of the nanocomposites resulted from a synergetic effect of CNTs and europium oxide. ► We also discovered that CNTs had an effect of fluorescence quenching. - Abstract: A novel high temperature sensitive fluorescent nanocomposite has been successfully synthesized by an economic hydrothermal method using carbon nanotubes (CNTs), europium oxide, and sodium dodecyl benzene sulfonate (SDBS). To our great interest, the nanocomposites show high temperature sensitivity after calcinations at various temperatures, suggesting a synergetic effect of CNTs and europium oxide which leads to ultrahigh fluorescence intensity of europium oxide nanotubes. When the novel high temperature sensitive fluorescent nanocomposites were calcined beyond 620 °C for 4 h, the obtained nanocomposites have a strong emission peak at around 540 and 580 nm, due to the 5 D 0 → 7 F j (j = 0, 1) forced electric dipole transition of Eu 3+ ions. In turn, the emission spectra showed a slight blue shift. The intensity of this photoluminescence (PL) band is remarkably temperature-dependent and promotes strongly beyond 620 °C. This novel feature is attributed to the thermally activated carrier transfer process from nanocrystals and charged intrinsic defects states to Eu 3+ energy levels. The novel high temperature sensitive fluorescent nanocomposite has potential applications in high temperature warning materials, sensors and field emission displays. It is also interesting to discover that CNTs have the effect of fluorescence quenching.

  11. Luminescent micro- and nanofibers based on novel europium phthalate complex

    Energy Technology Data Exchange (ETDEWEB)

    Enculescu, M., E-mail: mdatcu@infim.ro [National Institute of Materials Physics, Multifunctional Materials and Structures, PO Box MG-7, 77125 Magurele-Bucharest (Romania); Preda, N.; Matei, E.; Enculescu, I. [National Institute of Materials Physics, Multifunctional Materials and Structures, PO Box MG-7, 77125 Magurele-Bucharest (Romania)

    2012-09-14

    We synthesized by wet chemical route a novel europium-potassium phthalate complex Eu{sup 3+}K{sup +}[(COO){sub 2}(C{sub 6}H{sub 4})]{sub 2}. The compound is a white powder insoluble in water. X-ray diffraction evaluation shows that we obtained a new crystalline compound with no traces of the starting materials (potassium hydrogen phthalate and europium chloride). Scanning electron microscopy reveals that the powder consists of fiber-shaped structures with sizes larger than 250 nm in diameter. Energy dispersive X-ray analysis proves that the compound has a 1:1 europium-potassium ratio. Fourier transform infrared spectroscopy confirms the presence of the phthalate in the new compound. Photoluminescence and cathodoluminescence measurements show that the fiber-shaped structures are intensely luminescent with emission bands corresponding to the {sup 5}D{sub 0} {yields} {sup 7}F{sub J} (J = 1-4) Eu (III) ion's transitions in the region between 580 nm and 700 nm, the most intense maximum being observed around 615 nm. Up-converted luminescence with a maximum at 315 nm was recorded. -- Highlights: Black-Right-Pointing-Pointer A new europium-potassium phthalate complex was synthesized by wet chemical route. Black-Right-Pointing-Pointer Fiber-shaped crystalline structures with sizes larger than 250 nm. Black-Right-Pointing-Pointer The most probable structure of the molecule is [C{sub 6}H{sub 4}(COO{sup -}){sub 2}]{sub 2} K{sup +}Eu{sup 3+}. Black-Right-Pointing-Pointer Intense luminescence due to Eu{sup 3+} ions {sup 5}D{sub 0} {yields} {sup 7}F{sub J} transitions. Black-Right-Pointing-Pointer Up-converted luminescence with a maximum at 315 nm was recorded.

  12. Optical and magnetization studies on europium based iron pnictides

    Energy Technology Data Exchange (ETDEWEB)

    Zapf, Sina Maria Ute

    2015-07-01

    The investigations carried out in the framework of this thesis mainly concentrate on europium based iron pnictides. These are a peculiar member of the 122 family as they develop at low temperatures (∝20K) an additional magnetic order of the local rare earth moments. Therefore, europium based iron pnictides provide a unique platform to study the interplay of structural, magnetic and electronic effects in high-temperature superconductors. For this challenging purpose, we have employed SQUID magnetometry and Fourier-transform infrared spectroscopy on EuFe{sub 2}(As{sub 1-x}P{sub x}){sub 2} single crystals. By systematic studies of the in- and out-of-plane magnetic properties of a series of single crystals, we derived the complex magnetic phase diagram of europium based iron pnictides, which contains an A-type antiferromagnetic and a re-entrant spin glass phase. Furthermore, we have investigated the magneto-optical properties of EuFe{sub 2}As{sub 2}, revealing a much more complex magnetic detwinning process than expected. These studies demonstrate a remarkable interdependence between magnetic, electronic and structural effects that might be very important to understand the unconventional superconductivity in these fascinating materials.

  13. Optical and magnetization studies on europium based iron pnictides

    International Nuclear Information System (INIS)

    Zapf, Sina Maria Ute

    2015-01-01

    The investigations carried out in the framework of this thesis mainly concentrate on europium based iron pnictides. These are a peculiar member of the 122 family as they develop at low temperatures (∝20K) an additional magnetic order of the local rare earth moments. Therefore, europium based iron pnictides provide a unique platform to study the interplay of structural, magnetic and electronic effects in high-temperature superconductors. For this challenging purpose, we have employed SQUID magnetometry and Fourier-transform infrared spectroscopy on EuFe 2 (As 1-x P x ) 2 single crystals. By systematic studies of the in- and out-of-plane magnetic properties of a series of single crystals, we derived the complex magnetic phase diagram of europium based iron pnictides, which contains an A-type antiferromagnetic and a re-entrant spin glass phase. Furthermore, we have investigated the magneto-optical properties of EuFe 2 As 2 , revealing a much more complex magnetic detwinning process than expected. These studies demonstrate a remarkable interdependence between magnetic, electronic and structural effects that might be very important to understand the unconventional superconductivity in these fascinating materials.

  14. Synthesis of xerogels with Europium impurities for dosimetric applications

    International Nuclear Information System (INIS)

    Rivera R, C.; Garcia R, F.J.; Yanez L, M. -

    2007-01-01

    The objective of this work is the obtaining xerogels in bundle of SiO 2 with europium impurities to low concentrations, with the objective of exploring their mechanical, optical and emission properties. The obtained xerogels was synthesized by means of the sol-gel technique, using water, TEOS and ethanol to a molar relationship 16:1:4 respectively, the europium was added by oxide via to the precursor solution and to catalyze the hydrolysis condensation reaction, its were added: nitric acid and hydrofluorhydric acid. Later on these mixtures were left to gel by 72 hours and under this same composition, but with different quantities of impurifying material (0.0, 0.01 and 0.05g of europium oxide), the materials were dried in a ramp of controlled temperature, from ambient temperature up to 120 C, some of these thermally tried materials were calcined at 500 and 800 C, being obtained in this way xerogels free of fractures, stable, porous and semi-transparent. The characterization of these materials includes: pH measurements and solutions viscosity during the gelation stage, as well as characterization of their optic properties by means of infrared spectroscopy, UV-vis and emission spectroscopy. The microhardness results show that these materials present smaller values to those corresponding of the corning glass, as well as a growing behavior with regard to the calcination temperatures of the material. (Author)

  15. Characterisation of kaolinite and adsorption of europium on kaolinite

    International Nuclear Information System (INIS)

    Olin, M.; Puhakka, E.; Lehikoinen, J.; Puukko, E.; Hakanen, M.; Lindberg, A.

    2007-10-01

    Kaolinite is a common fracture mineral in many crystalline rocks and, thus, a potential sorbent for groundwater solutes. The low cation-exchange capacity makes kaolinite a good mineral to study sorption by inner-sphere complexation of multivalent ions, such as trivalent actinides or their analogues, the trivalent lanthanides. The sorption of europium and americium on kaolinite has been studied previously by Puukko and Hakanen using a natural kaolinite, KGa-1b (from the Clay Minerals Society, USA). This work describes the determination of surface-charging mechanism and surface acidity constants for KGa-1b kaolinite, and adsorption of Eu(III) on both the natural (KGa-1b) and its acid-conditioned form (HKGa). The ionic strength of the background NaNO 3 electrolyte used in these titrations was 0.05 M, 0.1 M and 0.5 M. The surface acidity of kaolinite was explained using the FITEQL software by applying the 1-pK model. The optimized concentration of surface sites was close to a value previously reported for KGa-1b kaolinite. The adsorption modelling of europium was carried out by adopting one surfacecomplexation and one cation-exchange reaction. In the acidic pH range, sorption of europium decreased with increasing ionic strength of the NaNO 3 solution, which is an indication of the dominance of cation exchange or outer-sphere complexation. At the lowest ionic strength, the sorption was reversible. In the 0.1 M and 0.5 M NaNO 3 solutions, the sorption of europium in the basic pH range was only partly reversible, or desorption kinetically slow. The degree of irreversibility increased with increasing pH and ionic strength. A diffuse-layer model was readily fitted on the per-cents sorbed scale (default in FITEQL), but the results were not as good on a Kd scale, especially at circumneutral pH values. In the water analysis of the batch titration of KGa-1b kaolinite, the main observed elements were aluminium and zinc. The concentrations of Al and Zn decreased with p

  16. Enhancement in red emission at room temperature from europium doped ZnO nanowires by 1,10 phenanthroline-europium interface induced resonant excitations

    Directory of Open Access Journals (Sweden)

    Soumen Dhara

    2017-02-01

    Full Text Available We show that europium doped ZnO nanowires after surface modification with organic ligand, 1,10 phenanthroline (phen leads to strong red emission at 613 nm which is a characteristic emission from the atomic levels of Eu3+. Surface modification with phen leads to formation of phenanthroline-europium interface on the surface of the nanowires due to attachment of Eu3+ ions. After an optimized surface modification with phen, intensity of both the UV emission (band edge and red emission improved by two orders of magnitude at room temperature. We observed multiple energy transfer pathways to the energy levels of Eu3+ ions through the phenanthroline-europium interface, which found to be very effective to the significant enhancement of emission from the dopant Eu3+. This study shows a new insight in to the energy transfer process from phen to the europium doped ZnO system.

  17. Synthesis and characterization of highly triboluminescent doped europium tetrakis compounds

    International Nuclear Information System (INIS)

    Fontenot, Ross S.; Hollerman, William A.; Bhat, Kamala N.; Aggarwal, Mohan D.

    2012-01-01

    One of the most intriguing properties involving crystals is their ability to emit light when fractured. While this property was discovered over 200 years ago, no one has ever been able to come up with a complete theory that can predict the physical principles associated with triboluminescence. However, this has not stopped scientists from coming up with various uses for these materials. One such application is to use these materials as the active element for smart impact sensors that can warn of catastrophic impacts. If these sensors are to become a reality however, the material must emit a bright light when fractured. One of the brightest triboluminescent materials found thus far is europium dibenzoylmethide triethylammonium (EuD 4 TEA). This material was discovered by Hurt in 1966 and is bright enough to be seen in daylight. In 2011, the authors discovered that synthesizing EuD 4 TEA using europium nitrate instead of chloride significantly increased the triboluminescence yield and made the synthesis much easier and more consistent. However, to date, there are few investigations into the effects of dopants on the triboluminescence of EuD 4 TEA. This paper reports the investigation of the effects of various dopants on: (1) The triboluminescent light yield, (2) Crystal size and structure, (3) Synthesis time, and (4) Prompt decay time. Results show that inclusion of dopants during synthesis increases the triboluminescence emission of EuD 4 TEA by 55%, significantly reduces the synthesis time, and controls the decay time. All of these properties can be useful for constructing the first prototype of a customized impact sensor. - Highlights: ► Doped europium dibenzoylmethide triethylammonium (EuD 4 TEA) was synthesized. ► Effects of dopants was studied from EuD 4 TEA during low velocity (<10 m/s) impacts. ► The triboluminescent light yield, decay time, and synthesis time were measured. ► A specially-built drop tower was developed to measure triboluminescence

  18. Mass spectrometric investigation of fluorated europium. beta. -diketonates. [Electrons

    Energy Technology Data Exchange (ETDEWEB)

    Khomenko, V.S.; Lozinskij, M.O.; Fialkov, Yu.A.; Rasshinina, T.A.; Suboch, V.P. (AN Belorusskoj SSR, Minsk. Inst. Fiziki; AN Ukrainskoj SSR, Kiev. Inst. Organicheskoj Khimii)

    Ternary complexes of europium with two organic ligands - fluorated ..beta..-diketone and organic base - in the aqueous phase at electron shock are investigated; regroupings that take place in them are established. Mass-spectrometric investigation has shown that complexes with ..beta..-diketones, containing in oxygen atom in a fluorated radical, eliminate stable molecules of difluorophosgen, CoF/sub 2/. For the complexes studied under the above conditions the Co molecule elimination is also typical which is accompanied by the formation of ions with a metal-carbon bond.

  19. Mass spectrometric investigation of fluorated europium β-diketonates

    International Nuclear Information System (INIS)

    Khomenko, V.S.; Lozinskij, M.O.; Fialkov, Yu.A.; Rasshinina, T.A.; Suboch, V.P.; AN Ukrainskoj SSR, Kiev. Inst. Organicheskoj Khimii)

    1983-01-01

    Ternary complexes of europium with two organic lidands - fluorated β-diketone and organic base - in the aqueous phase at electron shock are investigated; regroupings that take place in them are established. Mass-spectrometric investigation has shown that complexes with β-diketones, containing in oxygen atom in a fluorated radical, eliminate stable molecules of difluorophosgen, CoF 2 . For the complexes studied under the above conditions the Co molecule elimination is also typical which is accompanied by the formation of ions with a metal-carbon bond

  20. Test of zircon materials for sorption of europium

    International Nuclear Information System (INIS)

    Ordonez R, E.; Fernandez V, S.M.; Garcia R, G.

    2003-01-01

    In previous works it has already been made notice that some phosphates have the property of sipping radioactive metals in solution, what takes advantage to fabricate reactive barriers that are placed in the repositories of nuclear wastes. In our laboratory it has been obtained to the zirconium silicate (ZrSiO 4 ) and the alpha zirconium hydrogen phosphate (Zr(HPO 4 ) 2H 2 0) starting from sea sand in an easy and economic way. With the interest of knowing if these compounds can be used in contention barriers the evaluation of their surface properties it is made and of europium sorption. (Author)

  1. 29 CFR 1915.134 - Abrasive wheels.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Abrasive wheels. 1915.134 Section 1915.134 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... wheels shall fit freely on the spindle and shall not be forced on. The spindle nut shall be tightened...

  2. In vivo toxicity studies of europium hydroxide nanorods in mice

    International Nuclear Information System (INIS)

    Patra, Chitta Ranjan; Abdel Moneim, Soha S.; Wang, Enfeng; Dutta, Shamit; Patra, Sujata; Eshed, Michal; Mukherjee, Priyabrata; Gedanken, Aharon; Shah, Vijay H.; Mukhopadhyay, Debabrata

    2009-01-01

    Lanthanide nanoparticles and nanorods have been widely used for diagnostic and therapeutic applications in biomedical nanotechnology due to their fluorescence and pro-angiogenic properties to endothelial cells, respectively. Recently, we have demonstrated that europium (III) hydroxide [Eu III (OH) 3 ] nanorods, synthesized by the microwave technique and characterized by several physico-chemical techniques, can be used as pro-angiogenic agents which introduce future therapeutic treatment strategies for severe ischemic heart/limb disease, and peripheral ischemic disease. The toxicity of these inorganic nanorods to endothelial cells was supported by several in vitro assays. To determine the in vivo toxicity, these nanorods were administered to mice through intraperitoneal injection (IP) everyday over a period of seven days in a dose dependent (1.25 to 125 mg kg -1 day -1 ) and time dependent manner (8-60 days). Bio-distribution of europium elements in different organs was analyzed by inductively coupled plasma mass spectrometry (ICPMS). Short-term (S-T) and long-term (L-T) toxicity studies (mice euthanized on days 8 and 60 for S-T and L-T, respectively) show normal blood hematology and serum clinical chemistry with the exception of a slight elevation of liver enzymes. Histological examination of nanorod-treated vital organs (liver, kidney, spleen and lungs) showed no or only mild histological changes that indicate mild toxicity at the higher dose of nanorods.

  3. Temperature dependences in electron-stimulated desorption of neutral europium

    CERN Document Server

    Ageev, V N; Madey, T E

    2003-01-01

    The electron-stimulated desorption (ESD) yield for neutral europium (Eu) atoms from Eu layers adsorbed on oxygen-covered tungsten surfaces has been measured as a function of electron energy, europium coverage and degree of oxidation of tungsten, with an emphasis on effects of substrate temperature. The measurements have been carried out using a time-of-flight method and surface ionization detector. We expand on an earlier report, and compare ESD of multivalent Eu with ESD of monovalent alkali atoms, studied previously. The Eu atom ESD is a complicated function of Eu coverage, electron energy and substrate temperature. In the coverage range 0.05-0.35 monolayer (ML), overlapping resonant-like Eu atom yield peaks are observed at electron energies E sub e of 36 and 41 eV that might be associated with Eu or W shallow core level excitations. Additional resonant-like peaks are seen at E sub e of 54 and 84 eV that are associated with W 5p and 5s level excitations. The Eu atom yield peaks at 36 and 41 eV are seen only...

  4. Trivalent europium speciation in a room-temperature ionic liquid

    International Nuclear Information System (INIS)

    Mekki, S.

    2006-10-01

    Since the nuclear industry is playing an important role in the power production field, a relevant number of problems have been revealed. Indeed, high-level radioactive long-lived nuclear wastes present a real difficulty for nuclear wastes management. Minor actinides, which compose most of these wastes, will be radioactive for several thousands of years. For eventual disposal deep underground, their reprocessing needs to be optimized. The extraction processes used industrially to separate actinides and lanthanides from other metal species characterizing the spent nuclear fuel produce, nevertheless, enormous quantities of contaminated liquid wastes directly issued from the liquid/liquid extraction step. During the last decade, some room-temperature ionic liquid have been studied and integrated into industrial processes. The interest on this class of solvent came out from their 'green' properties (non volatile, non flammable, recyclable, etc...), but also from the variability of their physico-chemical properties (stability, hydrophobicity, viscosity) as a function of the RTIL chemical composition. Indeed, it has been shown that classical chemical industrial processes could be transferred into those media, even more improved, while a certain number of difficulties arising from using traditional solvent can be avoided. In this respect, it could be promising to investigate the ability to use room-temperature ionic liquid into the spent nuclear fuel reprocessing field. The aim of this thesis is to test the ability of the specific ionic liquid bumimTf 2 N to allow trivalent europium extraction. The choice of this metal is based on the chemical analogy with trivalent minor actinides Curium and Americium which are contributing the greatest part of the long-lived high-level radioactive wastes. Handling these elements needs to be very cautious for the safety and radioprotection aspect. Moreover, europium is a very sensitive luminescent probe to its environment even at the

  5. Soluble dendrimers europium(III) β-diketonate complex for organic memory devices

    International Nuclear Information System (INIS)

    Wang Binbin; Fang Junfeng; Li Bin; You Han; Ma Dongge; Hong Ziruo; Li Wenlian; Su Zhongmin

    2008-01-01

    We report the synthesis of a soluble dendrimers europium(III) complex, tris(dibenzoylmethanato)(1,3,5-tris[2-(2'-pyridyl) benzimidazoly]methylbenzene)-europium(III), and its application in organic electrical bistable memory device. Excellent stability that ensured more than 10 6 write-read-erase-reread cycles has been performed in ambient conditions without current-induced degradation. High-density, low-cost memory, good film-firming property, fascinating thermal and morphological stability allow the application of the dendrimers europium(III) complex as an active medium in non-volatile memory devices

  6. Sorption of europium (3) by polymer sorbents with grafted heterocyclic nitrogen-containing groupings

    International Nuclear Information System (INIS)

    Bel'tyukova, S.V.; Kravchenko, T.B.; Balamtsarashvili, G.M.; Roska, A.S.

    1990-01-01

    On polymer sorbents (copolymer of styrene-divinylbenzene) with grafted heterocyclic nitrogen-containing functional groupings of tetrazole, triazole and imidazole (sorbents 1,2,3, respectively). It is stated that europium sorption takes place from neutral solutions in presence of organic solvents. Luminescent properties of europium on sorbent are used to develope methods of its determination in high purity lanthanide and yttrium oxides. Europium determination limits consist 7.5·10 -5 μg/ml on 1 and 3 sorbents and 1.5·10 -4 μg/ml on sorbent 2, S p value is 0.089 and 0.075, respectivaly

  7. Luminescent properties of europium different-ligand complexes with cyclic. beta. -diketones and diantipyrylalkanes

    Energy Technology Data Exchange (ETDEWEB)

    Ul' yanova, T M; Gerasimenko, G N; Tishchenko, M A; Vitkun, R A [AN Ukrainskoj SSR, Odessa. Fiziko-Khimicheskij Inst.

    1983-03-01

    Using luminescence method different-ligand complexing of europium ions with diantipyrylalkanes and cyclic ..beta..-diketones: 2-acetyl- and 2-benzoyl-1.3-indandions, has been studied. The optimum conditions of the formation of different-ligand complexes and the ratio of components in it are determined. Effect of alien lanthanides and diantipyrylmethane derivatives on the luminescence intensity of europium complexes is clarified. A correlation between the ratio of the luminescence intensity bands of europium complexes and the values of oscillator strengths of supersensitive transitions of neodymium and erbium absorption bands is established.

  8. Sorption of small amounts of europium(III) on iron(III) hydroxide and oxide

    International Nuclear Information System (INIS)

    Music, S.; Gessner, M.; Wolf, R.H.H.

    1979-01-01

    The sorption of small amounts of europium(III) on iron(III) hydroxide and oxide has been studied as a function of pH. The mechanism of sorption is discussed. Optimum conditions have been found for the preconcentration of small or trace amounts of europium(III) by iron(III) hydroxide and oxide. The influence of complexing agents (EDTA, oxalate, tartrate and 5-sulfosalicylic acid) on the sorption of small amounts of europium(III) on iron(III) oxide has also been studied. (author)

  9. Development of ultraviolet LED devices containing europium (III) complexes in fluorescence layer

    International Nuclear Information System (INIS)

    Iwanaga, Hiroki; Amano, Akio; Aiga, Fumihiko; Harada, Kohichi; Oguchi, Masayuki

    2006-01-01

    Relations between molecular structures of europium complexes and their luminescent properties were investigated. Europium complex with β-diketones and two different phosphine oxides 8 was highly soluble in fluorinated medium, and realized largest fluorescence intensities. The luminous intensity of ultraviolet light emitting diodes devices (LEDs) whose fluorescence layer consists of fluorinated polymer and 8 was over 200 mcd (20 mA). Fluorescence compounds of this type are promising for application in next-generation white LEDs. Moreover, we proposed a novel molecular design of europium complex with asymmetric diphosphine dioxide

  10. Synthesis and spectroscopic behavior of highly luminescent trinuclear europium complexes with tris-β-diketone ligand

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Dunjia, E-mail: dunjiawang@163.com; Pi, Yan; Liu, Hua; Wei, Xianhong; Hu, Yanjun; Zheng, Jing

    2014-11-15

    Highlights: • Synthesis of the tris-β-diketone ligand and its trinuclear europium complexes. • Photoluminescence behavior of trinuclear europium complexes. • Analysis of the Judd–Ofelt intensity parameters (Ω{sub t}), lifetime (τ) and quantum yield (η). - Abstract: A new tris-β-diketone ligand, 2-[4,6-bis-(1-benzoyl-2-oxo-2-phenyl-ethyl)-[1,3,5]triazin-2-yl] -1,3-diphenyl-propane-1,3-dione (H{sub 3}L), and its trinuclear europium complexes, Eu{sub 3}(DBM){sub 6}L (C1), Eu{sub 3}(DBM){sub 6}(Bipy){sub 3}L (C2) and Eu{sub 3}(DBM){sub 6}(Phen){sub 3}L (C3) were synthesized and their spectroscopic behaviors were studied by FT-IR, {sup 1}H NMR, UV–vis and photoluminescence spectroscopic techniques. These europium complexes exhibited the characteristic emission bands that arise from the {sup 5}D{sub 0} → {sup 7}F{sub J} (J = 0–4) transitions of the europium ion in solid state. The Ω{sub 2} and Ω{sub 4} intensity parameters, lifetime (τ) and luminescence quantum yield (η) were calculated according to the emission spectra and luminescence decay curves in solid state. The results indicated that these trinuclear europium complexes displayed a longer lifetime (τ) and higher luminescence quantum efficiency (η), especially complexes C2 (τ = 0.820 ms, η = 46.5%) and C3 (τ = 0.804 ms, η = 47.4%), which due to the effect of two additional europium ion lumophors and the introduction of the third ligands, Bipy or Phen in trinuclear complexes. Their Ω{sub 2} values demonstrated that the europium ion in these complexes is in a highly polarizable chemical environment.

  11. Luminescent amine sensor based on europium(III) chelate.

    Science.gov (United States)

    Petrochenkova, Nataliya V; Mirochnik, Anatolii G; Emelina, Tatyana B; Sergeev, Alexander A; Leonov, Andrei A; Voznesenskii, Sergey S

    2018-07-05

    The effect of methylamine vapor on luminescence of Eu(III) tris-benzoylacetonate (I) immobilized in thin-layer chromatography plates has been investigated. It has been revealed that interaction of I with analyte vapor results in increase of the intensity of Eu(III) luminescence. The mechanism of the effect of methylamine vapors on intensification of the Eu(III) luminescence has been suggested using the data of IR spectroscopy and quantum chemistry calculations. The mechanism of luminescence sensitization consists in bonding of an analyte molecule with a water molecule into the coordination sphere of Eu(III). As a result, the bond of a water molecule with the luminescence centre weakens, rigid structural fragment including europium ion, water and methylamine molecules forms. The presence of such fragment must naturally promote decrease of influence of OH-vibrations on luminescence of the complex I. Copyright © 2018 Elsevier B.V. All rights reserved.

  12. Preparation of 1 Ci of europium 155 without carrier

    International Nuclear Information System (INIS)

    Falconi, N.; Radicella, R.

    1968-01-01

    High activity 'point' sources of 155 Eu are used for medical and industrial applications. For this purpose we have studied a method of obtaining I Ci of carrier free 155 Eu, with a solid residue smaller than 5 mg per Ci. In order to separate the 155 Eu from several grams of a 154 Sm enriched target we propose a procedure which is based on the work of Bouissieres and David, Onstott, and Takekoshi et al. The separation is carried out by electrolysis on a mercury cathode followed by purification on ion exchange resin. The yields of the europium separation and target recovery are 80 per cent and 90 per cent respectively. The time required for the procedure is three days. (authors) [fr

  13. Ferromagnetic semiconductor-metal transition in heterostructures of europium monoxide

    Energy Technology Data Exchange (ETDEWEB)

    Stollenwerk, Tobias; Kroha, Johann [Physikalisches Institut der Universitaet Bonn (Germany)

    2012-07-01

    Experiments on thin films of electron doped europium monoxide show a simultaneous ferromagnetic semiconductor-metal transition which goes along with a huge drop in resistivity over several orders of magnitude. Therefore, this material is a very promising candidate for spintronics applications. We have developed a theory which correctly predicts the simultaneous phase transition in thin films of electron doped EuO and the increase of the Curie temperature T{sub C} with doping concentration. The origin of the increased T{sub C} lies in the enhanced RKKY interaction between the localized 4f moments of the Eu atoms. Therefore, the phase transition is controlled by the population of the conduction band. We investigate the influence of film thickness and interface effects on the population of the conduction band and on the magnetic and electronic properties of the EuO film.

  14. Magnetic and structural properties of yellow europium oxide compound and Eu(OH)3

    International Nuclear Information System (INIS)

    Lee, Dongwook; Seo, Jiwon; Valladares, Luis de los Santos; Avalos Quispe, O.; Barnes, Crispin H.W.

    2015-01-01

    A new material based on a yellow europium oxide compound was prepared from europium oxide in a high vacuum environment. The structural and magnetic properties of the material were investigated. Owing to the absence of a crystal structure, the material exhibited a disordered magnetic behavior. In a reaction with deionized (DI) water without applied heat, the compound assumed a white color as soon as the DI water reached the powder, and the structure became polycrystalline Eu(OH) 3 . The magnetic properties, such as the thermal hysteresis, disappeared after the reaction with DI water, and the magnetic susceptibility of the yellow oxide compound weakened. The magnetic properties of Eu(OH) 3 were also examined. Although Eu 3+ is present in Eu(OH) 3 , a high magnetic moment due to the crystal field effect was observed. - Graphical abstract: (top left) Optical image of the yellow europium oxide compound. (top right) Optical image of the product of DI water and yellow europium oxide. (bottom) Magnetization curves as a function of temperature measured in various magnetic field. - Highlights: • We prepared a new material based on a yellow europium oxide compound from europium oxide. • We characterized the magnetic properties of the material which exhibits a disordered magnetic behavior such as thermal hysteresis. • The compound turned white (Eu(OH) 3 ) as soon as the DI water reached the powder. • The thermal hysteresis disappeared after the reaction with DI water and the magnetic susceptibility of the yellow oxide compound weakened

  15. Purification and measurement of acid leachable europium in sands as an aid in the study of sediment transport

    International Nuclear Information System (INIS)

    Ditchburn, R.G.; McCabe, W.J.

    1982-05-01

    The use of europium labelled sand as an aid in the study of sediment transport has been suggested. A method for the purification of acid leachable europium is described. The final measurement is made by flame emission spectrometry using a nitrous oxide-acetylene flame. The usefulness of the method is limited by the natural levels of europium which, in the sand studied, was around 0.3 ppm

  16. The R-134a energy efficiency problem

    International Nuclear Information System (INIS)

    Behrens, N.; Dekleva, T.W.; Hartley, J.G.; Murphy, F.T.; Powell, R.L.

    1990-01-01

    This paper examines the controversy over the relative energy efficiencies of R-134a and R-12, from a theoretical thermodynamic perspective. In this regard, the authors have used an in-house process flowsheeting program which allows to simulate the complete thermodynamic cycle, and investigate the effects of superheat and subcooling. Special attention is given to the suitable basis for comparing the energy efficiencies of different refrigerants calculated from thermodynamic data. Modelling experiments demonstrate the relative extent to which R-12 and R-134a respond differently to superheat and subcooling. With appropriate superheat and subcooling taken into consideration, such as applied in standard practice in the home appliance industry, R-134a can provide COP values essentially equivalent to that of R-12

  17. Europium-doped calcium titanate: Optical and structural evaluations

    Energy Technology Data Exchange (ETDEWEB)

    Mazzo, Tatiana Martelli; Pinatti, Ivo Mateus [INCTMN, LIEC, Departamento de Química, Universidade Federal de São Carlos, P.O. Box 676, 13565-905 São Carlos, SP (Brazil); Macario, Leilane Roberta [INCTMN, LIEC, Instituto de Química, Universidade Estadual Paulista, P.O. Box 355, 14800-900 Araraquara, SP (Brazil); Avansi, Waldir [Centro de Ciências Exatas e de Tecnologia, Departamento de Física, Universidade Federal de São Carlos, Jardim Guanabara, 13565-905 São Carlos, SP (Brazil); Moreira, Mario Lucio [Instituto de Física e Matemática, Universidade Federal de Pelotas, P.O. Box 354, Campus do Capão do Leão, 96001-970 Pelotas, RS (Brazil); Rosa, Ieda Lucia Viana, E-mail: ilvrosa@ufscar.br [INCTMN, LIEC, Departamento de Química, Universidade Federal de São Carlos, P.O. Box 676, 13565-905 São Carlos, SP (Brazil); Mastelaro, Valmor Roberto [Instituto de Física de São Carlos, Departamento de Física e Ciência dos Materiais, Universidade de São Paulo, P.O. Box 369, Av Trabalhador São Carlense 400, 13560-970 São Carlos, SP (Brazil); Varela, José Arana; Longo, Elson [INCTMN, LIEC, Instituto de Química, Universidade Estadual Paulista, P.O. Box 355, 14800-900 Araraquara, SP (Brazil)

    2014-02-05

    Highlights: • CaTiO{sub 3}:Eu{sup 3+} were obtained using low temperatures and very short reactional times. • The Eu{sup 3+} changes the local order–disorder of the [TiO{sub 6}] and [CaO{sub 12}] clusters. • Lifetime decay curves reveal two sites of symmetry of the Eu{sup 3+} in the CT matrix. • CaTiO{sub 3}:Eu{sup 3+} exhibit the strongest luminescent intensity and pure red color. -- Abstract: Pure Calcium Titanate (CT-pure) and Europium doped Calcium Titanate Ca{sub 1−x}Eu{sub x}TiO{sub 3} (x = 0.5%, 1.0% and 2.0% molar ratio of Eu{sup 3+} ions) powders were synthesized by hydrothermal microwave method (HTMW) at 140 °C for 8 min. The HTMW method appears to be an efficient method to prepare the luminescence materials using low temperatures and very short reactional times. In addition it is possible to determine specific correlations imposed by TiCl{sub 4} replacement by titanium isopropoxide [Ti(OC{sub 3}H{sub 7}){sub 4}] changing the reaction character and resulting in two different options of europium doping CT syntesis. To evaluate the influence of the structural order–disorder among the reactions and different properties of these materials, the following techniques were used for characterization. XANES spectroscopy that revealed that the introduction of Eu{sup 3+} ions into the CT lattice induces to significant changes in the local order–disorder around both, [TiO{sub 6}] and [CaO{sub 12}], complex clusters. PL spectra show Eu{sup 3+} emission lines ascribed to the Eu{sup 3+} transitions from {sup 5}D{sub 0} excited states to {sup 7}F{sub J} (J = 0, 1–4) fundamental states in CT:Eu{sup 3+} powders excited at 350 and 394 nm.

  18. 19 CFR 134.34 - Certain repacked articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain repacked articles. 134.34 Section 134.34... TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.34 Certain repacked articles. (a) Exception for repacked articles. An exception under § 134.32(d) may be authorized in the...

  19. Preparation of 1 Ci of europium 155 without carrier; Une methode de production d'europium 155 sans entraineur au niveau du curie

    Energy Technology Data Exchange (ETDEWEB)

    Falconi, N; Radicella, R [Commissariat a l' Energie Atomique, Dir. des Materiaux et Combustibles Nucleaires, Saclay (France). Centre d' Etudes Nucleaires

    1968-07-01

    High activity 'point' sources of {sup 155}Eu are used for medical and industrial applications. For this purpose we have studied a method of obtaining I Ci of carrier free {sup 155}Eu, with a solid residue smaller than 5 mg per Ci. In order to separate the {sup 155}Eu from several grams of a {sup 154}Sm enriched target we propose a procedure which is based on the work of Bouissieres and David, Onstott, and Takekoshi et al. The separation is carried out by electrolysis on a mercury cathode followed by purification on ion exchange resin. The yields of the europium separation and target recovery are 80 per cent and 90 per cent respectively. The time required for the procedure is three days. (authors) [French] L'obtention de sources ponctuelles de haute activite d'europium-l55 est interessante tant pour des usages medicaux qu'industriels. Nous avons cherche le moyen de preparer en une seule fois, une solution d'un curie d'europium-155 sans entraineur presentant un extrait sec inferieur a 5 mg par curie. En se basant sur des travaux de Bouissieres et Davis, d'Onstott, et de Takekoshi et coll., nous avons mis au point une methode permettant de separer l'europium-155 de sa cible de samarium enrichi en {sup 154}Sm par une electrolyse sur cathode de mercure suivie d'une purification sur resine echangeuse d'ions. Les rendements chimiques de separation de l'europium et de recuperation de la cible de samarium enrichi sont respectivement de 80 pour cent et 90 pour cent. La duree de l'operation est de 3 jours. (auteurs)

  20. Dicty_cDB: CHI134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

  1. Use of europium ions for SAD phasing of lysozyme at the Cu Kα wavelength

    International Nuclear Information System (INIS)

    Vijayakumar, Balakrishnan; Velmurugan, Devadasan

    2012-01-01

    Europium(III) ions bound to the surface of hen egg-white lysozyme were found to exhibit good anomalous signal facilitating SAD phasing using laboratory-source data and automated model building. The europium ion-binding sites were observed up to the 15σ level. Europium is shown to be a good anomalous scatterer in SAD phasing for solving the structure of biological macromolecules. The large value of the anomalous contribution of europium, f′′ = 11.17 e − , at the Cu Kα wavelength is an advantage in de novo phasing and automated model building. Tetragonal crystals of hen egg-white lysozyme (HEWL) incorporating europium(III) chloride (50 mM) were obtained which diffracted to a resolution of 2.3 Å at a wavelength of 1.54 Å (Cu Kα). The master data set (360° frames) was split and analyzed for anomalous signal-to-noise ratio, multiplicity, completeness, SAD phasing and automated building. The structure solution and model building of the split data sets were carried out using phenix.autosol and phenix.autobuild. The contributions of the Eu ions to SAD phasing using in-house data collection are discussed. This study revealed successful lysozyme phasing by SAD using laboratory-source data involving Eu ions, which are mainly coordinated by the side chains of Asn46, Asp52 and Asp101 together with some water molecules

  2. Sulfur, cobalt and europium activation from the A-bombs in Japan

    International Nuclear Information System (INIS)

    Gritzner, M.L.; Egbert, S.D.; Woolson, W.A.

    1987-01-01

    Comparisons are made between calculations and measurements of in-situ sulfur, cobalt, and europium activation by neutrons at Hiroshima and Nagasaki to check the validity of the neutron sources and transport air-over-ground used in the new Dosimetry System 1986 (DS86). Europium and cobalt are activated by epithermal/thermal neutrons. The sulfur activation has an effective threshold around 2 MeV. Comparisons of sulfur activation at Hiroshima, which necessitate considering the tilt and heading of the cylindrically shaped Little Boy bomb, confirm the high energy neutron portion of the source relevant to sulfur activation. The europium and cobalt activation calculations tend to be higher than the measurements for ground ranges within 300 m and lower than the measurements beyond 700 m. Thus, the cobalt and europium measurements do not validate the source or the transport, embodied in DS87, for those neutrons relevant to europium and cobalt activation. Presently, it is unresolved as to whether the discrepancy can be explained as a problem in the measurements, in their interpretation, or as a problem in the calculations due to the source neutrons and/or their transport from source to the sample site

  3. Highly sensitive sorption-luminescence determination of trace europium with preconcentration on silica chemically modified with iminodiacetic acid

    International Nuclear Information System (INIS)

    Voronina, R.D.; Zorov, N.B.

    2007-01-01

    Features of a sorption-luminescence method for the determination of trace europium were studied. The method includes the preliminary sorption of europium at pH 7.1 from solutions with silica chemically modified with iminodiacetic acid, the subsequent treatment of the sorbent with 2-thenoyltrifluoroacetone at pH 8.0, and the measurement of the intensity of luminescence of the surface three-component europium complex at 613 nm. The effect of moisture as the quencher of luminescence of the surface europium complex was studied, and techniques for its removal were proposed. Sorption in the static mode provides the detection limit of europium of 7 x 10 -5 g/ml. The calibration plot is linear in the range of two orders of magnitude of europium concentration in solutions. The relative standard deviation in the determination of 1.5 x 10 -2 μg/ml europium is 5%. In the dynamic mode of sorption from 1000 ml of an analyzed solution with the use of sorption-desorption, the detection limit of europium of 8 x 10 -7 μg/ml was attained [ru

  4. 13 CFR 134.218 - Judges.

    Science.gov (United States)

    2010-01-01

    ... Administrative Law Judge. The AA/OHA will assign all other cases before OHA to either an Administrative Law Judge... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.218 Judges. (a) Assignment. The AA...

  5. 13 CFR 134.405 - Jurisdiction.

    Science.gov (United States)

    2010-01-01

    ... Jurisdiction. (a) The Administrative Law Judge selected to preside over an appeal shall decline to accept... disadvantage, economic disadvantage, ownership or control; (2) The appeal is untimely filed under § 134.202 or... before a court of competent jurisdiction over such matters. (b) Once the Administrative Law Judge accepts...

  6. 42 CFR 410.134 - Provider qualifications.

    Science.gov (United States)

    2010-10-01

    ... after December 22, 2000: (a) Holds a bachelor's or higher degree granted by a regionally accredited college or university in the United States (or an equivalent foreign degree) with completion of the... PROGRAM SUPPLEMENTARY MEDICAL INSURANCE (SMI) BENEFITS Medical Nutrition Therapy § 410.134 Provider...

  7. Synergistic extraction of europium(III) in ammonium ionic liquid

    International Nuclear Information System (INIS)

    Rout, Alok; Venkatesan, K.A.; Antony, M.P.

    2016-01-01

    Room temperature ionic liquids have been receiving increased attention for possible applications in the area of nuclear fuel reprocessing and waste management due to their fascinating properties such as good ionicity, high solvation capability, properties tunable etc. Most of the studies in the literature on the extraction of metal ions with molecular extractants dissolved in ionic liquid diluents are making use of the hydrophobic ionic liquids containing imidazolium cations such as the 1-alkyl-3-methylimidazolium ion. From an environmental point of view, such ionic liquids are not suitable as the primary mode of the metal extraction is by cation exchange mechanism wherein ionic liquid cation is lost to the aqueous phase leading to aqueous contamination and issue of recyclability of organic phase. However, there are some hydrophobic ionic liquids such as trioctylmethylammonium chloride ((N 1888 )(Cl)), and trihexyl(tetradecyl)phoshonium chloride (Cyphos IL 101) that exhibit no cation exchange in the aqueous phase during extraction. In this context, the extraction behavior of europium(III) using a neutral extractant, octyl, phenyl-N.N-diisobutylmethylcarbamoylphophinoxide (CMPO) and/or an acidic extractant bis(ethylhexyl)phosphoric acid (D2EHPA) dissolved in the ammonium ionic liquid diluent, trioctylmethylammonium bis(trifluoromethanesulfonyl)imide, (N 1888 )(NTf 2 ). The extraction behavior of CMPO (or D2EHPA)/(N 1888 )((Tf 2 ) system was investigated as a function of different extraction parameters such as feed acidity, extractant concentration, equilibration time etc.

  8. RBS and RNRA studies on sorption of europium by apatite

    Energy Technology Data Exchange (ETDEWEB)

    Ohnuki, Toshihiko; Kozai, Naofumi; Isobe, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murakami, Takashi; Yamamoto, Shunya; Aoki, Yasushi; Naramoto, Hiroshi

    1997-03-01

    The sorption mechanism of europium, alternative of trivalent TRU has been studied based on the depth profiles of elements obtained by Rutherford Backscattering Spectroscopy (RBS) and Resonant Nuclear Reaction Analysis (RNRA). The positive peak for Eu and the negative peak for Ca were observed in the subtracted RBS spectra of the apatites on which Eu was sorbed from that of the fresh apatite. This indicates that Eu was sorbed on apatite, while a fraction of Ca was released from apatite. The peak height for Eu in the RBS spectrum of the apatite obtained at 75degC was higher than that of the apatite at 40degC. The depth profile of hydrogen of the apatite on which Eu was sorbed was similar to that of the fresh apatite. The concentration of Eu in the solution decreased with increasing temperature. On the contrary, the concentration of Ca increased with increasing temperature. Thus, it is concluded that a fraction of Eu is exchanged for Ca in the structure of apatite. (author)

  9. Europium-Doped Lanthanum Hafnate Nanoparticles: Structure, Photoluminescence, and Radioluminescence

    Science.gov (United States)

    Wahid, Kareem; Pokhrel, Madhab; Mao, Yuanbing

    Due to their novel physical properties, nanostructured phosphors are of interest for radiation-based imaging and therapeutics. Herein, the structural and luminescent properties of europium-doped lanthanum hafnate (La2Hf2O7:xmol%Eu3+, x = 0 - 35) nanoparticles are investigated for use as scintillators. X-ray diffraction, Raman spectroscopy, and scanning electron microscopy confirm samples prepared through a combined co-precipitation and low-temperature molten salt synthetic process homogenously form spherical nanocrystals of 36 nm in the ordered pyrochlore phase. Ultraviolet and X-ray excitation of these samples induce strong red emissions in the 580 - 590 and 612 - 630 nm range corresponding to the 5D0->7 F1 magnetic dipole and 5D0->7 F2 electric dipole transitions of Eu3+. Optical response and quantum yield are optimized at 5% Eu3+; a proposed trade-off between quenching mechanisms (defect-states/cross-relaxation) and dopant concentration is discussed. Owing to their high density, large effective atomic number, and bright luminescence, these La2Hf2O7:xmol%Eu3+ nanoparticles warrant further investigation for scintillator applications. The authors thank the support from the Defense Threat Reduction Agency of the U.S. Department of Defense (award #HDTRA1- 10-1-0114).

  10. Chloride, bromide and iodide scintillators with europium doping

    Science.gov (United States)

    Zhuravleva, Mariya; Yang, Kan

    2014-08-26

    A halide scintillator material is disclosed where the halide may comprise chloride, bromide or iodide. The material is single-crystalline and has a composition of the general formula ABX.sub.3 where A is an alkali, B is an alkali earth and X is a halide which general composition was investigated. In particular, crystals of the formula ACa.sub.1-yEu.sub.yI.sub.3 where A=K, Rb and Cs were formed as well as crystals of the formula CsA.sub.1-yEu.sub.yX.sub.3 (where A=Ca, Sr, Ba, or a combination thereof and X=Cl, Br or I or a combination thereof) with divalent Europium doping where 0.ltoreq.y.ltoreq.1, and more particularly Eu doping has been studied at one to ten mol %. The disclosed scintillator materials are suitable for making scintillation detectors used in applications such as medical imaging and homeland security.

  11. A Preliminary Study of Europium Uptake by Yeast Cells. The Case of Kluveromyces Marxianus

    International Nuclear Information System (INIS)

    Anagnostopoulos, V.; Symeopoulos, B.

    2008-01-01

    The objective of the present work is an exploration of a cost effective recovery of lanthanides, either for minimizing the industrial processes losses, or for reasons related to Radioactive Waste Management. Specifically, the uptake of europium from aqueous solutions by Kluveromyces marxianus cells was studied. Moreover, this biotechnological approach turns out to be environmental friendly, considering that cells of Kluveromyces marxianus are readily available as wastes from food fermentation industries. Europium [ 152 Eu+ 154 Eu]-labelled solutions were used providing better accuracy and reproducibility of measurements, mainly in low concentration range. The effect of pH, contact time and europium initial concentration were investigated. Adsorption data were fitted to Langmuir and Freundlich sorption models and Scatchard plots were used to reveal the existence of at least two types of binding sites

  12. Magnetic and structural properties of yellow europium oxide compound and Eu(OH){sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Dongwook, E-mail: dongwookleedl324@gmail.com [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom); Seo, Jiwon, E-mail: jiwonseo@yonsei.ac.kr [Department of Physics and IPAP, Yonsei University, Seoul 120-749 (Korea, Republic of); Valladares, Luis de los Santos [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom); Avalos Quispe, O. [Laboratorio de Cerámicos y Nanomateriales, Facultad de Ciencias Físicas, Universidad Nacional Mayor de San Marcos, Ap. Postal 14-0149, Lima, Perú (Peru); Barnes, Crispin H.W. [Cavendish Laboratory, University of Cambridge, J. J Thomson Av., Cambridge CB3 0HE (United Kingdom)

    2015-08-15

    A new material based on a yellow europium oxide compound was prepared from europium oxide in a high vacuum environment. The structural and magnetic properties of the material were investigated. Owing to the absence of a crystal structure, the material exhibited a disordered magnetic behavior. In a reaction with deionized (DI) water without applied heat, the compound assumed a white color as soon as the DI water reached the powder, and the structure became polycrystalline Eu(OH){sub 3}. The magnetic properties, such as the thermal hysteresis, disappeared after the reaction with DI water, and the magnetic susceptibility of the yellow oxide compound weakened. The magnetic properties of Eu(OH){sub 3} were also examined. Although Eu{sup 3+} is present in Eu(OH){sub 3}, a high magnetic moment due to the crystal field effect was observed. - Graphical abstract: (top left) Optical image of the yellow europium oxide compound. (top right) Optical image of the product of DI water and yellow europium oxide. (bottom) Magnetization curves as a function of temperature measured in various magnetic field. - Highlights: • We prepared a new material based on a yellow europium oxide compound from europium oxide. • We characterized the magnetic properties of the material which exhibits a disordered magnetic behavior such as thermal hysteresis. • The compound turned white (Eu(OH){sub 3}) as soon as the DI water reached the powder. • The thermal hysteresis disappeared after the reaction with DI water and the magnetic susceptibility of the yellow oxide compound weakened.

  13. Nuclear orientation experiments on the magnetic moments of europium and gadolinium nuclei

    International Nuclear Information System (INIS)

    Berg, F.G. van den.

    1984-01-01

    In this thesis, experimental results on the ground state nuclear magnetic moments of europium and gadolinium isotopes are presented. The nuclear orientation experiments were performed on europium and gadolinium nuclei embedded in several host lattices. Attention is paid to the hyperfine interactions of the ions. Nuclear moments are discussed in the context of nuclear shell model. The theoretical framework is described for nuclear structure and low temperature nuclear orientation. Furthermore, the experimental techniques, the technical arrangement of the orientation apparatus, the methods for radiative detection and the use of nuclear orientation thermometry are described. (Auth.)

  14. Carbamoyl methylphosphine oxide derivatives of adamantane as americium and europium extractants

    International Nuclear Information System (INIS)

    Babain, V.A.; Alyapyshev, M.Yu.; Novakov, I.A.; Orlinson, B.S.; Savel'ev, E.N.; Shokova, Eh.A.; Serebrayannikova, A.E.; Kovalev, V.V.

    2007-01-01

    Adamantane di-1,3-carbamoyl methylphosphine oxide (CMPO) derivatives, where CMPO-groups connect with 1,3-positions of rigid adamantane platform by methylene and ethylene bridges, are synthesized, and their efficiency as extractants of americium(III) and europium(III) from nitric acid solutions is demonstrated. Distribution function of Am 3+ and Eu + during extraction from 3M HNO 3 are measured in the investigation of extraction properties. It is noted that first synthesized adamantane CMPO derivatives are more effective for the extraction of americium(III) and europium(III) from 3MHNO 3 [ru

  15. The europium and praseodymium hydrolysis in a 2M NaCl environment

    International Nuclear Information System (INIS)

    Jimenez R, M.; Lopez G, H.; Solache R, M.; Rojas H, A.

    1998-01-01

    It was studied the europium and praseodymium hydrolysis in a 2M NaCl ion force environment at 303 K, through two methods: this one extraction with dissolvents (lanthanide-water-NaCl-dibenzoylmethane) in presence of a competitive ligand (diglycolic acid) and that one direct potentiometric titration, of soluble species, followed by a computer refining. The values of one or another techniques of the first hydrolysis constants obtained were similar, which demonstrates that the results are reliable. The set of data obtained on the stability constants of hydrolysis products allowed to draw up the distribution diagrams of chemical species, as europium as praseodymium in aqueous environment. (Author)

  16. Europium(II)heptaphosphide EuP/sub 7/

    Energy Technology Data Exchange (ETDEWEB)

    von Schnering, H G; Wittmann, M

    1980-07-01

    The novel polyphosphide, EuP/sub 7/, was prepared under controlled conditions by reaction of the elements in salt melts at 750-800 K. EuP/sub 7/ forms black prismatic crystals not attacked by dilute mineral acids and bases. The thermal decomposition yields EuP/sub 3/ at 700 K and in further steps EuP/sub 2/, Eu/sub 3/P/sub 4/ and EuP, respectively. According to the crystal structure as well as the electrical, optical and magnetic properties, EuP/sub 7/ is a semiconductor (Esub(G) = 0.9 eV; Esub(G) (vert) = 1.1 eV) with divalent europium (..mu.. = 7.55 B.M.). The compound crystallizes in the monoclinic space group P 2/sub 1//n with a = 1148.8(7) pm, b = 570.0(3) pm, c = 1061.0(6) pm, and ..beta.. = 106.08/sup 0/(5); (X-ray diffraction data; 1479 hkl; R = 0.031). The P-atoms are connected ((P-P) = 218.0-223.5 pm) to a 2-dimensional infinite polyanionic structure 2sub(infinity)(P/sub 7//sup 2 -/) with homonuclear 3-bonded and 2-bonded P-atoms in the ratio 5 : 2. The polyanionic network contains P/sub 6/-rings (chair conformation) as well as P/sub 8/-rings and P/sub 10/-rings. The Eu-atoms are bonded to 9 P-atoms (1,4,4-polyhedra) with bond distances ranging from 306.6 to 326.6 pm. The Eu-atoms complete the tetrahedral environment of the P-atoms.

  17. Spectral characteristics of europium-doped lead iodide

    International Nuclear Information System (INIS)

    Novosad, I.S.; Novosad, S.S.

    2013-01-01

    Optical absorption and x-ray luminescence spectra and thermally stimulated luminescence curves of a PbI 2 :EuCl 3 crystal grown by the Stockbarger method were investigated in the temperature range 85-295 K. It was presumed based on results of EPR spectral studies that the europium ions in this material existed in the divalent state and replaced matrix cations. An intense broad non-elementary band at 780 nm in addition to a weak band with a maximum in the range 512-520 nm were observed in the PbI 2 :Eu 2+ x-ray luminescence spectrum at 85 K. The intensity of the long-wavelength emission increased slightly upon increasing the crystal temperature from 85 to 130 K and was quenched in several stages upon increasing the temperature further to 220 K. The maximum shifted to 740 nm. It was proposed based on an analysis of the obtained data and results of a study of the luminescence properties of PbI 2 and PbI 2 :Mn 2+ crystals that the non-elementary emission band of the PbI 2 :Eu 2+ crystal at 780 nm could be represented as a superposition of three individual Gaussian bands with maxima near 715, 740, and 800 nm that were due to centers characteristic of the matrix and additional centers that were formed by Eu ions through association with intrinsic and dopant oxygen-containing defects, respectively. Doping PbI 2 with Eu 2+ ions did not affect the spectrum of matrix trapping levels. The nature of emission and trapping centers and luminescence excitation mechanisms of PbI 2 :Eu 2+ were discussed. (authors)

  18. Behavior of cesium-134 in the tea tree

    International Nuclear Information System (INIS)

    Xu Yinliang; Chen Kaixuan; Chen Chuangqun

    1996-01-01

    The radioactivity changes of 134 Cs in the aged and the young leaves followed an exponential regression function after spraying 134 Cs in the tea trees. Contamination by spraying 134 Cs greatly harmed tea tree and by irrigating or mixing 134 Cs with soil resulted in a potential endangerment. The concentrating ability of tea leaves for 134 CS was very low and K value was 0.02. After the fresh tea leaves were processed to dry tea, the content of 134 Cs decreased by about 13.3%. When the tea leaves were soaked in hot water, the extraction ratio was around 83.6%

  19. Performance comparison of a refrigerator system using R134a and hydrocarbon refrigerant (HCR134a) with different expansion devices

    Science.gov (United States)

    Aziz, A.; Izzudin; Mainil, A. K.

    2017-09-01

    The objective of this study is to compare the performance of refrigerator system using working fluid between R134a refrigerant and HCR134a as hydrocarbon refrigerant for substitution of R134a. The use of capillary tube (CT) 1.5 m with HCR134a showed that slightly better COP than among the others, due to the lower pressure of condenser, conversely thermostatic expansion valve (TEV) showed that better COP than among the others with R134a. COP of CT 1.25 m and CT 1.5 m using HCR134a increase about 42.89% and 18.09% compared to R134a, where the electric current of refrigerator system decrease about 11.63% and 10.98%. However, the COP of HCR134a with CT 2.7 m and TEV were obtained lower than R134a about 16.2% and 17.06% and the use of electric current is higher than R134a about 12.98% and 16.5%. The use of HCR134a provides a higher refrigeration effect than R134a about 66.71%-88.27% for various types of expansion devices. The results confirmed that HCR134a could be an alternative refrigerant for replacement of R134a refrigerant.

  20. Molecular interactions of Leucoagaricus naucinus with uranium(VI) and europium(III)

    Energy Technology Data Exchange (ETDEWEB)

    Wollenberg, Anne; Raff, Johannes [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Biogeochemistry; Guenther, A. [Helmholtz Institute Freiberg for Resource Technology, Freiberg (Germany)

    2017-06-01

    With regard to a molecular understanding of the interaction of fungal mycelium with radionuclides and its possible application for precautionary radiation protection and bio-remediation, the binding mechanism of the radionuclide uranium and the metal europium, as surrogate for trivalent actinides, where investigated with different starting conditions by the living fungal cells of Leucoagaricus naucinus.

  1. Magneto-optical studies of valence instability in europium and terbium phosphors

    Czech Academy of Sciences Publication Activity Database

    Rodrigues, L.C.v.; Hölsä, J.; Brito, H.F.; Maryško, Miroslav; Matos, J.R.; Paturi, P.; Rodrigues, R.V.; Lastusaari, M.

    2016-01-01

    Roč. 170, Feb (2016), 701-706 ISSN 0022-2313 Institutional support: RVO:68378271 Keywords : valence * europium * terbium * oxysulfide and -sulfate * phosphors * paramagnetic susceptibility Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  2. Molecular interactions of Leucoagaricus naucinus with uranium(VI) and europium(III)

    International Nuclear Information System (INIS)

    Wollenberg, Anne; Raff, Johannes

    2017-01-01

    With regard to a molecular understanding of the interaction of fungal mycelium with radionuclides and its possible application for precautionary radiation protection and bio-remediation, the binding mechanism of the radionuclide uranium and the metal europium, as surrogate for trivalent actinides, where investigated with different starting conditions by the living fungal cells of Leucoagaricus naucinus.

  3. Thermodynamic and structural description of europium complexation in 1-octanol - H2O solutions

    International Nuclear Information System (INIS)

    Vu, T.H.; Charbonnel, M.C.; Boubals, N.; Couston, L.; Arnaud, F.

    2008-01-01

    Polydentate N-bearing ligands such as bis-triazinyl-pyridines (BTPs) are interesting extractants for actinide(III)/lanthanide(III) separation. A description of europium complexation in 1-octanol solutions was undertaken to enhance the knowledge of the extraction mechanisms. The first solvation shell for europium(III) nitrate, chloride, and perchlorate with different amounts of water was determined by Time-Resolved Laser-Induced Fluorescence (TRLIF) spectroscopy. Europium nitrate complexation by iPr-BTP was then studied by TRLIF and micro-calorimetry; similar stability constants related to the formation of Eu(BTP) 2 3+ and Eu(BTP) 3 3+ were obtained by both techniques (log(β 2 ) = 9.0 ± 0.3 and log(β 3 ) = 13.8 ± 0.2). The presence of water in the octanol diluent has an influence on solvation of europium and also on the [Eu(BTP) 2 3+ ] / [Eu(BTP) 3 3+ ] ratio. (authors)

  4. Thermodynamic and structural description of europium complexation in 1-octanol - H{sub 2}O solutions

    Energy Technology Data Exchange (ETDEWEB)

    Vu, T.H.; Charbonnel, M.C.; Boubals, N.; Couston, L. [CEA Marcoule, DEN/DRCP/SCPS/LCAM, BP 17171, 30207 Bagnols-sur-Ceze (France); Arnaud, F. [Laboratoire de Chimie Physique, IPHC, 25 rue Becquerel, 67087 Strasbourg (France)

    2008-07-01

    Polydentate N-bearing ligands such as bis-triazinyl-pyridines (BTPs) are interesting extractants for actinide(III)/lanthanide(III) separation. A description of europium complexation in 1-octanol solutions was undertaken to enhance the knowledge of the extraction mechanisms. The first solvation shell for europium(III) nitrate, chloride, and perchlorate with different amounts of water was determined by Time-Resolved Laser-Induced Fluorescence (TRLIF) spectroscopy. Europium nitrate complexation by iPr-BTP was then studied by TRLIF and micro-calorimetry; similar stability constants related to the formation of Eu(BTP){sub 2}{sup 3+} and Eu(BTP){sub 3}{sup 3+} were obtained by both techniques (log({beta}{sub 2}) = 9.0 {+-} 0.3 and log({beta}{sub 3}) = 13.8 {+-} 0.2). The presence of water in the octanol diluent has an influence on solvation of europium and also on the [Eu(BTP){sub 2}{sup 3+}] / [Eu(BTP){sub 3}{sup 3+}] ratio. (authors)

  5. ULTRAVIOLET TRANSITIONS IN EUROPIUM STUDIED WITH A FREQUENCY-DOUBLED CW RING DYE-LASER

    NARCIS (Netherlands)

    Eliel, E.R.; Hogervorst, W.; van Leeuwen, K.A.H.; Post, B.H.

    1981-01-01

    High resolution laser spectroscopy has been applied to the study of three ultraviolet transitions in Europium at λ = 294.8, 295.1 and 295.8 nm. The tunable narrowband UV has been generated by intracavity frequency doubling in a cw ring dye laser using a temperate tuned, Brewster angled ADA crystal.

  6. Detection of Molecular Chirality by Induced Resonance Raman Optical Activity in Europium Complexes

    Czech Academy of Sciences Publication Activity Database

    Yamamoto, Shigeki; Bouř, Petr

    2012-01-01

    Roč. 51, č. 44 (2012), s. 11058-11061 ISSN 1433-7851 R&D Projects: GA MŠk(CZ) LH11033; GA ČR GAP208/11/0105 Institutional support: RVO:61388963 Keywords : europium * complexes * raman optical activity * resonance Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 13.734, year: 2012

  7. The 134Cs uptake by sunflower (Helianthus anuus, Less) cultivated on soil contaminated with 134Cs

    International Nuclear Information System (INIS)

    Poppy Intan Tjahaja; Putu Sukmabuana

    2008-01-01

    One of the methods for remediation of contaminated environment is phytoremediation techniques, i.e. the environmental remediation using plants. In this research the bioavailability of sunflower plant (Helianthus anuus, Less) in radiocaesium uptake from soil was studied for being considered as a phytoremediator later. Sunflower plants were cultivated on soil contaminated with 134 Cs with the concentrations of 29,3 kBq/kg ; 117,2 kBq/kg ; 557 kBq/kg for 45 days. As control the sunflowers were also cultivated on non contaminated soil. Observation was carried out every 5 days by sampling 3 plants and soils. The plant and soil samples were dried using infra red lamp for 24 hours, and then counted using gamma spectrometer. The counting results i.e. 134 Cs concentration on soil and plant parts were then analyzed to obtain transfer factor (TF) values. The highest TF values was reached on 26 th day, i.e. 0,87; 1,89 ; 2,82 for initial soil 134 Cs concentrations of 29,3 Bq/g ; 117,2 Bq/g ; 557 Bq/g, respectively. The TF values obtained expressed the capability of plants to accumulate 134 Cs from soils. The observation to the plants growth showed that the plants grew normally on the 134 Cs contaminated soil until the concentration of 557 Bq/g. The sunflower can be considered to be phytoremediator of andosol soil contaminated with Cs radionuclides. (author)

  8. Study of the europium behavior in aqueous media; Estudio sobre el comportamiento del europio en medios acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.; Martinez M, V. [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

    2000-07-01

    Europium as waste can produce a pollution problem in water that is in contact with it, what would has a heavy environmental impacts, because of the possibilities of diffusion of these wastes from their place of confinement or storage until the geo and biosphere. The solution of such problem requires of a lot of knowledge over the behavior of several chemical elements such as europium in aqueous solutions. In this work it was used a low ion force (0.02 M). The data set will allow extrapolate the hydrolytic behavior of europium in too much minors ion force media, such as the ground waters, including in ion force zero.

  9. Atomic absorption spectrophotometry of europium using an enhancing effect of ammonium perchlorate

    International Nuclear Information System (INIS)

    Oguro, Hiroshi

    1976-01-01

    In the atomic absorption spectrophotometry of europium in air-acetylene flame, ammonium perchlorate (NH 4 ClO 4 ) increases the absorption of europium. In the case of 0.5 M NH 4 ClO 4 , the increase is by about 1.5 times. In this paper, a method for eliminating the interferences of many coexisting compounds using an enhancing effect and a method for determining Eu 2 O 3 in La 2 O 3 were investigated. The working conditions using Nippon Jarrell-Ash model AA-1 atomic absorption/flame emission spectrophotometer were as follows; wavelength 4594 A, lamp current 15 mA, burner height 10 mm, air flow-rate 6.51/min, acetylene flow-rate 1.81/min. Though the enhancing or depressing effects of HCl, HNO 3 , HBr and HClO 4 in concentrations below 0.1 M were eliminated by 0.5 M NH 4 ClO 4 , the remarkable depressing effects of H 2 SO 4 and H 3 PO 4 on europium could not be eliminated. The interferences of Na + , K + , Cs + and Al 3+ in the concentration of 200 ppm were not eliminated, but those of other cations including rare earth elements were completely eliminated. Lanthanum in the range of (2000--10000) ppm increased the absorption of europium by about 1.4 times. But the effect of lanthanum in the range of (0--9000) ppm was also eliminated by NH 4 ClO 4 . The calibration curve for europium in the presence of NH 4 ClO 4 was linear in the range of (0--400) ppm with a sensitivity larger by about 1.5 times than that for europium alone. The analytical procedure is as follows. A sample is dissolved in HCl and NH 4 ClO 4 is added. Europium in the sample solution is determined by atomic absorption method using air-acetylene flame. For practical samples, the values obtained were in fair agreement with those by the flame emission method using a nitrous oxide-acetylene flame. The coefficients of variation by the present method were (3.7--2.4)% (Eu 2 O 3 content (1--3)%). (auth.)

  10. 13 CFR 134.409 - Decision on appeal.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision on appeal. 134.409 Section 134.409 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.409 Decision on appeal. (a) A decision of the Administrative Law Judge under this subpart is the...

  11. 13 CFR 134.404 - Decision by Administrative Law Judge.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision by Administrative Law Judge. 134.404 Section 134.404 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... 8(a) Program § 134.404 Decision by Administrative Law Judge. Appeal proceedings brought under this...

  12. 19 CFR 134.14 - Articles usually combined.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles usually combined. 134.14 Section 134.14... TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.14 Articles usually combined. (a) Articles combined before delivery to purchaser. When an imported article is of a kind which is usually...

  13. 29 CFR 2570.134 - Consequences of default.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Consequences of default. 2570.134 Section 2570.134 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(7) § 2570.134 Consequences of default. For 502(c)(7) civil penalty proceedings...

  14. 12 CFR 13.4 - Recommendations to customers.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Recommendations to customers. 13.4 Section 13.4... PRACTICES § 13.4 Recommendations to customers. In recommending to a customer the purchase, sale or exchange... reasonable grounds for believing that the recommendation is suitable for the customer upon the basis of the...

  15. 49 CFR 195.134 - CPM leak detection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.134 Section 195.134... PIPELINE Design Requirements § 195.134 CPM leak detection. This section applies to each hazardous liquid... computational pipeline monitoring (CPM) leak detection system and each replaced component of an existing CPM...

  16. Synthesis, characterization, and properties of reduced europium molybdates and tungstates

    Energy Technology Data Exchange (ETDEWEB)

    Abeysinghe, Dileka [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Gerke, Birgit [Institut für Anorganische und Analytische Chemie, Universität Münster , Corrensstrasse 30, Münster D-48149 (Germany); Morrison, Gregory; Hsieh, Chun H.; Smith, Mark D. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Pöttgen, Rainer [Institut für Anorganische und Analytische Chemie, Universität Münster , Corrensstrasse 30, Münster D-48149 (Germany); Makris, Thomas M. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Loye, Hans-Conrad zur, E-mail: zurloye@mailbox.sc.edu [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States)

    2015-09-15

    Single crystals of K{sub 0.094}Eu{sub 0.906}MoO{sub 4}, K{sub 0.097}Eu{sub 0.903}WO{sub 4}, EuWO{sub 4}, and EuMoO{sub 4} were grown from molten chloride fluxes contained in vacuum-sealed fused silica and structurally characterized via single crystal X-ray diffraction. The in situ reduction of Eu{sup 3+} to Eu{sup 2+} was carried out using Mo, W, and Zn as metal reducing agents. All four compounds crystallize in the tetragonal space group of I4{sub 1}/a and adopt the scheelite (CaWO{sub 4}) structure type. The magnetic susceptibility of the reported compounds shows paramagnetic behavior down to 2 K. {sup 151}Eu Mössbauer spectroscopy was used to analyze the relative Eu{sup 2+} and Eu{sup 3+} content of the samples. All the compounds were further characterized by EPR, and UV-vis spectroscopy. - Graphical abstract: TOC Caption Two new reduced europium containing quaternary oxides, K{sub 0.094}Eu{sub 0.906}MoO{sub 4} and K{sub 0.097}Eu{sub 0.903}WO{sub 4}, and two previously reported ternary reduced oxides, EuWO{sub 4} and EuMoO{sub 4}, were synthesized via an in situ reduction of Eu{sup 3+} to Eu{sup 2+} under flux method using Mo, W, and Zn as metal reducing agents. {sup 151}Eu Mössbauer spectroscopy was used to analyze the relative Eu{sup 2+} and Eu{sup 3+} content of the samples. - Highlights: • K{sub 0.094}Eu{sub 0.906}MoO{sub 4}, K{sub 0.097}Eu{sub 0.903}WO{sub 4}, EuWO{sub 4}, and EuMoO{sub 4} have been synthesized and characterized. • The in situ reduction of Eu{sup 3+} to Eu{sup 2+} was carried out using Mo, W, and Zn as metal reducing agents. • Magnetic susceptibility data were collected. • {sup 151}Eu Mössbauer spectroscopy was used to analyze Eu{sup 2+} and Eu{sup 3+} content.

  17. Silica- and silylated europium-based luminescent hybrids: new analysis tools for biological environments

    International Nuclear Information System (INIS)

    Pereira Duarte, Adriana

    2012-01-01

    The association of the very interesting luminescence properties of the lanthanide chelates with the physicochemical properties of inorganic matrix such as silica is a promising way to obtain new probes or luminescent markers for biology analyses. In this idea, this work focuses on the preparation of new hybrid materials based on the grafting of new europium(III) complexes on silica nanoparticles. These europium complexes were developed in our group using bifunctional ligands containing both complexing and grafting sites. Intrinsic characteristic of the ligands gives us the ability to make a covalent bond between the material surface and the complex. Two different methodologies were used; the first one is the direct grafting reaction involving the complex and silica nanoparticles (i.e. dense or meso-porous particles). The second one is the Stoeber reaction, where the SiO 2 nanoparticles were prepared in presence of the europium complex. The last methodology has an additional difficult, because of the presence of silylated europium complex, it needs a closer control of the physicochemical conditions. The new organic-inorganic hybrid materials, obtained in this work, present an interesting luminescence behavior and this one is depending on the localization of the europium complex, i.e. on the surface or within the nanoparticles. In addition, the obtained hybrids present the nano-metric dimension and the complex is not leachable. Analyses were realized to describe the luminescence properties, beyond surface and structural characteristics. Initial results show that the new hybrids are promising candidates for luminescent bio-markers, particularly for the time-resolved analysis. (author) [fr

  18. STS-134 Re-Rendezvous Design History

    Science.gov (United States)

    Stuit, Timothy D.

    2011-01-01

    In preparation to provide the capability for the Orion spacecraft to rendezvous with the International Space Station (ISS), a new suite of relative navigation sensors are in development and will be tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the instruments on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle Orbiter at the end of the mission. Unlike the initial rendezvous and docking, the re-rendezvous profile would replicate the newly designed Orion coelliptic approach trajectory, something never before attempted with the Shuttle Orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this re-rendezvous to make the flight test successful. And all of this work had to be integrated with the normal operations of the ISS and Shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and re-rendezvous trajectory design that will prove not only the design of the relative navigation sensors for the Orion vehicle, but also will serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.

  19. Experimental evaluation of automotive air-conditioning using HFC-134a and HC-134a

    Science.gov (United States)

    Nasution, Henry; Zainudin, Muhammad Amir; Aziz, Azhar Abdul; Latiff, Zulkarnain Abdul; Perang, Mohd Rozi Mohd; Rahman, Abd Halim Abdul

    2012-06-01

    An experimental study to evaluate the energy consumption of an automotive air conditioning is presented. In this study, these refrigerants will be tested using the experimental rig which simulated the actual cars as a cabin complete with a cooling system component of the actual car that is as the blower, evaporator, condenser, radiators, electric motor, which acts as a vehicle engine, and then the electric motor will operate the compressor using a belt and pulley system, as well as to the alternator will recharge the battery. The compressor working with the fluids HFC-134a and HC-134a and has been tested varying the speed in the range 1000, 1500, 2000 and 2500 rpm. The measurements taken during the one hour experimental periods at 2-minutes interval times for temperature setpoint of 20°C with internal heat loads 0, 500, 700 and 1000 W. The final results of this study show an overall better energy consumption of the HFC-134a compared with the HC-134a.

  20. Luminescent properties of Europium(III) nitrate with 1,10-phenantroline and cinnamic acid in light - Transforming polymer materials

    Science.gov (United States)

    Kalinovskaya, I. V.; Zadorozhnaya, A. N.

    2018-04-01

    Influence of cinnamic acid on the luminescent properties of the europium(III) nitrate with 1,10-phenantroline in a polymer materials was studied. It was shown that combined use of these rare earth complexes leads to intense luminescence in the 400-700 nm region. Samples containing polymer europium nitrate with 1,10-phenantroline and cinnamic acid at a molar ratio of 1:2,0 had the maximum luminescence intensity and photostability.

  1. Europium determination in oxide and oxysulfide luminophors and their wastes by the method of direct and derivative spectrophotometry

    International Nuclear Information System (INIS)

    Mishchenko, V.T.; Aleksandrova, N.N.

    1989-01-01

    Spectrophotometric methods for europium determination in luminophors are proposed. Application of standard and derivative spectrophotometry allows one to determine europium in oxide and oxysulfide luminophors, their wastes and raffinates produced during waste reprocessing quite accurately and reliably. When determining Eu 2 O 3 (Eu 2 O 2 S) mass shares within 4-8 % limits absolute deviation from the mean result makes up to more than ± 0.2 %, relative standard deviation does not exceed 0.02

  2. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    Energy Technology Data Exchange (ETDEWEB)

    Shaorong Liu; Jian Meng (Beijing Research Institute of Chemical Engineering and Metallurgy (China)); Wenhua Liu (General Research Institute for Non-Ferrous Metals (China))

    1992-08-24

    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs.

  3. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    International Nuclear Information System (INIS)

    Shaorong Liu; Jian Meng; Wenhua Liu

    1992-01-01

    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs

  4. Lanthanum and yttrium oxysulfides activated by europium: (Ln1-x Eux)2 O2 S - Synthesis and characterization

    International Nuclear Information System (INIS)

    Luiz, J.M.

    1989-01-01

    The synthesis of lanthanum and yttrium oxysulfides activated by europium were obtained by thermal decomposition of lanthanum and yttrium oxalates doped with europium, under an argon and sulphur atmosphere. The thermal decomposition of these compounds is studied by differential thermal analysis (DTA). The characterization of these oxysulfides were made by chemical analyses, infrared spectroscopy, X-ray diffraction, scanning electron microscopy and emission spectroscopy. (M.V.M.)

  5. Spectroscopic studies of europium-tetracyclines complexes and their applications in detection of hydrogen peroxide and urea peroxide

    International Nuclear Information System (INIS)

    Grasso, Andrea Nastri

    2010-01-01

    In this work were studied the spectroscopic properties of trivalent europium ion complexed with components of tetracycline family, chlorotetracycline, oxytetracycline and metacycline, in the presence of hydrogen peroxide and urea peroxide. Optical parameters were obtained such as absorption, emission, lifetime and calibration curves were constructed for luminescence spectra. Experiments were carried out with both inorganic compounds and europium-tetracyclines complexes in order to verify possible interferences. Studies for glucose determination were also described using europium-tetracyclines complexes as biosensors. Results show that europium tetracyclines complexes emit a narrow band in the visible region and, in the presence of hydrogen peroxide or urea peroxide there is a greater enhancement in their luminescence and lifetime. Thus, europium-tetracyclines complexes studied can be used as biosensors for hydrogen and urea peroxides determination as a low cost and room temperature method. An indirect method for glucose determination was studied by adding glucose oxidase enzyme in europium-tetracyclines complex in the presence of glucose promoting as product hydrogen peroxide. (author)

  6. Influence of biofilms on migration of uranium, americium and europium in the environment; Einfluss von Biofilmen auf das Migrationsverhalten von Uran, Americium und Europium in der Umwelt

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-07-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  7. Incorporation of europium III complex into nanoparticles and films obtained by the Sol-Gel methodology

    Directory of Open Access Journals (Sweden)

    Faley Jean de Sousa

    2010-03-01

    Full Text Available The sol-gel process is very effective for the preparation of new materials with potential applications in optics, sensors, catalyst supports, coatings, and specialty inorganic polymers that can be used as hosts for the accommodation of organic molecules. The low temperature employed in the process is the main advantage of this methodology. In this work, the europium (III complex with 1,10-phenantroline was prepared, and this luminescent complex was incorporated into silica nanoparticles and films by the sol-gel process. The nanoparticles were obtained by the modified Stöber methodology. The films were obtained by the dip-coating technique, at different deposition rates and numbers of layers. The nanoparticles and films were characterized by photoluminescence, thermal analysis, and Raman and infrared spectroscopies. Characterization revealed that the europium (III complex was not affected upon incorporation into the nanoparticles and films, opening a new field for the application of these materials.

  8. Synthesis, characterization and fluorescence studies of a novel europium complex based sensor

    International Nuclear Information System (INIS)

    Li Bin; Chen Qiuyun; Wang Yachen; Huang Jing; Li Yang

    2010-01-01

    A novel europium(III) complex was synthesized using TTA (α-thenoyltrifluoroacetone) as the first ligand and H 2 bpdc (2,2'-bipyridine-3,3'-dicarboxylate) as the second ligand. Elemental analysis, thermal analysis, IR and UV-vis spectrum and fluorescence spectrum of the europium(III) complex were carried out. A characteristic Eu 3+ fluorescence emission was observed in ethanol-water (1:1) solution, indicating that the complex is stable in solution and the emission of Eu(III) ions was not influenced by the water molecules. The fluorescence emission of the complex was quenched completely by the Co 2+ and Fe 3+ ions, but the quenched emission was recovered in the presence of glycine. Moreover, the Eu 3+ emission was very sensitive to pH, so the complex can be used as pH-dependent fluorescence probe or chemosensors.

  9. Characterization of photoluminescent europium doped yttrium oxide thin-films prepared by metallorganic chemical vapor deposition

    International Nuclear Information System (INIS)

    McKittrick, J.; Bacalski, C.F.; Hirata, G.A.; Hubbard, K.M.; Pattillo, S.G.; Salazar, K.V.; Trkula, M.

    1998-01-01

    Europium doped yttrium oxide, (Y 1-x Eu x ) 2 O 3 , thin-films were deposited on silicon and sapphire substrates by metallorganic chemical vapor deposition (MOCVD). The films were grown in a MOCVD chamber reacting yttrium and europium tris(2,2,6,6-tetramethyl-3,5,-heptanedionates) precursors in an oxygen atmosphere at low pressures (5 Torr) and low substrate temperatures (500--700 C). The films deposited at 500 C were flat and composed of nanocrystalline regions of cubic Y 2 O 3 , grown in a textured [100] or [110] orientation to the substrate surface. Films deposited at 600 C developed from the flat, nanocrystalline morphology into a plate-like growth morphology oriented in the [111] with increasing deposition time. Monoclinic Y 2 O 3 :Eu 3+ was observed in x-ray diffraction for deposition temperatures ≥600 C on both (111) Si and (001) sapphire substrates. This was also confirmed by the photoluminescent emission spectra

  10. Is the stoichiometry of the europium nitrate complexes with neutral organophosphorus extractants be anticipated?

    International Nuclear Information System (INIS)

    Beudaert, Ph.; Lamare, V.; Wipff, G.

    2001-01-01

    Molecular dynamics simulations have been performed in water on europium nitrate complexes with three neutral organophosphorus extractants (TBP, TPPO and CMPO) in order to determine on what criteria it is possible to obtain by simulations the experimental 1:3 stoichiometry in organic solution. This stoichiometry was investigated by progressive saturation of the cation coordination sphere. When the nitrate counter-ions are bidentate, the 1:3 stoichiometry corresponds to the degree of saturation where the interaction energy between europium and water becomes repulsive. Beyond this stoichiometry, complexes with TPPO and CMPO are unstable, although a 1:4 complex with TBP may exist but its formation appears to be energetically unfavored. (author)

  11. Study on Europium-Doped Hydroxyapatite Nanoparticles by Fourier Transform Infrared Spectroscopy and Their Antimicrobial Properties

    Directory of Open Access Journals (Sweden)

    Simona-Liliana Iconaru

    2013-01-01

    Full Text Available Fourier transform infrared spectroscopy (FT-IR analysis was conducted on europium-doped hydroxyapatite, Ca10-xEux(PO46(OH2 nanocrystalline powders (Eu:HAp with 0≤xEu≤0.2. Antimicrobial studies were also performed for the first time on Eu:HAp. The antimicrobial properties of Eu:HAp nanoparticles with 0≤xEu≤0.2 on Gram-negative (E. coli ATCC 25922, Pseudomonas aeruginosa 1397 and Gram-positive (Staphylococcus aureus 0364, Enterococcus faecalis ATCC 29212 bacteria systems and a species of fungus (Candida albicans ATCC 10231 were reported. Our study demonstrates that the antimicrobial activity of Eu:HAp nanoparticles is dependent on the europium concentration.

  12. The enthalpies of formation of neutral and charged components of saturated vapor over europium dichloride

    International Nuclear Information System (INIS)

    Pogrebnoj, A.M.; Kudin, L.S.

    2003-01-01

    Composition of saturated vapor over europium dichloride was studied by the method of high-temperature mass spectrometry in the temperature range of 1154 - 1267 K. For neutral components of the vapor, represented by monomer and dimer molecules, partial pressures were determined. Enthalpies of sublimation of europium dichloride Δ s H 0 (298 K) as monomers (338 ± 9) and dimers (407 ± 20 kJ/mol) were calculated. Equilibrium constants of ion-molecular and ion-ionic reactions were measured, their enthalpies being ascertained. Enthalpies of formation of molecules and ions Δ f H 0 (298 K) were calculated: -486 ± 11 (EuCl 2 ), -1242 ± 22 (Eu 2 Cl 4 ), 1 ± 12 (Eu 2 Cl 2 + ), -347 ± 20 (Eu 2 Cl 3 + ), -1111 ± 42 (Eu 3 Cl 5 + ), -975 ± 20 (EuCl 3 - ), -1309 ± 17(EuCl 4 - ), -1734 ± 20 (Eu 2 Cl 5 - ) kJ/mol [ru

  13. Luminescence properties of europium (III) cryptates trapped in sol-gel glass

    International Nuclear Information System (INIS)

    Zaitoun, M.A.; Kim, T.; Jaradat, Q.M.; Momani, K.; Qaseer, H.A.; El-Qisairi, A.K.; Qudah, A.; Radwan, N.E.

    2008-01-01

    The Lanthanide complexes Eu-2.2.1 and Eu-2.2.2 were synthesized and then incorporated into silica based transparent organic-inorganic hybrid material by the sol-gel method as an example of how doped xerogel materials are emerging as an important means of producing new materials. The produced gels were diagnosed to monitor emission spectra of the luminescent trivalent europium (Eu 3+ ) complexes; emissions were compared to those for gels containing uncomplexed Eu 3+ . Results of the experiments (emission and lifetimes) concerning the coordination sphere composition showed that a cryptand ligand with aromatic groups (short range effect) and the hydrophobic gel host (long range effect) settle efficient action in the antenna effect and isolate the central ion from efficient quenchers, as e.g. water molecules. Each ligand imposed a distinct splitting pattern on the europium emission bands that helps identify them

  14. Crystal agglomeration of europium oxalate in reaction crystallization using double-jet semi-batch reactor

    International Nuclear Information System (INIS)

    Kim, Woo-Sik; Kim, Woon-Soo; Kim, Kwang-Seok; Kim, Joon-Soo; Ward, Michael D.

    2004-01-01

    The particle agglomeration of europium oxalate was investigated in a double-jet semi-batch reactor over a wide range of operating variables, including the agitation speed, reactant feed rate, and reactant concentration. The size of the agglomerates was directly dictated by the particle collision and supersaturation promoting agglomeration and the fluid shear force inhibiting agglomeration. Thus, with a longer feeding time and higher feed concentration for the reaction crystallization, the mean particle size increased, while the corresponding total particle population decreased due to the enhanced chance of particle agglomeration, resulting from a longer residence time and higher supersaturation in the reactor. Agitation was found to exhibit a rather complicated influence on particle agglomeration. Although both particle collision and turbulent fluid shear were promoted by an increase in the mixing intensity, the crystal agglomeration of europium oxalate was maximized at around 500 rpm of agitation speed due to an optimized balance between particle aggregation and breakage

  15. Improved efficiency of organic light-emitting diodes based on a europium complex by fluorescent dye

    Energy Technology Data Exchange (ETDEWEB)

    You Han [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of Chinese Academy of Sciences, Changchun 130022 (China); Fang Junfeng [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of Chinese Academy of Sciences, Changchun 130022 (China); Gao Jia [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of Chinese Academy of Sciences, Changchun 130022 (China); Ma Dongge [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of Chinese Academy of Sciences, Changchun 130022 (China)]. E-mail: mdg1014@ciac.jl.cn

    2007-01-15

    Improved efficiency of organic light-emitting diodes (OLEDs) based on europium complexes have been realized by using a fluorescent dye 4-(dicyanomethylene)-2-t-butyl-6 (1,1,7,7-tetramethyljulolidyl-9-enyl))-4H-pyran (DCJTB) doping .The luminous efficiency of the devices with a fluorescent dye in the emissive layer was found to improve two times of that in devices without fluorescent dye. The devices showed pure red light, which is the characteristic emission of trivalent europium ion with a full-width at half-maximum of 3 nm.The maximum brightness and luminous efficiency reached 1200 cd/m{sup 2} at 23 V and 7.3 cd/A (2.0 lm/w), respectively, at a current density of 0.35 mA/cm{sup 2}.

  16. Determination of the first hydrolysis constant of Europium (III) in 3 M of ionic strength

    International Nuclear Information System (INIS)

    Ramirez B, M.E.

    1994-01-01

    The first hydrolysis constant of Eu 3+ has been determined at 303 K and 3 M (NaCl) ionic strength. A solvent extraction method was used, the extractant was dibenzoylmethane in benzene and di glycolate anion in the aqueous phase provided competitive complexation. The tracer solution was 152m1 Eu (III) in water. The radioactive solution of europium was obtained by neutron irradiation of europium nitrate solutions at pH 3.0, in a TRIGA Mark III nuclear reactor at a neutron flux of 1 x 10 13 cm -2 s -1 . The half life of the produced isotope, 152m1 Eu (9.3 h), was verified by means of a Ge H detector and no interfering radiations were observed in the spectra. (Author)

  17. Extraction of europium with thenoyltrifluoroacetone into alcohol, ketone and ester solvents

    International Nuclear Information System (INIS)

    Akiba, K.; Kanno, T.

    1980-01-01

    The effect of solvent has been studied on the extraction of tris-thenoyltrifluoroacetone (TTA) chelate of europium(III). Donor-active solvents (S) greatly promote the extraction owing to the formation of solvate species EuA 3 .mS (m = 1,2). Linear relations were established between the distribution of ratios of europium (Dsub(Eu)) and the partition constants of TTA (Psub(HA)); log Dsub(Eu) (at a definite pA) = a log Psub(HA) + b, where constants a and b were empirically determined for each series of solvents. The regularity is interpreted in terms of dual roles of solvent as donor and as medium. (author)

  18. Spectroscopic properties of trivalent Europium in various composites with an eulytin structure. Internship report

    International Nuclear Information System (INIS)

    Raynal, Francoise

    1975-01-01

    Eulytin is a bismuth orthosilicate and eulytin compounds revealed to be interesting matrix materials which can be used as medium gain laser materials. This research report is thus a contribution for a better knowledge of this material. Different eulytin compounds doped with lanthanide ions have been used to study the cationic polyhedron (by using structural probes such as the trivalent Europium in spectroscopy, or the trivalent gadolinium in electronic paramagnetic resonance) and the anionic polyhedron

  19. Systematic investigation and in vitro biocompatibility studies on mesoporous europium doped hydroxyapatite

    OpenAIRE

    Popa Cristina; Ciobanu Carmen; Iconaru Simona; Stan Miruna; Dinischiotu Anca; Negrila Constantin; Motelica-Heino Mikael; Guegan Regis; Predoi Daniela

    2014-01-01

    International audience; This paper reports a systematic investigation on europium doped hydroxyapatite (Eu:HAp). In this work, a set of complementary techniques Fourier Transform Infrared spectroscopy (FTIR), X-ray photoelectron spectroscopy (XPS), transmission electron microscopy (TEM) and, Brunauer-Emmett-Teller (BET) technique was used to allowing a proper understanding of Eu:HAp. The XPS analysis confirmed the substitution of Ca ions by Eu ions in Eu:HAp samples. Eu:HAp and pure HAp show ...

  20. Effects of added uranium on the triboluminescent properties of europium dibenzoylmethide triethylammonium

    International Nuclear Information System (INIS)

    Fontenot, Ross S.; Hollerman, William A.; Bhat, Kamala N.; Aggarwal, Mohan D.

    2013-01-01

    The ability of a material to emit light upon fracture is known as triboluminescence. One of the few materials that emits triboluminescence in daylight is europium dibenzoylmethide triethylammonium (EuD 4 TEA). It has been shown that this material is 106% brighter than ZnS:Mn when excited by low speed impacts. In 2011, the authors of this paper found that replacing the traditional europium chloride with europium nitrate and changing the carrier solvent could both significantly affect the triboluminescent emission yield. While these changes provided a significant increase in yield, the emission was still not sufficient to be observed in bright daylight. In order to enhance the effect, a series of materials were added to the EuD 4 TEA to study the effects of “doping” on the triboluminescence yield. Results from this research showed that doping from a small number of materials, such as uranyl acetate, increased emission yield. This paper discusses the research that was completed on effects of the addition of uranyl acetate to EuD 4 TEA could increase the triboluminmescent emission yield. Results show that the added uranium does indeed increase emission yield when it is first synthesized. However, radiation emitted by the uranium also was found to damage the doped EuD 4 TEA, thus reducing the emitted triboluminescence over a period of time. - Highlights: ► Uranium doped europium dibenzoylmethide triethylammonium (EuD 4 TEA) was synthesized. ► Effects of uranium was studied for low velocity ( 4 TEA was determined.

  1. Determination of Europium by fluorescence using pyrrolidinium based task specific ionic liquid

    International Nuclear Information System (INIS)

    Kumar, Satendra; Gayan, Siuli Maji; Sankaran, K.

    2012-01-01

    Determination of lanthanides using fluorescence is a major challenge in aqueous medium due to their poor molar absorptivities and low quantum yield. To overcome these problems, ligand sensitized fluorescence has been widely used for trace level detection of lanthanides in solutions. Recently, ionic liquid a non aqueous medium has been used to observe the fluorescence of lanthanides. In this work we have used pyrrolidinium based ionic liquid for the study of europium fluorescence. The ionic liquid (bmpyr)(BA) was prepared using the metathesis reaction involving 1-butyl,1-methyl pyrrolidinium chloride (bmpyr)(CI). (bmpyr)(Cl) crystals and silver benzoate were added according to their mole equivalents in methanol and stirred for 4 hrs. The filtrate was concentrated using a rotary evaporator, dried for 10 h at room temperature, and then for 40 h at 105℃under reduced pressure. This results in a white crystalline hygroscopic solid which was characterized by FT-lR spectroscopy. The yield of the product was ∼ 95%. Butyl-1, methyl pyrrolidinium bis(trifluoromethanesulfonyl)amide (bmpyr)(TF 2 N) is used for dissolve and dilute (bmpyr)(BA) and fluorescence and life time of Eu 3+ were obtained. For the concentration of Eu 3+ used in this study (2x10 -7 M), the optimum concentration of the sensitizing ionic liquid was found to be 10 -4 M. An enhancement factor of about 32000 was found in this ionic liquid compare to aqueous medium. Fluorescence life time of europium in this ionic liquid is 1100 μs which is ten times more than the life time of europium in aqueous medium (110 μs), indicating a reduction in the rates of non-radiative processes which was provided by the ionic liquid. This study leads to detection of europium in ppb level. (author)

  2. Solubility and first hydrolysis constants of europium at different ionic strength and 303 K

    International Nuclear Information System (INIS)

    Ramirez-Garcia, J.J.; Jimenez-Reyes, M.; Lopez-Gonzalez, H.; Autonoma Metropolitana-Iztapalapa Univ., Mexico City; Solache-Rios, M.; Fernandez-Ramirez, E.; Centro Interamericano de Recursos del Agua, Toluca; Rojas-Hernandez, A.

    2003-01-01

    The solubility of europium at 0.02M, 0.1M and 0.7M NaClO 4 ionic strength solutions was determined by a radiometric method and pEu s -pC H diagrams were obtained. Hydrolysis constants were also determined at the same ionic strengths by pH titration and the values found were log *β 1 -7.68±0.11, -8.07±0.10 and -8.20±0.11. The log K sp values were -23.5±0.2, -22.7±0.2 and -21.9±0.2 for 0.02M, 0.1M and 0.7M NaClO 4 ionic strengths, respectively, at 303 K under CO 2 -free conditions and the extrapolated value at zero ionic strength was log K sp 0 = -24.15. The working pC H ranges for the calculation of the hydrolysis constants were selected from the pEu s -pC H diagrams in the region where precipitation of europium oxide or hydroxide was less than 20%. Europium removal from aqueous solutions with zeolites was explored. (author)

  3. Time-resolved laser fluorescence spectroscopy of organic ligands by europium: Fluorescence quenching and lifetime properties

    Science.gov (United States)

    Nouhi, A.; Hajjoul, H.; Redon, R.; Gagné, J. P.; Mounier, S.

    2018-03-01

    Time-resolved Laser Fluorescence Spectroscopy (TRLFS) has proved its usefulness in the fields of biophysics, life science and geochemistry to characterize the fluorescence probe molecule with its chemical environment. The purpose of this study is to demonstrate the applicability of this powerful technique combined with Steady-State (S-S) measurements. A multi-mode factor analysis, in particular CP/PARAFAC, was used to analyze the interaction between Europium (Eu) and Humic substances (HSs) extracted from Saint Lawrence Estuary in Canada. The Saint Lawrence system is a semi-enclosed water stream with connections to the Atlantic Ocean and is an excellent natural laboratory. CP/PARAFAC applied to fluorescence S-S data allows introspecting ligands-metal interactions and the one-site 1:1 modeling gives information about the stability constants. From the spectral signatures and decay lifetimes data given by TRLFS, one can deduce the fluorescence quenching which modifies the fluorescence and discuss its mechanisms. Results indicated a relatively strong binding ability between europium and humic substances samples (Log K value varies from 3.38 to 5.08 at pH 7.00). Using the Stern-Volmer plot, it has been concluded that static and dynamic quenching takes places in the case of salicylic acid and europium interaction while for HSs interaction only a static quenching is observed.

  4. Ferromagnetic semiconductor-metal transition in heterostructures of electron doped europium monoxide

    International Nuclear Information System (INIS)

    Stollenwerk, Tobias

    2013-09-01

    In the present work, we develop and solve a self-consistent theory for the description of the simultaneous ferromagnetic semiconductor-metal transition in electron doped Europium monoxide. We investigate two different types of electron doping, Gadolinium impurities and Oxygen vacancies. Besides the conduction band occupation, we can identify low lying spin fluctuations on magnetic impurities as the driving force behind the doping induced enhancement of the Curie temperature. Moreover, we predict the signatures of these magnetic impurities in the spectra of scanning tunneling microscope experiments. By extending the theory to allow for inhomogeneities in one spatial direction, we are able to investigate thin films and heterostructures of Gadolinium doped Europium monoxide. Here, we are able to reproduce the experimentally observed decrease of the Curie temperature with the film thickness. This behavior is attributed to missing coupling partners of the localized 4f moments as well as to an electron depletion at the surface which leads to a reduction of the number of itinerant electrons. By investigating the influence of a metallic substrate onto the phase transition in Gadolinium doped Europium monoxide, we find that the Curie temperature can be increased up to 20%. However, as we show, the underlying mechanism of metal-interface induced charge carrier accumulation is inextricably connected to a suppression of the semiconductor-metal transition.

  5. Ferromagnetic semiconductor-metal transition in heterostructures of electron doped europium monoxide

    Energy Technology Data Exchange (ETDEWEB)

    Stollenwerk, Tobias

    2013-09-15

    In the present work, we develop and solve a self-consistent theory for the description of the simultaneous ferromagnetic semiconductor-metal transition in electron doped Europium monoxide. We investigate two different types of electron doping, Gadolinium impurities and Oxygen vacancies. Besides the conduction band occupation, we can identify low lying spin fluctuations on magnetic impurities as the driving force behind the doping induced enhancement of the Curie temperature. Moreover, we predict the signatures of these magnetic impurities in the spectra of scanning tunneling microscope experiments. By extending the theory to allow for inhomogeneities in one spatial direction, we are able to investigate thin films and heterostructures of Gadolinium doped Europium monoxide. Here, we are able to reproduce the experimentally observed decrease of the Curie temperature with the film thickness. This behavior is attributed to missing coupling partners of the localized 4f moments as well as to an electron depletion at the surface which leads to a reduction of the number of itinerant electrons. By investigating the influence of a metallic substrate onto the phase transition in Gadolinium doped Europium monoxide, we find that the Curie temperature can be increased up to 20%. However, as we show, the underlying mechanism of metal-interface induced charge carrier accumulation is inextricably connected to a suppression of the semiconductor-metal transition.

  6. Enthalpies of formation of europium alkoxides: What lessons can be drawn from them

    International Nuclear Information System (INIS)

    Branco, Joaquim B.; Carretas, José M.; Epple, Matthias; Cruz, Adelaide; Pires de Matos, A.; Leal, João Paulo

    2014-01-01

    Highlights: • First time measurement of europium(II) alkoxides enthalpy of formation. • Calculation of alkoxides thermochemical radii and M–O distances in this environment. • Comparison of experimental EXAFS distance with the calculated ones. • Hints on the type of bond existing in these compounds. • Correlation of bond type and possible use as catalysts. - Abstract: The synthesis and characterization of two europium alkoxides, Eu(OCH 3 ) 2 and Eu(OC 2 H 5 ) 2 , were described. For the first time the enthalpies of formation of divalent lanthanide alkoxides were determined by using reaction-solution calorimetry. The values obtained are Δ f H 0 [Eu(OCH 3 ) 2 ,cr] = −850.5 ± 5.0 kJ/mol and Δ f H 0 [Eu(OC 2 H 5 ) 2 ,cr] = −902.5 ± 5.5 kJ/mol, respectively. Since these compounds have a large use as catalysts or catalysts precursors, the first step of the reaction of them with CO 2 was addressed, which permits to have an idea of the kind of bond involved in those compounds. Moreover, insertion of CO 2 in the europium oxygen bond and formation of metal carboxylate complexes, is in both cases presumably bidentate

  7. 19 CFR 134.43 - Methods of marking specific articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Methods of marking specific articles. 134.43...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.43 Methods of marking specific articles. (a) Marking previously required by certain provisions of the...

  8. 19 CFR 134.54 - Articles released from Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles released from Customs custody. 134.54...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.54 Articles... value of the articles not properly marked or redelivered. (b) Failure to petition for relief. A written...

  9. 40 CFR 86.134-96 - Running loss test.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Running loss test. 86.134-96 Section... Heavy-Duty Vehicles; Test Procedures § 86.134-96 Running loss test. (a) Overview. Gasoline- and methanol-fueled vehicles are to be tested for running loss emissions during simulated high-temperature urban...

  10. Behaviour of 134Cs in the aquatic ecosystems

    International Nuclear Information System (INIS)

    Xu Yinliang; Chen Chuanqun

    1992-07-01

    The diminution of 134 Cs in the aquatic phases and the absorption of 134 Cs by aquatic lives observe the exponential expression. i.e. Y Ae be . The relationships between the enrichment factor of 134 Cs(K) and the time(t) in the aquatic lives can be represented by a linear equation, K A + Bt. The value of K in the Alternanthera philoxeroides was about 560. That can be used for monitoring and purifying the water phase contaminated by 134 Cs. Fish can absorb 134 Cs from water phase and store it in liver and kidney. The specific activity of 134 Cs in fish flesh was low but the percentage of radioactivity was high that was about 30% of total radioactivity in the fish. River mud can strongly absorb 134 Cs and reduce the absorption by aquatic lives. It is a good adsorbent and purifying agent with low cost for treatment of 134 Cs. The K + can prevent aquatic lives from absorbing Cs + because of antagonistic function

  11. 41 CFR 105-53.134 - Office of Administration.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office of Administration. 105-53.134 Section 105-53.134 Public Contracts and Property Management Federal Property Management... Associate Administrator for Administration, participates in the executive leadership of the agency...

  12. 9 CFR 3.134-3.135 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false [Reserved] 3.134-3.135 Section 3.134-3.135 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  13. 42 CFR 84.134 - Respirator containers; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.134... Respirators § 84.134 Respirator containers; minimum requirements. Supplied-air respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...

  14. 13 CFR 134.209 - Requirement of signature.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirement of signature. 134.209 Section 134.209 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... of signature. Every written submission to OHA, other than evidence, must be signed by the party...

  15. 13 CFR 134.713 - When is the record closed?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When is the record closed? 134.713 Section 134.713 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...

  16. 13 CFR 134.702 - Who may appeal?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who may appeal? 134.702 Section 134.702 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...

  17. Direct and indirect contamination of tree crops with Cs-134

    International Nuclear Information System (INIS)

    Skarlou, V.; Nobeli, C.; Anoussis, J.; Arapis, G.; Haidouti, C.

    1996-01-01

    A long term glasshouse pot experiment was established in 1994 to study the transfer factors of Cs-134 from soil to olive and orange trees for which no relevant data are available. A calcareous-heavy textured and an acid-light textured soil were used in this experiment. Results from two year's experimentation are considered in this study. The ability of the studied plant species for Cs-134 root uptake seems to be significantly influenced by soil type. The contamination of both tree species grown on calcareous and heavy soil was very low and did not change much with the time. On the contrary, trees grown on acid and light soil showed much higher Cs-134 concentration (up to 34 times for orange and 23 for olive trees) which significantly increased with the time. Both olive and orange trees showed a similar behaviour in the studied soils. Effort was also made to study the long term consequences of the direct contamination in a field experiment where an olive tree was contaminated by dry deposition with Cs-134. Six months after contamination 5 % of the Cs-134 deposited on the leaves was measured in the first olive production. However, very small quantities (= 0.5 %) of the olive Cs-134 was detected in the unprocessed olive oil. The following year 15 % of the Cs-134 remained in the leaves while extremely low quantities of Cs-134 were detected in either olives or olive oil. (author)

  18. 22 CFR 134.30 - Payment of award.

    Science.gov (United States)

    2010-04-01

    ... will pay the amount awarded to the applicant within 60 days, unless judicial review of the award or of... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Payment of award. 134.30 Section 134.30 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS EQUAL ACCESS TO JUSTICE ACT; IMPLEMENTATION Procedures for...

  19. The Preparation and Thermodynamics of Europium Dicarbide; Preparation et Thermodynamique du Bicarbure d'Europium; Poluchenie i termodinamicheskie svojstva dikarbida evropiya; Preparacion y Termodinamica del Dicarburo de Europio

    Energy Technology Data Exchange (ETDEWEB)

    Gebelt, R. E. [Oklahoma State University, Stillwater, OK (United States); Eick, H. A. [Michigan State University, East Lansing, MI (United States)

    1966-01-15

    Europium dicarbide has been prepared by the reaction of europium metal and graphite in a stainless steel bomb. Chemical analysis indicates an average composition of the product of EuC{sub 1.87{+-}0.07}. X-ray powder diffraction analysis shows the compound to be of body-centred tetragonal symmetry, space group D{sup 17}{sub 4}n-14/mm , with lattice parameters: a{sub 0} = 4.045 A; c{sub 0} = 6.645 A. Vapour phase chromatographic analysis indicates that 98% of the gaseous product of acid hydrolysis of europium dicarbide is the hydrocarbon acetylene. These analytical data, together with the lattice parameters, indicate that europium dicarbide resembles alkaline earth dicarbides more than it resembles the other lanthanon dicarbides. The vaporization of europium dicarbide over the temperature range 1130 to 1600 Degree-Sign K was investigated by the Knudsen effusion method. The effusate was either collected and analysed chemically or observed with a time-of-flight mass spectrometer. Thedata presented here are based predominantly on the massspectro- metric observations since they yielded more reproducible data than the collection technique. Gaseous europium dicarbide and europium, in concentrations of 1 and 99%respectively, were found in the effusate. Instrument limitations prevented determination of the concentration of the gaseous dicarbide as a function of temperature. Calibration of the mass spectrometer with silver permitted the calculation of the pressures corresponding to the observed ion intensities. An empirical equation was fitted to the data for europium by the method of least squares. From the second law of thermodynamics the following values were calculated for the reaction: EuC{sub 2} Rightwards-Harpoon-Over-Leftwards-Harpoon Eu(g) + 2C (graphite); {Delta}H{sup 0}{sub 298} = 51.09{+-}1.42kcal/mole; {Delta}H{sup 0}{sub 298} = 18.43 {+-} 1.75 e.u. Values of the free energy function for EuC{sub 2}(s) were estimated and combined with published data to yield for

  20. Measurement limits to 134Cs concentration in soil

    International Nuclear Information System (INIS)

    Ahn, J.K.; Kim, J.S.; Lee, H.M.; Kim, H.; Kim, T.H.; Park, J.N.; Kang, Y.S.; Lee, H.S.; Kim, S.J.; Park, J.Y.; Ryu, S.Y.; Kim, H.-Ch.; Kang, W.G.; Kim, S.K.

    2011-01-01

    We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the 134 Cs. In order to lower the minimum detectable amount (MDA) of activity for the 134 Cs, we have used the ammonium molybdophosphate (AMP) precipitation method to get rid of the 40 K existing in natural radioactivity, which reduces the MDA activity about 10 times smaller than those without the AMP precipitation method. The MDA results for the 134 Cs were found to be in the range between 0.015 and 0.044 Bq/kg-dry weight. In order to diminish the background, we also have measured a part of the soil samples in Yangyang, a small town in the east coast of Korea. However, it turns out that in order to detect the 134 Cs in the samples the MDA should be reduced to the level of mBq/kg-dry weight. - Highlights: → We study the caesium concentrations in soils in mountain areas near Gori NPT in Korea. → We use the AMP precipitation method to lower the minimum detectable amount (MDA) of activity for the 134 Cs. → The results of the MDA for the 134 Cs turn out to be in the range between 0.015 and 0.044. → In order to detect the 134 Cs in the samples, the MDA should be reduced to the level of mBq/kg-dry weight.

  1. MicroRNA-134 regulates poliovirus replication by IRES targeting

    OpenAIRE

    Bakre, Abhijeet A.; Shim, Byoung-Shik; Tripp, Ralph A.

    2017-01-01

    Global poliovirus eradication efforts include high vaccination coverage with live oral polio vaccine (OPV), surveillance for acute flaccid paralysis, and OPV “mop-up” campaigns. An important objective involves host-directed strategies to reduce PV replication to diminish viral shedding in OPV recipients. In this study, we show that microRNA-134-5p (miR-134) can regulate Sabin-1 replication but not Sabin-2 or Sabin-3 via direct interaction with the PV 5′UTR. Hypochromicity data showed miR-134 ...

  2. 134Cs emission probabilities determination by gamma spectrometry

    Science.gov (United States)

    de Almeida, M. C. M.; Poledna, R.; Delgado, J. U.; Silva, R. L.; Araujo, M. T. F.; da Silva, C. J.

    2018-03-01

    The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of 134Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. 134Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration. The gamma emission probabilities (Pγ) were determined mainly for some energies of the 134Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1).

  3. Characterization of the europium tetracycline complex as a biomarker for atherosclerosis

    Science.gov (United States)

    Courrol, Lilia C.; da Silva, Mônica N.; Sicchieri, Leticia B.

    2016-04-01

    Atherosclerosis is a narrowing of the arteries caused by an increase of atheromatous plaque: material formed by macrophage cells containing cholesterol and fatty acids, calcium and a variable amount of fibrous connective tissue. The elation between vulnerable plaques and cardiovascular events can be determined using plaque biomarkers. In this work, atherosclerotic plaques stained with different molar ratios of europium, in a potential plaque biomarker, europium tetracycline complex, were studied by fluorescence microscopy. The tetracycline antibiotic used was chlortetracycline. The growth of atherosclerotic plaque was followed during 60 days in New Zealand rabbits divided in two groups: an experimental group (EG), with nine animals and a control group (CG) with three animals. The animals in the EG received a diet with 1% of cholesterol and the animals of GC received a normal diet. The aortic arch of the animals with 60 days were cut in the vertical plane in 6 μm thick slices, which were mounted on glass slides and stained with hematoxylin an eosin and europium chlortetracycline complex (EuCTc). The fluorescence images were obtained exciting the EuCTc absorption band with a filter cube D (BP 355 - 425) and the emission was collected with a LP 470 suppression filter. Light intensity, detector gain and acquisition time were fixed for comparisons. The 20× magnified images were collected with 12 bit (or 4096 gray tones) resolution. The mean value of gray scale for each molar ratio of EuCTc was different, indicating that the complex interacts with the components of atherosclerotic plaque and the best molar ratio was 1.5 EuCTc. These results indicate the potential use of the EuCTc biomarker for atherosclerotic plaque characterization.

  4. Europium sorption on zirconia at elevated temperatures: experimental study and modeling

    International Nuclear Information System (INIS)

    Eglizaud, N.; Catalette, H.

    2005-01-01

    Full text of publication follows: Direct disposal of spent nuclear fuel in deep underground repository is being considered by several countries. The waste package maintains an elevated temperature for thousands of years. As sorption is one of the main phenomenon limiting the dispersion of radionuclides in the environment, it has to be studied at elevated temperatures. Zirconia is an oxide produced by cladding oxidation which is suspected in the near field of a nuclear repository. It then could possibly be in contact with waste elements as Europium (III), the sorption of which is therefore studied on zirconia. Experiments were performed by the batch method at a solid/liquid ratio of 10 g.L-1. The sorption edges were recorded in the pH-range from 2 to 10 at 2.10 -5 mol.L -1 Eu(NO 3 ) 3 (I = 0.1 mol.L -1 KNO 3 ). An over-pressure device in an autoclave with an incorporated filtering system allowed the experiments, carbonate free, at 25 deg. C, 50 deg. C, 80 deg. C, 120 deg. C and 150 deg. C and in situ pH measurements. Filtrates were analyzed by the ICP-AES method. Sorption isotherms show an increase in the sorption phenomenon when the temperature raises. The half sorption pH decreases from 7 at 25 deg. C to 3,6 at 150 deg. C. The distribution coefficients that were obtained at elevated temperatures enriched the databases of integrated performance assessment codes. Raw data were modeled with the surface complexation theory using the double layer model (DLM). Several possible surface complexes were examined and discussed, taking into account aqueous hydrolyzed and precipitated species of Europium. A good agreement between experimental values and modeled isotherms was found at all studied temperatures. Results were consistent with a bidentate complex formed by Europium (III) on the zirconia surface. Associated formation constants were then determined with the geochemical computer code CHESS. (authors)

  5. Preparation and luminescence of silica aerogel composites containing an europium (III) phenanthroline nitrate complex

    Energy Technology Data Exchange (ETDEWEB)

    Gutzov, Stoyan, E-mail: sgutzov@chem.uni-sofia.bg [University of Sofia “St. Kliment Ohridski”, Department of Physical Chemistry, J. Bourchier Blvd. 1, 1164 Sofia (Bulgaria); Danchova, Nina; Kirilova, Rada; Petrov, Vesselin [University of Sofia “St. Kliment Ohridski”, Department of Physical Chemistry, J. Bourchier Blvd. 1, 1164 Sofia (Bulgaria); Yordanova, Stanislava [University of Sofia “St. Kliment Ohridski”, Department of Organic Chemistry, J. Bourchier Blvd. 1, 1164 Sofia (Bulgaria)

    2017-03-15

    A simple two step procedure for the functionalization of hydrophobic silica aerogel microgranules with europium ions and/or 1,10 - phenanthroline is demonstrated. The activation procedure is based on soaking aerogels in a europium nitrate solution, followed by functionalization with 1,10 – phenanthroline. The functionalized materials display strong red or blue emission at UV-excitation, coming from the formation of [Eu(phen){sub 2}](NO{sub 3}){sub 3} or Si(IV)– 1,10-phenathroline complexes in the porous system of the aerogels. The most probable site symmetry of the europium cation is C{sub 2v} confirmed by luminescence spectra analysis. Room temperature diffuse reflectance spectra and excitation/luminescence spectra are used to describe the optical properties of the hybrid composites. Excitation spectra prove an efficient energy transfer between 1,10 – phenanthroline and the Eu{sup 3+} ion. - Graphical abstract: An effective activation procedure for functionalization of silica aerogel granules with [Eu(phen){sub 2}](NO{sub 3}){sub 3} and/or 1,10 – phenanthroline /phen/ has been demonstrated in order to obtain red or blue emitting materials. Luminescence spectra (excitation at 355 nm) of functionalized aerogel granules: 1 – SiO{sub 2}:0.18phen; 2 – [Eu(phen){sub 2}](NO{sub 3}){sub 3}; 3– SiO{sub 2}:0.007Eu(phen){sub 2}(NO{sub 3}){sub 3}. The Eu{sup 3+} f-f {sup 5}D{sub 0} →{sup 7}F {sub 0,1,2,3,4} emission transitions are denoted as 0-0, 0-1, 0-2, 0-3, 0-4. The most probable site symmetry of Eu3{sup +} ion is C{sub 2v}.

  6. Electron-induced desorption of europium atoms from oxidized tungsten surface: concentration dependence of low-energy peak

    CERN Document Server

    Davydov, S Y

    2002-01-01

    One discusses nature of electron induced desorption of Eu sup 0 europium atoms under E sub e irradiating electron low-energies (approx 30 eV) and peculiarities of yield dependence of Eu sup 0 atoms on their concentration at oxidized tungsten surface. Primary act of vacancy origination in europium adatom inner 5p-shell turned to be the determining stage. Evaluations have shown that just the first of two possible scenarios of ionization (electron intra-atomic to Eu adatom external quasi-level or realise of knocked out electron into vacuum) leads to Eu sup 0 desorption. One determined concentration threshold for yield of Eu sup 0 atoms

  7. Highly specific ''sensing'' of tryptophan by a luminescent europium(III) complex

    Energy Technology Data Exchange (ETDEWEB)

    Stubenrauch, Jan A.; Mevissen, Christian; Schulte, Marie F.; Bochenek, Steffen; Albrecht, Markus [RWTH Univ. Aachen (Germany). Inst. fuer Organische Chemie; Subramanian, Palani S. [Central Salt and Marine Chemicals, Research Institute (CSRI), Gujarat (India)

    2016-07-01

    The europium(III) complex 1-Cl{sub 3} (S,S-2,2{sup '}-(((1,10-phenanthroline-2,9-diyl)bis(methanylylidene))bis (azanylyliden e))bis(3-methylbutanamide)europiumtrichloride) undergoes, only in the presence of the amino acid tryptophan, a change of emission at 615 nm. In the presence of few equivalents of tryptophan, emission of the europium complex is enhanced while it disappears upon addition of large amounts. This behavior can be assigned to displacement of the sensitizing phenanthroline ligand of 1-Cl{sub 2} x Trp in the latter case.

  8. Different-ligand coordination europium compounds with dibenzoylmethane, nitrate-group, and hexamethylphosphotriamide

    International Nuclear Information System (INIS)

    Karasev, V.E.; Botova, I.N.

    1988-01-01

    Some different-ligand europium complexes with dibenzoylmethane (DBM), hexamethylphosphotriamide (HMPA) and NO 3 -group of composition: Eu(NO 3 ) 3 x3HMPAx2H 2 O, Eu(NO 3 ) 2 xDBMx2HMPA, EuNO 3 x(DBM) 2 x2HMPA and Eu(DBM) 3 xHMPA are synthesized. Individuality of each complex is confirmed by methods of chemical, IR spectroscopic, luminescent, thermogravimetric analyses. Integral intensities of luminescence of synthesized complexes are measured, their excitation spectra in the crystal state at 77 K in the 200-600 nm range are studied

  9. Synthesis of mixed ligand europium complexes: Verification of predicted luminescence intensification

    International Nuclear Information System (INIS)

    Lima, Nathalia B.D.; Silva, Anderson I.S.; Gonçalves, Simone M.C.; Simas, Alfredo M.

    2016-01-01

    Mixed ligand europium complexes are predicted to be more luminescent than what would be expected from their corresponding repeating ligand compounds according to a conjecture recently advanced by our research group; a conjecture that has already been validated for strongly luminescent europium complexes. In this article, we seek to further verify the validity of this conjecture for complexes which are much more symmetric, and which thus display lower levels of luminescence. Accordingly, we synthesized complexes Eu(DBM) 3 (L) 2 , and all novel mixed ligand combinations Eu(DBM) 3 (L,L') with L and L' equal to DBSO, PTSO, and TPPO. The syntheses were carried out via displacement reactions from the starting complex Eu(DBM) 3 (H 2 O) 2 , passing through the intermediates Eu(DBM) 3 (L) 2 and finally, by displacement of L by L', arriving at Eu(DBM) 3 (L,L'). The ligands L obey the following order of displacement TPPO>PTSO>DBSO>H 2 O, which had been previously described by our group. In the present article, we further show that this displacement order could have been predicted by Sparkle/RM1 thermochemical calculations. Subsequently, we determined the radiative decay rates, A rad , for all six compounds by photophysical measurements. As expected, results show that the measured A rad values for all novel mixed ligand complexes are larger than the average of the A rad values for the corresponding repeating ligand coordination compounds. In conclusion, the present article does broaden the scope of our conjecture, which enunciates that an increase in the diversity of ligands around the europium ion tends to intensify the luminescence. - Highlights: • Mixed ligand europium complexes are predicted to be more luminescent than repeating ligand ones. • Radiative decay rates increase with structural coordination asymmetry. • The non-ionic ligands displacement order in substitution reactions is TPPO>PTSO>DBSO>H 2 O. • Sparkle/RM1 correctly predicts the

  10. Test of zircon materials for sorption of europium; Pruebas de materiales circoniferos para sorcion de europio

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Fernandez V, S.M.; Garcia R, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2003-07-01

    In previous works it has already been made notice that some phosphates have the property of sipping radioactive metals in solution, what takes advantage to fabricate reactive barriers that are placed in the repositories of nuclear wastes. In our laboratory it has been obtained to the zirconium silicate (ZrSiO{sub 4}) and the alpha zirconium hydrogen phosphate (Zr(HPO{sub 4}) 2H{sub 2}0) starting from sea sand in an easy and economic way. With the interest of knowing if these compounds can be used in contention barriers the evaluation of their surface properties it is made and of europium sorption. (Author)

  11. Determination of micro amounts of samarium and europium by analogue derivative spectrophotometry

    International Nuclear Information System (INIS)

    Ishii, H.; Satoh, K.

    1982-01-01

    Derivative spectrophotometry using the analogue differentiation circuit was applied to the determination of samarium and europium at ppm levels. By measuring the second or the fourth derivative spectra of the characteristic absorption bands of both the rare earth ions around 400 nm, they can be determined directly and selectively in the presence of large amounts of most other rare earths without any prior separation. Further, aptly selecting conditions for the measurement of the derivative spectra, the simultaneous determination of both the rare earth elements was feasible. The principle and the characteristics of analogue derivative spectrophotometry are also described. (orig.) [de

  12. Spectroscopic studies of 2-thenoyltrifluoro acetonate of uranyl salts doped with europium

    International Nuclear Information System (INIS)

    Nakagawa, F.T.; Luiz, J.E.M. de Sa; Felinto, M.C.F.C.; Brito, H.F.; Teotonio, E.E.S.

    2006-01-01

    Uranyl compounds present a great potential as luminescence materials. Some examples of applications are: in laser technology, cathode ray tube, X-rays diagnostic. In this work it was studied the synthesis, characterization and spectroscopic properties study of uranyl 2-thenoyl trifluoroacetonate and uranyl 2- thenoyl trifluoroacetonate doped with europium. The compounds were synthesized and characterized by infrared absorption spectroscopy, thermal analysis, scanning electronic microscopy, and electronic spectroscopy of emission and excitation. The Eu 3+ ion acted as an effective luminescent probe, however the process of energy transfer from UO 2 2+ to Eu 3+ ion has not been efficient. (author)

  13. Positive parity states and some electromagnetic transition properties of even-odd europium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Yazar, Harun Resit, E-mail: yazar@nevsehir.edu.tr [Nevsehir University, Faculty of Art and Science (Turkey)

    2013-06-15

    The positive-parity low-spin states of even-odd Europium isotopes ({sup 151-155}Eu) were studied within the framework of the interacting boson-fermion model. The calculated positive low-spin state energy spectra of the odd Eu isotope were found to agree quite well with the experimental data. The B(E2) values were also calculated and it was found that the calculated positive-parity low-spin state energy spectra of the odd-A Eu isotopes agree quite well with the experimental data.

  14. Luminescent sensing of organophosphates using europium(III) containing imprinted polymers prepared by RAFT polymerization

    International Nuclear Information System (INIS)

    Southard, Glen E.; Van Houten, Kelly A.; Ott, Edward W.; Murray, George M.

    2007-01-01

    Molecularly imprinted polymers capable of sensing organophosphorous compounds by luminescence have been prepared by reversible addition fragmentation chain transfer (RAFT) polymerization. The polymer contained a dithiobenzoate substituted tris(β-diketonate) europium(III) complex which served as a polymerization substrate and as a luminescent binding site for pinacolyl methylphosphonate (PMP), the hydrolysis product of the nerve agent Soman. The resultant polymer allowed quantitation of PMP in the low ppb range with minimal interference from similar compounds. Polymers were characterized by luminescence spectroscopy and scanning electron microscopy

  15. Spectral-luminescent investigation of polymers doped with europium trisphenoyltrifluoroacetonate compound with 1,10-phenanthroline

    International Nuclear Information System (INIS)

    Karasev, V.E.; Mirochnik, A.G.; Shchelokov, R.N.

    1983-01-01

    Spectral-luminescent characteristics of europium tristhenoyltrifluoroacetonate with 1.10-phenanthpoline in polystyrepe and polyvinyl chloride are investigated. E 4 (TTA) 3 phen during introduction into polymers preserves its composition and structure. Weak temperature dependence of half-Width of luminescent lines qualitatively different from the case of crystal chelate is characteristic for polymers doped with E 4 (TTA) 3 xphen. Investigation into temperature dependence of E 4 3+ luminescent intensity in chelate doped polymers proves the conclusion on weakening processes of excitation energy relaxation by vibration constituents of close and far environment during chelate introduction into polymers

  16. A microemulsion preparation of nanoparticles of europium in silica with luminescence enhancement using silver

    International Nuclear Information System (INIS)

    Ma Zhiya; Dosev, Dosi; Kennedy, Ian M

    2009-01-01

    A facile one-pot microemulsion method has been developed for the synthesis of spherical silver core-silica shell (Ag-SiO 2 ) nanoparticles with europium chelates doped in the shell through a silane agent. The method is significantly more straightforward than other extant methods. Measurements of the luminescent emissions from the Ag-SiO 2 nanoparticles, in comparison with control silica nanoparticles without silver cores, showed that the presence of the silver cores can increase the fluorescence intensity approximately 24-fold and decrease the luminescence lifetime. This enhancement offers a potential increase in overall particle detectability with increased fluorophore photostability.

  17. The different-ligand complexing of europium with complexones and β-diketones in micellar solution

    International Nuclear Information System (INIS)

    Svetlova, I.E.; Dobrynina, N.A.; Smirnova, N.S.; Martynenko, L.I.; Evseev, A.M.; Savitskij, A.P.

    1989-01-01

    Method of pH-metric titration with mathematical simulation was used to study the effect of nonionic surfactant (polyoxyethyleneoctylphenyl este) on stability of europium complexes with cyclohexanediaminetetraacetic and ethylenediaminetetraacetic acids. Optimal conditions for ternary complex formation in the system Eu 3+ -complexone-β-diketone at pH 7.0-9.0 were found. Complex-compositions were determined and their stability constants were calculated. It is shown that complex stability decreases by several orders in micellar solutions, tecause β-diketone introduction to the solution decreases thermodynamic stability of complexes

  18. Trace electrochemical analysis of Europium, Ytterbium, and Cerium at their joint presence in solution

    Directory of Open Access Journals (Sweden)

    Rema Matakova

    2012-03-01

    Full Text Available In the course of several decades at the department of analytical chemistry and chemistry of rare elements there were studied the electrode processes with participation of rare-earth metals (REM in accordance with the long awaiting problem of the development of rare-metal and rare-earth branch of non-ferrous metallurgy of Kazakhstan. With the aim of express and highly sensitive analytical control of raw materials and final product of rare-earth industry there were developed the methods of inversion-voltamperometric determination of low concentrations of europium, ytterbium and cerium under the conditions of their individual and combined presence in the solution.

  19. Preparation and fluorescent recognition properties for fluoride of a nanostructured covalently bonded europium hybrid material

    Institute of Scientific and Technical Information of China (English)

    余旭东; 李景印; 李亚娟; 耿丽君; 甄小丽; 于涛

    2015-01-01

    A novel covalently bonded Eu3+-based silica hybrid material was designed and its spectrophotometric anion sensing prop-erty was studied. The fluorescent receptor (europium complex) was covalently grafted to the silica matrix via a sol-gel approach. FTIR, UV-vis spectra, scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD) and photoluminescent spectra were characterized, and the results revealed that the hybrid material with nanosphere structure displayed excellent photophysical property. In addition, the selective anion sensing property of the hybrid material was studied by UV-vis and fluorescence spectra. The results showed that the hybrid material exhibited a smart response with fluoride anions.

  20. The condition for electroplex emission from an europium complex doped poly( N-vinylcarbazole)

    Science.gov (United States)

    Zhang, T.; Xu, Z.; Qian, L.; Tao, D. L.; Teng, F.; Gao, X.; Xu, X. R.

    2005-10-01

    Spectral characteristics of photoluminescence (PL) and electroluminescence (EL) of poly( N-vinylcarbazole) (PVK) matrices doped with a novel europium complex Eu(aspirin) 3phen were investigated. A red-shift and broadening were observed in the EL spectra but not in the PL ones. However, neither red-shift nor broadening were observed in the EL spectra of PVK doped with a similar complex with the same ligand, terbium complex (Tb(aspirin) 3phen). This result suggests the formation of electroplexes in blend systems, which is likely due to inefficient energy transfer from host molecules to dopant molecules.

  1. Thermal expansion studies on europium titanate (Eu2TiO5)

    International Nuclear Information System (INIS)

    Panneerselvam, G.; Subramanian, G.G.S.; Antony, M.P.

    2008-01-01

    The lattice thermal expansion characteristics of europium titanate (Eu 2 TiO 5 ) have been studied by measuring the lattice parameter by high temperature X-ray diffraction technique (HT-XRD) in the temperature range 298-1573K. Percentage linear thermal expansion and mean linear thermal expansion coefficients were computed from the lattice parameter data. The percentage linear thermal expansion in the temperature range 298-1573 K along a, b and c axes are 1.05, 1.15 and 0.95 respectively. (author)

  2. Temperature dependence of the luminescence lifetime of a europium complex immobilized in different polymer matrices

    Energy Technology Data Exchange (ETDEWEB)

    Basu, Bharathi Bai J. [Surface Engineering Division, National Aerospace Laboratories, Bangalore 560017 (India)], E-mail: bharathi@css.nal.res.in; Vasantharajan, N. [Surface Engineering Division, National Aerospace Laboratories, Bangalore 560017 (India)

    2008-10-15

    The temperature dependence of the luminescence lifetime of temperature sensor films based on europium (III) thenoyltrifluoroacetonate (EuTTA) as sensor dye in various polymer matrices such as polystyrene (PS), polymethylmethacrylate (PMMA), polyurethane (PU) and model airplane dope was studied and compared. The luminescence lifetime of EuTTA was found to depend on the polymer matrix. The temperature sensitivity of lifetime was maximum for EuTTA-PS coating in the temperature range of 10-60 deg. C. The effect of concentration of the sensor dye in the polymer on the lifetime and temperature sensitivity was also studied.

  3. Influence of biofilms on migration of uranium, americium and europium in the environment

    International Nuclear Information System (INIS)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-01-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  4. Synthesis and structural characterization of an unusual heterometallic europium(III) amidinate complex

    International Nuclear Information System (INIS)

    Sroor, Farid M.; Hrib, Cristian G.; Hilfert, Liane; Edelmann, Frank T.

    2015-01-01

    The reaction of EuI_2(THF)_2 with 3 equiv. of the recently discovered lithium-cyclopropylethinylamidinate Li[c-C_3H_5-C≡C-C(NCy)_2] (1) (Cy = cyclohexyl) unexpectedly afforded the heterometallic europium(III) amidinate complex [{c-C_3H_5-C≡C-C(NCy)_2}Li{c-C_3H_5-C≡C-C(NCy)_2}_2Eu(μ-I)_2Li(THF)_2] (2) in the form of bright yellow, air- and moisture-sensitive crystals. An X-ray diffraction study of 2 revealed several unusual structural features. It comprises a double ''ate'' complex of the tentative trivalent europium(III) bis(cyclopropylethinylamidinate) derivative [c-C_3H_5-C≡C-C(NCy)_2]_2Eu"I"I"II. ''Ate'' complex formation occurred not only through retention of one equiv. of lithium iodide but also through addition of one equiv. of Li[c-C_3H_5-C≡C-C(NCy)_2]. The Li atom in the iodo-bridged Eu(μ-I)_2Li(THF)_2 part of the molecule is tetrahedrally coordinated, whereas the second lithium atom is only tricoordinate through the presence of a rare monodentate (dangling) amidinate ligand. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  5. Determination for Enterobacter cloacae based on a europium ternary complex labeled DNA probe

    Science.gov (United States)

    He, Hui; Niu, Cheng-Gang; Zeng, Guang-Ming; Ruan, Min; Qin, Pin-Zhu; Liu, Jing

    2011-11-01

    The fast detection and accurate diagnosis of the prevalent pathogenic bacteria is very important for the treatment of disease. Nowadays, fluorescence techniques are important tools for diagnosis. A two-probe tandem DNA hybridization assay was designed for the detection of Enterobacter cloacae based on time-resolved fluorescence. In this work, the authors synthesized a novel europium ternary complex Eu(TTA) 3(5-NH 2-phen) with intense luminescence, high fluorescence quantum yield and long lifetime before. We developed a method based on this europium complex for the specific detection of original extracted DNA from E. cloacae. In the hybridization assay format, the reporter probe was labeled with Eu(TTA) 3(5-NH 2-phen) on the 5'-terminus, and the capture probe capture probe was covalent immobilized on the surface of the glutaraldehyde treated glass slides. The original extracted DNA of samples was directly used without any DNA purification and amplification. The detection was conducted by monitoring the fluorescence intensity from the glass surface after DNA hybridization. The detection limit of the DNA was 5 × 10 -10 mol L -1. The results of the present work proved that this new approach was easy to operate with high sensitivity and specificity. It could be conducted as a powerful tool for the detection of pathogen microorganisms in the environment.

  6. Luminescence variations in europium-doped silicon-substituted hydroxyapatite nanobiophosphor via three different methods

    Energy Technology Data Exchange (ETDEWEB)

    Thang, Cao Xuan; Pham, Vuong-Hung, E-mail: vuong.phamhung@hust.edu.vn

    2015-07-15

    Highlights: • Europium doped silicon-substituted hydroxyapatite was synthesized by wet chemical synthesis method. • Morphology of nanoparticles depended on the synthesized method. • Photoluminescence intensity of the sample increases with the increasing of Si substitutions, Eu dopants and thermal annealing. - Abstract: This paper reports the first attempt for the synthesis of europium-doped Si-substituted hydroxyapatite (HA) nanostructure to achieve strong and stable luminescence of nanobiophosphor, particularly, by addition of different Eu dopants, Si substitutions, and application of optimum annealing temperatures of up to 1000 °C. The nanobiophosphor was synthesized by the coprecipitation, microwave, and hydrothermal methods. The nanoparticles demonstrated a nanowire to a spindle-like morphology, which was dependent on the method of synthesis. The photoluminescence (PL) intensity of the sample increases with the increase in Si substitutions and Eu dopants. The luminescent nanoparticles also showed the typical luminescence of Eu{sup 3+} centered at 610 nm, which was more efficient for the annealed Eu-doped Si-HA nanoparticles than for the as-synthesized nanoparticles. Among the different synthesis methods, the hydrothermal method reveals the best light emission represented by high PL intensity and narrow PL spectra. These results suggest the potential application of Eu-doped Si-HA in stable and biocompatible nanophosphors for light emission and nanomedicine.

  7. Red light emission from europium doped zinc sodium bismuth borate glasses

    Science.gov (United States)

    Hegde, Vinod; Viswanath, C. S. Dwaraka; Upadhyaya, Vyasa; Mahato, K. K.; Kamath, Sudha D.

    2017-12-01

    Zinc sodium bismuth borate (ZNBB) glasses doped with different concentrations of europium were prepared by conventional melt quenching method and characterized through the measurements of density, refractive index, X-ray diffraction (XRD), Fourier Transform Infrared (FTIR) spectra, optical absorption, luminescence and radiative lifetimes. FTIR spectra showed seven characteristic peaks of bismuth and borate functional groups in the range of 400-1600 cm-1. The optical band gap and bonding parameters have been calculated from absorption spectra. Photoluminescence spectra recorded in the visible region with 394 nm excitation are used to calculate the Judd-Ofelt (JO) intensity parameters (Ω2 and Ω4). The JO intensity parameters have been used to calculate the radiative parameters such as branching ratio (β), stimulated emission cross-section (σse), transition probability (A) for the fluorescent level of 5D0→7F2. Decay rates through single exponential are used to calculate the lifetime (τm) of the meta-stable state 5D0 of (Eu3+ ion) these glasses. The radiative parameters measured for all these glasses show 0.7 mol% europium doped zinc sodium bismuth borate glass 5D0→7F2 transition has the potential for red laser applications. The quality of the colour emitted by the present glasses are estimated quantitatively by CIE chromaticity coordinates, which confirms the suitability of these glasses as a red emitting material for field emission technologies and LEDs.

  8. Theoretical spectroscopic study of the conjugate microcystin-LR-europium cryptate

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Julio G.; Dutra, Jose Diogo L.; Costa Junior, Nivan B. da; Freire, Ricardo O., E-mail: rfreire@ufs.br [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Quimica; Alves Junior, Severino; Sa, Gilberto F. de [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Quimica Fundamental

    2013-02-15

    In this work, theoretical tools were used to study spectroscopic properties of the conjugate microcystin-LR-europium cryptate. The Sparkle/AM1 model was applied to predict the geometry of the system and the INDO/S-CIS model was used to calculate the excited state energies. Based on the Judd-Ofelt theory, the intensity parameters were predicted and a theoretical model based on the theory of the 4f-4f transitions was applied to calculate energy transfer and backtransfer rates, radiative and non-radiative decay rates, quantum efficiency and quantum yield. A detailed study of the luminescent properties of the conjugate Microcystin-LR-europium cryptate was carried out. The results show that the theoretical quantum yield of luminescence of 23% is in good agreement with the experimental value published. This fact suggests that this theoretical protocol can be used to design new systems in order to improve their luminescence properties. The results suggest that this luminescent system may be a good conjugate for using in assay ELISA for detection by luminescence of the Microcystin-LR in water. (author)

  9. Europium-doped amorphous calcium phosphate porous nanospheres: preparation and application as luminescent drug carriers

    Directory of Open Access Journals (Sweden)

    Zhang Kui-Hua

    2011-01-01

    Full Text Available Abstract Calcium phosphate is the most important inorganic constituent of biological tissues, and synthetic calcium phosphate has been widely used as biomaterials. In this study, a facile method has been developed for the fabrication of amorphous calcium phosphate (ACP/polylactide-block-monomethoxy(polyethyleneglycol hybrid nanoparticles and ACP porous nanospheres. Europium-doping is performed to enable photoluminescence (PL function of ACP porous nanospheres. A high specific surface area of the europium-doped ACP (Eu3+:ACP porous nanospheres is achieved (126.7 m2/g. PL properties of Eu3+:ACP porous nanospheres are investigated, and the most intense peak at 612 nm is observed at 5 mol% Eu3+ doping. In vitro cytotoxicity experiments indicate that the as-prepared Eu3+:ACP porous nanospheres are biocompatible. In vitro drug release experiments indicate that the ibuprofen-loaded Eu3+:ACP porous nanospheres show a slow and sustained drug release in simulated body fluid. We have found that the cumulative amount of released drug has a linear relationship with the natural logarithm of release time (ln(t. The Eu3+:ACP porous nanospheres are bioactive, and can transform to hydroxyapatite during drug release. The PL properties of drug-loaded nanocarriers before and after drug release are also investigated.

  10. Resonance ionization spectroscopy of Europium The first application of the PISA at ISOLDE-RILIS

    CERN Document Server

    AUTHOR|(CDS)2099873; Marsh, Bruce Alan

    The following work has been carried out at the radioactive ion beam facility ISOLDE at CERN. A compact atomic beam unit named PISA (Photo Ionization Spectroscopy Apparatus) has been implemented as a recent addition to the laboratory of the Resonance Ionization Laser Ion Source (RILIS). The scope of this thesis work was to demonstrate different applications of the PISA, using the existing and highly developed laser setup of the RILIS installation. In a demonstration of the suitability of PISA for ionization scheme development, a new ionization scheme for Europium has been developed. This resulted in the observation of several new autoionizing states and Rydberg series. Through the analysis of the observed Rydberg resonances a refined value of $45734.33(3)(3)$ cm$^{-1}$ for the ionization potential of the europium atom has been determined. In addition this thesis reports on the feasibility of the use of the PISA as a RILIS performance monitoring device during laser ion source operations. Finally the present wor...

  11. Study of Polymeric Luminescent Blend (PC/PMMA) Doped with Europium Complex under Gamma-Iradiation

    International Nuclear Information System (INIS)

    Parra, D. F.

    2006-01-01

    Spectroscopic properties of blends formed by bisphenol-A polycarbonate (PC) and poly(methyl methacrylate) (PMMA) doped with europium in organic complex were studied. Polymeric luminescent blends are potential materials for many applications; however, little information has been reported concerning the stability under thermal and radiation conditions. Luminescent films were synthesized from europium thenoyltrifluoroacetonate at different concentrations doped in PC/PMMA blends. Films produced of the luminescent polymer blend were irradiated in a 60 C o source. Their luminescent properties, in the solid state, as well as, the thermal oxidative resistance after gamma irradiation was investigated. These systems were characterized by elemental analysis, thermogravimetry (TGA), differential scanning calorimetry (DSC) and infrared spectroscopy (FTIR). Based on TGA data, the thermal stability of PC/PMMA:(tta)3 system is higher than the polymer blend. The DSC results indicated that those new systems are chemically stables. The emission spectra of the Eu 3 +-tta complex doped in the PC/PMMA recorded at 298 and 77 K exhibited the characteristic bands arising from the 5 D 0 →7 F J transitions (J = 0-6). The luminescence intensity decreases with increasing of precursor concentration in the doped polymer obtained by chemical reaction. This result is different from that of samples obtained by physical method in melting doping. The blend was irradiated under ionizing radiation of 60 C o source. After irradiation of the luminescent films the physical properties of luminescence, thermal and oxidative stability were evaluated.(Fapesp and Cnpq financial support)

  12. Rapid screening of oxytetracycline residue in catfish muscle by dispersive liquid-liquid microextraction and europium-sensitized luminescence

    Science.gov (United States)

    Oxytetracycline (OTC) residue in catfish muscle was screened by dispersive liquid-liquid microextraction (DLLME) and europium-sensitized luminescence (ESL). After extraction in EDTA, HCl, and acetonitrile, cleanup was carried out by DLLME, and ESL was measured at microgram = 385 nm and wavelength = ...

  13. Synthesis and luminescence properties of europium and terbium complexes with pyridine- or bipyridine-linked oligothiophene ligand

    International Nuclear Information System (INIS)

    Liu Ping; Huang Mingsheng; Pan Wanzhang; Zhang Yamin; Hu Jianhua; Deng Wenji

    2006-01-01

    With an aim to develop novel luminescence materials, europium and terbium complexes of 2,5-(2-thiophene)-pyridine (TPY) and 5,5'-bis(5-(2,2'-bithiophene))-2,2'-bipyridine (B2TBPY) were synthesized, and their luminescence properties studied. The complexes exhibit ligand-sensitized emission, which is typical of Eu(III) and Tb(III) ions

  14. {sup 134}Cs emission probabilities determination by gamma spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, M.C.M. de, E-mail: candida@cnen.gov.br [Comissão Nacional de Energia Nuclear (DINOR/CNEN), Riode Janeiro, RJ (Brazil); Poledna, R.; Delgado, J.U.; Silva, R.L.; Araujo, M.T.; Silva, C.J. da [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2017-07-01

    The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of {sup 134}Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. {sup 134}Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration.The gamma emission probabilities (Pγ) were determined mainly for some energies of the {sup 134}Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1). (author)

  15. Structural and luminescence properties of europium(III)-doped zirconium carbonates and silica-supported Eu3+-doped zirconium carbonate nanoparticles

    International Nuclear Information System (INIS)

    Sivestrini, S.; Riello, P.; Freris, I.; Cristofori, D.; Enrichi, F.; Benedetti, A.

    2010-01-01

    The synthesis, morphology and luminescence properties of europium(III)-doped zirconium carbonates prepared as bulk materials and as silica-supported nanoparticles with differing calcination treatments are reported. Transmission electron microscopy and X-ray diffraction analyses have, respectively, been used to study the morphology and to quantify the atomic amount of europium present in the optically active phases of the variously prepared nanomaterials. Rietveld analysis was used to quantify the constituting phases and to determinate the europium content. Silica particles with an approximate size of 30 nm were coated with 2 nm carbonate nanoparticles, prepared in situ on the surface of the silica core. Luminescence measurements revealed the role of different preparation methods and of europium-doping quantities on the optical properties observed.

  16. Determination of the hydrolysis constants of Europium (III), in ion strength media 4, 5 and 6 M NaClO4 at 303 K

    International Nuclear Information System (INIS)

    Alvarado B, A.; Jimenez R, M.; Solache R, M.

    1999-01-01

    This work was made with the purpose to complete information about the hydrolysis constants of Europium (III) in high ion strength media. So it was determined at a ion forces media 4, 5 and 6 M of sodium perchlorate at 303 K. The method used was the potentiometric with the aid of the Super quad computer program. In high ion strength media, the measurements of p H do not correspond directly to negative logarithm of the concentration of hydrogen ions, by this it is necessary to calibrate the electrode in these conditions. The Europium was hydrolized at pC H values greater 6 in all cases. The potentiometric method used under the described experimental conditions is adequate to determine the hydrolysis constants of Europium (III). According to the results and diagrams of chemical species of Europium obtained we can conclude that the hydrolysis constants, differ by its distribution but not in its identity. (Author)

  17. Activity standardization of 134Cs and 137Cs

    International Nuclear Information System (INIS)

    Sochorová, Jana; Auerbach, Pavel

    2014-01-01

    The paper presents the results from a primary standardization of 137 Cs using two independent methods – efficiency tracing using PC-NaI coincidence and the TDCR method. The nuclides 60 Co and 134 Cs were used as the tracers. Primary standardization of the 134 Cs is also discussed. The efficiency extrapolation was carried out by measuring samples of varying mass and using the wet extrapolation method. The results obtained are in good agreement; the differences did not exceed 0.5%. The advantages, pitfalls and also possibilities for improvement of the procedures are discussed

  18. Determination of Cs-134 and Cs-137 rain water samples

    International Nuclear Information System (INIS)

    Lima, M.F.; Mazzilli, B.

    1988-01-01

    In order to setting an environmental monitoring program at IPEN, was developed a fast and simple methodology for concentration of Cs-134 and Cs-137 in rain water. This procedure consists in the precipitation of cesium and others cathions of its family (NH 4 + , K + and Rb + ) by ammonium molybdophosphate. The measures of the desintegration rates of Cs-134 and Cs-137 was done by gamma spectrometry in a Ge(Li) detector. After setting up the ideal experimental conditions, the procedure was used to analyze four samples of rain water. (author) [pt

  19. Study of relaxation processes and uniaxial anisotropy in the Europium Gallium Garnet epitaxial films

    International Nuclear Information System (INIS)

    Mukhopadhyay, P.

    1987-04-01

    We report here the magnetic properties of Europium-Gallium Garnet LPE films of the type Eu x Y 3-x Fe 5-y Ga y O 12 (where O< x<1.2 and 1< y<1.1). The mechanism by which the magnetic moments relax in Eu or Sm Garnets is still not fully understood. We have made studies on Eu-Ga garnet films and explain some of the results observed in these films. Pb and Pt ions are always found as impurities in our films. Pb ions contribute to the anisotropy in the film. Most of the experimental results can be explained with the three sub lattice model. The shape of the FMR line width shows strong sensitivity towards the surface impurities. (author). 18 refs, 6 figs, 1 tab

  20. First principles description of the insulator-metal transition in europium monoxide

    KAUST Repository

    Wang, Hao

    2012-02-01

    Europium monoxide, EuO, is a ferromagnetic insulator. Its electronic structure under pressure and doping is investigated by means of density functional theory. We employ spin polarized electronic structure calculations including onsite electron-electron interaction for the localized Eu 4f and 5d electrons. Our results show that under pressure the ferromagnetism is stable, both for hydrostatic and uniaxial pressure, while the compound undergoes an insulator-metal transition. The insulator-metal transition in O deficient and Gd doped EuO is reproduced for an impurity concentration of 6.25%. A 10 monolayer thick EuO(1 0 0) thin film is predicted to be an insulator with a narrow band gap of 0.08 eV. © 2011 Elsevier B.V. All rights reserved.

  1. Spectroscopic studies of an europium(III) tris-β-diketonate complex bearing a pyrazolylpyridine ligand

    International Nuclear Information System (INIS)

    Moreira dos Santos, Antonio; Coelho, Ana C.; Almeida Paz, Filipe A.; Rocha, Joao; Goncalves, Isabel S.; Carlos, Luis D.

    2008-01-01

    A new europium(III) complex, Eu(BTA) 3 (ethyl[3-(2-pyridyl)-1-pyrazolyl]acetate) (where BTA: 1-benzoyl-3,3,3-trifluoroacetonate), was synthesised by simple ligand exchange with the solvent adduct Eu(BTA) 3 (H 2 O) 2 . The compound was characterised by elemental analysis, thermogravimetry, FTIR, FT Raman and photoluminescence spectroscopies. A significant increase of the 5 D 0 lifetime of the complex, relative to the value found for the water-coordinated adduct (from 0.657 ± 0.001 to 0.835 ± 0.002 ms), and a larger contribution of the ligand levels to the excitation spectrum indicate a better photoluminescence performance for the former complex

  2. The mercury-richest europium amalgam Eu{sub 10}Hg{sub 55}

    Energy Technology Data Exchange (ETDEWEB)

    Tambornino, Frank; Hoch, Constantin [Department of Chemistry, Ludwig-Maximilians-Universitaet Muenchen (Germany)

    2015-03-15

    The mercury-richest europium amalgam Eu{sub 10}Hg{sub 55} was synthesized by isothermal electrocrystallization from a solution of EuI{sub 3}.8DMF in DMF on a reactive mercury cathode. The crystal structure shows remarkable complexity and polar metal-metal bonding. Closely related to the structures of mercury-rich amalgams A{sub 11-x}Hg{sub 55+x} (A = Na, Ca, Sr), it shows underoccupied Hg positions along [00z]. Eu{sub 10}Hg{sub 55} can be described as hettotype structure of the Gd{sub 14}Ag{sub 51} structure type. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. Removal of cobalt and europium radioisotopes using activated carbon prepared from apricot stones

    International Nuclear Information System (INIS)

    Daifullah, A.A.M.; Moloukhia, H.

    2002-01-01

    the phenomena of cobalt and europium sorption by activated carbon from aqueous solution was studied. Activated carbon prepared from locally available agricultural wastes; apricot stones; was used. The prepared carbon was characterized using different techniques. The chemical nature of the surface of the activated carbon was also studied. Experimental studies were conducted to evaluate and optimize the various process variables i.e. equilibrium time, carbon dose, solution ph and the presence of competitive. Optimal conditions for the sorption of the radioisotopes have been identified. The sorption isotherm of Freundlich was the best fitting for the concentration range studied. Interference of oxalic acid, EDTA and phenol molecules were discussed. Percentages desorption of both acid, EDTA and phenol using bi-distilled water and IMHCI was determined. The data suggest the possible use of activated carbon of apricot stone (ACAS) for the concentration of these cations

  4. Characterization of an azo-calix[4]arene-based optical sensor for Europium (III) ions

    International Nuclear Information System (INIS)

    Echabaane, M.; Rouis, A.; Bonnamour, I.; Ouada, H. Ben

    2012-01-01

    Selective and sensitive optical sensor membranes (optodes) were elaborated to detect cations in aqueous solutions. The sensing films are based on chromogenic calix[4]arene derivatives. The optode membranes were studied using UV/Vis absorption spectroscopy measurements. The sensitivity of the optode has been tested for Pb 2+ , Cd 2+ , Mg 2+ and Eu 3+ ions at pH 6.8. The results showed a good selectivity response towards Eu 3+ . Low selectivity coefficients were observed for Cd 2+ and Mg 2+ where Pb 2+ can be considered as interfering ions. The characteristics of this optode such as response time, regeneration, reproducibility and lifetime are discussed. - Highlights: ► We report optical sensing studies of chromogenic calixarene derivatives. ► We investigate optical interaction between azo-calix[4]arene and Eu 3+ . ► We study sensitivity and selectivity of optode films. ► We describe characteristics of optode films for determination of europium traces.

  5. Quadrupole splitting and Eu partial lattice dynamics in europium orthophosphate EuPO {sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Klobes, B., E-mail: b.klobes@fz-juelich.de [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany); Arinicheva, Y., E-mail: y.arinicheva@fz-juelich.de; Neumeier, S., E-mail: s.neumeier@fz-juelich.de [Forschungszentrum Jülich GmbH, Institute of Energy and Climate Research (IEK-6) Nuclear Waste Management and Reactor Safety (Germany); Simon, R. E., E-mail: r.simon@fz-juelich.de; Jafari, A., E-mail: a.jafari@fz-juelich.de [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany); Bosbach, D., E-mail: d.bosbach@fz-juelich.de [Forschungszentrum Jülich GmbH, Institute of Energy and Climate Research (IEK-6) Nuclear Waste Management and Reactor Safety (Germany); Hermann, R. P., E-mail: hermannrp@ornl.gov [JARA-FIT - Forschungszentrum Jülich GmbH, Jülich Centre for Neutron Science JCNS and Peter Grünberg Institute PGI (Germany)

    2016-12-15

    Hyperfine interactions in europium orthophosphate EuPO{sub 4} were investigated using {sup 151}Eu Mössbauer spectroscopy from 6 to 300 K. The value of the quadrupole splitting and the asymmetry parameter were refined and further substantiated by nuclear forward scattering data obtained at room temperature. The temperature dependence of the relative absorption was modeled with an Eu specific Debye temperature of 221(1) K. Eu partial lattice dynamics were probed by means of nuclear inelastic scattering and the mean force constant, the Lamb-Mössbauer factor, the internal energy, the vibrational entropy, the average phonon group velocity were calculated using the extracted density of phonon states. In general, Eu specific vibrations are characterized by rather small phonon energies and contribute strongly to the total entropy of the system. Although there is no classical Debye like behavior at low vibrational energies, the average phonon group velocity can be reasonably approximated using a linear fit.

  6. Chemiluminescence determination of tetracyclines using Fenton system in the presence europium(III) ions

    International Nuclear Information System (INIS)

    Kaczmarek, Malgorzata; Lis, Stefan

    2009-01-01

    A new simple chemiluminescent method for the determination of chlortetracycline (Chlor-TC), oxytetracycline (Oxy-TC) and doxycycline (Doxy-TC) is described. This method is based on the europium(III) emission as a result of the energy transfer process from the excited product of the tetracyclines oxidation to the uncomplexed Eu(III). Under the optimum conditions, calibration graphs were obtained for 4 x 10 -7 to 2 x 10 -5 mol L -1 of Chlor-TC; 2 x 10 -7 to 2 x 10 -5 mol L -1 of Oxy-TC and 1 x 10 -7 to 3 x 10 -5 mol L -1 of Doxy-TC. The method was successfully applied to the determination of these drugs in pharmaceutical and veterinary formulation and honey.

  7. Chemiluminescence determination of tetracyclines using Fenton system in the presence europium(III) ions

    Energy Technology Data Exchange (ETDEWEB)

    Kaczmarek, Malgorzata [Department of Rare Earths, Faculty of Chemistry, Adam Mickiewicz University, Grunwaldzka 6, 60 - 780 Poznan (Poland); Lis, Stefan [Department of Rare Earths, Faculty of Chemistry, Adam Mickiewicz University, Grunwaldzka 6, 60 - 780 Poznan (Poland)

    2009-04-20

    A new simple chemiluminescent method for the determination of chlortetracycline (Chlor-TC), oxytetracycline (Oxy-TC) and doxycycline (Doxy-TC) is described. This method is based on the europium(III) emission as a result of the energy transfer process from the excited product of the tetracyclines oxidation to the uncomplexed Eu(III). Under the optimum conditions, calibration graphs were obtained for 4 x 10{sup -7} to 2 x 10{sup -5} mol L{sup -1} of Chlor-TC; 2 x 10{sup -7} to 2 x 10{sup -5} mol L{sup -1} of Oxy-TC and 1 x 10{sup -7} to 3 x 10{sup -5} mol L{sup -1} of Doxy-TC. The method was successfully applied to the determination of these drugs in pharmaceutical and veterinary formulation and honey.

  8. Sorption of Europium in zirconium silicate; Sorcion de Europio en silicato de circonio

    Energy Technology Data Exchange (ETDEWEB)

    Garcia R, G. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Some minerals have the property of sipping radioactive metals in solution, that it takes advantage to manufacture contention barriers that are placed in the repositories of nuclear wastes. The more recent investigations are focused in the development of new technologies guided to the sorption of alpha emissors on minerals which avoid their dispersion in the environment. In an effort to contribute to the understanding of this type of properties, some studies of sorption of Europium III are presented like homologous of the americium, on the surface of zirconium silicate (ZrSiO{sub 4}). In this work the results of sorption experiences are presented as well as the interpretation of the phenomena of the formation of species in the surface of the zirconium silicate. (Author)

  9. Effect of the ion force on the hydrolysis constants and of the solubility product of Europium

    International Nuclear Information System (INIS)

    Jimenez R, M.; Ramirez G, J.J.; Solache R, M.; Rojas H, A.

    2003-01-01

    A study on the behavior of the first hydrolysis constant β Eu,H l-0 and the constant of the solubility product Kps of the europium in front of the changes of the ion force: 0. 02 M, 0.1 M, 0.7M, 2M, 3M and 4M of sodium perchlorate, at 303 K. Experimentally the potentiometry and also radioactivity measures its were used. The specific interaction of ions theory (SIT) of Bronsted-Guggenheim-Scatchard allows the extrapolation of the values to infinite dilution and the results were: log β Eu,H l-0 = -7 36 and log K sp l-0 = -24. 68. A discussion of the group of results with the data of the literature is presented. (Author)

  10. Use of dispersive liquid-liquid microextraction for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium

    International Nuclear Information System (INIS)

    Mallah, M.H.; Atomic Energy Organization of Iran, Tehran; Shemirani, F.; Ghannadi Maragheh, M.

    2008-01-01

    A new preconcentration method of dispersive liquid-liquid microextraction (DLLME) was developed for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium. DLLME technique was successfully used as a sample preparation method. In this preconcentration method, an appropriate mixture of extraction solvent, disperser solvent was injected rapidly into an aqueous solution containing Sm, Eu, Gd and Dy after complex formation using chelating reagent of the 1-(2-pyridylazo)-2-naphthol (PAN). After phase separation, 0.5 mL of the settled phase containing enriched analytes was determined by inductively coupled plasma optical emission spectrometry (ICP-OES). The main factors affected the preconcentration of Sm, Eu, Gd and Dy were extraction and dispersive solvent type and their volume, extraction time, volume of chelating agent (PAN), centrifuge speed and drying temperature of the samples. Under the best operating condition simultaneous preconcentration factors of 80, 100, 103 and 78 were obtained for Sm, Eu, Gd and Dy, respectively. (author)

  11. Synthesis, Structure, and Luminescent Properties of Europium-Doped Hydroxyapatite Nanocrystalline Powders

    International Nuclear Information System (INIS)

    Ciobanu, C.S.; Iconaru, S.L.; Predoi, D.; Massuyeau, F.; Constantin, L.V.; Costescu, A.

    2012-01-01

    The luminescent europium-doped hydroxyapatite (Eu:HAp, Ca 10-x Eu x (PO 4 ) 6 (OH) 2 ) with 0>x>0.2 nanocrystalline powders was synthesized by coprecipitation. The structural, morphological, and textural properties were well characterized by X-ray diffraction, scanning electron microscopy, and transmission electron microscopy. The vibrational studies were performed by Fourier transform infrared, Raman, and photoluminescence spectroscopies. The X-ray diffraction analysis revealed that hydroxyapatite is the unique crystalline constituent of all the samples, indicating that Eu has been successfully inserted into the HAp lattice. Eu doping inhibits HAp crystallization, leading to a decrease of the average crystallite size from around 20 nm in the undoped sample to around 7 nm in the sample with the highest Eu concentration. Furthermore, the samples show the characteristic 5 D 0 → 7 F 0 transition observed at 578 nm related to Eu 3+ ions distributed on Ca 2+ sites of the apatitic structure

  12. Europium and samarium doped calcium sulfide thin films grown by PLD

    International Nuclear Information System (INIS)

    Christoulakis, S.; Suchea, M; Katsarakis, N.; Koudoumas, E

    2007-01-01

    Europium and samarium doped calcium sulfide thin films (CaS:Eu,Sm) with different thickness were prepared by the pulsed laser deposition technique using sintered targets. A typical homemade deposition chamber and XeCl excimer laser (308 nm) were employed and the films were deposited in helium atmosphere onto silicon and corning glass substrates. Structural investigations carried out by X-ray diffraction and atomic force microscopy showed a strong influence of the deposition parameters on the film properties. The films grown had an amorphous or polycrystalline structure depending on growth temperature and the number of pulses used, the same parameters affecting the film roughness, the grain shape and dimensions, the film thickness and the optical transmittance. This work indicates that pulsed laser deposition can be a suitable technique for the preparation of CaS:Eu,Sm thin films, the film characteristics being controlled by the growth conditions

  13. Magnesium ionophore II as an extraction agent for trivalent europium and americium

    Energy Technology Data Exchange (ETDEWEB)

    Makrlik, Emanuel [Czech Univ. of Life Sciences, Prague (Czech Republic). Faculty of Environmental Sciences; Vanura, Petr [Univ. of Chemistry and Technology, Prague (Czech Republic). Dept. of Analytical Chemistry

    2016-11-01

    Solvent extraction of microamounts of trivalent europium and americium into nitrobenzene by using a mixture of hydrogen dicarbollylcobaltate (H{sup +}B{sup -}) and magnesium ionophore II (L) was studied. The equilibrium data were explained assuming that the species HL{sup +}, HL{sup +}{sub 2}, ML{sup 3+}{sub 2}, and ML{sup 3+}{sub 3} (M{sup 3+} = Eu{sup 3+}, Am{sup 3+}; L=magnesium, ionophore II) are extracted into the nitrobenzene phase. Extraction and stability constants of the cationic complex species in nitrobenzene saturated with water were determined and discussed. From the experimental results it is evident that this effective magnesium ionophore II receptor for the Eu{sup 3+} and Am{sup 3+} cations could be considered as a potential extraction agent for nuclear waste treatment.

  14. Ligand effect on the performance of organic light-emitting diodes based on europium complexes

    International Nuclear Information System (INIS)

    Fang Junfeng; You Han; Gao Jia; Lu Wu; Ma Dongge

    2007-01-01

    A series of europium complexes were synthesized and their electroluminescent (EL) characteristics were studied. It was found by comparison that the different substituted groups, such as methyl, chlorine, and nitryl, on ligand 1,10-phenanthroline affect significantly the EL performance of devices based on these complexes. The more methyl-substituted groups on ligand 1,10-phenanthroline led to higher device efficiency. A chlorine-substituted group showed the approximate EL performance as two methyl-substituted groups, whereas a nitryl substituent reduced significantly the EL luminous efficiency. However, β-diketonate ligand TTA and DBM exhibited similar EL performance. The improved EL luminous efficiency by proper substituted groups on the 1,10-phenanthroline was attributed to the reduction of the energy loss caused by light hydrogen atom vibration, as well as concentration quenching caused by intermolecular interaction, and the match of energy level between the ligand and Eu 3+

  15. Radiogenotoxicological effect of signal nuclide 134Cs on somatic and germ cells

    Institute of Scientific and Technical Information of China (English)

    ZhuShou-Peng; XiaFen; 等

    1997-01-01

    Chromosome at aberation rates in bone marrow cells and micronucleus formation in bone marrow polychromatic erythrocytes both rise with increase in radioactivities of 134Cs,and can be fitted to power functions of radioactivities of 134Cs.In spermatogonia 134Cs mainly induced chromatid breakage,and abnormalities in sperm can also be experessed as power functions of radioactivities of 134 Cs.

  16. Effects of added dibutyl phosphate on the luminescent properties of europium tetrakis dibenzoylmethide triethylammonium

    International Nuclear Information System (INIS)

    Fontenot, Ross S.; Bhat, Kamala N.; Owens, Constance A.; Hollerman, William A.; Aggarwal, Mohan D.

    2015-01-01

    Since 2003, the authors have been pushing the boundaries on a special type of functional material, i.e., a material that gives off light when it is stressed, strained, and/or fractured. This unique class of materials has been proposed for the active element of impact sensors, earthquake detectors, and stress sensors. However, in order for this concept to go from the lab to real world applications, the light emission from these functional materials must be bright such that inexpensive light detectors can be used. One of the brightest materials found thus far is europium tetrakis dibenzoylmethide triethylammonium (EuD 4 TEA). This material has an emission so bright that it can be observed in daylight. In 2013, the authors discovered that the addition of dimethyl methylphosphonate (DMMP) increased the light emission two fold. As a result, a search for similar compounds was conducted to determine if the emission can be increased further. This paper explores the effects of dibutyl phosphate (DBP) on EuD 4 TEA. The effects of DBP on the triboluminescence, photoluminescence, and crystal structure of EuD 4 TEA will be determined. This paper will show that DBP has an even greater effect on the properties of EuD 4 TEA than DMMP. - Highlights: • Synthesized europium tetrakis dibenzoylmethide triethylammonium. • Six fold increase in the light yield was detected. • Effects of dibutyl phosphate on the triboluminescence on EuD 4 TEA were determined. • Effects of dibutyl phosphate on the photoluminescence of EuD 4 TEA were determined

  17. Red polymer light-emitting devices based on an oxadiazole-functionalized europium(III) complex

    International Nuclear Information System (INIS)

    Liu, Yu; Wang, Yafei; Li, Chun; Huang, Ying; Dang, Dongfeng; Zhu, Meixiang; Zhu, Weiguo; Cao, Yong

    2014-01-01

    A novel tris(dibenzoylmethanato)[5-(2-(4-tert-butylbenzenyl)-5-benzenyl-1,3, 4-oxadiazole-4′)-1,10-phenanthroline]europium(III) [Eu(DBM) 3 (BuOXD-Phen)] containing an electron-transporting oxadiazole-functionalized phenanthroline ligand was synthesized and characterized. Its UV–vis absorption and photoluminescence (PL), as well as the electroluminescence (EL) in polymer light-emitting devices (PLEDs) were investigated. The double-layer PLEDs with a configuration of ITO/PEDOT:PSS (50 nm)/PVK (40 nm)/PFO:PBD (30%):Eu(DBM) 3 (BuOXD-Phen) (1–8 wt %) (80 nm)/Ba (4 nm)/Al (150 nm) were fabricated. Saturated red Eu 3+ ion emission, based on the 5 D 0 → 7 F 2 transition, is centered at a wavelength of 614 nm with a full width at half maximum (FWHM) of 10 nm. The highest external quantum efficiency (QE ext ) of 1.26% at current density of 1.65 mA cm −2 , with a maximum brightness of 568 cd m −2 at 137.8 mA cm −2 was achieved from the device at 1 wt % dopant concentration. - Highlights: • An oxadiazole-functionalized europium(III) complex of Eu(DBM) 3 (BuOXD-Phen) was presented. • The optophysical properties of Eu(DBM) 3 (BuOXD-Phen) were investigated. • Saturated red emission was observed in the PLEDs. • An external quantum efficiency of 1.26% was obtained in these devices

  18. Radiotracer study of sorption of europium on Gorleben sand from aqueous solutions containing humic substances

    International Nuclear Information System (INIS)

    Benes, P.; Stamberg, K.; Siroky, L.; Mizera, J.

    2002-01-01

    The sorption of trace europium, as a trivalent actinide homologue, was studied in the system Gorleben sand - aqueous solution with the aim to elucidate its mechanism. Radiotracer method ( 152/154 Eu) and batch experiments were used. Simultaneously, the distribution of humic substances present in, or added to the system was measured. The evaluation of the sorption was complicated by the adsorption of Eu on the walls of polyethylene vials used for the experiments, which was rather high and had to be taken into consideration. It has been found that Eu sorption on Gorleben sand increases from pH 2 to pH 5-7 and then it decreases. The decrease is due to the complexation of Eu with humic substances leached from Gorleben sand at pH>7. The position of the sorption maximum depends on the composition of the solution and on the liquid-to-solid ratio. It is shifted to lower pH values in the presence of added humic acid (HA), which enhances Eu sorption at low PH values and suppresses it at pH values higher than 5. The regions of the enhancing/suppressing effects coincidence with the high/low adsorption of HA on Gorleben sand, respectively. The increasing ionic strength (from 0.01 to 0.1) and europium concentration (3.4 x 10 -8 to 9.3 x 10 -7 mol/l) suppress the relative sorption (expressed in %) at low pH values and enhance it at pH>6-8. Addition of carbonates (5 x 10 -3 mol/l) supports Eu sorption at pH>7.5 so that no decrease with pH is observed till pH 9. Alkaline leaching of the sand significantly changes most of the effects found. These results were qualitatively interpreted and conclusions were drawn on the mechanism of the sorption. (author)

  19. Effects of added dibutyl phosphate on the luminescent properties of europium tetrakis dibenzoylmethide triethylammonium

    Energy Technology Data Exchange (ETDEWEB)

    Fontenot, Ross S., E-mail: rsfontenot@hotmail.com [Alabama A and M University, Department of Physics, Chemistry, and Mathematics, P.O. Box 1268, Normal, AL 35762 (United States); University of Louisiana at Lafayette, Department of Physics, P.O. Box 44210, Lafayette, LA 70504 (United States); Bhat, Kamala N.; Owens, Constance A. [Alabama A and M University, Department of Physics, Chemistry, and Mathematics, P.O. Box 1268, Normal, AL 35762 (United States); Hollerman, William A. [University of Louisiana at Lafayette, Department of Physics, P.O. Box 44210, Lafayette, LA 70504 (United States); Aggarwal, Mohan D. [Alabama A and M University, Department of Physics, Chemistry, and Mathematics, P.O. Box 1268, Normal, AL 35762 (United States)

    2015-02-15

    Since 2003, the authors have been pushing the boundaries on a special type of functional material, i.e., a material that gives off light when it is stressed, strained, and/or fractured. This unique class of materials has been proposed for the active element of impact sensors, earthquake detectors, and stress sensors. However, in order for this concept to go from the lab to real world applications, the light emission from these functional materials must be bright such that inexpensive light detectors can be used. One of the brightest materials found thus far is europium tetrakis dibenzoylmethide triethylammonium (EuD{sub 4}TEA). This material has an emission so bright that it can be observed in daylight. In 2013, the authors discovered that the addition of dimethyl methylphosphonate (DMMP) increased the light emission two fold. As a result, a search for similar compounds was conducted to determine if the emission can be increased further. This paper explores the effects of dibutyl phosphate (DBP) on EuD{sub 4}TEA. The effects of DBP on the triboluminescence, photoluminescence, and crystal structure of EuD{sub 4}TEA will be determined. This paper will show that DBP has an even greater effect on the properties of EuD{sub 4}TEA than DMMP. - Highlights: • Synthesized europium tetrakis dibenzoylmethide triethylammonium. • Six fold increase in the light yield was detected. • Effects of dibutyl phosphate on the triboluminescence on EuD{sub 4}TEA were determined. • Effects of dibutyl phosphate on the photoluminescence of EuD{sub 4}TEA were determined.

  20. Modified magnetic and optical properties of manganese nanoparticles incorporated europium doped magnesium borotellurite glass

    Energy Technology Data Exchange (ETDEWEB)

    Aziz, Siti Maisarah; Sahar, M.R., E-mail: mrahim057@gmail.com; Ghoshal, S.K.

    2017-02-01

    This paper reports the modified optical and magnetic properties of europium (Eu{sup 3+}) ions doped and Manganese nanoparticles (NPs) embedded Magnesium Borotellurite glass synthesized via melt quenching method. The influence of varying Mn NPs concentrations on the magnetic, absorption and emission properties of such glass samples are determined. Stables, transparent and amorphous glasses are obtained. The observed modification of the electronic polarizability is interpreted in terms of the generation of non-bridging oxygen (NBO) and bridging oxygen (BO) in the amorphous network. TEM images manifested the growth of Mn NPs with average diameter 11±1 nm. High-resolution TEM reveals that the lattice spacing of manganese nanoparticles is 0.308 nm at (112) plane. The emission spectra revealed four prominent peaks centered at 587 nm, 610 nm, 651 nm and 700 nm assigned to the transition from {sup 5}D{sub 0} →{sup 7}F{sub J} (J=1, 2, 3, 4) states of Eu{sup 3+} ion. A significant drop in the luminescence intensity due to the incorporation of Mn NPs is ascribed to the enhanced energy transfer from the Eu{sup 3+} ion to NPs. Prepared glass systems exhibited paramagnetic behavior. - Highlights: • The europium doped magnesium borotellurite glasses embedded Mn NPs prepared using the conventional melt-quenching method. • The TEM result reveals the size of Mn NPs while its planar spacing has been determined by HRTEM. • The luminescence properties of TeO{sub 2}–B{sub 2}O{sub 3}–MgO–Eu{sub 2}O{sub 3}–Mn{sub 3}O{sub 4} glasses have been investigated as effect of Mn NPs content. • The magnetization measurement of glass sample is carried out using vibrating sample magnetometer (VSM)

  1. Crystal growth and characterization of europium doped lithium strontium iodide scintillator as an ionizing radiation detector

    Science.gov (United States)

    Uba, Samuel

    High performance detectors used in the detection of ionizing radiation is critical to nuclear nonproliferation applications and other radiation detectors applications. In this research we grew and tested Europium doped Lithium Strontium Iodide compound. A mixture of lithium iodide, strontium iodide and europium iodide was used as the starting materials for this research. Congruent melting and freezing temperature of the synthesized compound was determined by differential scanning calorimetry (DSC) using a Setaram Labsys Evo DSC-DTA instrument. The melting temperatures were recorded at 390.35°C, 407.59°C and freezing temperature was recorded at 322.84°C from a graph of heat flow plotted against temperature. The synthesized material was used as the charge for the vertical Bridgeman growth, and a 6.5 cm and 7.7cm length boule were grown in a multi-zone transparent Mullen furnace. A scintillating detector of thickness 2.53mm was fabricated by mechanical lapping in mineral oil, and scintillating response and timing were obtained to a cesium source using CS-137 isotope. An energy resolution (FWHM over peak position) of 12.1% was observed for the 662keV full absorption peak. Optical absorption in the UV-Vis wavelength range was recorded for the grown crystal using a U-2900 UV/VIS Spectrophotometer. Absorption peaks were recorded at 194nm, 273nm, and 344nm from the absorbance spectrum, various optical parameters such as absorption coefficient, extinction coefficient, refractive index, and optical loss were derived. The optical band gap energy was calculated using Tauc relation expression at 1.79eV.

  2. Spectroscopic investigation on europium doped heavy metal borate glasses for red luminescent application

    Energy Technology Data Exchange (ETDEWEB)

    Hegde, Vinod; Wagh, Akshatha; Kamath, Sudha D. [Manipal University, Department of Physics, Manipal Institute of Technology, Manipal (India); Hegde, Hemanth [Manipal University, Department of Chemistry, Manipal Institute of Technology, Manipal (India); Vishwanath, C.S.D. [Sri Venkateswara University, Department of Physics, Tirupati (India)

    2017-05-15

    The present study explores a new borate family glasses based on 10ZnO-5Na{sub 2}O-10Bi{sub 2}O{sub 3}-(75 - x) B{sub 2}O{sub 3}-xEu{sub 2}O{sub 3} (x = 0, 0.1, 0.5, 1, 1.5, 2, 3 mol%) composition, synthesized by rapid melt quench technique. Prepared glasses were subjected to the density and refractive index measurements and their values were used to calculate other physical properties of the glass matrix as a function of Eu{sup 3+} concentration. XRD confirmed amorphous nature of the glasses. FTIR spectra in the absorption mode were recorded in the 400-4000 cm{sup -1} region to identify different functional groups in the glass matrix. Deconvoluted FTIR spectra showed increase in BO{sub 4} units with rise in europium content which confirmed the 'network strengthener' role of europium ions by creating bridging oxygens (BOs). Optical properties were investigated for their luminescence behavior through various spectroscopic techniques such as UV-Vis-NIR absorption, excitation, emission, decay profiles, and color measurements at room temperature. Lasing properties of the glasses like total radiative life time, branching ratio, emission cross section, and optical gain were obtained from the calculated Judd-Ofelt (Ω{sub 2},Ω{sub 4}) intensity parameters. From the measured values of emission, cross sections, branching ratios, life times, strong photoluminescence features, and CIE chromaticity coordinates, 0.5 mol% of Eu{sup 3+} ions doped ZnNaBiB glasses showed optimum performance and are potential candidate for red light generation at 613 nm. (orig.)

  3. Tuning Eu"3"+ emission in europium sesquioxide films by changing the crystalline phase

    International Nuclear Information System (INIS)

    Mariscal, A.; Quesada, A.; Camps, I.; Palomares, F.J.; Fernández, J.F.; Serna, R.

    2016-01-01

    Highlights: • PLD production of high quality europium sesquioxide (Eu_2O_3) films. • The deposition of Al_2O_3 capping and/or buffer layers modifies the crystallization for Eu_2O_3 films upon annealing. • The formation of cubic or monoclinic phases can be favored. • Eu"3"+ emission tuning is achieved as a consequence of crystal field effects. - Abstract: We report the growth of europium sesquioxide (Eu_2O_3) thin films by pulsed laser deposition (PLD) in vacuum at room temperature from a pure Eu_2O_3 ceramic bulk target. The films were deposited in different configurations formed by adding capping and/or buffer layers of amorphous aluminum oxide (a-Al_2O_3). The optical properties, refractive index and extinction coefficient of the as deposited Eu_2O_3 layers were obtained. X-ray photoelectron spectroscopy (XPS) measurements were done to assess its chemical composition. Post-deposition annealing was performed at 500 °C and 850 °C in air in order to achieve the formation of crystalline films and to accomplish photoluminescence emission. According to the analysis of X-ray diffraction (XRD) spectra, cubic and monoclinic phases were formed. It is found that the relative amount of the phases is related to the different film configurations, showing that the control over the crystallization phase can be realized by adequately designing the structures. All the films showed photoluminescence emission peaks (under excitation at 355 nm) that are attributed to the intra 4f-transitions of Eu"3"+ ions. The emission spectral shape depends on the crystalline phase of the Eu_2O_3 layer. Specifically, changes in the hypersensitive "5D_0 → "7F_2 emission confirm the strong influence of the crystal field effect on the Eu"3"+ energy levels.

  4. Surface-imprinted nanofilaments for europium-amplified luminescent detection of fluoroquinolone antibiotics.

    Science.gov (United States)

    Zdunek, Jolanta; Benito-Peña, Elena; Linares, Ana; Falcimaigne-Cordin, Aude; Orellana, Guillermo; Haupt, Karsten; Moreno-Bondi, María C

    2013-07-29

    The development and characterization of novel, molecularly imprinted polymer nanofilament-based optical sensors for the analysis of enrofloxacin, an antibiotic widely used for human and veterinary applications, is reported. The polymers were prepared by nanomolding in porous alumina by using enrofloxacin as the template. The antibiotic was covalently immobilized on to the pore walls of the alumina by using different spacers, and the prepolymerization mixture was cast in the pores and the polymer synthesized anchored onto a glass support through UV polymerization. Various parameters affecting polymer selectivity were evaluated to achieve optimal recognition, namely, the spacer arm length and the binding solvent. The results of morphological characterization, binding kinetics, and selectivity of the optimized polymer material for ENR and its derivatives are reported. For sensing purposes, the nanofilaments were incubated in solutions of the target molecule in acetonitrile/HEPES buffer (100 mM, pH 7.5, 50:50, v/v) for 20 min followed by incubation in a 10 mM solution of europium(III) ions to generate a europium(III)-enrofloxacin complex on the polymer surface. The detection event was based on the luminescence of the rare-earth ion (λexc=340 nm; λem=612 nm) that results from energy transfer from the antibiotic excited state to the metal-ion emitting excited state. The limit of detection of the enrofloxacin antibiotic was found to be 0.58 μM. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Determination of europium content in Li_2SiO_3(Eu) by neutron activation analysis using Am-Be neutron source

    International Nuclear Information System (INIS)

    Naik, Yeshwant; Tapase, Anant Shamrao; Mhatre, Amol; Datrik, Chandrashekhar; Tawade, Nilesh; Kumar, Umesh; Naik, Haladhara

    2016-01-01

    Circulardiscs of Li_2SiO_3 doped with europium were prepared and a new activation procedure for the neutron dose estimation in a breeder blanket of fusion reactor is described. The amount of europium in the disc was determined by neutron activation analysis (NAA) using an isotopic neutron source. The average neutron absorption cross section for the reaction was calculated using neutron distribution of the Am-Be source and available neutron absorption cross section data for the "1"5"1Eu(n,γ)"1"5"2"mEu reaction, which was used for estimation of europium in the pallet. The cross section of the elements varies with neutron energy, and the flux of the neutrons in each energy range seen by the nuclei under investigation also varies. Neutron distribution spectrum of the Am-Be source was worked out prior to NAA and the effective fractional flux for the nuclear reaction considered for the flux estimation was also determined. - Highlights: • Lithium meta-silicate is breeder materials for a fusion reactor. • Europium is used for neutron dose estimation in a breeder blanket. • It is important to determine amount of europium in lithium meta-silicate. • Amount of europium in lithium meta-silicate was determined by neutron activation and off-line gamma spectrometry.

  6. Environmentally benign synthesis of sydnone containing 1,3,4 ...

    Indian Academy of Sciences (India)

    TECS

    lop benign synthetic methods for sydnone deriva- tives,. 9 we report here a new series of sydnone containing 1,3,4-thiadiazines by microwave irradia- tion under solvent-free conditions. 2. Experimental. 2.1 General remarks. Melting points were determined by open capillary method and are uncorrected. All compounds were.

  7. Physical properties of 134 soils in six northeastern states

    Science.gov (United States)

    A. R. Eschner; B. O. Jones; R. C. Moyle

    1957-01-01

    From June 1954 to July 1955 the Vicksburg Infiltration Project collected and analyzed samples from 134 sites in six Northeastern States; the samples included 79 soil series and 114 soil types. This work was done to supply the U. S. Army with information needed for specialized research on military traffic ability. The basic data are herein presented because of their...

  8. Predicting heat transfer in long, R-134a filled thermosyphons

    NARCIS (Netherlands)

    Grooten, M.H.M.; Geld, van der C.W.M.

    2008-01-01

    When traditional air-to-air cooling is too voluminous, heat exchangers with long thermosyphons offer a good alternative. Experiments with a single thermosyphon with a large length-to-diameter ratio (188) and filled with R-134a are presented and analyzed. Saturation temperatures, filling ratios, and

  9. 43 CFR 13.4 - Terms of permit.

    Science.gov (United States)

    2010-10-01

    ... § 13.4 Terms of permit. Every permit shall describe the location of the vending facilities and shall be... Interior bureau or office for each location. The head of the Interior bureau or office may require... efficiency as may be prescribed by the head of the Interior bureau or office. Such standards shall conform...

  10. 10 CFR 63.134 - Monitoring and testing waste packages.

    Science.gov (United States)

    2010-01-01

    ....134 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A... geologic repository operations area, the environment of the waste packages selected for the waste package monitoring program must be representative of the environment in which the wastes are to be emplaced. (c) The...

  11. Calibration of the SH134-20 Standard Gain Horn

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Breinbjerg, Olav

    This report documents the measurement of the linearly polarized SH134-20 Standard Gain Horn. The measurement comprises on-axis gain, on-axis polarization characteristics, and reflection coefficient at 111 frequencies in the frequency range from 22-33 GHz. The measurement was carried out at the DTU...

  12. 13 CFR 134.618 - How are awards paid?

    Science.gov (United States)

    2010-01-01

    ... CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Implementation of the Equal Access to Justice Act § 134... of Financial Operations, SBA, P.O. Box 205, Denver, CO 80201-0205. SBA will pay you the amount awarded within 60 days of receipt of your request unless it is notified that you or another party has...

  13. EXPERIMENTAL INVESTIGATION OF R-134a AND R-600a ...

    African Journals Online (AJOL)

    Preet khandelwal

    performance of blends of two existing refrigerant, R-134a and R-600a, blended together at ratios of 11%/89%, ... blending ratios, estimated GWPs ≤ 150 using Ali's model. .... series are less flammable among other HCs and its .... Figure 2: Variation of Evaporator Temperature with Time at an Ambient Temperature of 37oC.

  14. 19 CFR 134.35 - Articles substantially changed by manufacture.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles substantially changed by manufacture. 134... substantially changed by manufacture. (a) Articles other than goods of a NAFTA country. An article used in the United States in manufacture which results in an article having a name, character, or use differing from...

  15. Nature of the concentration thresholds of europium atom yield from the oxidized tungsten surface under electron stimulated desorption

    CERN Document Server

    Davydov, S Y

    2002-01-01

    The nature of the electron-stimulated desorption (ESD) of the europium atoms by the E sub e irradiating electrons energies, equal to 50 and 80 eV, as well as peculiarities of the Eu atoms yield dependence on their concentration on the oxidized tungsten surface are discussed. It is shown, that the ESD originates by the electron transition from the interval 5p- or 5s shell of the tungsten surface atom onto the oxygen external unfilled 2p-level

  16. New coordination compounds of europium (3) with fluorated β-diketones and their use as lanthanide shift reagents

    International Nuclear Information System (INIS)

    Goryushko, A.G.; Davidenko, N.K.; Kudryavtseva, L.S.; Lozinskij, M.O.; Lugina, L.N.; Fialkov, Yu.A.

    1980-01-01

    Altogether five coordination compounds of europium (3) of the composition EuL 3 , wherein HL is a fluorinated beta-diketone containing in its fluorinated linear or cyclic radical a heteroatom, such as oxygen, have been obtained. The hygroscopicity of the obtained tris-beta-ketones has been tested. Their activity as lanthanide shifting agents for NMR spectroscopy purposes has been analyzed and the stability constants of their monoadducts with ethyl acetate have been determined [ru

  17. Liquid crystal europium(III) β-diketonato complex with 5,5'-di(heptadecyl)-2,2'-bipyridine

    International Nuclear Information System (INIS)

    Knyazev, A.A.; Lobkov, V.S.; Galyametdinov, Yu.G.

    2004-01-01

    Liquid crystal europium(III) complex containing β-diketone and 5,5-di(heptadecyl)-2,2'-bipyridine as ligands was prepared in ethanol solution and was isolated as a yellow precipitate with 62% yield. The product was characterized by data of elementary analysis, thermography, IR spectroscopy and luminescence spectra. Temperatures of crystal-mesophase and mesophase-isotropic liquid phase transitions amount to 95 and 130 Deg C respectively [ru

  18. Effect of temperature on the extraction of europium (III) bymixtures of neutral phosphoro-organic extractants from nitrate solutions

    International Nuclear Information System (INIS)

    Milchlin, E.B.; Khmuran, M.A.; Mikhailichenko, A.I.

    1986-01-01

    A study has been made of the distribution of microquantities of europium (III) on extraction with neutral phosphoorganic compounds-tri-n-butyl phosphate (TBP), diisooctylmethyl phosphonate (DIOMP),trialkylphosphine oxide with dissimilar radicals (PODR), or mixtures thereof-from a solution of 2 mole/liter NH 4 NO 3 and 0.01 mole/liter HNO 3 , in the temperature range 20-60 0 C. A temperature rise results in a decrease of the distribution coefficients of the europium on extraction by all of the extractants tested and their mixtures, and also in a reduction of the synergistic effect in extraction by mixtures of the extractants. Based on an investigation of the temperature dependences of the distribution constants of europium nitrate upon extraction by TBP, DIOMP, PODR, or their mixtures, values have been determined for the enthalpy, free energy, and entropy of extraction. It is shown that the enthalpy (-ΔH) increases in the order TBP< DIOMP< PODR. In an extraction with mixed extractants, the enthalpy has a value intermediate between those with the individual extractants. The entropy of extraction (-ΔS) increases in the reverse order PODR< DIOMP< TBP

  19. Electroplex emission from a layer of a mixture of a europium complex and tris(8-quinolinolato) aluminum

    Science.gov (United States)

    Cao, Hong; Gao, Xicun; Huang, Chun-Hui

    2000-07-01

    With a europium complex, tris(α-thenoyltrifluoroacetonato) bis(triphenylphosphine oxide) europium (Eu(TTA) 3(TPPO) 2), as the light-emitting layer, N, N'-diphenyl- N, N'-di( m-tolyl)-benzidine (TPD) as the hole transport layer and tris(8-quinolinolato) aluminum (ALQ) as the electron transport layer, the triple-layer electroluminescent (EL) device emits red light characteristic of Eu 3+ emission. However, as the mixture of Eu(TTA) 3(TPPO) 2 and ALQ is co-evaporated as the light-emitting layer to form a bilayer EL device, a new wide-banded emission peaked at c. 640 nm was obtained. This emission is neither from ALQ nor from the europium complex. The photoluminescence (PL) of the thin film on quartz substrate evaporated from one mixed solid powder of Eu(TTA) 3(TPPO) 2 and ALQ is composed of distinct PL emissions of Eu(TTA) 3(TPPO) 2 and ALQ, denying an exciplex formation mechanism. It is impossible to form a host-guest system. We propose that the EL emission peaked at c. 640 nm is from an electroplex route: a transition between the lowest unoccupied molecular orbital (LUMO) of Eu(TTA) 3(TPPO) 2 and the highest occupied molecular orbital (HOMO) of ALQ.

  20. Isotope ratios and chemical fractionation of CO in Lynds 134

    International Nuclear Information System (INIS)

    Dickman, R.L.; Langer, W.D.

    1977-01-01

    Mahoney, McCutcheon and Shuter (1976) reported observations of the J = 1 → 0 transition of three isotopes of CO in the dust cloud Lynds 134 using the 4.6 m telescope at Aerospace Corporation. In this paper a new observation of 12 C 17 O is discussed and the question of the ratio 13 C 16 O/ 12 C 18 O across the dust cloud is considered further. (Auth.)

  1. Investigation of R-134a as a modeling fluid for supercritical water

    International Nuclear Information System (INIS)

    Jouvin, J.C.; Pioro, I.

    2014-01-01

    The objective of this paper is to investigate the feasibility of using Refrigerant-134a (R-134a) as a potential modeling fluid by comparing the thermophysical properties with those of water. Operating conditions of SuperCritical Water-cooled Reactors (SCWRs) are scaled into those of R-134a, in order to provide proper SCWR-equivalent conditions. The thermophysical properties for R-134a are obtained from NIST REFPROP software. The results indicate that the thermophysical properties of R-134a undergo significant changes within the critical and pseudocritical regions similar to that of supercritical water. An investigation into the pseudocritical region of R-134a was also conducted. (author)

  2. miR-134: A Human Cancer Suppressor?

    Directory of Open Access Journals (Sweden)

    Jing-Yu Pan

    2017-03-01

    Full Text Available MicroRNAs (miRNAs are small noncoding RNAs approximately 20–25 nt in length, which play crucial roles through directly binding to corresponding 3′ UTR of targeted mRNAs. It has been reported that miRNAs are involved in numerous of diseases, including cancers. Recently, miR-134 has been identified to dysregulate in handles of human cancers, such as lung cancer, glioma, breast cancer, colorectal cancer, and so on. Increasing evidence indicates that miR-134 is essential for human carcinoma and participates in tumor cell proliferation, apoptosis, invasion and metastasis, drug resistance, as well as cancer diagnosis, treatment, and prognosis. Nevertheless, its roles in human cancer are still ambiguous, and its mechanisms are sophisticated as well, referring to a variety of targets and signal pathways, such as STAT5B, KRAS, MAPK/ERK signal pathway, Notch pathway, etc. Herein, we review the crucial roles of miR-134 in scores of human cancers via analyzing latest investigations, which might provide evidence for cancer diagnose, treatment, prognosis, or further investigations.

  3. Implementation of R134a Thermophysical Properties for MARS Application

    Energy Technology Data Exchange (ETDEWEB)

    Son, Gyu Min; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

    2016-05-15

    MARS requires 3 files for analysis: executable MARS file, input, and thermodynamic property file (tpf) for target fluids like light water or heavy water. Most experiments and scenarios were interested in behavior of water so original tpfs were sufficient enough for analysis. As MARS application became wider, needs for other fluid properties rose since MARS do not have extra function to interpret foreign materials that does not have tpf. One way of solving this problem is to generate external tpf file and if successfully implemented, this methodology could widen the application of MARS to other fields of engineering. Thus, this study aims for tpf generation of R134a. The reasons for its selection is because R134a is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. Generation methods of tpf were discussed. Conventional tpfh2o utilized Gibbs function to calculate the properties. However, since that method could not be applied to other fluids, fitting equation with temperature and pressure variables were applied from R134a property database. Direct implementation of theses equations simplified the structure of main program.

  4. Application of a room temperature ionic liquid for nuclear spent fuel reprocessing: speciation of trivalent europium and solvatation effects

    International Nuclear Information System (INIS)

    Moutiers, G.; Mekki, S.; Billard, I.

    2007-01-01

    One of the solutions proposed for the optimization of the long term storage and conditioning of spent nuclear fuel is to separate actinide and lanthanide both from each other and from other less radioactive metallic species. The industrial proposed processes, based on liquid liquid extraction steps, involve solvents with non negligible vapour pressure and may generate contaminated liquid wastes that will have to be reprocessed. During the last decade, some room-temperature ionic liquids have been studied and integrated into industrial processes. The interest on this class of solvent came out from their 'green' properties (non volatile, non flammable, recyclable, etc...), but also from the variability of their physico-chemical properties (stability, hydrophobicity, viscosity) as a function of the RTIL chemical composition. Indeed, it has been shown that classical chemical industrial processes could be transferred into those media, even more improved, while a certain number of difficulties arising from using traditional solvent can be avoided. In this respect, it could be promising to investigate the ability to use room temperature ionic liquid into the spent nuclear fuel reprocessing field. The aim of this this study is to test the ability of the specific ionic liquid bumimTf 2 N to allow trivalent europium extraction. The choice of this metal is based on the chemical analogy with trivalent minor actinides Curium and Americium which are contributing the greatest part of the long-lived high level radioactive wastes. Handling these elements needs to be very cautious for the safety and radioprotection aspect. Moreover, europium is a very sensitive luminescent probe to its environment even at the microscopic scale. The report is structured with four parts. In a first chapter, we present the main physico-chemical properties of an imidazolium-based ionic liquid family, and then we choose the ionic liquid bumimTf 2 N for the whole thesis and start with the electrochemical

  5. Computational Investigation on the Spectroscopic Properties of Thiophene Based Europium β-Diketonate Complexes.

    Science.gov (United States)

    Greco, Claudio; Moro, Giorgio; Bertini, Luca; Biczysko, Malgorzata; Barone, Vincenzo; Cosentino, Ugo

    2014-02-11

    The adiabatic transition energies from the lowest triplet states of four Europium tris β-diketonate/phenantroline complexes have been determined in vacuo and in dicholomethane solution by the ΔSCF approach at the density functional theory level, using the PBE1PBE and the CAM-B3LYP hybrid functionals. The calculated adiabatic transition energies have been compared with the experimental 0-0 transitions of each complex determined from phosphorescence spectra of the corresponding Gd(3+) complexes and followed by direct comparison between simulated and experimental spectra line shapes. For compound 1, the Eu(TTA)3Phen system, triplet states other than the lowest one and conformational isomers other than the one present in the crystallographic structure have been considered. In the crystallographic structure, this compound presents three quasi-degenerate low energy triplet states, differing for the TTA ligand where the two unpaired electrons are localized and showing close adiabatic transition energies. For compound 1, the lowest triplet states of the four investigated conformational isomers show similar characteristics and close adiabatic transition energies. On the basis of these results, an investigation of compounds 2-4 (Eu(Br-TTA)3Phen, Eu(DTDK)3Phen, and Eu(MeT-TTA)3) has been performed by considering only the isomer present in the crystallographic structure and only the lowest triplet state of each compound. For compounds 1-3, the energies of the lowest triplet states calculated by both functionals in solution including zero-point energy corrections well reproduce the experimental trends as well as the values of the adiabatic transition energies: CAM-B3LYP, the best performing functional, provides energies of the lowest triplet state with deviations from experiments lower than 1200 cm(-1). Also, the calculated vibrationally resolved phosphorescence spectra and UV-vis absorptions well reproduce the main features of their experimental counterparts. Significant

  6. Synthesis and characterization of phosphors based on calcium and magnesium silicates doped with europium and dysprosium

    International Nuclear Information System (INIS)

    Misso, Agatha Matos

    2016-01-01

    Ca and Mg silicates based phosphors were prepared by sol-gel method combined with the molten salts process. The gel of silica was obtained from Na 2 SiO 3 solution by using europium, dysprosium, calcium and magnesium chloride solutions. Therefore, those chlorides were homogeneously dispersed into the gel. The obtained gel was dried and heat treated to 900° C for 1h to allow the fusion of the present salts. Then it was water washed until negative test for Cl - , and dried. The reduction of the europium to Eu 2+ was performed under atmosphere of 5% of H 2 and 95% of Ar to 900° C for 3h, to reach CaMgSi 2 O 6 :Eu 2+ and CaMgSi 2 O 6 :Eu 2+ :Dy 3+ phosphors. Diopside was identified as main crystalline phase and quartz, as secondary phase from XRD (X-ray diffraction) patterns. SEM (scanning electron microscopy) micrographs, of the samples showed needles, spheres, leaves and rods of particles and agglomerates. Thermal analysis (TGA-DTGA) curves revealed that the crystallization temperature of CaMgSi 2 O 6 :Eu 2+ lies around 765° C. Photoluminescence spectroscopy of the phosphors was studied based on interconfigurational 4f N → 4f N-1 5d transition of Eu 2+ ion. The spectra of excitation showed 4f N → 4f N-1 5d transition of Eu 2+ ion broad band, related to the ligand to metal charge transfer transition (LMCT) O 2- (2p) → Eu 3+ in the 250 nm region, when the emission is monitored at 583,5 nm. It also presents the 4f ↔ 4f transitions of Eu 3+ ion bands, showing the 7 F 0 → 5 L 6 transition at 393 nm. From emission spectra with excitation monitored at 393 nm, it can be observed fine peaks between 570 and 750 nm which are characteristics of 5 D 0 → 7 F J (J = 0 - 5) transition of Eu 3+ ion, indicating that the Eu 3+ ion occupies a site with center of inversion. Finally, the obtained results indicate that the developed method is suitable to synthesize CaMgSi 2 O 6 :Eu 2+ and CaMgSi 2 O 6 :Eu 2+ :Dy 3+ phosphors, as it has been proposed. (author)

  7. Fluorometric determination of samarium and europium in rare earth minerals with. beta. -diketoneternary complex

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

    1981-07-01

    This communication reported the optimum conditions for the fluorometric determination of these ions, and the method was adopted in the simultaneous determination of samarium and europium in xenotime and monazite minerals. From the experimental results on the effect of diverse ions and the extraction pH of the aqueous phase, it became clear that TTA-TOPO hexane method was the best system for the determination of samarium and europium because of the highest fluorescence sensitivity of the ternary complex, and also because the lower extraction pH eliminated the effect of diverse ions. Moreover, the very high detection limit (2 ppb) of Sm was achieved by the use of a red sensitive photomultiplier. Which was used at 644 nm, and that of Eu (0.02 ppb) at 614 nm. The procedure was established as follows: The rare earth minerals (xenotime, monazite) sample was treated with hot conc. H/sub 2/SO/sub 4/ and twice precipitated with 0.5 mol dm/sup -3/ oxalic acid (pH was adjusted to 2.0 -- 2.2). Then the precipitate was filtered and ignited to give the rare earth oxide. Fifty milligrams of the oxide was dissolved in HCl and diluted with water in order to obtain the solution containing 5 ..mu..g cm/sup -3/ rare earth oxide. An aliquot of the solution ((1.0 -- 3.0) cm/sup 3/) was adjusted to pH 5.5 with sodium acetate and shaken with 1 x 10/sup -4/ mol dm/sup -3/ TTA- 2 x 10/sup -2/ mol dm/sup -3/ TOPO hexane solution. Then the fluorescence intensity of the organic layer was measured at 644 nm for Sm and 614 nm for Eu. In this procedure, the recovery of Sm and Eu was found to be about 96%. Xenotime contained 0.70% of Sm and 0.004% of Eu, and monazite contained 1.84% of Sm and 0.003% of Eu.

  8. Fluorescence properties of europium and samarium. beta. -diketonates and their use in fluorometry

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

    1981-01-01

    Several europium and samarium ..beta..-diketonates (tta, ntfa, bfa) complexed with 1, 10-phenanthroline, or with trioctylphosphine oxide (topo) were synthesized. The fluorescence properties of these compounds in benzene or hexane have been studied. Absorption and fluorescence spectra, fluorescence quantum yield, fluorescence sensitivity index (F.S.I.), and fluorescence lifetime were measured. From the measurement of fluorescence lifetime of the ..beta..-diketonates, the velocity of radiative process (k sub(f)/phi sub(f)) has almost the same value for benzene and hexane solvent. The red fluorescence (Em. max. : 619 nm) of Eu(III) in these chelates is attributed to transitions from /sup 5/D/sub 0/ ..-->.. /sup 7/F/sub 2/ levels of this ion, and the three-band spectrum (Em. max. : 569 nm, 606 nm, 650 nm) indicates the transitions from the /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(5/2), /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(7/2), and /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(9/2) levels of Sm(III), respectively. These spectra are not changed by any solvents and ligands. From the results, the fluorescence of the ..beta..-diketonates in organic solvent has been attributed to m* ..-->.. m luminescence transition. The complexes of Eu(III) and Sm(III) show radiative transition within orbitals, composed exclusively of 4f orbitals of rare earth ions (m* ..-->.. m radiative transition). Fluorinated ligands show better sensitivity than unfluorinated ligands, and the best sensitivity is obtained with TTA-phen system, and/or TTA-topo system for the spectrofluorometric determination of the two metals. In the case of Eu determination, 619 nm emission wavelength is used (the determinable range : 0.2 -- 10 ppb Eu), and in the case of Sm determination, 650 nm emission wavelength is adopted (the determinable range : 0.1 -- 1 ppm Sm), because of much higher sensitivity than the other two peaks (569, 606 nm) without interference from europium complex.

  9. Tuning Eu{sup 3+} emission in europium sesquioxide films by changing the crystalline phase

    Energy Technology Data Exchange (ETDEWEB)

    Mariscal, A., E-mail: antonio.mariscal@csic.es [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain); Quesada, A. [Ceramics for Smart Systems Group, Instituto de Cerámica y Vidrio, C/ Kelsen 5, 28049 Madrid (Spain); Camps, I. [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain); Palomares, F.J. [Instituto de Ciencia de Materiales de Madrid, C/ Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Fernández, J.F. [Ceramics for Smart Systems Group, Instituto de Cerámica y Vidrio, C/ Kelsen 5, 28049 Madrid (Spain); Serna, R. [Laser Processing Group, Instituto de Óptica, CSIC, C/ Serrano 121, 28006 Madrid (Spain)

    2016-06-30

    Highlights: • PLD production of high quality europium sesquioxide (Eu{sub 2}O{sub 3}) films. • The deposition of Al{sub 2}O{sub 3} capping and/or buffer layers modifies the crystallization for Eu{sub 2}O{sub 3} films upon annealing. • The formation of cubic or monoclinic phases can be favored. • Eu{sup 3+} emission tuning is achieved as a consequence of crystal field effects. - Abstract: We report the growth of europium sesquioxide (Eu{sub 2}O{sub 3}) thin films by pulsed laser deposition (PLD) in vacuum at room temperature from a pure Eu{sub 2}O{sub 3} ceramic bulk target. The films were deposited in different configurations formed by adding capping and/or buffer layers of amorphous aluminum oxide (a-Al{sub 2}O{sub 3}). The optical properties, refractive index and extinction coefficient of the as deposited Eu{sub 2}O{sub 3} layers were obtained. X-ray photoelectron spectroscopy (XPS) measurements were done to assess its chemical composition. Post-deposition annealing was performed at 500 °C and 850 °C in air in order to achieve the formation of crystalline films and to accomplish photoluminescence emission. According to the analysis of X-ray diffraction (XRD) spectra, cubic and monoclinic phases were formed. It is found that the relative amount of the phases is related to the different film configurations, showing that the control over the crystallization phase can be realized by adequately designing the structures. All the films showed photoluminescence emission peaks (under excitation at 355 nm) that are attributed to the intra 4f-transitions of Eu{sup 3+} ions. The emission spectral shape depends on the crystalline phase of the Eu{sub 2}O{sub 3} layer. Specifically, changes in the hypersensitive {sup 5}D{sub 0} → {sup 7}F{sub 2} emission confirm the strong influence of the crystal field effect on the Eu{sup 3+} energy levels.

  10. Characteristics of transfer of europium ions from phosphoric acid solution into the CaSO4·O.5H2O solid phase

    International Nuclear Information System (INIS)

    Berdonosova, D.G.; Burlakova, E.V.; Yasenkova, M.A.; Ivanov, L.N.; Melikhov, I.V.

    1989-01-01

    The mechanism of formation of the precipitated CaSO 4 ·0.5H 2 O phase was studied in detail; the precipitation was performed at 80 degree, equimolar solutions of Ca(H 2 PO 4 ) 2 and H 2 SO 4 in phosphoric acid of 38% concentration being used. The availability of detailed information on the mechanism of formation of CaSO 4 ·0.5H 2 O precipitates determined the choice of conditions of study of capture of rare earths. In particular, H 3 PO 4 of 38% P 2 O 5 concentration was used as the medium of formation of the calcium sulfate precipitate. Europium was chosen as the rare earth. Its behavior in the liquid and solid phases was studied by radiometric and luminescence methods. The radionuclide 152 Eu is convenient as a radioactive tracer while luminescence of europium is structure-sensitive; therefore, europium is often used in physicochemical investigations as a luminescent probe. It follows from the data that most of the europium captured by the precipitate during coagulation of the ultramicrocrystals is retained firmly by the solid phase. Therefore, in order to diminish capture of europium (and other rare earths) by the precipitate coagulation of the latter should be prevented

  11. Damage recovery and optical activity in europium implanted wide gap oxides

    International Nuclear Information System (INIS)

    Alves, E.; Marques, C.; Franco, N.; Alves, L.C.; Peres, M.; Soares, M.J.; Monteiro, T.

    2010-01-01

    In this study we compare and discuss the defects and optical behaviour of sapphire and magnesium oxide single crystals implanted at room temperature with different fluences (1 x 10 15 -1 x 10 16 cm -2 ) of europium ions. Rutherford backscattering channelling shows that for fluences above 5 x 10 15 cm -2 the surface disorder level in the Al-sublattice reaches the random level. Implantation damage recovers fast for annealing in oxidizing atmosphere but even for the highest fluence we recover almost completely all the damage after annealing at 1300 o C, independently of the annealing environment (reducing or oxidizing). Annealing above 1000 o C promotes the formation of Eu 2 O 3 in the samples with higher concentration of Eu. The optical activation of the rare earth ions at room temperature was observed after annealing at 800 o C by photoluminescence and ionoluminescence. In Al 2 O 3 lattice the highest intensity line of the Eu 3+ ions corresponds to the forced electric dipole 5 D 0 → 7 F 2 transition that occurs ∼616 nm. For the MgO samples the Eu 3+ optical activation was also achieved after implantation with different fluences. Here, the lanthanide recombination is dominated by the magnetic dipole 5 D 0 → 7 F 1 transition near by 590 nm commonly observed for samples were Eu 3+ is placed in a high symmetry local site. The results clearly demonstrate the possibility to get Eu incorporated in optical active regular lattice sites in wide gap oxides.

  12. Photoluminescent behaviors of several kinds of europium ternary complexes doped in PMMA

    International Nuclear Information System (INIS)

    Liu, H.-G.; Lee, Yong-Ill; Park, Seongtae; Jang, Kiwan; Kim, Sang Su

    2004-01-01

    Four kinds of europium ternary complexes; Eu(DBM) 3 phen, Eu(DBM) 3 (DB-bpy), Eu(DBM) 3 (DN-bpy) and Eu(DBM) 3 biq (DBM, phen, DB-bpy, DN-bpy and biq refer to Dibenzoylmethane, 1,10-phenanthroline, 4,4'-Di-tert-butyl-2,2'-dipyridyl, 4,4'-Dinonyl-2,2'-dipyridyl and 2,2'-Biquinoline, respectively), were doped in poly(methyl methacrylate) (PMMA) matrix. The luminescence properties of the composites were investigated by emission spectroscopy and lifetime measurements. It was found that the composites formed by the three complexes, Eu(DBM) 3 phen, Eu(DBM) 3 (DB-bpy), and Eu(DBM) 3 (DN-bpy), exhibit strong luminescence and similar emission spectral characteristics to Eu(III). Whereas, Eu(DBM) 3 biq shows large differences in its luminescence spectrum compared to those of other complexes. The luminescence was very weak and broad. The emission spectral features of Eu(III) in the Eu(DBM) 3 biq/PMMA systems change with the molar ratios of the complex and PMMA. The lifetime of 5 D 0 level of Eu(III) in Eu(DBM) 3 biq/PMMA systems is shorter than those in the other systems. The luminescence intensity of Eu(III) in Eu(DBM) 3 biq/PMMA systems decreases gradually when exposed to UV-light while the broad emission band becomes stronger

  13. Complexation and molecular modeling studies of europium(III)-gallic acid-amino acid complexes.

    Science.gov (United States)

    Taha, Mohamed; Khan, Imran; Coutinho, João A P

    2016-04-01

    With many metal-based drugs extensively used today in the treatment of cancer, attention has focused on the development of new coordination compounds with antitumor activity with europium(III) complexes recently introduced as novel anticancer drugs. The aim of this work is to design new Eu(III) complexes with gallic acid, an antioxida'nt phenolic compound. Gallic acid was chosen because it shows anticancer activity without harming health cells. As antioxidant, it helps to protect human cells against oxidative damage that implicated in DNA damage, cancer, and accelerated cell aging. In this work, the formation of binary and ternary complexes of Eu(III) with gallic acid, primary ligand, and amino acids alanine, leucine, isoleucine, and tryptophan was studied by glass electrode potentiometry in aqueous solution containing 0.1M NaNO3 at (298.2 ± 0.1) K. Their overall stability constants were evaluated and the concentration distributions of the complex species in solution were calculated. The protonation constants of gallic acid and amino acids were also determined at our experimental conditions and compared with those predicted by using conductor-like screening model for realistic solvation (COSMO-RS) model. The geometries of Eu(III)-gallic acid complexes were characterized by the density functional theory (DFT). The spectroscopic UV-visible and photoluminescence measurements are carried out to confirm the formation of Eu(III)-gallic acid complexes in aqueous solutions. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. Mean-field potential approach for thermodynamic properties of lanthanide: Europium as a prototype

    Science.gov (United States)

    Kumar, Priyank; Bhatt, N. K.; Vyas, P. R.; Gohel, V. B.

    2018-03-01

    In the present paper, a simple conjunction scheme [mean-field potential (MFP) + local pseudopotential] is used to study the thermodynamic properties of divalent lanthanide europium (Eu) at extreme environment. Present study has been carried out due to the fact that divalent nature of Eu arises because of stable half-filled 4f-shell at ambient condition, which has great influence on the thermodynamic properties at extreme environment. Due to such electronic structure, it is different from remaining lanthanides having incomplete 4f-shell. The presently computed results of thermodynamic properties of Eu are in good agreement with the experimental results. Looking to such success, it seems that the concept of MFP approach is successful to account contribution due to nuclear motion to the total Helmholtz free energy at finite temperatures and pressure-induced inter-band transfer of electrons for condensed state of matter. The local pseudopotential is used to evaluate cold energy and hence MFP accounts the s-p-d-f hybridization properly. Looking to the reliability and transferability along with its computational and conceptual simplicity, we would like to extend the present scheme for the study of thermodynamic properties of remaining lanthanides and actinides at extreme environment.

  15. EUROPIUM ION INFLUENCE ON THE FORMATION OF Ag-NANOPARTICLES IN FLUORINE PHOSPHATE GLASSES

    Directory of Open Access Journals (Sweden)

    R. O. Pysh'ev

    2015-05-01

    Full Text Available The paper deals with research of formation characteristics of silver nanoparticles in fluorophosphate glasses 0.25 Na2O - 0.5 P2O5 - 0.10 Ga2O3 - 0.075 AlF3 - 0.025 NaF - 0.05 ZnF2 doped with EuF3 (0.8 and 4 wt.% and without them. The synthesis was carried out in closed glassy carbon crucibles in argon atmosphere. Nanoparticles were formed after a low temperature process of Ag+ → Na+ ion-exchange (320 °C and subsequent heat treatment. It was shown that in the initial glasses doped with EuF3, rare earth ions exist in two valence forms (Eu2+ and Eu3+ in dynamic equilibrium and the concentration of Eu2+ increases proportionally to the total concentration of fluoride. It was shown that sizes of molecular clusters or metal nanoparticles depend on the concentration of europium fluoride and duration of ion exchange. The metallic Ag-nanoparticles sizes were defined for different times of heat treatment and ion exchange. The possibility of the stimulating growth of nanoparticles through the introduction of additional EuF3 in the glass was proved. The possibility of obtaining nanoparticles without the heat treatment in glasses with a high concentration of EuF3 was shown. Chemical mechanism for the formation of Ag-nanoparticles during the ion exchange was suggested.

  16. Determination of piroxicam in pharmaceutical formulations and urine samples using europium-sensitized luminescence

    Energy Technology Data Exchange (ETDEWEB)

    Al-Kindy, Salma M.Z. [Department of Chemistry, College of Science, P.O. Box 36, Al-Khod 123, Sultan Qaboos University (Oman)], E-mail: alkindy@squ.edu.om; Suliman, Fakhr Eldin O.; Al-Wishahi, Aisha A.; Al-Lawati, Haidar A.J.; Aoudia, Muhammed [Department of Chemistry, College of Science, P.O. Box 36, Al-Khod 123, Sultan Qaboos University (Oman)

    2007-12-15

    A simple, selective and sensitive luminescence method for the assay of piroxicam (PX) in aqueous solution is developed. The method is based on the luminescence sensitization of europium (Eu{sup 3+}) by formation of ternary complex with PX in the presence of TOPO and Tween-80 as surfactant. The signal for Eu-PX-TOPO is monitored at {lambda}{sub ex}=359 nm and {lambda}{sub em}=615 nm. Optimum conditions for the formation of the complex in sequential injection analysis (SIA) were 0.01 M Tris buffer, pH 7.5, TOPO 5.0x10{sup -5} M, Tween-80 0.15% and 1.5 mM of Eu{sup 3+}, which allows the determination of 100-1000 ppb of PX with limit of detection (LOD) of 29 ppb. The relative standard deviations of the method range between 0.5% and 3.9% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assay of PX in pharmaceutical formulations and in urine samples. Average recoveries of 100.8{+-}1.7% was obtained in tablet, whereas a recovery of 97.5{+-}2.0% was obtained for the total PX (PX+hydoxy-PX) in urine sample.

  17. Photoluminescent study of Polycarbonate (PC) and Poly(9-vinylcarbazole) (PVK) doped films with europium complex

    International Nuclear Information System (INIS)

    Forster, Pedro Lima

    2010-01-01

    Polymers doped with rare earth complexes are advantaged in film production for many applications in the luminescent field. In this study luminescent polymer obtained from polycarbonate (PC) and poly(9-vinylcarbazole) films doped with diaquatris(thenoyltrifluoroacetonate)europium(III) complex [Eu(tta) 3 (H 2 0) 2 ] were prepared and their calorimetric and luminescent properties in the solid state are reported. The thermal behavior was investigated by differential scanning calorimetry (OSC) and thermogravimetry analysis (TGA). Due of the addition of rare earth Eu(tta) 3 (H 2 0) 2 ] into PC and PVK matrices, changes were observed in the thermal behavior concerning the glass transition and thermal stability. Characteristic broadened narrow bands arising from the 5 D 0 -→ 7 F J transitions (J = 0-4) of Eu 3+ ion indicate the incorporation of the Eu 3+ ions into those polymers. The luminescent films show enhancement emission intensity with an increase in the rare earth concentration in polymeric matrix accompanied by decrease in thermal stability. (author)

  18. Determination of piroxicam in pharmaceutical formulations and urine samples using europium-sensitized luminescence

    International Nuclear Information System (INIS)

    Al-Kindy, Salma M.Z.; Suliman, Fakhr Eldin O.; Al-Wishahi, Aisha A.; Al-Lawati, Haidar A.J.; Aoudia, Muhammed

    2007-01-01

    A simple, selective and sensitive luminescence method for the assay of piroxicam (PX) in aqueous solution is developed. The method is based on the luminescence sensitization of europium (Eu 3+ ) by formation of ternary complex with PX in the presence of TOPO and Tween-80 as surfactant. The signal for Eu-PX-TOPO is monitored at λ ex =359 nm and λ em =615 nm. Optimum conditions for the formation of the complex in sequential injection analysis (SIA) were 0.01 M Tris buffer, pH 7.5, TOPO 5.0x10 -5 M, Tween-80 0.15% and 1.5 mM of Eu 3+ , which allows the determination of 100-1000 ppb of PX with limit of detection (LOD) of 29 ppb. The relative standard deviations of the method range between 0.5% and 3.9% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assay of PX in pharmaceutical formulations and in urine samples. Average recoveries of 100.8±1.7% was obtained in tablet, whereas a recovery of 97.5±2.0% was obtained for the total PX (PX+hydoxy-PX) in urine sample

  19. Temperature effects on the interaction mechanisms between the europium (III) and uranyl ions and zirconium diphosphate

    International Nuclear Information System (INIS)

    Finck, N.

    2006-10-01

    Temperature should remain higher than 25 C in the near field environment of a nuclear waste repository for thousands years. In this context, the aim of this work is to study the temperature influence on the interaction mechanisms between europium (III) and uranyl ions and zirconium diphosphate, as well as the influence of a complexing medium (nitrate) on the sorption of the lanthanide. The experimental definition of the equilibria was achieved by combining a structural investigation with the macroscopic sorption data. Surface complexes were characterized at all temperatures (25 C to 90 C) by TRLFS experiments carried out on dry and in situ samples using an oven. This characterization was completed by XPS experiments carried out at 25 C on samples prepared at 25 C and 90 C. The reaction constants (surface hydration and cations sorption) were obtained by simulating the experimental data with the constant capacitance surface complexation model. The reaction constants temperature dependency allowed one to characterize thermodynamically the different reactions by application of the van't Hoff relation. The validity of this law was tested by performing microcalorimetric measurements of the sorption heat for both cations. (author)

  20. NMR and luminescence spectroscopy study of formation of mixed β-diketonate europium complexes

    International Nuclear Information System (INIS)

    Kavun, V.Ya.; Kalinovskaya, I.V.; Karasev, V.E.; Chernyshov, B.N.; Steblevskaya, N.I.

    1987-01-01

    Methods of NMR ('H, 19 F) and luminescent spectroscopy were applied to study ligand substitution in Eu(β-dik) 3 phen-CDCl 3 -(β-dik)' systems, where β-dik-acetylacetone (AA) and hexafluoroacetyl-acetone (HFAA), phen-1.10-phenathroline at different mole ratio (m) of competing ligands (m=AA/HFAA). Formation of mixed Eu(AA) 2 (HFAA)phen and Eu(AA)(HFAA) 2 phen complexes is proved; calculation of the stark structure of 5 D 0 - 7 F j (j=0,1,2) transitions in low-temperature luminescence spectra is conducted for these complexes. It is stated that at minimum HFAA concentration in the solution the latter replaces AA from europium coordination sphere. It is shown that depending on the value in substitution of acidoligands proceeds successfully by the equations Eu(AA) 3 phen+(NHFAA) n → Eu(AA) 3-n → (HFAA) n phen+(NAA) n ; (n=1,2,3)

  1. Doping β-Ga2O3 with europium: influence of the implantation and annealing temperature

    Science.gov (United States)

    Peres, M.; Lorenz, K.; Alves, E.; Nogales, E.; Méndez, B.; Biquard, X.; Daudin, B.; Víllora, E. G.; Shimamura, K.

    2017-08-01

    β-Ga2O3 bulk single crystals were doped by ion implantation at temperatures from room temperature to 1000 °C, using a 300 keV Europium beam with a fluence of 1  ×  1015 at cm-2. Rising the implantation temperature from room temperature to 400-600 °C resulted in a significant increase of the substitutional Eu fraction and of the number of Eu ions in the 3+  charge state as well as in a considerable decrease of implantation damage. Eu is found in both charge states 2+  and 3+  and their relative fractions are critically dependent on the implantation and annealing temperature, suggesting that defects play an important role in stabilizing one of the charge states. The damage recovery during post-implant annealing is a complex process and typically defect levels first increase for intermediate annealing temperatures and a significant recovery of the crystal only starts around 1000 °C. Cathodoluminescence spectra are dominated by the sharp Eu3+ related intra-ionic 4f transition lines in the red spectral region. They show a strong increase of the emission intensity with increasing annealing temperature, in particular for samples implanted at elevated temperature, indicating the optical activation of Eu3+ ions. However, no direct correlation of emission intensity and Eu3+ fraction was found, again pointing to the important role of defects on the physical properties of these luminescent materials.

  2. Influence of organic solvent treatment on elasticoluminescent property of europium-doped strontium aluminates

    International Nuclear Information System (INIS)

    Fujio, Yuki; Xu, Chao-Nan; Terasaki, Nao; Ueno, Naohiro

    2014-01-01

    The influence of an organic solvent treatment on elasticoluminescent (ELS) characteristics of mechanoluminescent (ML) sensor using the composite film consisting of an ELS material and epoxy resin was investigated. We used strontium aluminate doped with a small amount of europium (SrAl 2 O 4 :Eu, SAOE) as an ELS material in this study. After evaluating the ELS characteristics of the fabricated ML sensors using SAOE treated with/without various organic solvents, SAOE treated with methanol and ethanol showed lower ELS intensities than that of untreated SAOE. In contrast, the ELS response curves against strain for the ML sensors using SAOE treated with acetone and toluene, overlapped with that of untreated SAOE. From the characterization of SAOE treated with alcohols, such as methanol and ethanol, we can hypothesize that poor ELS characteristics is due to the degradation of the SAOE grain surfaces by the hydrolyze reaction of SAOE with hydroxyl group of alcohol. Thus, on the basis of the obtained results, we can conclude that the selection of organic solvent used in the preparation of SAOE film is of considerable importance in the development of ML sensor with a highly-reliable ELS characteristic. -- Highlights: • Influence of organic solution treatment on the sensing characteristics of a mechanoluminescent (ML) sensor using SrAl 2 O 4 :Eu has been investigated. • An alcohol treatment of SAOE powder has considerable effect on its ML characteristic. • There is almost no influence of acetone and toluene treatments on ML characteristics

  3. Effects of europium polyoxometalate encapsulated in silica nanoparticles (nanocarriers) in soil invertebrates

    Energy Technology Data Exchange (ETDEWEB)

    Bicho, Rita C., E-mail: ritabicho@ua.pt; Soares, Amadeu M.V.M. [Universidade de Aveiro, Departamento de Biologia & CESAM (Portugal); Nogueira, Helena I.S. [Universidade de Aveiro, Departamento de Química & CICECO (Portugal); Amorim, Mónica J.B. [Universidade de Aveiro, Departamento de Biologia & CESAM (Portugal)

    2016-12-15

    Polyoxometalates (POMs) are metal oxo clusters that have been investigated for several applications in material sciences, catalysis, and biomedicine; these gained increasing interest in the field of nanotechnology as nanocarriers for drug delivery. Associated to the increasing applications, there is the need for information regarding the effects on the environment of these compounds, which is completely absent in the literature. In the present study, the effects of europium polyoxometalates encapsulated into silica nanoparticles (Eu-POM/SiO{sub 2} NPs) were assessed on the soil representative Enchytraeus crypticus. The individual materials were also assessed (Eu-POMs and SiO{sub 2} NPs). Toxicity was evaluated in various test media with increasing complexity: water, soil/water extracts, and soil. Toxicity was only observed for Eu-POM/SiO{sub 2} NPs and in the presence of soil components. Despite the fact that effects were observed for concentrations higher than current predicted environmental concentration (PEC), attention should be given to the growing use of these compounds. The present study shows the importance of assessing the effects in soil media, also compared to water. Moreover, results of “no effect” are critically needed and often unpublished. The present study can contribute to the improvement of the OECD guidelines for safety of manufactured nanomaterials on environmental toxicity in the soil compartment providing an improved test alternative.

  4. Synthesis, Structure, and Luminescent Properties of Europium-Doped Hydroxyapatite Nanocrystalline Powders

    Directory of Open Access Journals (Sweden)

    Carmen Steluta Ciobanu

    2012-01-01

    Full Text Available The luminescent europium-doped hydroxyapatite (Eu:HAp, Ca10−xEux(PO46(OH2 with 0≤x≤0.2 nanocrystalline powders was synthesized by coprecipitation. The structural, morphological, and textural properties were well characterized by X-ray diffraction, scanning electron microscopy, and transmission electron microscopy. The vibrational studies were performed by Fourier transform infrared, Raman, and photoluminescence spectroscopies. The X-ray diffraction analysis revealed that hydroxyapatite is the unique crystalline constituent of all the samples, indicating that Eu has been successfully inserted into the HAp lattice. Eu doping inhibits HAp crystallization, leading to a decrease of the average crystallite size from around 20 nm in the undoped sample to around 7 nm in the sample with the highest Eu concentration. Furthermore, the samples show the characteristic 5D0→7F0 transition observed at 578 nm related to Eu3+ ions distributed on Ca2+ sites of the apatitic structure.

  5. Europium concentration effect on characteristics and luminescent properties of hydroxyapatite nanocrystalline powders

    Science.gov (United States)

    Nikolaev, Anton; Kolesnikov, Ilya; Frank-Kamenetskaya, Olga; Kuz'mina, Maria

    2017-12-01

    Series of Eu-apatites were synthesized by precipitation from aqueous solutions with the Eu/Ca atomic ratio from 0.5% to 5% at T = 90 °C. Resulting precipitates were studied using different experimental techniques including X-ray powder diffraction, infrared and raman spectroscopy, scanning elecrton microscopy, EDX and photoluminescent spectroscopy. Eu-doped Ca-deficit nanosized non-stoichiometric hydroxyapatite with high water content has been obtained throughout the experiment. Europium content in the synthesized apatites reaches 0.24 apfu (Eu/Ca = 2.5%). Relations between Eu content is the solution and precipitate have been established. It was shown that Eu-monacite starts to precipitate as secondary phase at Eu/Ca ratio in starting solution 1% or higher. Maximum luminescence is observed in apatite with ∼2% Eu/Ca ratio (which equals to ∼0.2 apfu and corresponds to 3% Eu/Ca ratio in the starting solution). As an important and brand-new result, apatite with 2% Eu/Ca ratio can be considered as the most appropriate material for the producing biolabels for luminescent research in medicine and biology.

  6. Reducing the photo-bleaching effect of a new europium complex embedded in styrene butadiene copolymer

    Science.gov (United States)

    Jiménez, G. Lesly; Reyes-Rodríguez, J. L.; Padilla, Isela; Alarcón-Flores, G.; Falcony, C.

    2018-02-01

    A highly luminescent europium complex obtained with two different ligands, succinimide (SI) and 2-thenoyltrifluoroacetone (TTA) , was synthetized with different TTA concentrations. The photoluminescence (PL) emission from these materials corresponds to the characteristic inter-electronic energy level transitions of the Eu3+ ions. However, the excitation spectrum is strongly dependent on the presence of TTA, having an optimum response when 0.75 mmol of this compound is added to the EuL3(H2O)3 complex. The quantum yield obtained by these powders were around 72 % ± 1.7 % indicating an optimum sensitization of these complex. The EuL3 TTA complex with the best PL properties was embedded in a styrene butadiene copolymer (SBC) film, produced by the drop casting method, obtaining similar PL behavior at different concentrations, the highest intensity was observed at 1.2% (w/v) of EuL3 TTA complex and the quantum yield of these composite films was 60.5 % ± 2 % . These films were exposed to continuous UV irradiation and after 141 h no photo-bleaching effect was observed in contrast with the EuL3 TTA complex that exhibited a noticeable photoluminescence intensity degradation at much shorter exposure times. Both the Eu-complexes and the composite films were characterized by FT-IR, XRD, SEM and fluorescence spectroscopy.

  7. Effects of europium polyoxometalate encapsulated in silica nanoparticles (nanocarriers) in soil invertebrates

    International Nuclear Information System (INIS)

    Bicho, Rita C.; Soares, Amadeu M.V.M.; Nogueira, Helena I.S.; Amorim, Mónica J.B.

    2016-01-01

    Polyoxometalates (POMs) are metal oxo clusters that have been investigated for several applications in material sciences, catalysis, and biomedicine; these gained increasing interest in the field of nanotechnology as nanocarriers for drug delivery. Associated to the increasing applications, there is the need for information regarding the effects on the environment of these compounds, which is completely absent in the literature. In the present study, the effects of europium polyoxometalates encapsulated into silica nanoparticles (Eu-POM/SiO 2 NPs) were assessed on the soil representative Enchytraeus crypticus. The individual materials were also assessed (Eu-POMs and SiO 2 NPs). Toxicity was evaluated in various test media with increasing complexity: water, soil/water extracts, and soil. Toxicity was only observed for Eu-POM/SiO 2 NPs and in the presence of soil components. Despite the fact that effects were observed for concentrations higher than current predicted environmental concentration (PEC), attention should be given to the growing use of these compounds. The present study shows the importance of assessing the effects in soil media, also compared to water. Moreover, results of “no effect” are critically needed and often unpublished. The present study can contribute to the improvement of the OECD guidelines for safety of manufactured nanomaterials on environmental toxicity in the soil compartment providing an improved test alternative.

  8. 33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...

  9. 24 CFR 17.134 - Procedures for salary offset: when deductions may begin.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Procedures for salary offset: when deductions may begin. 17.134 Section 17.134 Housing and Urban Development Office of the Secretary, Department... Government Salary Offset Provisions § 17.134 Procedures for salary offset: when deductions may begin. (a...

  10. 40 CFR 81.134 - Austin-Waco Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Austin-Waco Intrastate Air Quality Control Region. 81.134 Section 81.134 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.134 Austin-Waco Intrastate Air Quality Control Region. The Austin-Waco...

  11. 134cs uptake by plants from soil applying different absorbents

    International Nuclear Information System (INIS)

    Oncsik, M.

    1998-01-01

    A study of isotope uptake by plants using different zeolite clay minerals (montmorillonite, mordenite, clinoptilolite) was started with a view to reducing the rate of isotope uptake by plants by applying additives given to the soil. In pot experiments, the 134 Cs activity of green peas was reduced by 16% in average as compared to the control in the soils enriched with zeolite (mordenite type). Under field conditions, the radioactivity of millet and carrot yields were investigated in soils ameliorated with montmorillonite clay mineral. The radioactive contamination of the yield in soil treated with zeolite was in average 10% lower for millet and 24% for carrot roots as compared to the control

  12. Sorption behavior of cesium, cobalt and europium radionuclides onto hydroxyl magnesium silicate

    Energy Technology Data Exchange (ETDEWEB)

    Hamed, Mostafa M.; Holiel, M.; Ahmed, I.M. [Atomic Energy Authority, Cairo (Egypt). Hot Laboratories and Waste Management Center

    2016-07-01

    The radioactive wastes from different activities have to be safely disposed of and isolated from the human environment. The retardation of radioactive materials by designed barriers is originally controlled by the sorption ability of the mineral compositions. In this work, a naturally available mineral composite, a hydroxyl magnesium silicate (HMS) was investigated as potential natural inorganic sorbent for the retention of long-lived radionuclides ({sup 134}Cs, {sup 60}Co and {sup 152+154}Eu) from aqueous solutions. The factors affecting the sorption process, such as contact time and pH were evaluated. Furthermore X-ray fluorescence (XRF), Fourier transform infrared spectroscopy (FT-IR), scanning electron microscopy (SEM), X-ray diffraction (XRD), differential thermal and thermogravimetry analyses (DTA/TGA) measurements were examined in order to assess the physicochemical properties of the magnesium silicate mineral. Langmuir and Freundlich isotherms fitted the result s substantially better than the Flory-Huggins isotherm and the sorption was found to follow pseudo-first order kinetic model. The proposed mineral has been successfully applied for the sorption of {sup 134}Cs, {sup 60}Co and {sup 152+154}Eu radionuclides from real radioactive waste. The results indicated that about 97.4-99% of {sup 134}Cs, {sup 60}Co and {sup 152+154}Eu radionuclides were efficiently retained onto the HMS mineral. Based on the results obtained, it can be concluded that the HMS mineral is an economic and efficient retaining material for environmental hazardous migration and/or leakage of some radionuclides such as {sup 134}Cs, {sup 60}Co and {sup 152+154}Eu and trivalent actinide ({sup 241}Am, {sup 242m}Am and {sup 243}Am) ions. Therefore, this study could be used as a starting point to establish and consider that mineral as an engineered barrier around the disposal facilities at the nuclear activity centres.

  13. Europium(III) chelate-dyed nanoparticles as donors in a homogeneous proximity-based immunoassay for estradiol

    International Nuclear Information System (INIS)

    Kokko, Leena; Sandberg, Kaisa; Loevgren, Timo; Soukka, Tero

    2004-01-01

    Nanoparticles containing thousands of fluorescent europium(III) chelates have a very high specific activity compared to traditional lanthanide chelate labels. It can be assumed that if these particles are used in a homogeneous assay as donors, multiple chelates can excite a single acceptor in turns and the energy transfer to the acceptor is increased. The principle was employed in an immunoassay using luminescent resonance energy transfer from a long lifetime europium(III) chelate-dyed nanoparticle to a short lifetime, near-infrared fluorescent molecule. Due to energy transfer fluorescence lifetime of the sensitised emission was prolonged and fluorescence could be measured using a time-resolved detection. A competitive homogeneous immunoassay for estradiol was created using 92 nm europium(III) chelate-dyed nanoparticle coated with 17β-estradiol specific recombinant antibody Fab fragments as a donor and estradiol conjugated with near-infrared dye AlexaFluor 680 as an acceptor. The density of Fab fragments on the surface of the particle influenced the sensitivity of the immunoassay. The optimal Fab density was reached when the entire surface of the particle participated in the energy transfer, but the areas where the energy was transferred to a single acceptor, did not overlap. We were able to detect estradiol concentrations down to 70 pmol l -1 (3xSD of a standard containing 0 nmol l -1 of E2) using a 96-well platform. In this study we demonstrated that nanoparticles containing lanthanide chelates could be used as efficient donors in homogeneous assays

  14. Comparison of infrared-excited up-converting phosphors and europium nanoparticles as labels in a two-site immunoassay

    International Nuclear Information System (INIS)

    Ukonaho, Telle; Rantanen, Terhi; Jaemsen, Laura; Kuningas, Katri; Paekkilae, Henna; Loevgren, Timo; Soukka, Tero

    2007-01-01

    Research in the field of immunoassays and labels used in the detection has been recently focused on particulate reporters, which possess very high specific activity that excludes the label as a sensitivity limiting factor. However, the large size and shape of the particulate labels may produce additional problems to immunoassay performance. The aim of this work was to study with two identical non-competitive two-site immunoassays whether up-converting phosphor (UCP) particles are comparable in performance with europium(III) chelate-dyed nanoparticles as particulate labels. In addition we strived to verify the common assumption of the photostability of up-converting phosphor particles supporting their potential applicability in imaging. Detection limits in two-site immunoassay for free prostate-specific antigen (free-PSA) were 0.53 ng L -1 and 1.3 ng L -1 using two different up-converting phosphors and 0.16 ng L -1 using europium(III) nanoparticle. Large size distribution and non-specific binding of up-converting phosphor particles caused assay variation in low analyte concentrations and limited the analytical detection limit. The non-specific binding was the major factor limiting the analytical sensitivity of the immunoassay. The results suggests the need for nanoscaled and uniformely sized UCP-particles to increace the sensitivity and applicability of up-converting phosphor particles. Anti-Stokes photoluminescence of up-converting phosphor particles did not photobleach when measured repeatedly, on the contrary, the time-resolved fluorescence of europium nanoparticles photobleached relatively rapidly

  15. Europium (III) PVC membrane sensor based on N-pyridine-2-carboxamido-8-aminoquinoline as a sensing material

    International Nuclear Information System (INIS)

    Zamani, Hassan Ali; Kamjoo, Rahman; Mohammadhosseini, Majid; Zaferoni, Mojdeh; Rafati, Zynab; Ganjali, Mohammad Reza; Faridbod, Farnoush; Meghdadi, Soraia

    2012-01-01

    Conductometric study in acetonitrile solution shows the selectivity of PCQ toward europium ion. Therefore, a new europium PVC membrane electrode was prepared based on N-pyridine-2-carboxamido-8-aminoquinoline (PCQ) as an ion carrier. The electrode has a wide concentration range from 1.0 × 10 −2 and 1.0 × 10 −6 mol L −1 , Nernstian slope of 19.8 ± 0.3 mV per decade and a detection limit of 6.4 × 10 −7 mol L −1 . The potentiometric response is pH independent in the range of 2.4–7.4. The proposed sensor has a relatively fast response time less than 10 s and it can be used for at least 2 months without any considerable divergence in its potentials. The proposed electrode revealed good selectivity toward europium ion in comparison with variety of other metal ions. The practical utility of the electrodes has been demonstrated by their use as indicator electrodes in the potentiometric titration of Eu 3+ ions with EDTA and for determination of Eu 3+ ion concentration in mixtures of two and three different ions. - Highlights: ► A new ion carrier is introduced to preparation of a selective sensor for Eu 3+ ions. ► This technique is very simple and it's not necessary to use sophisticated equipment. ► The novelty of this work is the high affinity of the ionophore toward the Eu 3+ ions. ► The sensor is superior to the formerly reported Eu 3+ sensors in terms of selectivity.

  16. Determination of the theoretical feasibility for the transmutation of europium isotopes from high flux isotope reactor control cylinders

    International Nuclear Information System (INIS)

    Elam, K.R.; Reich, W.J.

    1995-09-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) is a 100 MWth light-water research reactor designed and built in the 1960s primarily for the production of transuranic isotopes. The HFIR is equipped with two concentric cylindrical blade assemblies, known as control cylinders, that are used to control reactor power. These control cylinders, which become highly radioactive from neutron exposure, are periodically replaced as part of the normal operation of the reactor. The highly radioactive region of the control cylinders is composed of europium oxide in an aluminum matrix. The spent HFIR control cylinders have historically been emplaced in the ORNL Waste Area Grouping (WAG) 6. The control cylinders pose a potential radiological hazard due to the long lived radiotoxic europium isotopes 152 Eu, 154 Eu, and 155 Eu. In a 1991 health evaluation of WAG 6 (ERD 1991) it was shown that these cylinders were a major component of the total radioactivity in WAG 6 and posed a potential exposure hazard to the public in some of the postulated assessment scenarios. These health evaluations, though preliminary and conservative in nature, illustrate the incentive to investigate methods for permanent destruction of the europium radionuclides. When the cost of removing the control cylinders from WAG 6, performing chemical separations and irradiating the material in HFIR are factored in, the option of leaving the control cylinders in place for decay must be considered. Other options, such as construction of an engineered barrier around the disposal silos to reduce the chance of migration, should also be analyzed

  17. Europium (III) PVC membrane sensor based on N-pyridine-2-carboxamido-8-aminoquinoline as a sensing material

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Kamjoo, Rahman [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Mohammadhosseini, Majid [Department of Chemistry, Faculty of Basic Sciences, Shahrood Branch, Islamic Azad University, Shahrood (Iran, Islamic Republic of); Zaferoni, Mojdeh; Rafati, Zynab [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Faridbod, Farnoush [Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Meghdadi, Soraia [Department of Chemistry, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of)

    2012-04-01

    Conductometric study in acetonitrile solution shows the selectivity of PCQ toward europium ion. Therefore, a new europium PVC membrane electrode was prepared based on N-pyridine-2-carboxamido-8-aminoquinoline (PCQ) as an ion carrier. The electrode has a wide concentration range from 1.0 Multiplication-Sign 10{sup -2} and 1.0 Multiplication-Sign 10{sup -6} mol L{sup -1}, Nernstian slope of 19.8 {+-} 0.3 mV per decade and a detection limit of 6.4 Multiplication-Sign 10{sup -7} mol L{sup -1}. The potentiometric response is pH independent in the range of 2.4-7.4. The proposed sensor has a relatively fast response time less than 10 s and it can be used for at least 2 months without any considerable divergence in its potentials. The proposed electrode revealed good selectivity toward europium ion in comparison with variety of other metal ions. The practical utility of the electrodes has been demonstrated by their use as indicator electrodes in the potentiometric titration of Eu{sup 3+} ions with EDTA and for determination of Eu{sup 3+} ion concentration in mixtures of two and three different ions. - Highlights: Black-Right-Pointing-Pointer A new ion carrier is introduced to preparation of a selective sensor for Eu{sup 3+} ions. Black-Right-Pointing-Pointer This technique is very simple and it's not necessary to use sophisticated equipment. Black-Right-Pointing-Pointer The novelty of this work is the high affinity of the ionophore toward the Eu{sup 3+} ions. Black-Right-Pointing-Pointer The sensor is superior to the formerly reported Eu{sup 3+} sensors in terms of selectivity.

  18. Internal-standard method for the determination of uranium, thorium, lanthanum and europium in carbonaceous shale and monazite by epithermal neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Shuenn-Gang; Tsai, Hui-Tuh; Wu, Shaw-Chii [Institute of Nuclear Energy Research, Lung-Tan (Taiwan, Republic of China)

    1981-10-03

    An internal-standard method was applied for the determination of uranium, thorium, lanthanum and europium is carbonaceous shale samples and monazite sand by epithermal neutron activation analysis using gold as an internal standard element. The samples were irradiated in a zero-power reactor at the Institute of Nuclear Energy Research and measured with a high-resolution Ge(Li) detector. The detection limit is 0.1 ppm for uranium and europium, 1 ppm for thorium, 5 ppm for lanthanum, and the realative error of all elements is within +-2.6%.

  19. Idiopathic urolithiasis in Tunisian children: A report of 134 cases

    Directory of Open Access Journals (Sweden)

    A Alaya

    2013-01-01

    Full Text Available We evaluated the metabolic and the nutritional aspects of 134 urolithiasis children in order to outline the characteristics of idiopathic urolithiasis in children. This prospective study group of 134 children (56 females, 78 males with renal calculi was evaluated. The age range of the patients was six months to 16 years. A dietary survey was performed on every child. All patients were investigated with respect to stone localization and serum and urine risk factors. Statistical analysis of data was carried out using software SPSS 11.0 for Windows. Hypercalciuria was the most common risk factor detected in this group (28.3%. A decrease of water intake was noted in all age groups, especially in the rural area (549.6 mL/day vs. 1150.6 mL/day, and there was an increase in animal protein intake in 17 cases (mean: 1.9 g/kg. In addition, increased intake of starchy foods and food with high oxalate content (sorgum were detected in the ten to 16 years age group (51% of our study. Calcium oxalate monohydrate represents the principal component of idiopathic stone (58.2%, which is more frequent in children (68% than in infants (51.7% (P <0.02. The major etiology of idiopathic urolithiasis highlights the influence of dietary habit in stone formers in our country. The increased occurrence of calcium oxalate stones in school age children confirms the change in the etiology of urolithiasis according to age.

  20. Clinical, ultrasonographic, and roentgenographic study in 134 asymptomatic gallstone carriers

    International Nuclear Information System (INIS)

    Lirussi, F.; Passera, D.; Iemmolo, R.M.; Nassuato, G.; Okolicsanyi, L.

    1993-01-01

    The authors investigated retrospectively the ultrasonographic and roentgenographic characteristics of the gallstones and the gallbladder in 134 symtom-free carriers and evaluated prospectively the outcome and side effects of 6 to 24 months' ursodeoxycholic acid (UDCA) therapy in 36 individuals with silent stones. Two-thirds of the 134 subjects had multiple stones, and 71 to 75% had stones less than 15 mm in diameter. Gallstone calcification was detected in 13%. A non-functioning gallbladder was observed in 19%, whereas gallbladder contraction was normal in 64 of 76 gallstone carriers. With regard to oral bile acid treatment, complete and partial dissolutions were achieved in 7 and 9 of 33 subjects, respectively (48.5%). Development of a non-functioning gallbladder occurred in 9%, and acquired gallstone calcification was seen in another 15%. It is concluded that: i) the characteristics of the gallstones and the gallbladder are similar to those observed in symptomatic patients, and ii) UDCA therapy may be given in selected symptom-free carriers for no more than 6 to 12 months. Thereafter, it does not appear to be cost-effective. 23 refs., 2 figs., 3 tabs

  1. Structural and photocatalytic properties of iron- and europium-doped TiO2 nanoparticles obtained under hydrothermal conditions

    International Nuclear Information System (INIS)

    Diamandescu, L.; Vasiliu, F.; Tarabasanu-Mihaila, D.; Feder, M.; Vlaicu, A.M.; Teodorescu, C.M.; Macovei, D.; Enculescu, I.; Parvulescu, V.; Vasile, E.

    2008-01-01

    Iron- and europium-doped (≤1 at.%) TiO 2 nanoparticles powders have been synthesized by a hydrothermal route at 200 deg. C, starting with TiCl 4 , FeCl 3 .6H 2 O and EuCl 3 .6H 2 O. The structure, morphology and optical peculiarities were investigated by means of X-ray diffraction (XRD), transmission electron microscopy (TEM), extended X-ray absorption fine structure (EXAFS), Moessbauer spectroscopy and UV-vis measurements. The photocatalytic performance was analysed in the photodegradation reaction of phenol. Rietveld refinements of XRD patterns reveal that the as-prepared samples consist in iron- and europium-doped TiO 2 in the tetragonal anatase structural shape, with particle size as low as 15 nm. By means of Moessbauer spectroscopy on both 57 Fe and 151 Eu isotopes as well as by EXAFS analyses, the presence of Fe 3+ and/or Eu 3+ ions in the nanosized powders has been evidenced. It was found that iron and europium ions can substitute for titanium in the anatase structure. From the UV-vis reflection spectra, by using the transformed Kubelka-Munk functions, the band gap energy (E g ) of the hydrothermal samples has been determined in comparison with that of Degussa P-25 photocatalyst. A decrease of E g from 2.9 eV found for Degussa photocatalyst to 2.8 eV for the titania doped with 1 at.% Fe has been evidenced, indicating a valuable absorption shift (∼20 nm) towards visible light region. However, the best photocatalytic activity in the photodegradation reaction of phenol was evidenced for the hydrothermal sample, TiO 2 : 1 at.% Fe, 0.5 at.% Eu, in both UV and visible light regions. The photocatalytic activities of iron-doped and iron-europium-codoped samples are high and practically the same only in visible light. The photocatalytic properties in correlation with the structural and optical peculiarities of the hydrothermal samples are discussed

  2. The Magnetic Response of Europium Implanted in Cerium and in Platinum as Investigated by the PAC-Method

    International Nuclear Information System (INIS)

    Zeitz, W.-D.; Unterricker, S.; Schneider, F.; Samokhvalov, V.; Potzger, K.; Weber, A.; Dietrich, M.

    2004-01-01

    The magnetic response of europium in γ-cerium and in platinum was studied by applying the perturbed angular correlation spectroscopy. The probe nuclei were 147 Eu(11/2 - ) and 149 Eu(11/2 - ). The response in γ-Ce was determined by the electronic S = J = 7/2 ground state of divalent Eu. In Pt, on the other hand, Eu is trivalent (J = 0 ground state). Here the magnetic contributions originate from Van Vleck terms of the whole multiplet system.

  3. Solid-phase synthesis of compounds of europium and terbium with nitrogen-containing heterocyclic compounds under mechanical activation

    International Nuclear Information System (INIS)

    Kalinovskaya, I.V.; Karasev, V.E.

    2000-01-01

    Effect of solvents and parameters of mechanical treatment on basic regularities of synthesis of rare earth compounds with nitrogen-containing heterocyclic compounds is studied. It is shown that interaction on europium (3) and terbium (3) nitrates with nitrogen-containing heterocyclic compounds leads to formation of compounds of Ln(NO 3 )·2D composition, where Ln=Eu, Tb; D=2,2-dipyridyl, 1,10-phenanthroline, diphenylguanidine. Effect of conditions of mechanical treatment and different additions on process and yield of products is studied. Compounds prepared are characterized by the methods of chemical element analysis, IR spectroscopy and luminescent spectroscopy [ru

  4. The absorption and distribution of Cesium-134 in rice-soil system

    International Nuclear Information System (INIS)

    Xu Yinliang; Chen Chuanqun; Chen Bin; Sun Zhiming

    1991-01-01

    Dynamics of absorption of 134 Cs by rice shows that absorption rate is the fastest at boot stage; absorption capacities of 134 Cs in soils are different with the different physical-chemical properties of soils; absorption amounts vary with the time of irrigating 134 Cs; the closer the irrigation time to mature stage is, the more the absorption amount of 134 Cs in rice will be; the more the irrigating times are, and the higher the radioactivity of 134 Cs in irrigating water is, the more the absorption amount in rice will be. After brown rice is polished, contamination of 134 Cs can be decreased by 22.6-45.6%. The order of specific activity in rice is: bran > root > straw > husk > polished rice. Percentage activity of straw, brown rice, root and husk is 51.4%, 28.4%, 11.8% and 8.4% respectively. The migration of 134 Cs is very slow in soil and 95.1% of 134 Cs is concentrated in surface soil (0-2.5 cm). The distribution ratio of 134 Cs in the rice and soil is 6.1%:93.9%. Potassium ion can inhibit the absorption of 134 Cs by rice. There is an exponential function between the concentration of potassium ion and specific activity of 134 Cs in rice

  5. Uncertainties in measuring trace amounts of cobalt and europium with low-flux neutron activation analysis

    Directory of Open Access Journals (Sweden)

    Burnham Steven

    2017-01-01

    Full Text Available Neutron activation analysis is widely used for identification of elements and their quantities even in trace amounts in the samples of almost any type. The challenges in detecting trace amounts of particular elements are often associated with the neutron flux produced at the research reactors. Low-flux neutron activation analysis usually presents the biggest challenge when analyzing trace quantities of elements with lower magnitude of radiative capture cross-sections. In this paper, we present the methodology and the quantified uncertainties associated with the detection of trace amounts of cobalt and europium, using as an example concrete aggregates. Recent growing interest is in improving structural concrete (increasing its strength but reducing its activation in nuclear power plant environments. Aside from buildings, structural concrete is also used as a biological shield in nuclear power plant that become radioactive after exposure to neutron flux. Due to radiative capture interactions, artificial radionuclides are generated to high enough concentrations that classify concrete as low-level radioactive waste at the time of the plant's decommissioning. Disposal of this concrete adds to the expense of nuclear power plant financing and its construction. Three radionuclides, 60Co, 152Eu, and 154Eu, account for 99 % of total residual radioactivity of nuclear power plant decommissioned concrete. IAEA document RS-G-1.7, Application of the Concepts of Exclusion, Exemption, and Clearance, specifies clearance levels of radionuclides specific activities: a specific activity lower than 0.1 Bqg-1 for 60Co and 152Eu, and 154Eu allows for a concrete to be recycled after decommissioning of the nuclear power plant. Therefore, low-flux neutron activation analysis is used to test the detection limits of trace elements in samples of cement, coarse, and fine concrete aggregates. These samples are irradiated at the University of Utah's 100 kW TRIGA Reactor at

  6. Different photoluminescent properties of binary and ternary europium chelates doped in PMMA

    International Nuclear Information System (INIS)

    Liu Hongguo; Park, Seongtae; Jang, Kiwan; Zhang Wansong; Seo, Hyo-Jin; Lee, Yong-Ill

    2003-01-01

    Two kinds of europium-β-diketone chelates, binary Eu(DBM) 3 and ternary Eu(DBM) 3 phen were doped in poly(methyl methacrylate) (PMMA). These chelates show very different photoluminescent (PL) behaviors: the hypersensitive 5 D 0 → 7 F 2 emission bands of Eu(DBM) 3 phen change slightly with the molar ratios, while those of Eu(DBM) 3 change obviously and regularly with the molar ratios. The results of the luminescent lifetimes of 5 D 0 levels show that the binary chelate exists as two kinds of species in the doped systems, and the lifetimes and contents of each species change with the molar ratios, while the ternary chelate exists as one kind of species in the doped systems. X-ray diffraction (XRD) patterns of the binary chelate doped systems give some diffraction peaks that are different from those of pure chelate and change with the molar ratios, indicating new kinds of crystal structures formed, and consequently, the first coordination sphere of Eu 3+ ion changes; while those of the ternary chelate doped systems just show amorphous diffraction halos of the host, indicating that the ternary chelate exist in an amorphous state and disperse well in the host. The FTIR spectra of PMMA also change gradually with increasing the molar ratios of the doped two kinds of chelates, and the XRD patterns show that the amorphous halos of PMMA in the doped systems are different from those of pure PMMA and change with the molar ratios, too, suggesting the interaction between the guest and the host

  7. Thermoluminescence of europium-doped zinc oxide exposed to beta particle irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Iriqui R, J. L.; Cruz V, C. [Universidad de Sonora, Departamento de Investigacion en Polimeros y Materiales, Apdo. Postal 130, 83000 Hermosillo, Sonora (Mexico); Bernal, R. [Universidad de Sonora, Departamento de Investigacion en Fisica, Apdo. Postal 5-088, 83000 Hermosillo, Sonora (Mexico); Castano, V. M., E-mail: jorgeiriqui@gimmunison.com [UNAM, Instituto de Fisica, Centro de Fisica Aplicada y Tecnologia Avanzada, Apdo. Postal 1-1010, 76000 Queretaro, Qro. (Mexico)

    2015-10-15

    Full text: Zn O is a promising material for a range of optoelectronics applications, due to its direct wide band gap (E{sub g} ∼3.3 eV at 300 K) and large exciton binding energy (60 MeV). Its applications include UV light emitters, varistors, surface acoustic wave devices, piezoelectric transducers, and chemical and gas sensing. Rare-earth activation of phosphors has long been seen as an effective process since coupling energy into the rare-earth-ion site, either by ionization, charge exchange or a resonance energy process, results in light production. It is reported that Europium modifies the response thermoluminescence (Tl) for pure zinc oxide, when is irradiated with X-ray, created a peak at 365 degrees C. In this work, Zn O:Eu phosphors were synthesized by a chemical method. Some samples were exposed to beta particle irradiation for doses ranging from 1 up to 100 Gy. Tl response as a function of dose is linear throughout the studied dose range. The glow curve exhibits three maxima, centered at 176, 279 and 340 degrees C. The reusability studies obtained after ten repeated cycles of annealing irradiation readout for the Zn O:Eu shows that the variation in the Tl response is ten percent and tends to stabilization. The results indicate that these new Zn O:Eu phosphors are promising detectors and dosimeters for beta radiation. The structural and morphological characterization was carried out by X-ray diffraction and scanning electron microscopy, respectively. (Author)

  8. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  9. Two-dimensional high spatial-resolution dosimeter using europium doped potassium chloride: a feasibility study

    International Nuclear Information System (INIS)

    Li, H Harold; Yang, Deshan; Xiao, Zhiyan; Driewer, Joseph P; Han, Zhaohui; Low, Daniel A

    2014-01-01

    Recent research has shown that KCl:Eu 2+  has great potential for use in megavoltage radiation therapy dosimetry because this material exhibits excellent storage performance and is reusable due to strong radiation hardness. This work reports the authors’ attempts to fabricate 2D KCl:Eu 2+  storage phosphor films (SPFs) using both a physical vapor deposition (PVD) method and a tape casting method. X-ray diffraction analysis showed that a 10 µm thick PVD sample was composed of highly crystalline KCl. No additional phases were observed, suggesting that the europium activator had been completely incorporated into the KCl matrix. Photostimulated luminescence and photoluminescence spectra suggested that F (Cl − ) centers were the electron storage centers post x-ray irradiation and that Eu 2+  cations acted as luminescence centers in the photostimulation process. The 150 µm thick casted KCl:Eu 2+  SPF showed sub-millimeter spatial-resolution. Monte Carlo simulations further demonstrated that the admixture of 20% KCl:Eu 2+  and 80% low Z polymer binder exhibited almost no energy-dependence in a 6 MV beam. KCl:Eu 2+  pellet samples showed a large dynamic range from 0.01 cGy to 60 Gy dose-to-water, and saturated at approximately 500 Gy as a result of KCl's intrinsic high radiation hardness. Taken together, this work provides strong evidence that KCl:Eu 2+ -based SPF with associated readout apparatus could result in a novel electronic film system that has all the desirable features associated with classic radiographic film and, importantly, water equivalence and the capability of permanent identification of each detector. (paper)

  10. Europium-labeled epidermal growth factor and neurotensin: novel probes for receptor-binding studies.

    Science.gov (United States)

    Mazor, Ohad; Hillairet de Boisferon, Marc; Lombet, Alain; Gruaz-Guyon, Anne; Gayer, Batya; Skrzydelsky, Delphine; Kohen, Fortune; Forgez, Patricia; Scherz, Avigdor; Rostene, William; Salomon, Yoram

    2002-02-01

    We investigated the possibility of labeling two biologically active peptides, epidermal growth factor (EGF) and neurotensin (NT), with europium (Eu)-diethylenetriaminepentaacetic acid. More specifically, we tested them as probes in studying receptor binding using time-resolved fluorescence of Eu3+. The relatively simple synthesis yields ligands with acceptable binding characteristics similar to isotopically labeled derivatives. The binding affinity (Kd) of labeled Eu-EGF to human A431 epidermal carcinoid cells was 3.6 +/- 1.2 nM, similar to the reported Kd values of EGF, whereas the Kd of Eu-NT to human HT29 colon cancer cells (7.4 +/- 0.5 nM) or to Chinese hamster ovary (CHO) cells transfected with the high-affinity NT receptor (CHO-NT1) were about 10-fold higher than the Kd values of NT. The bioactivity of the Eu-labeled EGF as determined by stimulation of cultured murine D1 hematopoietic cell proliferation was nearly the same as that obtained with native EGF. The maximal stimulation of Ca2+ influx with NT and Eu-NT in CHO-NT1 cells was similar, but the respective K0.5 values were 20 pM and 1 nM, corresponding to differences in the binding affinities previously described. The results of these studies indicate that Eu labeling of peptide hormones and growth factor molecules ranging from 10(3) to 10(5) Da can be conveniently accomplished. Importantly, the Eu-labeled products are stable for approximately 2 years and are completely safe for laboratory use compared to the biohazardous radioligands. Thus, Eu-labeled peptides present an attractive alternative for commonly used radiolabeled ligands in biological studies in general and in receptor assays in particular.

  11. Size-dependent cytotoxicity of europium doped NaYF4 nanoparticles in endothelial cells

    International Nuclear Information System (INIS)

    Chen, Shizhu; Zhang, Cuimiao; Jia, Guang; Duan, Jianlei; Wang, Shuxiang; Zhang, Jinchao

    2014-01-01

    Lanthanide-doped sodium yttrium fluoride (NaYF 4 ) nanoparticles exhibit novel optical properties which make them be widely used in various fields. The extensive applications increase the chance of human exposure to these nanoparticles and thus raise deep concerns regarding their riskiness. In the present study, we have synthesized europium doped NaYF 4 (NaYF 4 :Eu 3+ ) nanoparticles with three diameters and used endothelial cells (ECs) as a cell model to explore the potential toxic effect. The cell viability, cytomembrane integrity, cellular uptake, intracellular localization, intracellular reactive oxygen species (ROS), mitochondrial membrane potential (MMP), apoptosis detection, caspase-3 activity and expression of inflammatory gene were studied. The results indicated that these nanoparticles could be uptaken into ECs and decrease the cell viability, induce the intracellular lactate dehydrogenase (LDH) release, increase the ROS level, and decrease the cell MMP in a size-dependent manner. Besides that, the cells were suffered to apoptosis with the caspase-3 activation, and the inflammation specific gene expressions (ICAM1 and VCAM1) were also increased. Our results suggest that the damage pathway may be related to the ROS generation and mitochondrial damage. The results provide novel evidence to elucidate their toxicity mechanisms and may be helpful for more rational applications of these compounds in the future. - Highlights: • NaYF 4 :Eu 3+ nanoparticles with three diameters have been synthesized. • NaYF 4 :Eu 3+ nanoparticles could be uptaken by endothelial cells (ECs). • NaYF 4 :Eu 3+ nanoparticles show a significant cytotoxicity on ECs. • The size of NaYF 4 :Eu 3+ nanoparticles may be important to their toxicology effect

  12. Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms

    International Nuclear Information System (INIS)

    Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z.; Gillow, J.B.; Francis, A.J.

    2004-01-01

    We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K d ) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N H 2 O ) and the degree of strength of ligand field (R E/M ) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K d of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K d , indicating that an exchange with Na + on the functional groups was involved in their sorption. The ΔN H 2 O (= 9 - N H 2 O ) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R E/M for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)

  13. Sorption behavior of europium(III) and curium(III) on the cell surfaces of microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, T.; Kimura, T.; Ohnuki, T.; Yoshida, Z. [Advanced Science Research Center, Japan Atomic Energy Research Inst., Ibaraki (Japan); Gillow, J.B.; Francis, A.J. [Environmental Sciences Dept., Brookhaven National Lab., Upton, NY (United States)

    2004-07-01

    We investigated the association of europium(III) and curium(III) with the microorganisms Chlorella vulgaris, Bacillus subtilis, Pseudomonas fluorescens, Halomonas sp., Halobacterium salinarum, and Halobacterium halobium. We determined the kinetics and distribution coefficients (K{sub d}) for Eu(III) and Cm(III) sorption at pH 3-5 by batch experiments, and evaluated the number of water molecules in the inner-sphere (N{sub H{sub 2}O}) and the degree of strength of ligand field (R{sub E/M}) for Eu(III) by time-resolved laser-induced fluorescence spectroscopy (TRLFS). Exudates from C. vulgaris, Halomonas sp., and H. halobium had an affinity for Eu(III) and Cm(III). The log K{sub d} of Eu(III) and Cm(III) showed that their sorption was not fully due to the exchange with three protons on the functional groups on cell surfaces. The halophilic microorganisms (Halomonas sp., Halobacterium salinarum, H. halobium) showed almost no pH dependence in log K{sub d}, indicating that an exchange with Na{sup +} on the functional groups was involved in their sorption. The {delta}N{sub H{sub 2}O} (= 9 - N{sub H{sub 2}O}) for Eu(III) on C. vulgaris was 1-3, while that for the other microorganisms was over 3, demonstrating that the coordination of Eu(III) with C. vulgaris was predominantly an outer-spherical process. The R{sub E/M} for Eu(III) on halophilic microorganisms was 2.5-5, while that for non-halophilic ones was 1-2.5. This finding suggests that the coordination environment of Eu(III) on the halophilic microorganisms is more complicated than that on the other three non-halophilic ones. (orig.)

  14. Influence of natural mobile organic matter on europium retention on Bure clay rock

    International Nuclear Information System (INIS)

    Vu-Do, Laurence

    2013-01-01

    Bure clay rock (CR) was chosen as host rock for the French high and intermediate level long lived radioactive waste repository. This choice is mostly explained by the retention ability of the Callovo-Oxfordian rock (COx). Bure clay rock contains natural organic matter (OM) that could have an influence on radionuclide retention. The aim of this work is to assess the influence of natural mobile OM on the retention of Eu on clay rock. Eu was chosen as a chemical model for trivalent actinides contained in vitrified waste. Three organic molecules were studied: suberic, sorbic and tiglic acids, small organic acids identified in COx pore water. All the experiments were carried out in an environment recreating COx water (pH=7.5; I=0.1 mol/L; PCO 2 =10 -2 bar).Clay rock sample characterization showed that the sample used in this work was similar to those previously extracted from the area of interest and that it was necessary to maintain pH at 7.5 to avoid altering the clay rock. The Eu-OM system study indicated that organic acids had no influence on Eu speciation in COx water. The Eu-CR system experimental study confirmed that retention implied sorption on CR (C(Eu)≤6.10 -6 mol/L) and precipitation in COx water (C(Eu)≥6.10 -6 mol/L). Distribution coefficient Rd (quantifying sorption) was estimated at 170 ± 30 L/g. This high value is consistent with literature values obtained on clay rocks. The ternary Eu-OM-CR system study showed a slight increase of sorption in the presence of organic matter. This synergistic effect is very satisfactory in terms of storage security: the presence of small organic acids in clay rock does not question retention properties with respect to europium and trivalent actinides. (author)

  15. 134Cs-transport in an experimental ecological system

    International Nuclear Information System (INIS)

    Mocsy, Ildiko; Uray, Ildiko; Salagean, Stefania

    1986-01-01

    An experimental aquatic ecosystem was developed consisting of river water, slurry, algae and crustaceans. The change of the cesium concentration factor (F c ) of two alga species were measured using 20 Bq/ml of 134 CsCl. Measurements were performed in the 6th, 12th, 24th, 48th and 72nd hour after irradiation. F c in crustaceans was found to be 1300 in the 12th hr, then decreased rapidly down to 275. The temporal dependence of cesium accumulation in slurry increased consistently. It was found that algae accumulated cesium variously. Owing to its high accumulation, Cladophora glomerata can be used as a biological indicator of cesium concentration in surface waters. (K.I.)

  16. Influence of the organic coating and calcium ions on the sorption of europium on a silica gel

    International Nuclear Information System (INIS)

    Fleury, C.; Barbot, C.; Pieri, J.; Durand, J.P.; Goudard, F.

    1999-01-01

    Humic substances, ubiquitous polyelectrolyte and polydisperse macromolecules, have a great affinity towards heavy metals and radionuclides. It is important to understand the role of these substances in the migration of contaminants that could be accidentialy released from radioactive waste repositories. The migration of these radionuclides is also governed by different influent parameters like pH, flow rate, ionic strength and presence of competing cations. Lab experiments have been undertaken, they allowed us to confirm that the behaviour and dispersion of europium (used as analog of actinides) depends on the presence of humic acids. If the latter are bound to mineral surfaces, they immobilize the radionuclides. On the other hand, if they are in a suspended form, they are able to decrease the influence of some parameters (pH, flow rate or ionic strength) and stabilize europium onto the mineral surfaces. The presence of calcium cations tends to increase the migration of Eu at lower flow rates and at most alcaline pH. (orig.)

  17. A microwave-assisted solution combustion synthesis to produce europium-doped calcium phosphate nanowhiskers for bioimaging applications.

    Science.gov (United States)

    Wagner, Darcy E; Eisenmann, Kathryn M; Nestor-Kalinoski, Andrea L; Bhaduri, Sarit B

    2013-09-01

    Biocompatible nanoparticles possessing fluorescent properties offer attractive possibilities for multifunctional bioimaging and/or drug and gene delivery applications. Many of the limitations with current imaging systems center on the properties of the optical probes in relation to equipment technical capabilities. Here we introduce a novel high aspect ratio and highly crystalline europium-doped calcium phosphate nanowhisker produced using a simple microwave-assisted solution combustion synthesis method for use as a multifunctional bioimaging probe. X-ray diffraction confirmed the material phase as europium-doped hydroxyapatite. Fluorescence emission and excitation spectra and their corresponding peaks were identified using spectrofluorimetry and validated with fluorescence, confocal and multiphoton microscopy. The nanowhiskers were found to exhibit red and far red wavelength fluorescence under ultraviolet excitation with an optimal peak emission of 696 nm achieved with a 350 nm excitation. Relatively narrow emission bands were observed, which may permit their use in multicolor imaging applications. Confocal and multiphoton microscopy confirmed that the nanoparticles provide sufficient intensity to be utilized in imaging applications. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  18. Investigation of the influence of silver and tin on the luminescence of trivalent europium ions in glass

    International Nuclear Information System (INIS)

    Jimenez, J.A.; Lysenko, S.; Liu, H.; Fachini, E.; Cabrera, C.R.

    2010-01-01

    Europium-doped aluminophosphate glasses prepared by the melt-quenching technique have been studied by photoluminescence (PL) and X-ray photoelectron spectroscopy (XPS). The effects of silver and tin doping, and of further thermal processing on Eu 3+ ions luminescence have been assessed. For the glass system containing only europium, Eu 3+ PL observed under UV excitation is suggested to occur through energy transfer from the excited glass host. After silver and tin doping, an enhanced UV excited Eu 3+ PL has been indicated to occur essentially due to radiative energy transfer from isolated Ag + ions and/or two fold-coordinated Sn centers. Since thermal processing of the material leads to a quenching effect on Eu 3+ PL and Ag nanoparticles (NPs) formation due to reduction of silver ions by tin, XPS was employed in order to investigate the possibility for Eu 3+ →Eu 2+ reduction during HT as a potential source of the PL decrease. The data points towards Ag NPs as main responsible for the observed weakening of Eu 3+ PL.

  19. Simple preparation of fluorescent composite films based on cerium and europium doped LaF3 nanoparticles

    Science.gov (United States)

    Secco, Henrique de L.; Ferreira, Fabio F.; Péres, Laura O.

    2018-03-01

    The combination of materials to form hybrids with unique properties, different from those of the isolated components, is a strategy used to prepare functional materials with improved properties aiming to allow their application in specific fields. The doping of lanthanum fluoride with other rare earth elements is used to obtain luminescent particles, which may be useful to the manufacturing of electronic devices' displays and biological markers, for instance. The application of the powder of nanoparticles has limitations in some fields; to overcome this, the powder may be incorporated in a suitable polymeric matrix. In this work, lanthanum fluoride nanoparticles, undoped and doped with cerium and europium, were synthesized through the co-precipitation method in aqueous solution. Aiming the formation of solid state films, composites of nanoparticles in an elastomeric matrix, the nitrile rubber (NBR), were prepared. The flexibility and the transparency of the matrix in the regions of interest are advantages for the application of the luminescent composites. The composites were applied as films using the casting and the spin coating techniques and luminescent materials were obtained in the samples doped with europium and cerium. Scanning electron microscopy images showed an adequate dispersion of the particles in the matrix in both film formation techniques. Aggregates of the particles were detected in the samples which may affect the uniformity of the emission of the composites.

  20. Highly Sensitive Luminescence Assessment of Bile Acid Using a Balofloxacin-Europium(III) Probe in Micellar Medium

    International Nuclear Information System (INIS)

    Cai, Huan; Zhao, Fang; Si, Hailin; Zhang, Shuaishuai; Wang, Chunchun; Qi, Peirong

    2012-01-01

    A novel and simple method of luminescence enhancement effect for the determination of trace amounts of bile acid was proposed. The procedure was based on the luminescence intensity of the balofloxacin-europium(III) complex that could be strongly enhanced by bile acid in the presence of sodium dodecyl benzene sulfonate (SDBS). Under the optimum conditions, the enhanced luminescence intensity of the system exhibited a good linear relationship with the bile acid concentration in the range 5.0 Χ 10 -9 - 7.0 Χ 10 -7 mol L -1 with a detection limit of 1.3 Χ 10 -9 mol L.1 (3σ). The relative standard deviation (RSD) was 1.7% (n = 11) for 5.0 Χ 10 -8 mol L -1 bile acid. The applicability of the method to the determination of bile acid was demonstrated by investigating the effect of potential interferences and by analyzing human serum and urine samples. The possible enhancement mechanism of luminescence intensity in balofloxacin-europium(III)-bile acid-SDBS system was also discussed briefly

  1. Chemical states and electronic properties of the interface between aluminium and a photoluminescent conjugated copolymer containing europium complex

    International Nuclear Information System (INIS)

    Cai, Q.J.; Ling, Q.D.; Li, S.; Zhu, F.R.; Huang, Wei; Kang, E.T.; Neoh, K.G.

    2004-01-01

    The chemical states and electronic properties of the interface between thermally evaporated aluminium and a photoluminescent conjugated copolymer containing 9,9'-dihexylfluorene and europium complex-chelated benzoate units in the main chain (PF6-Eu(dbm) 2 phen) were studied in situ by X-ray photoelectron spectroscopy (XPS) and ultraviolet photoelectron spectroscopy (UPS). The changes in C 1s, Eu 3d, N 1s, and Al 2p core-level lineshapes with progressive deposition of aluminium atoms were carefully monitored. Aluminium was found to interact with the conjugated backbone of the copolymer to form the Al carbide, Al-O-C complex, and Al(III)-N chelate at the interface. In addition, the europium ions were reduced to the metallic state by the deposited aluminium atoms, which were oxidized and chelated by the 1,10-phenanthroline ligands (phen). The changes in chemical states at the interface suggest that the intramolecular energy transfer process in this copolymer had been affected. Moreover, aluminium also interacted with the bulk-adsorbed oxygen, which migrates to the surface in response to the deposition of aluminium atoms, to form a layer of metal oxides. On the other hand, the evolution of the UPS spectra suggests that the π-states of the conjugated system were affected and an unfavorable dipole layer was induced by the deposited aluminium atoms

  2. Synthesis and characterization of barium titanate, doped with europium and neodymium; Sintese e caracterizacao de titanato de bario, dopados com europio e neodimio

    Energy Technology Data Exchange (ETDEWEB)

    Sousa, Fernanda L.C.; Cabral, Alciney M.; Silva, Ademir O.; Oliveiro, Joao B.L., E-mail: nanda_louise@yahoo.com.br [Universidade Federal do Rio Grande do Norte (UFRN), Natal (Brazil). Instituto de Quimica

    2013-07-01

    This work aims at synthesize and characterize mixed oxides in Barium Titanium matrix in doping with Neodymium and Europium analyzing thermogravimetric curves, characteristic bands at infrared region of the polymer complex, which are intermediates to mixed oxides, and identify the formation thereof, and the crystallinity using XRD analysis.

  3. Stability constants of the Europium complexes with the chloride ions; Constantes de estabilidad de los complejos del europio con los iones cloruro

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez R, M.; Solache R, M.; Rojas H, A. [Instituto Nacional de Investigaciones Nucleares, Departamento de Quimica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

    2000-07-01

    The stability constants of lanthanides complexes with chloride ions which were determined at the same ionic force but in different media, are significantly different. It does not exist a systematic study over these stability constants. The purpose of this work is to determine the stability constants of the europium complexes with chloride ions at 303 K, by the solvents extraction method. (Author)

  4. The accumulation of 134Cs in heart and skeletal muscle of healthy and dystrophic hamsters

    International Nuclear Information System (INIS)

    Szentkuti, L.; Breitrueck, H.; Giese, W.

    1976-01-01

    he accumulation of cesium-134 in heart and skeletal muscle of healthy and dystrophic hamsters was compared. It was lower in dystrophic hamsters than in normal ones after only a single dose of cesium-134. The 134 Cs-concentrations of heart and 'red' skeletal muscle were different between normal and dystrophic hamsters. When the isotope had equilibrated in the animals differences in 134 Cs-accumulation in muscle tissue between normal and dystrophic hamsters were even more obvious. The faster elimination of cesium-134 from the body as affected by muscular dystrophy was due to a reduction of 134 Cs-accumulation in muscle tissue. The reduced ability of damaged muscles to accumulate Cs-ions offers the possibility to use Cs-isotopes in diagnosis of skeletal muscle dystrophy. (author)

  5. Structural, optical and electrical properties of europium picrate tetraethylene glycol complex as emissive material for OLED

    Energy Technology Data Exchange (ETDEWEB)

    Kusrini, Eny, E-mail: ekusrini@che.ui.ac.id [Department of Chemical Engineering, Faculty of Engineering, Universitas Indonesia, 16424 Depok (Indonesia); Saleh, Muhammad I.; Adnan, Rohana [School of Chemical Sciences, Universiti Sains Malaysia, 11800 Penang (Malaysia); Yulizar, Yoki [Department of Chemistry, Faculty of Mathematics and Natural Sciences, Universitas Indonesia, 16424 Depok (Indonesia); Sha Shiong, Ng; Fun, H.K. [School of Physics, Universiti Sains Malaysia, 11800 Penang (Malaysia); Adhha Abdullah, M.A.; Mamat, Mazidah [Department of Chemical Sciences, Faculty of Science and Technology, Universiti Malaysia Terengganu, 21030 Kuala Terengganu, Terengganu Darul Iman (Malaysia); Za' aba, N.K.; Abd. Majid, W.H. [Solid State Research Laboratory, Department of Physics, Universiti Malaya, 50603 Kuala Lumpur (Malaysia)

    2012-01-15

    A new europium complex [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75H{sub 2}O was synthesized and used as the emission material for the single layer device structure of ITO/EO4-Eu-Pic/Al, using a spin-coating technique. Study on the optical properties of the [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75H{sub 2}O complex where EO4=tetraethylene glycol and Pic=picrate anion, had to be undertaken before being applicable to the study of an organic light emitting diode (OLED). The electrical property of an OLED using current-voltage (I-V) measurement was also studied. In complex, the Eu(III) ion was coordinated with the EO4 ligand as a pentadentate mode, one water molecule, and with two Pic anions as bidentate and monodentate modes, forming a nine-coordination number. The photoluminescence (PL) spectra of the crystalline complex in the solid state and its thin film showed a hypersensitive peak at 613.5-614.9 nm that assigned to the {sup 5}D{sub 0}{yields}{sup 7}F{sub 2} transition. A narrow band emission from the thin film EO4-Eu-Pic was obtained. The typical semiconductor I-V curve of device ITO/EO4-Eu-Pic/Al showed the threshold and turn on voltages at 1.08 and 4.6 V, respectively. The energy transfer process from the ligand to the Eu(III) ion was discussed by investigating the excitation and PL characteristics. Effect of the picrate anion on the device performance was also studied. - Highlights: > The [Eu(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).0.75(H{sub 2}O) is crystallized in triclinic with space group P-1. > The complex is applied as a emissive center in single layer device structure of ITO/EO4-Eu-Pic/Al. > The complex displays a red luminescence in both the crystalline complex and its thin film state. > The low turn on voltage of the device (4.6 V), indicating that this material is suitable for OLED. > The roughness and morphology of the thin film affects luminance and electrical properties of OLED.

  6. 19 CFR 122.134 - When airline does not have in-bond liquor storeroom.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline does not have in-bond liquor storeroom. 122.134 Section 122.134 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.134 When airline does not have in-bond liquor storeroom. (a...

  7. Studies on effect of europium concentration on the photoemission of laser ablated Y2O3:Eu based nano-phosphors

    International Nuclear Information System (INIS)

    Nissamudeen, K.M.; Krishnan, Renju R.; Rajan, Geo; Gopchandran, K.G.

    2007-01-01

    Full text: Phosphors are essential materials in display applications. Oxide-based phosphors are likely to emerge as the potential choice for the FED red phosphor. Among those oxide-based phosphors, there has been significant research interest in the development of Y 2 O 3 :Eu thin films as one of the most promising oxide based red phosphor systems. Yttrium oxide mixed with europium exhibit strong UV and cathode-ray-excited luminescence that are useful in lamp and display applications. Dielectric Y 2 O 3 film has recently attracted much attention for its potential application as an electric insulation layer in electroluminescent devices and high-density dynamic random access memory gate dielectrics because of its high band gap (5.8 eV) and large dielectric constant (14 to 18). Another important application of Y 2 O 3 has been in luminescent displays as a host material for rare-earth ions, specifically europium, in order to get emission of red light. In the present study thin films were deposited under a vacuum of 10 -6 mbar on fused amorphous quartz substrates using a Q-switched Nd: YAG laser, 532 nm, pulse width 9 n sec, and repetition frequency of 10 Hz, with sintered Y 2 O 3 pellets having different europium concentration as target material. Attempts were made to understand the effect of europium concentration and annealing process on the photoemission properties of the films. A europium concentration of 8 wt% and an annealing temperature of 1173 K were found to be optimum conditions for maximum photoemission. The dependence of structure and morphology of the films on the photoemission intensity are described with XRD patterns and images obtained from AFM and SEM studies

  8. Preservation of renal blood flow by the antioxidant EUK-134 in LPS-treated pigs.

    Science.gov (United States)

    Magder, Sheldon; Parthenis, Dimitrios G; Ghouleh, Imad Al

    2015-03-25

    Sepsis is associated with an increase in reactive oxygen species (ROS), however, the precise role of ROS in the septic process remains unknown. We hypothesized that treatment with EUK-134 (manganese-3-methoxy N,N'-bis(salicyclidene)ethylene-diamine chloride), a compound with superoxide dismutase and catalase activity, attenuates the vascular manifestations of sepsis in vivo. Pigs were instrumented to measure cardiac output and blood flow in renal, superior mesenteric and femoral arteries, and portal vein. Animals were treated with saline (control), lipopolysaccharide (LPS; 10 µg·kg-1·h-1), EUK-134, or EUK-134 plus LPS. Results show that an LPS-induced increase in pulmonary artery pressure (PAP) as well as a trend towards lower blood pressure (BP) were both attenuated by EUK-134. Renal blood flow decreased with LPS whereas superior mesenteric, portal and femoral flows did not change. Importantly, EUK-134 decreased the LPS-induced fall in renal blood flow and this was associated with a corresponding decrease in LPS-induced protein nitrotyrosinylation in the kidney. PO2, pH, base excess and systemic vascular resistance fell with LPS and were unaltered by EUK-134. EUK-134 also had no effect on LPS-associated increase in CO. Interestingly, EUK-134 alone resulted in higher CO, BP, PAP, mean circulatory filling pressure, and portal flow than controls. Taken together, these data support a protective role for EUK-134 in the renal circulation in sepsis.

  9. 'Wash-out' of Cs-134 and Cs-137 from river sediment; 'Ispiranja' Cs-134 i Cs-137 iz recnog sedimenta

    Energy Technology Data Exchange (ETDEWEB)

    Skrbic, Z; Conkic, Lj; Bikit, I; Veskovic, M; Slivka, J; Marinkov, L [Institut za Fiziku, Novi Sad Univ. (Yugoslavia)

    1988-07-01

    Natural elimination and 'wash out' period of the Cs-134 and Cs-137 from the river sediment has been investigated. Obtained results suggest the possibility to describe these processes by exponential low and determination of the corresponding half lives. (author)

  10. Transient Increased Calcium and Calcitriol Requirements After Discontinuation of Human Synthetic Parathyroid Hormone 1-34 (hPTH 1-34) Replacement Therapy in Hypoparathyroidism.

    Science.gov (United States)

    Gafni, Rachel I; Guthrie, Lori C; Kelly, Marilyn H; Brillante, Beth A; Christie, C Michele; Reynolds, James C; Yovetich, Nancy A; James, Robert; Collins, Michael T

    2015-11-01

    Synthetic human PTH 1-34 (hPTH 1-34) replacement therapy in hypoparathyroidism maintains eucalcemia and converts quiescent bone to high-turnover bone. However, the skeletal and metabolic effects of drug discontinuation have not been reported. Nine subjects with hypoparathyroidism received subcutaneous injections of hPTH 1-34 two to three times daily for 19.8 to 61.3 months and then transitioned back to calcium and calcitriol. Biochemistries and bone mineral density (BMD) by dual-energy X-ray absorptiometry (DXA) were assessed at baseline, while on treatment, and at follow-up 3 to 12 months after drug discontinuation. Two subjects developed hypocalcemia when hPTH 1-34 was abruptly discontinued. Thus, to avoid hypocalcemia, subjects were slowly weaned from hPTH 1-34 over several weeks. When hPTH 1-34 was stopped, subjects were requiring two to three times pretreatment doses of calcitriol and calcium to maintain blood calcium levels. Doses were gradually reduced over many weeks until calcium levels were stable on doses similar to baseline. Bone-specific alkaline phosphatase (BSAP), N-telopeptide (NTX), and osteocalcin (OC) increased significantly with hPTH 1-34; at follow-up, BSAP and NTX had returned to baseline while OC was still slightly elevated. During treatment, BMD was unchanged at the hip and lateral spine but declined at the anterior-posterior (AP) spine, radius, and total body. During weaning, BMD increased, with the hip and lateral spine exceeding pre-hPTH 1-34 values and the whole body returning to baseline. AP spine was increased non-significantly compared to baseline at follow-up. hPTH 1-34 must be gradually weaned in hypoparathyroid patients with high doses of oral medications given to avoid hypocalcemia. The transient increased requirements accompanied by increased BMD after long-term hPTH 1-34 therapy suggest a reversal of the expanded remodeling space favoring bone formation as the skeleton returns to a low-turnover state, reminiscent of the hungry

  11. 340nm UV LED excitation in time-resolved fluorescence system for europium-based immunoassays detection

    DEFF Research Database (Denmark)

    Rodenko, Olga; Fodgaard, Henrik; Tidemand-Lichtenberg, Peter

    2017-01-01

    In immunoassay analyzers for in-vitro diagnostics, Xenon flash lamps have been widely used as excitation light sources. Recent advancements in UV LED technology and its advantages over the flash lamps such as smaller footprint, better wall-plug efficiency, narrow emission spectrum......, and no significant afterglow, have made them attractive light sources for gated detection systems. In this paper, we report on the implementation of a 340 nm UV LED based time-resolved fluorescence system based on europium chelate as a fluorescent marker. The system performance was tested with the immunoassay based...... on the cardiac marker, TnI. The same signal-to-noise ratio as for the flash lamp based system was obtained, operating the LED below specified maximum current. The background counts of the system and its main contributors were measured and analyzed. The background of the system of the LED based unit was improved...

  12. A search for long-lived radionuclides produced by fast-neutron irradiations of copper, silver, europium, terbium, and hafnium

    International Nuclear Information System (INIS)

    Meadows, J.W.; Smith, D.L.; Ikeda, Y.; Konno, C.

    1990-01-01

    Identical sample packets, each containing samples of elemental copper, silver, europium, terbium, and hafnium, as well as titanium, iron and nickel as dosimeters, have been irradiated in three distinct accelerator neutron fields (at Argonne National Laboratory and Los Alamos National Laboratory in the U.S.A., and Japan Atomic Energy Research Institute, Tokai, Japan) as part of an interlaboratory research collaboration to search for the production of long-lived radionuclides for fusion waste disposal applications. This paper is a progress report on this project. To date, we have detected the following activities, and have obtained preliminary experimental cross section values for several of these: Ag-106m,108m,110m; Eu-150m,152g,154; Tb-158,160; and Hf-175,178m2,179m2,181. (author). 11 refs, 1 fig., 4 tabs

  13. Luminescence behavior of the dibenzoyl methane europium(III) complexes in sol-gel derived host materials

    International Nuclear Information System (INIS)

    Wang Feng; Fan Xianping; Wang Minquan; Zhang Xianghua

    2005-01-01

    The luminescence behavior of the dibenzoyl methane europium(III) complexes (Eu(DBM) 3 ) in sol-gel derived host materials have been investigated. The steady-state excitation and emission spectra and the time-resolved spectra of the 1% EuCl 3 and 3% DBM co-doped gel indicated an efficient ligand-to-metal energy transfer. The Eu(DBM) 3 complexes in the gel showed longer 5 D 0 lifetimes in comparison with Eu(DBM) 3 .3H 2 O complexes. The luminescence intensity of the 1% EuCl 3 and 3% DBM co-doped gel decreased continuously with increasing temperature and time of heat treatment, which indicated the gradual decomposition of the Eu(DBM) 3 complexes in the gel during heat treatment

  14. Inorganic ion exchanger based on tin/titanium mixed oxide doped with europium to be used in radioactive waste

    International Nuclear Information System (INIS)

    Paganini, Paula P.; Felinto, Maria Claudia F.C.; Kodaira, Claudia A.; Brito, Hermi F.

    2009-01-01

    This work presents the results of synthesis and characterization of an inorganic ion exchanger based on tin/titanium mixed oxides doped with europium (SnO 2 /TiO 2 :Eu 3+ ) to be used in environmental field. The adsorption study of nickel was realized in this exchanger to recover the nickel metal which is in thorium-nickel alloys used as electrode of discharge lamps. The studied exchanger was synthesized by neutralization of tin chloride (IV) and titanium chloride (III) mixed solution and characterized by thermogravimetric measurement (TG), Differential Scanning Calorimetry (DSC), X-Ray Powder Diffraction (XRD), Infrared Spectroscopy (IR) and Scanning Electron Microscopy (SEM). The adsorption study showed that these inorganic ion exchangers are good materials to recovery nickel with high weight distribution ratios (Dw Ni 2+ ) and percent adsorption. (author)

  15. On the complexing of phosphoric acid vinyl esters with praseodymium (3) and europium (3) nitrates in acetonitrile

    International Nuclear Information System (INIS)

    Goryushko, A.G.; Gololobov, Yu.G.; Boldeskul, A.E.; Oganesyan, A.S.; Yartsev, V.G.

    1990-01-01

    By the methods of electron, IR and PMR spectroscopy interaction of vinyl esters of phosphoric acid with praseodymium (3) and europium (3) nitrates in acetonitrile solutions has been studied. It is shown that the character of metal-ligand interaction is determined by chemical nature of the ligands: for a compound of ionic structure partially covalent bond is formed, and for a compound of betaine structure the interaction has mainly dipole character. Addition of molecule with betaine structure to praseodymium nitrate causes a change in geometry of Pr 3+ close surrounding and increase in its coordination number. The possibility of formation of the complex with metal-ligand ratio equal to 1:3 is shown

  16. The effect of organics on the sorption of strontium, caesium, iodine, neptunium, uranium and europium by glacial sand

    International Nuclear Information System (INIS)

    Haigh, D.; Higgo, J.J.W.; Williams, G.M.; Hooker, P.J.; Ross, C.A.M.; Falck, W.E.; Allen, M.A.; Warwick, P.

    1991-01-01

    This study has been undertaken within the Commission of the European Communities MIRAGE II program on the determination of radionuclides in the geosphere. Preliminary batch sorption experiments have been carried out to study the behaviour of strontium, caesium, iodine, europium and uranium in a glacial sand-groundwater system. The effect of (i) the presence or absence of natural organic material and (ii) the addition of increasing quantities of EDTA or acetate on the distribution ratios was determined. In some cases speciation modelling was used as an aid to designing the experiments and interpreting the results. The aim of this work was to select suitable tracers for use in field experiments at Drigg. Cumbria and the results are intended to aid the design of future experiments rather than to provide a complete analysis of the radionuclide-organic interactions. 11 tabs., 49 refs

  17. 13 CFR 134.407 - Evidence beyond the record and discovery.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence beyond the record and discovery. 134.407 Section 134.407 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF..., the Administrative Law Judge may not admit evidence beyond the written administrative record nor...

  18. 32 CFR 13.4 - Duties and responsibilities of the defense.

    Science.gov (United States)

    2010-07-01

    ... COMMISSIONS RESPONSIBILITIES OF THE CHIEF DEFENSE COUNSEL, DETAILED DEFENSE COUNSEL, AND CIVILIAN DEFENSE COUNSEL § 13.4 Duties and responsibilities of the defense. (a) Regular duties. The Defense shall perform... 32 National Defense 1 2010-07-01 2010-07-01 false Duties and responsibilities of the defense. 13.4...

  19. Stage dependent expression and tumor suppressive function of FAM134B (JK1) in colon cancer.

    Science.gov (United States)

    Islam, Farhadul; Gopalan, Vinod; Wahab, Riajul; Smith, Robert A; Qiao, Bin; Lam, Alfred King-Yin

    2017-01-01

    The aims of the present study are to investigate sub-cellular location, differential expression in different cancer stages and functional role of FAM134B in colon cancer development. FAM134B expression was studied and quantified at protein and mRNA levels in cell lines using immunocytochemistry, Western blot and real-time PCR. In vitro functional assays and an in vivo xenotransplantation mouse models were used to investigate the molecular role of FAM134B in cancer cell biology in response to FAM134B silencing with shRNA lentiviral particles. FAM134B protein was noted in both cytoplasm and nuclei of cancer cells. In cancer cells derived from stage IV colon cancer, FAM134B expression was remarkably reduced when compared to non-cancer colon cells and cancer cells derived from stage II colon cancer. FAM134B knockdown significantly (P colon cancer cells following lentiviral transfection. Furthermore, FAM134B suppression significantly increased (34-52%; P cancer suppressor gene in colon cancer. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  20. 40 CFR 61.134 - Standard: Naphthalene processing, final coolers, and final-cooler cooling towers.

    Science.gov (United States)

    2010-07-01

    ... coolers, and final-cooler cooling towers. 61.134 Section 61.134 Protection of Environment ENVIRONMENTAL... Standard: Naphthalene processing, final coolers, and final-cooler cooling towers. (a) No (“zero”) emissions are allowed from naphthalene processing, final coolers and final-cooler cooling towers at coke by...

  1. 10 CFR 60.134 - Design of seals for shafts and boreholes.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Design of seals for shafts and boreholes. 60.134 Section....134 Design of seals for shafts and boreholes. (a) General design criterion. Seals for shafts and... closure. (b) Selection of materials and placement methods. Materials and placement methods for seals shall...

  2. 13 CFR 134.711 - Will the Judge permit discovery and oral hearings?

    Science.gov (United States)

    2010-01-01

    ... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Will the Judge permit discovery and oral hearings? 134.711 Section 134.711 Business Credit and Assistance SMALL BUSINESS...

  3. 13 CFR 134.712 - What are the limitations on new evidence?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the limitations on new evidence? 134.712 Section 134.712 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

  4. 13 CFR 134.705 - What are the requirements for an appeal petition?

    Science.gov (United States)

    2010-01-01

    ... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for an appeal petition? 134.705 Section 134.705 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

  5. 13 CFR 134.714 - When must the Judge issue his or her decision?

    Science.gov (United States)

    2010-01-01

    ... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must the Judge issue his or her decision? 134.714 Section 134.714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

  6. 13 CFR 134.709 - When will a Judge dismiss an appeal?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When will a Judge dismiss an appeal? 134.709 Section 134.709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

  7. 13 CFR 134.706 - What are the service and filing requirements?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the service and filing requirements? 134.706 Section 134.706 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

  8. 13 CFR 134.708 - What is the standard of review?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is the standard of review? 134.708 Section 134.708 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

  9. 13 CFR 134.715 - Can a Judge reconsider his decision?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can a Judge reconsider his decision? 134.715 Section 134.715 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF....715 Can a Judge reconsider his decision? (a) The Judge may reconsider an appeal decision within 20...

  10. 27 CFR 17.134 - Determination of unfitness for beverage purposes.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Determination of unfitness for beverage purposes. 17.134 Section 17.134 Alcohol, Tobacco Products and Firearms ALCOHOL AND... an alcoholic concentration of 15% and tasted. Sale or use for beverage purposes is indicative of...

  11. Mitochondria Targetable Time-Gated Luminescence Probe for Singlet Oxygen Based on a β-Diketonate-Europium Complex.

    Science.gov (United States)

    Sun, Jingyan; Song, Bo; Ye, Zhiqiang; Yuan, Jingli

    2015-12-21

    Singlet oxygen ((1)O2) plays a key role in the photodynamic therapy (PDT) technique of neoplastic diseases. In this work, by using a 9,10-dimethyl-2-anthryl-containing β-diketone, 1,1,1,2,2-pentafluoro-5-(9',10'-dimethyl-2'-anthryl)-3,5-pentanedione (Hpfdap), as a (1)O2-recognition ligand, a novel β-diketonate-europium(III) complex that can act as a luminescence probe for (1)O2, [Eu(pfdap)3(tpy)] (tpy = 2,2',2″-terpyridine), has been designed and synthesized for the time-gated luminescence detection of (1)O2 in living cells. The complex is weakly luminescent due to the quenching effect of 9,10-dimethyl-2-anthryl groups. After reaction with (1)O2, accompanied by the formation of endoperoxides of 9,10-dimethyl-2-anthryl groups, the luminescence quenching disappears, so that the long-lived luminescence of the europium(III) complex is switched on. The complex showed highly selective luminescence response to (1)O2 with a remarkable luminescence enhancement. Combined with the time-gated luminescence imaging technique, the complex was successfully used as a luminescent probe for the monitoring of the time-dependent generation of (1)O2 in 5-aminolevulinic acid (a PDT drug) loaded HepG2 cells during the photodynamic process. In addition, by coloading the complex and a mitochondrial indicator, Mito-Tracker Green, into HepG2 cells, the specific localization of [Eu(pfdap)3(tpy)] molecules in mitochondria of HepG2 cells was demonstrated by confocal fluorescence imaging measurements.

  12. Efficient red organic electroluminescent devices based on trivalent europium complex obtained by designing the device structure with stepwise energy levels

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Liang; Jiang, Yunlong; Cui, Rongzhen; Li, Yanan; Zhao, Xuesen; Deng, Ruiping; Zhang, Hongjie, E-mail: hongjie@ciac.ac.cn

    2016-02-15

    In this study, we aim to further enhance the electroluminescence (EL) performances of trivalent europium complex Eu(TTA){sub 3}phen (TTA=thenoyltrifluoroacetone and phen=1,10-phenanthroline) by designing the device structure with stepwise energy levels. The widely used bipolar material 2,6-bis(3-(9H-carbazol-9-yl)phenyl)pyridine (26DCzPPy) was chosen as host material, while the doping concentration of Eu(TTA){sub 3}phen was optimized to be 4%. To facilitate the injection and transport of holes, MoO{sub 3} anode modification layer and 4,4′,4′′-Tris(carbazole-9-yl)triphenylamine (TcTa) hole transport layer were inserted in sequence. Efficient pure red emission with suppressed efficiency roll-off was obtained attributed to the reduction of accumulation holes, the broadening of recombination zone, and the improved balance of holes and electrons on Eu(TTA){sub 3}phen molecules. Finally, the device with 3 nm MoO{sub 3} and 5 nm TcTa obtained the highest brightness of 3278 cd/m{sup 2}, current efficiency of 12.45 cd/A, power efficiency of 11.50 lm/W, and external quantum efficiency of 6.60%. Such a device design strategy helps to improve the EL performances of emitters with low-lying energy levels and provides a chance to simplify device fabrication processes. - Highlights: • Electroluminescent performances of europium complex were further improved. • Device structure with stepwise energy levels was designed. • Better carriers' balance was realized by improving the injection and transport of holes. • The selection of bipolar host caused the broadening of recombination zone.

  13. Spectroscopic studies of europium-tetracyclines complexes and their applications in detection of hydrogen peroxide and urea peroxide; Estudos espectroscopicos dos complexos europio-tetraciclinas e suas aplicacoes na detecao de peroxido de hidrogenio e peroxido de ureia

    Energy Technology Data Exchange (ETDEWEB)

    Grasso, Andrea Nastri

    2010-07-01

    In this work were studied the spectroscopic properties of trivalent europium ion complexed with components of tetracycline family, chlorotetracycline, oxytetracycline and metacycline, in the presence of hydrogen peroxide and urea peroxide. Optical parameters were obtained such as absorption, emission, lifetime and calibration curves were constructed for luminescence spectra. Experiments were carried out with both inorganic compounds and europium-tetracyclines complexes in order to verify possible interferences. Studies for glucose determination were also described using europium-tetracyclines complexes as biosensors. Results show that europium tetracyclines complexes emit a narrow band in the visible region and, in the presence of hydrogen peroxide or urea peroxide there is a greater enhancement in their luminescence and lifetime. Thus, europium-tetracyclines complexes studied can be used as biosensors for hydrogen and urea peroxides determination as a low cost and room temperature method. An indirect method for glucose determination was studied by adding glucose oxidase enzyme in europium-tetracyclines complex in the presence of glucose promoting as product hydrogen peroxide. (author)

  14. The review of 134 cases colon and rectal carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Chung Kyu; Choi, Byung Sook [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1971-10-15

    Barium Enema study for colon examination is of great importance in the health care of our people and its value can be increased by a wide understanding of the attendant difficulties and limitation. Since the incidence of the colon and rectal carcinoma is increasing, the barium enema examination is more valuable. Radiologically diagnosed 134 cases of colon and rectal carcinoma from January 1964 to June 1970 have been reviewed at Yensei Univ., College of Medicine. Among the total admission during these years, the ratio of the colon and rectal carcinoma was 0.29 percent, and the incidence among barium enema examination was 5.3%. The peak age range was between 40 and 50 years. The average age of the patients was 46 years. It was more common in male. The clinical picture was rather vague in some cases, especially in the lesions of right colon. The large number of cases has bowel habit change, tarry or bloody stool and abdominal pain. About 60% of the lesions were located in rectum and 40% was proximal portion from the rectum, which could not be completely diagnosed only by digital examination and proctosigmoidoscopy. On roentgenogram, the most common form was encircling type, next was fungating. The positivity for accuracy of the barium enema examination was 90%. Majority of cancers of the colon, particularly those that produce symptoms are relative gross lesions. In daily practise we have to eager to find out small lesions by repeat and complete barium enema examination, including double contrast study. Early diagnosis is an aid immediate, logical objective in attempts to decrease the morbidity and mortality from carcinoma of colon.

  15. The review of 134 cases colon and rectal carcinoma

    International Nuclear Information System (INIS)

    Kim, Chung Kyu; Choi, Byung Sook

    1971-01-01

    Barium Enema study for colon examination is of great importance in the health care of our people and its value can be increased by a wide understanding of the attendant difficulties and limitation. Since the incidence of the colon and rectal carcinoma is increasing, the barium enema examination is more valuable. Radiologically diagnosed 134 cases of colon and rectal carcinoma from January 1964 to June 1970 have been reviewed at Yensei Univ., College of Medicine. Among the total admission during these years, the ratio of the colon and rectal carcinoma was 0.29 percent, and the incidence among barium enema examination was 5.3%. The peak age range was between 40 and 50 years. The average age of the patients was 46 years. It was more common in male. The clinical picture was rather vague in some cases, especially in the lesions of right colon. The large number of cases has bowel habit change, tarry or bloody stool and abdominal pain. About 60% of the lesions were located in rectum and 40% was proximal portion from the rectum, which could not be completely diagnosed only by digital examination and proctosigmoidoscopy. On roentgenogram, the most common form was encircling type, next was fungating. The positivity for accuracy of the barium enema examination was 90%. Majority of cancers of the colon, particularly those that produce symptoms are relative gross lesions. In daily practise we have to eager to find out small lesions by repeat and complete barium enema examination, including double contrast study. Early diagnosis is an aid immediate, logical objective in attempts to decrease the morbidity and mortality from carcinoma of colon

  16. Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea

    International Nuclear Information System (INIS)

    Zhu Cong; Guo Jiangfeng

    2008-01-01

    Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)

  17. 134Cs in heather seed plants grown with and without mycorrhiza

    International Nuclear Information System (INIS)

    Strandberg, M.; Johansson, M.

    1988-01-01

    Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of 134 Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of 134 Cs to the shoots than heather without mycorrhiza. As an average the concentration of 134 Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of 134 Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of 134 Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)

  18. {sup 134}Cs in heather seed plants grown with and without mycorrhiza

    Energy Technology Data Exchange (ETDEWEB)

    Strandberg, M. [Risoe National Laboratory, DK-4000 Roskilde (Denmark); Johansson, M. [Department of Mycology, Botanical Institute, University of Copenhagen, Oester Farimagsgade 2D, DK-1353 Copenhagen K. (Denmark)

    1988-08-01

    Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of {sup 134}Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of {sup 134}Cs to the shoots than heather without mycorrhiza. As an average the concentration of {sup 134}Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of {sup 134}Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of {sup 134}Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)

  19. A Smart Europium-Ruthenium Complex as Anticancer Prodrug: Controllable Drug Release and Real-Time Monitoring under Different Light Excitations.

    Science.gov (United States)

    Li, Hongguang; Xie, Chen; Lan, Rongfeng; Zha, Shuai; Chan, Chi-Fai; Wong, Wing-Yan; Ho, Ka-Lok; Chan, Brandon Dow; Luo, Yuxia; Zhang, Jing-Xiang; Law, Ga-Lai; Tai, William C S; Bünzli, Jean-Claude G; Wong, Ka-Leung

    2017-11-09

    A unique, dual-function, photoactivatable anticancer prodrug, RuEuL, has been tailored that features a ruthenium(II) complex linked to a cyclen-europium chelate via a π-conjugated bridge. Under irradiation at 488 nm, the dark-inactive prodrug undergoes photodissociation, releasing the DNA-damaging ruthenium species. Under evaluation-window irradiation (λ irr = one-photon 350 nm or two-photon 700 nm), the drug delivery process can be quantitatively monitored in real-time because of the long-lived red europium emission. Linear relationships between released drug concentration and ESI-MS or luminescence responses are established. Finally, the efficiency of the new prodrug is demonstrated both in vitro RuEuL anticancer prodrug over some existing ones and open the way for decisive improvements in multipurpose prodrugs.

  20. Gamma-induced radiation polymerization of kaolin composite for sorption of lanthanum, europium and uranium ions from low-grade monazite leachate

    International Nuclear Information System (INIS)

    Metwally, S.S.; Hassan, R.S.; El-Masry, E.H.; Borai, E.H.

    2018-01-01

    Gamma radiation polymerization method was used for the modification of kaolin to produce (poly acrylamide-acrylic acid)-Kaolin (PAM-AA-K). Monazite ore is one of the main resources of uranium and lanthanide elements, therefore, this work focused on sorption of uranium, lanthanum and europium ions from low grade monazite leachate. The removal percent for Eu 3+ , La 3+ and UO 2 2+ are 94.6, 91.6 and 73.4%, respectively. Monolayer capacity of Eu 3+ , La 3+ and UO 2 2+ were found to be 54.64, 45.87 and 37.59 mg/g, respectively. The sorption mechanism of lanthanum and europium ions on PAM-AA-K composite mainly takes place as Ln(OH) 2+ , and for uranium as uranyl ion, UO 2 2+ . (author)

  1. Foliar uptake of 134Cs and 85Sr in strawberry as function by leaf age

    International Nuclear Information System (INIS)

    Fortunati, P.; Brambilla, M.; Speroni, F.; Carini, F.

    2004-01-01

    In this paper a study of the foliar uptake and translocation of 134 Cs and 85 Sr in a herbaceous fruit plant is presented. In particular, absorption, translocation and loss of these radionuclides in strawberry plants have been studied in relation to the age of contaminated leaves. Strawberry plants were contaminated by distributing droplets of an aqueous solution containing 134 CsCl and 85 SrCl 2 on the surface of two leaves per plant. One half of the plants was contaminated through two young leaves, a second half through two old leaves. Sets of plants were collected 1 day, 7 days and 15 days after contamination. One half of them was rinsed with double distilled water before gamma analysis. Rinsing contaminated leaves removes on average 55% of the applied 134 Cs and 45% of 85 Sr. The activity removed decreases during the 15 days of the experimental study, both for 134 Cs and for 85 Sr, suggesting an increase in foliar absorption during this period. The activity removed does not differ between old and young leaves. 'External loss' is lower for young than old contaminated leaves. 'Internal loss' through translocation occurs mainly for 134 Cs. Translocation coefficients from contaminated leaves to fruits are two orders of magnitude higher for 134 Cs (4.0%), than for 85 Sr (0.05%). Leaf to fruit translocation coefficients for 134 Cs are higher from young leaves (5.8%), than from old leaves (2.3%)

  2. Plant uptake of 134Cs in relation to soil properties and time

    International Nuclear Information System (INIS)

    Massas, I.; Skarlou, V.; Haidouti, C.

    2002-01-01

    134 Cs uptake by sunflower and soybean plants grown on seven different soils and its relation to soil properties were studied in a greenhouse pot experiment. Soil in each pot was contaminated by dripping the 134 Cs in layers, and sunflower and soybean plants were grown for three and two successive periods, respectively. 134 Cs plant uptake was expressed as the transfer factor (TF) (Bq kg -1 plant/Bq kg -1 soil) and as the daily plant uptake (flux) (Bq pot -1 day -1 ) taking into account biomass production and growth time. For the studied soils and for both plants, no consistent trend of TFs with time was observed. The use of fluxes, in general, provided less variable results than TFs and stronger functional relationships. A negative power functional relationship between exchangeable potassium plus ammonium cations expressed as a percentage of cation exchange capacity of each soil and 134 Cs fluxes was found for the sunflower plants. A similar but weaker relationship was observed for soybean plants. The significant correlation between sunflower and soybean TFs and fluxes, as well as the almost identical highest/lowest 134 Cs flux ratios, in the studied soils, indicated a similar effect of soil characteristics on 134 Cs uptake by both plants. In all the studied soils, sunflower 134 Cs TFs and fluxes were significantly higher than the respective soybean values, while no significant difference was observed in potassium content and daily potassium plant uptake (flux) of the two plants

  3. Composition shift in liquid-recirculation refrigerating systems: an experimental investigation for the pure fluid R134a and the mixture R32/134a

    Energy Technology Data Exchange (ETDEWEB)

    Giuliani, G.; Marchesi Donati, F.; Polonara, F. [Ancona Univ. (Italy). Dip. di Energetica; Hewitt, N.J. [University of Ulster at Coleraine, Northern Ireland (United Kingdom). NICERT

    1999-09-01

    The ability of zeotropic mixtures with a remarkable temperature glide to operate in liquid-recirculation systems is investigated and the results of an experimental comparison between the performances of the pure fluid R134a and the zeotropic mixture R32/134a (25/75% by mass) are presented. R134a performs slightly better in the liquid-recirculation mode than in the traditional dry-expansion mode; on the other hand, liquid-recirculation configuration has a detrimental effect on the zeotropic mixture's performance. The reason for this detrimental effect is the mixture component separation which occurs at the liquid/vapor separator. The effect of this separation is investigated using gas chromatograph analysis.

  4. Rate constants for the reactions of OH with HFC-134a (CF3CH2F) and HFC-134 (CHF2CHF2)

    Science.gov (United States)

    Demore, W. B.

    1993-01-01

    Measurements of rate constants for HFC-134 (CF2HCF2H) relative to CH3CCl3, HFC-125, and HFC-134a are reported. The measurements were made in a slow-flow, temperature controlled photochemical reactor, and were based on relative rates of disappearance of the parent compounds as measured by FTIR spectroscopy. Hydroxyl radicals were generated by 254-nm photolysis of O3 in the presence of water vapor. NASA/JPL rate constants for the reference compounds are used to derive temperature-dependent rate constants of both compounds. Rate constants obtained from the different reference compounds are in excellent agreement. The presently recommended rate constant for HFC-134a is about 25 percent too high.

  5. Structural and optical analysis on europium doped AZrO{sub 3} (A=Ba, Ca, Sr) phosphor for display devices application

    Energy Technology Data Exchange (ETDEWEB)

    Dubey, Vikas, E-mail: jsvikasdubey@gmail.com [Department of Physics, Bhilai Institute of Technology Raipur, 493661 (India); Tiwari, Neha [Department of Physics, Govt. Model Science College, Jabalpur (India)

    2016-05-06

    Behavior displayed by europium doped AZrO{sub 3} phosphor which was synthesized by solid state reaction method. For synthesis of BaZrO{sub 3}, SrZrO{sub 3} and CaZrO{sub 3} phosphor with fixed concentration of europium ion was calcination at 1000°C and sintered at 1300°C following intermediate grinding. Synthesized sample was characterized by X-ray diffraction analysis and crystallite sized was calculated by Scherer’s formula. From PL spectra of prepared phosphors shows intense emission centred at 612nm (red emission) with high intensity for SrZrO{sub 3}:Eu{sup 3+}. For europium doped BaZrO{sub 3} and CaZrO{sub 3} (613nm) phosphor shows less intense PL spectra as compared to SrZrO{sub 3}:Eu{sup 3+}. The strong emission peak of AZrO{sub 3}:Eu{sup 3+} phosphor is due to forced electric dipole transition of {sup 5}D{sub 0} to {sup 7}F{sub 2} centered at 612 and 613nm. It is characteristic red emission for europium ion. The excitation spectra of AZrO{sub 3}:Eu{sup 3+} phosphor mainly consists of the charge transfer and (CTB) of Eu{sup 3+} located in 200–350 nm centred at 254nm. The present phosphors can act as single host for red light emission in display devices. The CIE coordinates were calculated by Spectrophotometric method using the spectral energy distribution of the AZrO{sub 3}:Eu{sup 3+} sample.

  6. Spectrochemical study of europium and neodymium complexes with 3-(3'-trifluoromethoxy-2',2',3',3'-tetrafluoropropionyl)camphor and bisheterocycles

    International Nuclear Information System (INIS)

    Khomenko, V.S.; Pavich, T.A.; Lozonskij, M.O.; Fialkov, Yu.A.; AN Ukrainskoj SSR, Kiev. Inst. Organicheskoj Khimii)

    1987-01-01

    Methods of mass-spectrometry, luminescent specroscopy and thermogravimetry are used to study decomposition ways, structure and volatility of mixed europium and neodymium complexes with fluorated organic ligands and bisheterocycles. It is shown that complexes containing an oxygen atom in a fluorated ligand elimination of difluorophosgene and tetrafluoroethylene molecules takes place. The addition of a bisheterocyclic ligand to a triligand complex makes the averaged bond in the complex more covalent and increase its volatility

  7. Transfer factors of 134Cs for olive and orange trees grown on different soils

    International Nuclear Information System (INIS)

    Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.; Papanicolaou, E.

    1999-01-01

    Transfer factors (TF) of 134 Cs to olive and citrus trees grown on two different soils, were determined for a 3-year greenhouse experiment. Two-year-old trees were transplanted with their entire rootball into large pots containing the contaminated soil (110 kg pot -1 ). The soil was transferred to each pot in layers on the top of which 134 Cs as CsCl was dripped (18.5 MBq pot -1 ). For both evergreen trees, soil type significantly influenced radiocaesium transfer. 134 Cs concentration was lower for the calcareous-heavy soil than for the acid-light soil. Transfer factors of orange trees were higher than those of olive trees in the acid-light soil. Although a significant amount of 134 Cs was measured in olives grown on the acid-light soil, no 134 Cs was detected in the unprocessed olive oil when an oil fraction (5% f.w.) was extracted. On the contrary the edible part of the oranges showed the highest 134 Cs concentration of all plant parts. The relationship between 134 Cs uptake and potassium content in the different plant compartments was also studied when selected trees were cut down. The potassium concentration in the plants was not significantly different between the trees growing in the two types of soil in spite of the big differences in the 134 Cs uptake in the two soils. TF values and potassium content in the different plant compartments of each tree were highly correlated. For both crops transfer factors as well as potassium content were the highest in the developing plant parts (new leaves and branches, flowers). The transfer factors of 134 Cs for the studied trees are in the same order of magnitude as the values of annual crops grown under similar conditions. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  8. Electron tunneling transport across heterojunctions between europium sulfide and indium arsenide

    Science.gov (United States)

    Kallaher, Raymond L.

    This dissertation presents research done on utilizing the ferromagnetic semiconductor europium sulfide (EuS) to inject spin polarized electrons into the non-magnetic semiconductor indium arsenide (InAs). There is great interest in expanding the functionality of modern day electronic circuits by creating devices that depend not only on the flow of charge in the device, but also on the transport of spin through the device. Within this mindset, there is a concerted effort to establish an efficient means of injecting and detecting spin polarized electrons in a two dimensional electron system (2DES) as the first step in developing a spin based field effect transistor. Thus, the research presented in this thesis has focused on the feasibility of using EuS, in direct electrical contact with InAs, as a spin injecting electrode into an InAs 2DES. Doped EuS is a concentrated ferromagnetic semiconductor, whose conduction band undergoes a giant Zeeman splitting when the material becomes ferromagnetic. The concomitant difference in energy between the spin-up and spin-down energy bands makes the itinerant electrons in EuS highly spin polarized. Thus, in principle, EuS is a good candidate to be used as an injector of spin polarized electrons into non-magnetic materials. In addition, the ability to adjust the conductivity of EuS by varying the doping level in the material makes EuS particularly suited for injecting spins into non-magnetic semiconductors and 2DES. For this research, thin films of EuS have been grown via e-beam evaporation of EuS powder. This growth technique produces EuS films that are sulfur deficient; these sulfur vacancies act as intrinsic electron donors and the resulting EuS films behave like heavily doped ferromagnetic semiconductors. The growth parameters and deposition procedures were varied and optimized in order to fabricate films that have minimal crystalline defects. Various properties and characteristics of these EuS films were measured and compared to

  9. Dynamics of cesium-134 and biomass in treated and untreated turkey oak leaf-litter bags

    International Nuclear Information System (INIS)

    Croom, J.M.; Ragsdale, H.L.

    1978-01-01

    Litter bags were prepared from leaves harvested in late fall from turkey oak trees (Quercus laevis) tagged with 134 Cs. Untreated bags and bags treated by soaking in 1000 ppM HgCl 2 were placed in the field on Dec. 7, 1974. Five bags of each treatment were retrieved at 7-, 14-, and 30-day intervals as the experiment progressed. Treated bags remained free of visible fungal hyphae growth for 12 weeks. Untreated bags had lost more weight but less 134 Cs than treated bags after 14 and 56 days, respectively. After 9 months, untreated bags had lost 33% weight and 90% 134 Cs. Although 134 Cs is rapidly leached from litter (ecological half-life approximately equal to 12 weeks), some is retained by fungal hyphae on leaf-litter surfaces. This mechanism of mineral retention in the litter layer could represent adaptation at the ecosystem level for nutrient conservation

  10. Experimental study of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator

    International Nuclear Information System (INIS)

    Wongwises, Somchai; Chimres, Nares

    2005-01-01

    This work presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). A refrigerator designed to work with HFC-134a with a gross capacity of 239 l is used in the experiment. The consumed energy, compressor power and refrigerant temperature and pressure at the inlet and outlet of the compressor are recorded and analysed as well as the distributions of temperature at various positions in the refrigerator. The refrigerant mixtures used are divided into three groups: the mixture of three hydrocarbons, the mixture of two hydrocarbons and the mixture of two hydrocarbons and HFC-134a. The experiments are conducted with the refrigerants under the same no load condition at a surrounding temperature of 25 deg. C. The results show that propane/butane 60%/40% is the most appropriate alternative refrigerant to HFC-134a

  11. Isothermal phase equilibria for the (HFC-32 + HFC-134a) mixed-gas hydrate system

    International Nuclear Information System (INIS)

    Miyauchi, Hiroshi; Yasuda, Kenjiro; Matsumoto, Yuuki; Hashimoto, Shunsuke; Sugahara, Takeshi; Ohgaki, Kazunari

    2012-01-01

    Highlights: ► Structural phase transition results in the heterogeneous azeotropic-like behaviour. ► HFC-134a molecules, in spite of an s-II former, occupy the large cages of s-I. ► Negative azeotropic-like behaviour becomes more remarkable at higher temperatures. - Abstract: Isothermal phase equilibria (pressure-composition relations in hydrate, gas, and aqueous phases) in the {difluoromethane (HFC-32) + 1,1,1,2-tetrafluoroethane (HFC-134a)} mixed-gas hydrate system were measured at the temperatures 274.15 K, 279.15 K, and 283.15 K. The heterogeneous azeotropic-like behaviour derived from the structural phase transition of (HFC-32 + HFC-134a) mixed-gas hydrates appears over the whole temperature range of the present study. In addition to the heterogeneous azeotropic-like behaviour, the isothermal phase equilibrium curves of the (HFC-32 + HFC-134a) mixed-gas hydrate system exhibit the negative homogeneous azeotropic-like behaviour at temperatures 279.15 K and 283.15 K. The negative azeotropic-like behaviour, which becomes more remarkable at higher temperatures, results in the lower equilibrium pressure of (HFC-32 + HFC-134a) mixed-gas hydrates than those of both simple HFC-32 and HFC-134a hydrates. Although the HFC-134a molecule forms the simple structure-II hydrate at the temperatures, the present findings reveal that HFC-134a molecules occupy a part of the large cages of the structure-I mixed-gas hydrate.

  12. EXPERIMENTAL PERFORMANCE OF R134a AND R152a USING MICROCHANNEL CONDENSER

    OpenAIRE

    Bhatkar, V. W.

    2018-01-01

    An experimental performance study on vapour compression refrigeration system with R134a and drop in substitute R152a with aluminium microchannel condenser was carried out for condensation temperature of 48°C while evaporation temperature varied from -10 to 15°C. Refrigerant charge of R152a was reduced by 40% over R134a with the microchannel condenser. Performance parameters like work input to the compressor, coefficient of performance, refrigerating capacity, condenser capacity and the produc...

  13. Measurement of the effective thermal cross section of {sup 134}Cs by triple neutron capture reaction

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, Shoji; Harada, Hideo; Katoh, Toshio [Power Reactor and Nuclear Fuel Development Corp., Tokai, Ibaraki (Japan). Tokai Works; Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro; Kobayashi, Katsutoshi; Motoishi, Shoji; Tanase, Masakazu

    1998-03-01

    The effective thermal cross section ({sigma}{sub eff}) of the {sup 134}Cs(n,{gamma}){sup 135}Cs reaction was measured by the activation method and the {gamma}-ray spectroscopic method in order to obtain fundamental data for research on the transmutation of nuclear wastes. The effective thermal cross section of the reaction {sup 134}Cs(n,{gamma}){sup 135}Cs was found to be 140.6{+-}8.5 barns. (author)

  14. Highly luminescent pure-red-emitting fluorinated β-diketonate europium(III) complex for full solution-processed OLEDs

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Joao P. [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Serviço de Medicina Nuclear, SESARAM E.P.E., Avenida Luís de Camões 57, Funchal 9004-514, Madeira (Portugal); Martín-Ramos, Pablo [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Higher Technical School of Telecommunications Engineering, Universidad de Valladolid, Campus Miguel Delibes, Paseo Belén 15, Valladolid 47011 (Spain); Coya, Carmen, E-mail: carmen.coya@urjc.es [Escuela Superior de Ciencias Experimentales y Tecnología (ESCET), Universidad Rey Juan Carlos, Madrid 28933 (Spain); Silva, Manuela Ramos [CEMDRX, Physics Department, Universidade de Coimbra, Rua Larga, Coimbra P-3004-516 (Portugal); Eusebio, M. Ermelinda S. [Chemistry Department, Faculdade de Ciências e Tecnologia, Universidade de Coimbra, Coimbra P-3004-535 (Portugal); Andrés, Alicia de [Instituto de Ciencia de Materiales de Madrid, Consejo Superior de Investigaciones Científicas (CSIC), Cantoblanco, Madrid 28049 (Spain); Álvarez, Ángel L. [Escuela Superior de Ciencias Experimentales y Tecnología (ESCET), Universidad Rey Juan Carlos, Madrid 28933 (Spain); Martín-Gil, Jesús [Advanced Materials Laboratory, ETSIIAA, Universidad de Valladolid, Avenida de Madrid 44, Palencia 34004 (Spain)

    2015-03-15

    Current manufacturing technologies for OLEDs involve the use of expensive high vacuum techniques and call for thermal stability requirements which are not fulfilled by many materials. These problems disappear when the OLED films are deposited directly from solution. In this study, we have designed, synthesized and characterized a novel octacoordinated complex, Tris(1-(4-chlorophenyl)-4,4,4-trifluoro-1, 3-butanedionate)mono(bathophenanthroline) europium(III), to be used as a “complex-only” emissive layer in wet-processed OLEDs. Upon excitation in the UV region, very efficient energy transfer from the ligands to Eu{sup 3+} takes place, giving rise to intense red emission with very high monochromaticity (R=19), both in powder and as a thin film. The decay times of 754 µs (powder) and 620 µs (thin film) are comparable to those of the most efficient Eu{sup 3+} β-diketonate complexes reported to date. The same energy transfer leading to saturated red and narrow emission is also observed in the OLED device (glass/ITO/PEDOT:PSS/[Eu(cbtfa){sub 3}(bath)]/Ca/Al) when biased at >5.2 V. Its high quantum efficiency (∼60%), good thermal stability up to 200 °C and adequate thin film forming properties make this material a promising chromophore for cost-effective OLEDs. - Highlights: • A highly fluorinated europium(III) octacoordinated complex, [Eu(cbtfa)3(bath)], has been synthesized and its structure elucidated by single crystal X-ray diffraction. • The chosen coordination environment is well-suited for sensitizing the luminescence of the Eu{sup 3+} ion, achieving very efficient energy transfer from the organic ligands (excited in the UV region) to the rare earth ion, leading to highly efficient (Q∼60% in crystalline powder and Q∼50% in thin film) and saturated red photoluminescence. • The material has also been integrated into a single active layer, full solution-processed OLED, with ITO/PEDOT:PSS/[Eu(cbtfa)3(bath)]/ Ca/Al structure.

  15. Simultaneous analysis of free and humic acid complexed europium and gadolinium species by CE-ICP-MS

    International Nuclear Information System (INIS)

    Kautenburger, R.; Nowotka, K.; Beck, H.P.

    2005-01-01

    Full text of publication follows: For the long-term safety assessment of waste repositories, detailed information about geo-chemical behaviour of radioactive and toxic metal ions under environmental conditions (geological matrix and aquifer systems) is necessary. It includes knowledge about the mechanism of relevant geochemical reactions, as well as thermodynamic and kinetic data. Several previous studies have shown that humic acid can play an important role in the immobilisation or mobilization of metal ions due to complexation and colloid formation. In this project we investigate the complexation behaviour of humic acid (purified Aldrich humic acid) and its influence on the migration of the lanthanides europium and gadolinium (homologues of the actinides americium and curium) in the the ternary system consisting of these heavy metals, humic acid and kaolinite (KGa-1b) as geological model system under conditions close to nature. Capillary electrophoresis (CE, Beckman Coulter P/ACE MDQ), with its excellent separation performance, was coupled to Inductively Coupled Plasma Mass Spectrometry (ICP-MS, VG Elemental Plasma Quad 3) to obtain a high sensitivity for the determination of the rare earth elements europium (Eu 3+ ) and gadolinium (Gd 3+ ) and their complexes with humic acid. Additionally, the used humic acid was halogenated with iodine as ICP-MS marker. A fused-silica capillary was flexibly fitted into a MicroMist 50 μl nebulizer with a Cinnabar cyclonic spray chamber. The chamber was chilled to a temperature of 4 deg. C for best sensitivity. 200 ppb of caesium were added to the CE separation buffer to observe the capillary flow. A make-up fluid including 4 ppb Ho as an internal standard was combined with the flow from the capillary within the interface to obtain a fluid throughput high enough to maintain a continuous nebulization. Very low detection limits were achieved, 100 ppt for 153 Eu and 125 ppt for 158 Gd. With this optimized CE-ICP-MS coupling

  16. Comparison of transfer factors of Sr-85 and Cs-134 for soils and crops of Greece

    International Nuclear Information System (INIS)

    Skarlou, V.; Papanicolaou, E. P.; Nobeli, C.

    1994-01-01

    The transfer of Sr-85 and Cs-134 from soil to plant (CR) was studied in two successive and similar in design glasshouse experiments. Six plant species (wheat, alfalfa, radish, string bean, cucumber, lettuce - only for Sr-85 - and endives - only for Cs-134), were grown in pots on eight Greek soils differing significantly in their physical and chemical properties. After the necessary measurements and analyses, big differences were detected in the transfer factors of both radionuclides with the soil types. The CRs of Sr-85 were higher than those of Cs-134 and for the tested crops and soils ranged between 0.3 and 36.5 for Sr-85 and between < 0.01 and 1.72 for Cs-134. The CRs of grains and seeds were much lower than those of leafy material for Sr-85 while the difference was not so high for Cs-134. The correlation between CRs and pH, negative in all cases, was significant or highly significant for all tested crops or plant parts (for Sr-85 r-bar = - 0.89, for Cs-134 r-bar = - 0.82). The values of CRs indicated a trend for negative correlation with other soil properties (cation exchange capacity-CEC, clay %). From exchangeable cations, exchangeable (Ca + Mg) as well as exchangeable bases, expressed as percentages of CEC, gave a significant or highly significant correlation with CRs of both radionuclides. (author)

  17. Adsorbate shape selectivity: Separation of the HF/134a azeotrope over carbogenic molecular sieve

    Energy Technology Data Exchange (ETDEWEB)

    Hong, A.; Mariwala, R.K.; Kane, M.S.; Foley, H.C. [Univ. of Delaware, Nework, DE (United States)

    1995-03-01

    Experimental evidence is provided for adsorptive shape selectivity in the separation of the azeotrope between HF and 1,1,1,2-tetrafluoroethane (134a) over pyrolyzed poly(furfuryl alcohol)-derived carbogenic molecular sieve (PPFA-CMS). The separation can be accomplished over coconut charcoal or Carbosieve G on the basis of the differences in the extent of equilibrium adsorption of HF and 134a. On these adsorbents 134a is more strongly bound than HF, thus it elutes much more slowly from the bed. The heat of adsorption for 134a in the vicinity of 200 C on Carbosieve G is {approximately}8.8 kcal/mol. In contrast, when the same azeotropic mixture is separated over PPFA-CMS prepared at 500 C, 134a is not adsorbed. As a result 134a elutes from the bed first, followed by HF. The reversal is brought about by the narrower pore size and pore size distribution of the PPFA-CMS versus that for Carbosieve G. Thus the separation over PPFA-CMS is an example of adsorbate shape selectivity and represents a limiting case of kinetic separation.

  18. Soil to plant transfer of 134Cs for olive and orange trees after four years' experimentation

    International Nuclear Information System (INIS)

    Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.

    1998-01-01

    The transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) were calculated within a long-term glass-house pot experiment which was started in 1994. The effect of the soil characteristics on 134 Cs uptake was also studied using two soils with different physical and chemical properties. Both evergreen trees exhibited a similar behavior in the two soils, showing that a higher or lower uptake is not crop specific. The capacity of the trees for 134 Cs absorption through the roots seems to be significantly influenced by the soil type. The transfer factors were very low in the calcareous heavy soil and much higher in the acid light soil (up to 10 times for olives and 40 for the edible part of oranges). The difference in the TFs is higher between the two soils than between the two tree species. 134 Cs concentration kept increasing in the orange trees up to the 4th year of growth, while it seems to reach an equilibrium, with no further increase, in the olive trees. Although the behavior of the two tree species is similar, the difference in the final processed product is extreme. A significant amount of 134 Cs was observed in olives grown in the light-acid soil whereas no transfer to the olive oil was detected. On the other hand, the edible part of the oranges showed the highest 134 Cs of nearly all the plant parts

  19. Temperature effects on the interaction mechanisms between the europium (III) and uranyl ions and zirconium diphosphate; Effets de la temperature sur les mecanismes d'interaction entre les ions europium (3) et uranyle et le diphosphate de zirconium

    Energy Technology Data Exchange (ETDEWEB)

    Finck, N

    2006-10-15

    Temperature should remain higher than 25 C in the near field environment of a nuclear waste repository for thousands years. In this context, the aim of this work is to study the temperature influence on the interaction mechanisms between europium (III) and uranyl ions and zirconium diphosphate, as well as the influence of a complexing medium (nitrate) on the sorption of the lanthanide. The experimental definition of the equilibria was achieved by combining a structural investigation with the macroscopic sorption data. Surface complexes were characterized at all temperatures (25 C to 90 C) by TRLFS experiments carried out on dry and in situ samples using an oven. This characterization was completed by XPS experiments carried out at 25 C on samples prepared at 25 C and 90 C. The reaction constants (surface hydration and cations sorption) were obtained by simulating the experimental data with the constant capacitance surface complexation model. The reaction constants temperature dependency allowed one to characterize thermodynamically the different reactions by application of the van't Hoff relation. The validity of this law was tested by performing microcalorimetric measurements of the sorption heat for both cations. (author)

  20. Effects of added dopants on various triboluminescent properties of europium dibenzoylmethide triethylammonium (EuD4TEA)

    Science.gov (United States)

    Owens, Constance; Fontenot, Ross S.; Bhat, Kamala N.; Aggarwal, Mohan D.

    2014-03-01

    A triboluminescent (TL) material is one that emits light upon pressure, impact, friction, or mechanical shock. TL materials are desirable for investigation because they have the potential to be used as the active element for smart impact sensors. While the material europium dibenzoylmethide triethylammonium (EuD4TEA) produces a TL emission yield that can be observed by the naked eye, it is still not sufficiently bright for use in smart sensor devices. Previous studies have shown that additional materials can be combined with EuD4TEA in order to improve the TL emission yield. In this paper, we discuss the effects of doping on EuD4TEA at different concentrations with a variety of materials on the TL emission yield and decay times. The dopants that were used in this study were nicotine, dibutyl phosphate (DBP), and magnesium. We also discuss both the effects of pH on EuD4TEA, and the doping effects on impact energy. For testing triboluminescent properties, we use a custom-built drop tower that generates triboluminescence by fracturing compounds through impact. Collected data is analyzed using specially written LabVIEW programs.

  1. 340nm UV LED excitation in time-resolved fluorescence system for europium-based immunoassays detection

    Science.gov (United States)

    Rodenko, Olga; Fodgaard, Henrik; Tidemand-Lichtenberg, Peter; Pedersen, Christian

    2017-02-01

    In immunoassay analyzers for in-vitro diagnostics, Xenon flash lamps have been widely used as excitation light sources. Recent advancements in UV LED technology and its advantages over the flash lamps such as smaller footprint, better wall-plug efficiency, narrow emission spectrum, and no significant afterglow, have made them attractive light sources for gated detection systems. In this paper, we report on the implementation of a 340 nm UV LED based time-resolved fluorescence system based on europium chelate as a fluorescent marker. The system performance was tested with the immunoassay based on the cardiac marker, TnI. The same signal-to-noise ratio as for the flash lamp based system was obtained, operating the LED below specified maximum current. The background counts of the system and its main contributors were measured and analyzed. The background of the system of the LED based unit was improved by 39% compared to that of the Xenon flash lamp based unit, due to the LEDs narrower emission spectrum and longer pulse width. Key parameters of the LED system are discussed to further optimize the signal-to-noise ratio and signal-to-background, and hence the sensitivity of the instrument.

  2. Influence of ligands on the photoluminescent properties of Eu3+ in europium β-diketonate/PMMA-doped systems

    International Nuclear Information System (INIS)

    Liu, H.-G.; Park, Seongtae; Jang, Kiwan; Feng, X.-S.; Kim, Changdae; Seo, H.-J.; Lee, Y.-I.

    2004-01-01

    Three kinds of europium β-diketonates Eu(DBM) 3 , Eu(BA) 3 and Eu(TTA) 3 (DBM: Dibenzoylmethane; BA: 1-Benzoylacetone; TTA: Thenoyltrifluoroacetone) were doped in poly(methyl methacrylate) (PMMA) matrix. The doped systems were studied by using photoluminescent (PL) spectroscopy, emission decay experiments and X-ray diffractometry. Eu(III) ions in the doped Eu(DBM) 3 /PMMA systems have two distinct symmetric sites and the emission band changes greatly with the compositions. Eu(III) in the Eu(BA) 3 /PMMA systems gives only one symmetric site in the doped systems and the emission band changes slightly with the compositions. Although two distinct symmetric sites of Eu(III) can be distinguished in the doped systems of Eu(TTA) 3 /PMMA, the two sites have similar 5 D 0 lifetimes and the luminescent spectra almost do not change with the compositions. XRD reveals that crystallites were formed in the doped Eu(DBM) 3 /PMMA systems that have different crystalline structure from that of the chelate, and Eu(BA) 3 and Eu(TTA) 3 exist in amorphous state in the doped systems. The difference between the PL properties and structures of the doped systems for the three kinds of chelates should be attributed to different interactions between the chelate molecules and between the chelate and PMMA

  3. Synthesis of red fluorescent graphene quantum dot-europium complex composites as a viable bio imaging platform

    International Nuclear Information System (INIS)

    Liu, Yanting; Fan, Louzhen; Zhou, Shixin; Fan, Hong

    2016-01-01

    We have prepared graphene quantum dot-europium(III) complex composites by noncovalently connecting chelating ligands dibenzoylmethane (DBM) and 1,10-phenanthroline (Phen) with graphene quantum dots (GQDs) first, followed by coordination to Eu(III). The resulting composites are well water-soluble and display red fluorescence of high color purity. The composites were characterized by transmission electron microscopy, X-ray photoelectron spectroscopy and X-ray diffraction. Aqueous solutions of the composites under 365 nm excitation display fluorescence with a peak at 613 nm and a quantum yield as high as 15.5 %. The good water solubility and stable photoluminescence make the composites very different from other Eu(III)-based coordination complexes. The composites are cell viable and can be used to label both the cell membrane and the cytoplasm of MCF-7 cells. They are also shown to act as bioprobes for in-vivo localization of tumorous tissue. In our perception, such composites are expected to possess wide scope because of the many functionalizations that are possible with GQDs. (author)

  4. Interaction of europium and nickel with calcite studied by Rutherford Backscattering Spectrometry and Time-Resolved Laser Fluorescence Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Sabau, A. [Agence Nationale pour la gestion des Déchets RAdioactifs, 1-7 rue J. Monnet, Parc de la Croix Blanche, 92298 Châtenay-Malabry Cedex (France); Université de Nice Sophia Antipolis, Ecosystèmes Côtiers Marins et Réponses aux Stress (ECOMERS), 28 avenue Valrose, 06108 Nice Cedex 2 (France); Pipon, Y., E-mail: pipon@ipnl.in2p3.fr [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); Institut Universitaire de Technologie (IUT) Lyon-1, Université Claude Bernard Lyon 1, 69 622 Villeurbanne Cedex (France); Toulhoat, N. [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); CEA/DEN, Saclay, 91191 Gif sur Yvette (France); Lomenech, C. [Université de Nice Sophia Antipolis, Ecosystèmes Côtiers Marins et Réponses aux Stress (ECOMERS), 28 avenue Valrose, 06108 Nice Cedex 2 (France); Jordan, N. [Helmholtz Zentrum Dresden Rossendorf (HZDR), Institute of Resource Ecology (IRE) (Germany); Moncoffre, N. [Institut de Physique Nucléaire de Lyon (IPNL), Université Lyon 1, CNRS/IN2P3, 4 rue Enrico Fermi, 69 622 Villeurbanne Cedex (France); Barkleit, A. [Helmholtz Zentrum Dresden Rossendorf (HZDR), Institute of Resource Ecology (IRE) (Germany); and others

    2014-08-01

    This study aims at elucidating the mechanisms regulating the interaction of Eu and Ni with calcite (CaCO{sub 3}). Calcite powders or single crystals (some mm sized) were put into contact with Eu or Ni solutions at concentrations ranging from 10{sup −3} to 10{sup −5} mol L{sup −1} for Eu and 10{sup −3} mol L{sup −1} for Ni. The sorption durations ranged from 1 week to 1 month. Rutherford Backscattering Spectrometry (RBS) well adapted to discriminate incorporation processes such as: (i) adsorption or co precipitation at the mineral surfaces or, (ii) incorporation into the mineral structure (through diffusion for instance), has been carried out. Moreover, using the fluorescence properties of europium, the results have been compared to those obtained by Time-Resolved Laser Fluorescence Spectroscopy (TRLFS) on calcite powders. For the single crystals, complementary SEM observations of the mineral surfaces at low voltage were also performed. Results showed that Ni accumulates at the calcite surface whereas Eu is also incorporated at a greater depth. Eu seems therefore to be incorporated into two different states in calcite: (i) heterogeneous surface accumulation and (ii) incorporation at depth greater than 160 nm after 1 month of sorption. Ni was found to accumulate at the surface of calcite without incorporation.

  5. Fluorimetric study of the interaction between nicotinamide adenine dinucleotide phosphate and tetracycline-europium complex and its application

    International Nuclear Information System (INIS)

    Peng Qian; Hou Faju; Ge Xiaoxia; Jiang Chongqiu; Gong Shubo

    2005-01-01

    A new spectrofluorimetric method was developed for the determination of trace amount of nicotinamide adenine dinucleotide phosphate (NADP). Using europium (Eu 3+ )-tetracycline (TC) complex as a fluorescent probe, in the buffer solution of pH 7.60. NADP can remarkably enhance the fluorescence intensity of the Eu 3+ -TC complex at λ = 612 nm and the enhanced fluorescence intensity of Eu 3+ ion is in proportion to the concentration of NADP. Optimum conditions for the determination of NADP were also investigated. The dynamic range for the determination of NADP is 4.4 x 10 -7 to 2.2 x 10 -6 mol l -1 with detection limit of 6.9 x 10 -8 mol l -1 . This method is simple, practical and relatively free interference from coexisting substances and can be successfully applied to determination of NADP in synthetic water samples and in serum samples. Moreover, the enhancement mechanisms of the fluorescence intensity in the Eu 3+ -TC system and the Eu 3+ -TC-NADP system have been also discussed

  6. Sparkle/PM3 for the modeling of europium(III), gadolinium(III), and terbium(III) complexes

    International Nuclear Information System (INIS)

    Freire, Ricardo O.; Rocha, Gerd B.; Simas, Alfredo M.

    2009-01-01

    The Sparkle/PM3 model is extended to europium(III), gadolinium(III), and terbium(III) complexes. The validation procedure was carried out using only high quality crystallographic structures, for a total of ninety-six Eu(III) complexes, seventy Gd(III) complexes, and forty-two Tb(III) complexes. The Sparkle/PM3 unsigned mean error, for all interatomic distances between the trivalent lanthanide ion and the ligand atoms of the first sphere of coordination, is: 0.080 A for Eu(III); 0.063 A for Gd(III); and 0.070 A for Tb(III). These figures are similar to the Sparkle/AM1 ones of 0.082 A, 0.061 A, and 0.068 A respectively, indicating they are all comparable parameterizations. Moreover, their accuracy is similar to what can be obtained by present-day ab initio effective core potential full geometry optimization calculations on such lanthanide complexes. Finally, we report a preliminary attempt to show that Sparkle/PM3 geometry predictions are reliable. For one of the Eu(III) complexes, BAFZEO, we created hundreds of different input geometries by randomly varying the distances and angles of the ligands to the central Eu(III) ion, which were all subsequently fully optimized. A significant trend was unveiled, indicating that more accurate local minima geometries cluster at lower total energies, thus reinforcing the validity of sparkle model calculations. (author)

  7. Photovoltaic Performance Enhancement of Silicon Solar Cells Based on Combined Ratios of Three Species of Europium-Doped Phosphors

    Directory of Open Access Journals (Sweden)

    Wen-Jeng Ho

    2018-05-01

    Full Text Available This paper presents a scheme for the enhancement of silicon solar cells in terms of luminescent emission band and photovoltaic performance. The proposed devices are coated with an luminescent down-shifting (LDS layer comprising three species of europium (Eu-doped phosphors mixed within a silicate film (SiO2 using a spin-on film deposition. The three species of phosphor were mixed at ratios of 0.5:1:1.5, 1:1:1, or 1.5:1:0.5 in weight percentage (wt %. The total quantity of Eu-doped phosphors in the silicate solution was fixed at 3 wt %. The emission wavelengths of the Eu-doped phosphors were as follows: 518 nm (specie-A, 551 nm (specie-B, and 609 nm (specie-C. We examined the extended luminescent emission bands via photoluminescence measurements at room temperature. Closely matching the luminescent emission band to the high responsivity band of the silicon semiconductor resulted in good photovoltaic performance. Impressive improvements in efficiency were observed in all three samples: 0.5:1:1.5 (20.43%, 1:1:1 (19.67%, 1.5:1:0.5 (16.81%, compared to the control with a layer of pure SiO2 (13.80%.

  8. Quantum dot based on tin/titanium mixed oxide doped with europium synthesized by protein sol-gel method

    International Nuclear Information System (INIS)

    Paganini, Paula P.; Felinto, Maria Claudia F.C.; Brito, Hermi F.

    2011-01-01

    Special luminescence biomarkers have been developed to find more sensitive fluoroimmunoassay methods. A new generation of these biomarkers is the semiconductors nanocrystals, known as quantum dots, doped with lanthanides. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. The protein sol-gel is a modification of conventional method, in which the coconut water replacing the alkoxides normally used. The advantage is that, the proteins present in coconut water bind chemically with metal salts forming a polymer chain. This work presents nanoparticles based on tin/titanium mixed oxide doped with 3% of europium synthesized by protein sol-gel method. The nanoparticles were burned at 300 deg C, 500 deg C, 800 deg C and 1100 deg C. The samples were analyzed and characterized by thermal analysis, X-ray powder diffraction (XRD), infrared spectroscopy (IR) and scanning electron microscopy (SEM). The synthesis was effective and the nanoparticles showed nanometric size and structural differences with the annealing. To be used in the fluoroimmunoassays tests, these particles need to be functionalized before be connect with biological molecules and after this process, these nanoparticles going to be submitted at gamma radiation for sterilization. (author)

  9. Quantum dot based on tin/titanium mixed oxide doped with europium synthesized by protein sol-gel method

    Energy Technology Data Exchange (ETDEWEB)

    Paganini, Paula P.; Felinto, Maria Claudia F.C., E-mail: paulapaganini@usp.b, E-mail: mfelinto@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Brito, Hermi F., E-mail: hefbrito@iq.usp.b [Universidade de Sao Paulo (IQ/USP), Sao Paulo, SP (Brazil). Inst. de Quimica. Lab. de Elementos do Bloco f

    2011-07-01

    Special luminescence biomarkers have been developed to find more sensitive fluoroimmunoassay methods. A new generation of these biomarkers is the semiconductors nanocrystals, known as quantum dots, doped with lanthanides. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. The protein sol-gel is a modification of conventional method, in which the coconut water replacing the alkoxides normally used. The advantage is that, the proteins present in coconut water bind chemically with metal salts forming a polymer chain. This work presents nanoparticles based on tin/titanium mixed oxide doped with 3% of europium synthesized by protein sol-gel method. The nanoparticles were burned at 300 deg C, 500 deg C, 800 deg C and 1100 deg C. The samples were analyzed and characterized by thermal analysis, X-ray powder diffraction (XRD), infrared spectroscopy (IR) and scanning electron microscopy (SEM). The synthesis was effective and the nanoparticles showed nanometric size and structural differences with the annealing. To be used in the fluoroimmunoassays tests, these particles need to be functionalized before be connect with biological molecules and after this process, these nanoparticles going to be submitted at gamma radiation for sterilization. (author)

  10. Photovoltaic Performance Enhancement of Silicon Solar Cells Based on Combined Ratios of Three Species of Europium-Doped Phosphors.

    Science.gov (United States)

    Ho, Wen-Jeng; You, Bang-Jin; Liu, Jheng-Jie; Bai, Wen-Bin; Syu, Hong-Jhang; Lin, Ching-Fuh

    2018-05-18

    This paper presents a scheme for the enhancement of silicon solar cells in terms of luminescent emission band and photovoltaic performance. The proposed devices are coated with an luminescent down-shifting (LDS) layer comprising three species of europium (Eu)-doped phosphors mixed within a silicate film (SiO₂) using a spin-on film deposition. The three species of phosphor were mixed at ratios of 0.5:1:1.5, 1:1:1, or 1.5:1:0.5 in weight percentage (wt %). The total quantity of Eu-doped phosphors in the silicate solution was fixed at 3 wt %. The emission wavelengths of the Eu-doped phosphors were as follows: 518 nm (specie-A), 551 nm (specie-B), and 609 nm (specie-C). We examined the extended luminescent emission bands via photoluminescence measurements at room temperature. Closely matching the luminescent emission band to the high responsivity band of the silicon semiconductor resulted in good photovoltaic performance. Impressive improvements in efficiency were observed in all three samples: 0.5:1:1.5 (20.43%), 1:1:1 (19.67%), 1.5:1:0.5 (16.81%), compared to the control with a layer of pure SiO₂ (13.80%).

  11. Photo/electroluminescence properties of an europium (III) complex doped in 4,4'-N,N'-dicarbazole-biphenyl matrix

    International Nuclear Information System (INIS)

    Zhou Yonghui; Zhou Liang; Wu, Jing; Li, Hong-Yan; Zheng Youxuan; You Xiaozeng; Zhang Hongjie

    2010-01-01

    The photoluminescence properties of one europium complex Eu(TFNB) 3 Phen (TFNB = 4,4,4-trifluoro-1-(naphthyl)-1,3-butanedione, Phen = 1,10-phenanthroline) doped in a hole-transporting material CBP (4,4'-N,N'-dicarbazole-biphenyl) films were studied. A series of organic light-emitting devices (OLEDs) using Eu(TFNB) 3 Phen as the emitter were fabricated with a multilayer structure of indium tin oxide, 250 Ω/square)/TPD (N,N'-diphenyl-N,N'-bis(3-methyllphenyl)-(1,1'-biphenyl)-4,4'-diamine, 50 nm)/Eu(TFNB) 3 phen (x): CBP (4,4'-N,N'-dicarbazole-biphenyl, 45 nm)/BCP (2,9-dimethyl-4,7-diphenyl-l,10 phenanthroline, 20 nm)/AlQ (tris(8-hydroxy-quinoline) aluminium, 30 nm)/LiF (1 nm)/Al (100 nm), where x is the weight percentage of Eu(TFNB) 3 phen doped in the CBP matrix (1-6%). A red emission at 612 nm with a half bandwidth of 3 nm, characteristic of Eu(III) ion, was observed with all devices. The device with a 3% dopant concentration shows the maximum luminance up to 1169 cd/m 2 (18 V) and the device with a 5% dopant concentration exhibits a current efficiency of 4.46 cd/A and power efficiency of 2.03 lm/W. The mechanism of the electroluminescence was also discussed.

  12. [Overexpressed miRNA-134b inhibits proliferation and invasion of CD133+ U87 glioma stem cells].

    Science.gov (United States)

    Liu, Yifeng; Zhang, Baochao; Wen, Changming; Wen, Gongling; Zhou, Guoping; Zhang, Jingwei; He, Haifa; Wang, Ning; Li, Wei

    2017-05-01

    Objective To investigate the role of microRNA-134b (miR-134b) in the tumorigenesis of glioma stem cells (GSCs) and the possible molecular mechanism. Methods Real-time quantitative PCR (qRT-PCR) was used to evalate the expression of miR-134b in CD133 + and CD133 - U87 GSCs. A lentiviral vector overexpressing miR-134b in U87 GSCs was constructed, and the effect of miR-134b overexpression on matrix metalloproteinase-2 (MMP-2), MMP-9 and MMP-12 expressions at both mRNA and protein levels were detected by qRT-PCR and Western blotting, respectively. Transwell TM assay was performed to determine the effect of miR-134b overexpression on GSCs invasion ability. Tumor xenograft models in nude mice were established to evaluate the effect of miR-134b overexpression on tumorgenesis in vivo. Results The qRT-PCR showed that, compared with CD133 - cells, miR-134b was significantly down-regulated in CD133 + cells. Cell line over-expressing miR-134b was successfully established, and miR-134b was up-regulated significantly compared with empty vector control. Overexpression of miR-134b remarkably inhibited the invasion of U87 GSCs and the expression of MMP-12. However, overexpression of miR-134b did not affect MMP-2 and MMP-9 expressions. miR-134b also suppressed U87 GSCs xenograft growth in vivo. Tumor volume in tumor xenograft model group was significantly lower than that in control group, and tumor weight decreased by 42% in the former group. Conclusion Overexpression of miR-134b inhibits the growth and invasion of CD133 + GSCs.

  13. Resolution of the uncertainties in the radiative forcing of HFC-134a

    International Nuclear Information System (INIS)

    Forster, Piers M. de F; Burkholder, J.B.; Clerbaux, C.; Coheur, P.F.; Dutta, M.; Gohar, L.K.; Hurley, M.D.; Myhre, G.; Portmann, R.W.; Shine, K.P.; Wallington, T.J.; Wuebbles, D.

    2005-01-01

    HFC-134a (CF 3 CH 2 F) is the most rapidly growing hydrofluorocarbon in terms of atmospheric abundance. It is currently used in a large number of household refrigerators and air-conditioning systems and its concentration in the atmosphere is forecast to increase substantially over the next 50-100 years. Previous estimates of its radiative forcing per unit concentration have differed significantly ∼25%. This paper uses a two-step approach to resolve this discrepancy. In the first step six independent absorption cross section datasets are analysed. We find that, for the integrated cross section in the spectral bands that contribute most to the radiative forcing, the differences between the various datasets are typically smaller than 5% and that the dependence on pressure and temperature is not significant. A 'recommended' HFC-134a infrared absorption spectrum was obtained based on the average band intensities of the strongest bands. In the second step, the 'recommended' HFC-134a spectrum was used in six different radiative transfer models to calculate the HFC-134a radiative forcing efficiency. The clear-sky instantaneous radiative forcing, using a single global and annual mean profile, differed by 8%, between the 6 models, and the latitudinally-resolved adjusted cloudy sky radiative forcing estimates differed by a similar amount. We calculate that the radiative forcing efficiency of HFC-134a is 0.16+/-0.02Wm -2 ppbv -1

  14. Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134.

    Science.gov (United States)

    Kaneko, Mika K; Yamada, Shinji; Itai, Shunsuke; Chang, Yao-Wen; Nakamura, Takuro; Yanaka, Miyuki; Kato, Yukinari

    2018-07-01

    The epidermal growth factor receptor (EGFR) is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb), which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7%) to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA), flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375-394 amino acids of EGFR) neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377- RGDSFTHTPP -386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.

  15. Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134

    Directory of Open Access Journals (Sweden)

    Mika K. Kaneko

    2018-07-01

    Full Text Available The epidermal growth factor receptor (EGFR is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb, which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7% to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA, flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375–394 amino acids of EGFR neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377-RGDSFTHTPP−386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.

  16. Accumulation, distribution and excretion of 134Cs and 65Zn by the green mussels (Perna Viridis)

    International Nuclear Information System (INIS)

    Chen Shunhua; Zhong Chuangguang; Yan Yuanyi; Zhao Xiaokui; Peng Yefang; Shi Qiong

    1997-10-01

    Two important radionuclides 134 Cs and 65 Zn were applied to study the accumulation, distribution and excretion of radioactive nuclides in organs and tissues of green mussel Perna Viridis. the results showed that the uptake rate of 134 Cs by green mussels was very low and the concentration factor (CF) for 134 Cs in the byssus approximated to 1. This CF value was lower than that of other tissues and organs of mussels, but its excretion rate was much higher than that of soft tissues. It was also found that the byssus of mussels had a special ability to accumulate 65 Zn. Concentration factor (CF) for 65 Zn in the byssus could reach as high as 900, which was much higher than that of any other tissues. However, its excretion rate was lower than that of other tissues and organs. The uptake rate of 65 Zn by soft tissues was markedly higher than that of 134 Cs. The mussels could also highly concentrate the low level 65 Zn even if specific activity of 65 Zn was very low in the environmental seawater. Results of radioactive trace experiments showed that the absorption of 134 Cs and 65 Zn by Perna Viridis was selective

  17. R134a Flow Boiling Analysis with Modified Thermodynamic Property File of MARS Code

    Energy Technology Data Exchange (ETDEWEB)

    Son, Gyumin; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

    2016-10-15

    Previous study showed application of RELAP5 code to solar energy facility with molten salt (60% NaNO3 and 40% KNO3) as working fluid. Based on external experimental correlations, thermodynamic properties of molten salt were evaluated as a function of pressure and temperature and those equations were used to generate tpf. To validate external tpf, experimental values were compared with RELAP5 analysis. In nuclear field, utilization of other fluid is also important since many thermal-hydraulic experiments used various fluids such as FC-72, R123, and R134a. Theses refrigerants have been used to simulate the high pressure environment of nuclear power plants due to their low boiling point, and density ratio between vapor and liquid. Thus, this study aims for tpf generation of R134a and verification by analyzing real case. R134a is selected as a fluid to be implemented and analyzed because it is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. R134a property file were generated with fitted equation using temperature and pressure as variables, originated from external data source. For validation, flow boiling experiment case were made into simplified input. Analysis with tpfr134a showed that application of Gnielinksi correlation could enhance single phase flow accuracy. Large error of HTC from two phase analysis requires parameter study. Future work aims for more specified experimental case comparison and correlation enhancement for two phase analysis.

  18. Sulfur Bridged Multidentate Ligands Based on (Bipyridyl-(Bi-1,3,4-Thiadiazolyl Conjugates

    Directory of Open Access Journals (Sweden)

    M. Teresa Clasadonte

    2003-03-01

    Full Text Available The synthesis of a series of mixed (bipyridyl/(bi1,3,4-thiadiazolyl ligands, derived from the condensation of 2-mercapto-5-methylthio-1,3,4-thiadiazole or 5-mercapto-5'-methylthio-2,2'-bi-1,3,4-thiadiazole with 2,6-bis(chloromethylpyridine or 6,6’-bis(chloromethyl-2,2’-bipyridine (compounds L1–L4, and of 2,5-dimercapto-1,3,4-thiadiazole or 5,5'-dimercapto-2,2'-di-1,3,4-thiadiazole with picolyl chloride hydrochloride or 6-chloromethyl-6'-methyl-2,2'-bipyridine (compounds L5–L8 in the presence of triethylamine is described. All new compounds have been characterized by FAB (+ spectrometry and NMR spectroscopy. 13C-NMR spectra are crucial to firmly establish the thiol structure of the title ligands.

  19. Synthesis of novel 2,5-disubstituted-1,3,4-selenadiazoles from fatty acid hydrazides

    Directory of Open Access Journals (Sweden)

    Himani Varshney

    2018-01-01

    Full Text Available A series of novel unsaturated hydroxy and non-hydroxy fatty acid residue substituted 1,3,4-selenadiazoles were described here. These derivatives were synthesized from the reaction of fatty acid hydrazide 1(a–d with acetyl chloride in the presence of anhydrous sodium carbonate in tetrahydrofuran and water at 0 °C, to form N′-acetyl undec-10-enoic hydrazide 2a, N′-acetyl-(9Z-octadec-9-enoic hydrazide 2b, N′-acetyl-(9Z, 12R-12-hydroxy-9-enoic hydrazide 2c, and N′-acetyl-(9R, 12Z-9-hydroxy-12-enoic hydrazide 2d. Then these hydrazines (dicarbonyl compound on reaction with Woollin’s reagent (WR in toluene led to the corresponding 2-(dec-9′-enyl-5-methyl-1,3,4-selenadiazole 3a, 2-[(8′Z-heptadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3b, 2-[(8′Z, 11′R-11′-hydroxy-octadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3c, and 2-[(8′R, 11′Z-8′-hydroxy-octadec-11′-enyl]-5-methyl-1,3,4-selenadiazole 3d, respectively. These synthesized compounds were characterized on the basis of IR, 1H NMR, 13C NMR, mass spectra and elemental analysis results.

  20. Uptake of radiocesium by three plants grown in 134Cs contaminated soil under pot experiment condition

    International Nuclear Information System (INIS)

    Zheng Jiemin; Li Hongyan; Niu Tianxin; Chen Ziyuan; Tang Shirong

    2009-01-01

    Pot experiment was conducted to investigate the accumulation dynamics of 134 Cs in shoots of Rumex acetosa, Rumex hastatus and Helianthus annuus grown in 134 Cs contaminated soil under greenhouse condition. Results showed that shoot biomass of H. annuus was significantly higher than that of R. acetosa and R. hastatus; among 3 plant species, 13 '4Cs specific activity in shoots was the highest in H. annuus after treatment for 50 days, however after treatment for 70 days, that in R. acetosa was the highest. Bioaccumulation ratio reached 1.5, 1.4 and 1.3 in R. acetosa, R. hastatus and H. annuus at the end of experiment, respectively, and the former two plants kept with trend of continuously increasing during the experiment period. Three plants were tolerant to 134 Cs contaminated slil and capable to translocate 134 Cs from soil to plants. Among them, H. annuus removed greatest 134 Cs amount in the above ground part, and R. acetosa, R. hastatus showed higher tranclocation factor of Cs than H. annuus. Three plants are promising for phytoremediation of soil contaminated with radiocesium, and also could be used for phytoremediation of radiocesium and heavy metals complex contamination, potentially. (authors)

  1. Antagomirs Targeting MicroRNA-134 Increase Limk1 Levels After Experimental Seizures in Vitro and in Vivo

    Directory of Open Access Journals (Sweden)

    Jiahang Sun

    2017-09-01

    Full Text Available Background: MiR-134 is enriched in dendrites of hippocampal neurons and plays crucial roles in the progress of epilepsy. The present study aims to investigate the effects of antagomirs targeting miroRNA-134 (Ant-134 on limk1 expression and the binding of miR-134 and limk1 in experimental seizure. Methods: Status epilepticus (SE rat model was established by lithium chloride-pilocarpine injection and was treated with Ant-134 by intracerebroventricular injection. Low Mg2+-exposed primary neurons were used as an in vitro model of SE. The expression of miR-134 was determined using real-time PCR. Protein expressions of limk1 and cofilin were determined by Western blotting. Luciferase reporter assay was used to examine the binding between miR-134 and limk1 3’-untranslated region. Results: The expression of miR-134 was markedly enhanced in hippocampus of the SE rats and low Mg2+-exposed neurons. Ant-134 increased the expression of limk1 and reduced the expression of cofilin in the SE hippocampus and Low Mg2+-exposed neurons. In addition, luciferase reporter assay confirmed that miR-134 bound limk1 3’-UTR. MiR-134 overexpression inhibited limk1 mRNA and protein expressions in neurons. Conclusion: Blockage of miR-134 upregulates limk1 expression and downregulated cofilin expression in hippocampus of the SE rats. This mechanism may contribute to the neuroprotective effects of Ant-134.

  2. Study of the influence of humic acids (in solution or bound to a silica gel) on the migration of europium in a porous medium. Comparison with inorganic colloids

    International Nuclear Information System (INIS)

    Fleury, Ch.

    1998-01-01

    After having been reprocessed, radioactive wastes are stored in conditions which depend on the toxicity of the radioelements. In particular, for the actinides, the packaging has to be sure for several thousands years. In the case of a defective storage, phenomena which favour or diminish the migration of radioelements in the environment have to be identified. In water, organic or inorganic colloids able to bind radioelements can migrate. Among these colloids, are found the humic acids (HA), macromolecules (poly-electrolytes and poly-dispersed) known for their affinity towards some radioelements. These HA are either present on a soluble state or bound to mineral supports. Humic acids have then been studied in these two states and their influence on the europium migration in dynamical system have been observed (ion exchange and affinity chromatography). When HA are bound by covalent bonds to silica gel, they strongly retain the radioelement, whatever be the conditions of pH, flow rate or ionic strength, and either if phosphate ions are present. The study of HA in solution has shown that, on the one hand the formation of a Eu-HA complex alters the adsorption of the radioelement on sand and that the influence of the humic acids on the europium retention is superior to those of the inorganic colloids (silicon oxide, bentonite). On the other hand, the study has revealed that a solution containing HA desorbs almost entirely the europium beforehand bound to the sand. This desorption depends on the pH and on the flow rate but not on the presence of competitive ions as for instance phosphate ions. (O.M.)

  3. Isotopic exchange between 232Th and 234Th using ion exchange resins and its application for the radiochemical separation of thorium and europium

    International Nuclear Information System (INIS)

    Sepulveda Munita, C.J.A.; Atalla, L.T.

    1980-01-01

    The determination of thorium via the measurement of 233 Th activity (obtained by irradiating natural thorium with neutrons) may suffer the interference of various radioisotopes which may be also formed during irradiation, if their parent isotopes are present in the sample. Taking into account this possibility, another technique was chosen for the determination of thorium, based on isotopic exchange associated with ionic exchange. Conditions for the isotopic exchange between 234 Th in solution and 232 Th in the resin were optimized. It was verified that the behaviour of 233 Th and 234 Th is the same regarding isotopic exchange with 232 Th. 234 Th was chosen for the experiments since it has a longer half-life (24.1 days) than 233 Th (22.3 min), thus facilitating the performance of the work. As the major objective of this work is to separate thorium and europium isotopes, the behaviour of 152-154 Eu was studied in the same system used for thorium, envisaging a minimum retention of these radioisotopes in the resin. In order to establish the best conditions for separating 234-Th and 152/154-Eu, the following parameters were considered: the thorium concentration in the solution; the hydrochloric acid concentration in solution; the concentration of other elements in solution; the degree of cross-linking of the resin; the flow rate of the solution through the column. The other elements added to the elutant solution were: uranium, molybdenum, lanthanum, europium, ytterbium, bromine, cobalt, barium, manganese, indium, cesium and selenium. Europium was added so to dilute the 152/154-Eu tracer and avoid the retention of the latter in the resin. The other elements were added because they give rise to radioisotopes which interfere in the activation analysis of thorium when 233-Th activity is used and, the separation of these elements from thorium will also be subsequently studied by the method used in the present work. (C.L.B.) [pt

  4. The europium and praseodymium hydrolysis in a 2M NaCl environment; La hidrolisis del europio y del praseodimio en un medio 2M de NaCl

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez R, M.; Lopez G, H.; Solache R, M.; Rojas H, A. [Instituto Nacional de Investigaciones Nucleares, Departamento de quimica, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    1998-07-01

    It was studied the europium and praseodymium hydrolysis in a 2M NaCl ion force environment at 303 K, through two methods: this one extraction with dissolvents (lanthanide-water-NaCl-dibenzoylmethane) in presence of a competitive ligand (diglycolic acid) and that one direct potentiometric titration, of soluble species, followed by a computer refining. The values of one or another techniques of the first hydrolysis constants obtained were similar, which demonstrates that the results are reliable. The set of data obtained on the stability constants of hydrolysis products allowed to draw up the distribution diagrams of chemical species, as europium as praseodymium in aqueous environment. (Author)

  5. Heat transfer performance during condensation of R-134a inside helicoidal tubes

    International Nuclear Information System (INIS)

    Al-Hajeri, M.H.; Koluib, A.M.; Mosaad, M.; Al-Kulaib, S.

    2007-01-01

    This paper reports an experimental investigation of condensation heat transfer and pressure drop of an ozone friendly refrigerant, R-134a, inside a helical tube for climatic conditioning of hot regions. This study concerns the condensation of R-134a flowing through annular helical tubes with different operating refrigerant saturated temperatures. The average pressure drop is measured and compared with data from relevant literature. The measurements of R-134a were performed on mass flow flux ranges from 50 to 680 kg/m 2 s. The study provides experimental data that could be used for the design and development of more efficient condensers for refrigeration and air conditioning (A/C) systems working with the same refrigerant

  6. Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

    Energy Technology Data Exchange (ETDEWEB)

    Ballestra, S; Gastaud, J; Lopez, J J; Parsi, P; Vas, D

    1993-08-01

    The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for {sup 40}K, {sup 60}Co, {sup 137}Cs, and 2{sup 39+240}Pu (Reference date: 1 January 1992). Information values for {sup 90}Sr, {sup 106}Ru, {sup 125}Sb, {sup 134}Cs, {sup 154}Eu, {sup 155}Eu, {sup 210}Pb, {sup 210}Po, {sup 226}Ra, {sup 228}Ra, {sup 228}Th, {sup 230}Th, {sup 232}Th, {sup 234}U, {sup 235}U, {sup 238}U, {sup 238}Pu and {sup 241}Am are also reported. All the following values are expressed in Bq kg{sup -1} (dry weight). (author)

  7. Adsorption of *sp134*Cs onto two different types of roof materials

    International Nuclear Information System (INIS)

    Quenild, C.; Tveten, U.

    1983-01-01

    The report relates to a subproject under a Nordic project called ''Large reactor accidents - consequences and mitigating actions''. Natural decontamination of two types of roof material, typical of Norwegian and Swedish buildings, was examined. The roofs were contaminated with *sp134*Cs. After two days with 7 mm precipitation, the remaining activity on the tar-paper roof was 97% and on the steel roof 29%. After 8 months the remaining activity was 61% on the tar-paper roof and 22% on the steel roof. In spring *sp134*Cs was spread upon an 8 cm thick layer of fresh snow on an additional tar-paper roof. After 3 montsh and 191 mm precipitation the remaining activity was 59%. All results are based upon *sp134*Cs in collected run-off water.(Auth.)

  8. Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

    International Nuclear Information System (INIS)

    Ballestra, S.; Gastaud, J.; Lopez, J.J.; Parsi, P.; Vas, D.

    1993-08-01

    The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for 40 K, 60 Co, 137 Cs, and 2 39+240 Pu (Reference date: 1 January 1992). Information values for 90 Sr, 106 Ru, 125 Sb, 134 Cs, 154 Eu, 155 Eu, 210 Pb, 210 Po, 226 Ra, 228 Ra, 228 Th, 230 Th, 232 Th, 234 U, 235 U, 238 U, 238 Pu and 241 Am are also reported. All the following values are expressed in Bq kg -1 (dry weight). (author)

  9. Europium-activated phosphors containing oxides of rare-earth and group-IIIB metals and method of making the same

    Science.gov (United States)

    Comanzo, Holly Ann; Setlur, Anant Achyut; Srivastava, Alok Mani; Manivannan, Venkatesan

    2004-07-13

    Europium-activated phosphors comprise oxides of at least a rare-earth metal selected from the group consisting of gadolinium, yttrium, lanthanum, and combinations thereof and at least a Group-IIIB metal selected from the group consisting of aluminum, gallium, indium, and combinations thereof. A method for making such phosphors comprises adding at least a halide of at least one of the selected Group-IIIB metals in a starting mixture. The method further comprises firing the starting mixture in an oxygen-containing atmosphere. The phosphors produced by such a method exhibit improved absorption in the UV wavelength range and improved quantum efficiency.

  10. Concentration of 134Cs and 137Cs in Malaysian palm products

    International Nuclear Information System (INIS)

    Yii Mei Wo; Nor Aza Hassan; Narizan Sanusi

    2008-08-01

    Until today, countries importing food products from Malaysia, in region such as Indian Continental, Middle East, Central Europe and Central America still require the products to be tested for the radioactive contamination particularly for 134 Cs and 137 Cs. Information extracted from 3371 analytical results observed on isotopic concentration for 134 Cs and 137 Cs in the exported Malaysia origins palm products between years 2002 until 2007 had been summarized and reported in this work. Data shown that the concentration level of the concerned radio nuclides are below the minimum detectable activity and also well below maximum permissible limits adopted by Malaysian Government and also the international bodies. (Author)

  11. Uptake and loss of Cesium - 134 by the snail Biomphalaria glabrata (Say, 1818)

    International Nuclear Information System (INIS)

    Kikuchi, O.K.; Mastro, N.L. del.

    1988-07-01

    The uptake and loss of Cs-134 produced in IEA-R1 reactor of IPEN was observed in fresh water adult snails. Two activites were employed: 3.700 and 18.500 Bq/1. A monochannel analyses was used for radiactivity couting and the number of egg-laying and embryo were registered. Maximum uptake occured approximately at 8 th day and the biological half-life was about 6 days. Although the egg-laying and embryo number were diminished with Cs-134 presence, it is not possible to affirm that result due to the small number of animals used. (author) [pt

  12. Measurements of europium-152 depth profile of stone embankments exposed the Nagasaki atomic bomb for neutron spectrum analysis

    International Nuclear Information System (INIS)

    Tatsumi-Miyajima, Junko; Shimasaki, Tatsuya; Okajima, Shunzo; Takada, Jitsuya; Yoshida, Masahiro; Takao, Hideaki; Okumura, Yutaka; Nakazawa, Masaharu.

    1990-01-01

    Quantitative measurement of neutron-induced radionuclide of 152 Eu in rocks near the hypocenter (ground center of the atomic bomb explosion) in Nagasaki was performed to obtain the depth profiles and calculate the neutron energy spectrum. Core samples were drilled and taken from the stone embankments on both sides of river within a radius of 500 m from the hypocenter. After cutting each core into about 27 mm-thick sections, each section was measured its gamma-ray spectrum with a pure germanium semiconductor detector and analyzed a content of natural europium by the activation method. The highest value 8.0 x 10 -2 Bq/μg of 152 Eu at the time of the blast was obtained from the surface plates of rock cores collected near the hypocenter. The surface activity of cores was reduced with increasing the slant distances from the hypocenter. The slopes of the depth profiles were similar among samples taken from the same location. In order to analyze the depth profile of 152 Eu activity in rock andesite, experiments using a fast neutron reactor and thermal neutron reactor were carried out. Comparing the measurements on the A-bomb exposure rock with the simulated results at the reactors, among the experiments, the depth profile using the neutron moderator of 10 mm polyethylene was closed to that obtained from the A-bomb exposed samples. The experiment of thermal neutron incidence only could not reproduce the profiles from the A-bomb exposed samples. This fact indicates that the depth profiles of 152 Eu in rock exposed to the A-bomb include valuable information concerning the neutron spectrum and intensity. (author)

  13. Distribution of Europium between poly-maleic acid in solution or adsorbed onto alumina and Bacillus subtilis

    International Nuclear Information System (INIS)

    Markai, S.

    2002-07-01

    In order to understand the interactions of radionuclides under natural water conditions, the interactions were studied in a quaternary system composed of well characterized reference substances: europium as a heavy metal, poly-maleic acid (PMA) as model of humic substances, alumina as mineral phase and Bacillus subtilis representing biomass. The work was performed at pH=5 in 0,1 mol/L of NaClO 4 . The fundamental question addressed was to know if parameters deduced from the quantitative study of the reference systems Eu/PMA, Eu/PMA-Al 2 O 3 and Eu/Bacillus subtilis, could be used to quantify the distribution of Eu in the multi-substrate systems Eu/PMA/Bacillus subtilis and Eu/PMA-Al 2 O 3 /Bacillus subtilis. The experimental interaction data were described by a Langmuir-type model or by a surface complexation model, with surface speciation assessment by time resolved laser induced fluorescence spectroscopy. The study of the Eu/PMA system showed similarities with the Eu/ humic substances system as far as interaction strength and the nature of Eu environment were concerned. When PMA was adsorbed onto Al 2 O 3 , its complexation properties towards Eu were different. For high concentrations of Eu, a ternary complex was formed in which Eu was bound to a carboxylic function of PMA and to an aluminol function of Al 2 O 3 . For the Eu/B.subtilis system, Eu was bound to a carboxylic function and to a phosphate function. For the PMA/Eu/bacteria system, the reference systems were reversible and the parameters deduced from sub-systems allowed to quantify the distribution of Eu in the global system. In the PMA A l 2 O 3 /Eu/bacteria system, the equilibrium Eu/PMA-Al 2 O 3 was not reversible due to a diffusion of Eu in the adsorbed layer of PMA, reducing its bio-availability. (author)

  14. Raman, photoluminescence and EPR spectroscopic characterization of europium(III) oxide–lead dioxide–tellurite glassy network

    Energy Technology Data Exchange (ETDEWEB)

    Dehelean, A. [National Research and Development Institute for Isotopic and Molecular Technologies, Cluj-Napoca (Romania); Rada, S. [Technical University of Cluj-Napoca (Romania); Popa, A.; Suciu, R.C. [National Research and Development Institute for Isotopic and Molecular Technologies, Cluj-Napoca (Romania); Culea, E., E-mail: eugen.culea@phys.utcluj.ro [Technical University of Cluj-Napoca (Romania)

    2016-09-15

    Raman, photoluminescence and EPR spectroscopies were used to characterize some xEu{sub 2}O{sub 3}·(100−x)[4TeO{sub 2}·PbO{sub 2}] glasses with x=0–50 mol% obtained by melt quenching technique. Raman spectra of these glasses were interpreted in terms of vibration modes of deformed Te–O–Te linkages due to the intercalation of [PbO{sub n}] and [EuO{sub n}] entities produced by addition of Eu{sub 2}O{sub 3} to the host lead–tellurite glass. Photoluminescence spectra of xEu{sub 2}O{sub 3}·(100−x)[4TeO{sub 2}·PbO{sub 2}] glasses reveal the presence of Pb{sup 2+}, Eu{sup 2+} and Eu{sup 3+} ions. EPR data confirm the presence of Eu{sup 2+} ions in the europium–lead–tellurite glassy network and offer information about the compositional evolution of the Eu{sup 2+} ions local environment and Eu{sup 3+}↔Eu{sup 2+} redox process. PL and EPR data show that the decrease of the Eu{sup 2+} ions luminescence intensity for the x≥40 mol% Eu{sub 2}O{sub 3} region is not due to the clusterization of europium ions but is due the decrease of the amount of Eu{sup 2+} ions as result of changes in the Eu{sup 3+}→Eu{sup 2+} redox equilibrium.

  15. Migration of strontium, cesium, and europium from poly(butyl acrylate)/phosphate/composites prepared using gamma radiation

    Energy Technology Data Exchange (ETDEWEB)

    Alhassanieh, O., E-mail: cscientific@aec.org.s [Nuclear and Radiochemistry Division, Chemistry Department, Atomic Energy Commission of Syria, Damascus, P.O. Box 6091 (Syrian Arab Republic); Ajji, Z. [Polymer Technology Division, Radiation Technology Department, Atomic Energy Commission of Syria, Damascus, P.O. Box 6091 (Syrian Arab Republic); Alkourdi, H.; Haloum, D. [Nuclear and Radiochemistry Division, Chemistry Department, Atomic Energy Commission of Syria, Damascus, P.O. Box 6091 (Syrian Arab Republic)

    2011-02-15

    Composites based on natural phosphate powder and the monomer N-butyl acrylate have been prepared by means of gamma irradiation. The conversion of polymerization was followed up with respect to the irradiation dose using thermogravimetric analyzer (TGA). A total polymerization conversion was achieved by exposure of the samples to a dose of 10 kGy. A thermomechanical analyzer (TMA) was used to locate the region of the glass transition temperatures (T{sub g}) using the mode with alternative variable force; the mode with constant force was used to determine the T{sub g} of the pure polymer and the composite prepared at the same irradiation dose. The T{sub g} of the pure poly(butyl acrylate) is -51.41 {sup o}C, and the T{sub g} of poly(butyl acrylate)/phosphate/composites is -46.54 {sup o}C. The distribution of {sup 137}Cs, {sup 152}Eu, and {sup 85}Sr in a solid-aqueous system, a composite of phosphate-polybutyl acrylate in contact with groundwater, was investigated using {gamma}-spectrometry. The effect of contact time, pH, and the concentration of concurrent elements (Na, Ca, and La) were studied. The results were compared with earlier results with phosphate alone in the solid phase. The ability of the produced composites to keep the studied radioisotopes in the solid phase is much higher than mineral phosphate. This improvement is more remarkable by strontium and cesium than europium, due to its high element ratio in the solid phase in phosphate experiments.

  16. Photophysical studies of highly luminescent europium(III) and terbium(III) complexes functionalized with amino and mercapto groups

    Energy Technology Data Exchange (ETDEWEB)

    Souza, E.R.; Monteiro, J.H.S.K.; Mazali, I.O.; Sigoli, F.A., E-mail: fsigoli@iqm.unicam.br

    2016-02-15

    This work proposes the replacement of coordinated-water molecules from the precursor complexes [Ln(aba){sub 3}(H{sub 2}O)] and [Ln(tta){sub 3}(H{sub 2}O){sub 2}], (Ln=Eu{sup 3+}, Gd{sup 3+} or Tb{sup 3+}, aba{sup −}=aminobenzoate, tta{sup −}=thenoyltrifluoroacetonate) by the ligands mercaptobenzoate (mba{sup −}), mercaptopropionate (mpa{sup −}), phenanthroline (phen), dimethylformamide (dmf) and acetoacetanilide (aaa{sup −}), leading to anionic or neutral amino (–NH{sub 2}) or mercapto (–SH) functionalized-lantanides (III) complexes with reasonable emission quantum yields for potential application on fluorescence microscopy of biological moieties. The complexes photophysical properties were studied using luminescence spectroscopy and theoretical models to determine the transfer and back energy transfer rates and quantum yields, that were compared with experimental ones. The anionic complexes [Eu(tta){sub 3}(L)]{sup −} showed high quantum yield values and their sensitization efficiency are in the range of 39–81%. The overlay of the ground state geometries, obtained from the Sparkle/PM3 model, of the complexes [Eu(tta){sub 3}(aba)]{sup −}, [Eu(tta){sub 3}(mba)]{sup −} and [Eu(tta){sub 3}(mpa)]{sup −}, suggest similar coordination polyhedrons occupied by the europium(III). The highest transfer rates T→{sup 5}D{sub 1,0} were obtained for the anionic complexes [Eu(tta){sub 3}(L)]{sup −} which might be a result of the low triplet level energies and R{sub L} values. - Highlights: • Lanthanides functionalized-complexes. • Free mercapto and amino groups. • Covalence degree of Eu-ligands. • Energy transfer rates. • Intrinsic and absolute quantum yields and sensitization.

  17. Carbon footprint assessment of recycling technologies for rare earth elements: A case study of recycling yttrium and europium from phosphor.

    Science.gov (United States)

    Hu, Allen H; Kuo, Chien-Hung; Huang, Lance H; Su, Chao-Chin

    2017-02-01

    Rare earth elements are key raw materials in high-technology industries. Mining activities and manufacturing processes of such industries have caused considerable environmental impacts, such as soil erosion, vegetation destruction, and various forms of pollution. Sustaining the long-term supply of rare earth elements is difficult because of the global shortage of rare earth resources. The diminishing supply of rare earth elements has attracted considerable concern because many industrialized countries regarded such elements as important strategic resources for economic growth. This study aims to explore the carbon footprints of yttrium and europium recovery techniques from phosphor. Two extraction recovery methods, namely, acid extraction and solvent extraction, were selected for the analysis and comparison of carbon footprints. The two following functional units were used: (1) the same phosphor amounts for specific Y and Eu recovery concentrations, and (2) the same phosphor amounts for extraction. For acid extraction method, two acidic solutions (H 2 SO 4 and HCl) were used at two different temperatures (60 and 90°C). For solvent extraction method, acid leaching was performed followed by ionic liquid extraction. Carbon footprints from acid and solvent extraction methods were estimated to be 10.1 and 10.6kgCO 2 eq, respectively. Comparison of the carbon emissions of the two extraction methods shows that the solvent extraction method has significantly higher extraction efficiency, even though acid extraction method has a lower carbon footprint. These results may be used to develop strategies for life cycle management of rare earth resources to realize sustainable usage. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Study of the spectroscopy properties of uranium matrix doped with europium. Energy transfer between UO22+ and Eu3+

    International Nuclear Information System (INIS)

    Luiz, Jose Eduardo Monteiro de Sa

    2007-01-01

    Uranyl compounds (UO 2 2+ ) present a great potential as luminescent materials, for instance, applied in technology laser, luminescent probes, cells for conversion of energy, etc. In this work it is studied the efficiency of energy transfer in the compound Eu 3+ doped in UO 2 (MS) 2 .(H 2 O)n matrix and UO 2 2+ in Eu(MS) 3 (H 2 O)n for to be used as efficient Light Conversion Molecular Devices (LCMD) and/or in solar cells for energy conversion. It is also described the synthesis, characterization and spectroscopic study of the matrix Eu(MS) 3 .(H 2 O)n.(x%mol) UO 2 2+ and UO 2 (MS) 2 .(H 2 O)n.(x%mol) Eu 3+ (where x= 1, 3, 5 and 10). The compounds obtained was characterized by elementary analyses for determine the U 6+ concentration, infrared spectra, thermal analyses and luminescence spectra. The IR data suggest that the MS ligand acts as bidentate one. The emission spectra of Eu 3+ doped in UO 2 (MS) 2 .(H 2 O) 2 matrix showed characteristic fluorescence bands of the uranyl ion, attributed to the transition of 3 Π u -> 1 Σ g + of the uranium matrix. For the UO 2 2+ in Eu(MS) 3 (H 2 O) 6 the transitions of D o -> 7 F J (J=0 ->4 ) are predominant in the spectra. The intense europium luminescence associated with uranyl sensitising is registered in emission spectra of Eu 3+ ions in the range of 420-720 nm. The quenching rate constant of UO 2 2+ fluorescence with Eu 3+ is also determined. (author)

  19. Experimental studies on the biokinetics of Cs-134 and Cd-109 in the blood cockle (Anadara granosa)

    International Nuclear Information System (INIS)

    Norfaizal Mohamed; Nita Salina Abu Bakar; Zal Uyun Wan Mahmood; Nur Hidaya Dmuliany Mohd Sidek; Zaharudin Ahmad

    2010-01-01

    Bioaccumulation and depuration study under controlled laboratory conditions of Cs and Cd in Anadara granosa collected at coastal Kapar, Selangor was carried out using respective radiotracer, Cs-134 and Cd-109. The radioactivity of Cs-134 and Cd-109 were determined using high resolution hyper germanium detector. Our results demonstrate that Cd-109 was accumulated efficiently by this species, except Cs-134. The steady state concentration factor (CF) for accumulation of Cs-134 and Cd-109 from seawater was estimated to be about 5.86 and 51.31, respectively. For the depuration stage, loss kinetics of Cs-134 and Cd-109 was best described by 2-compartment exponential model. Results shown that A. granosa exposed to Cs-134 have a total loss of 69% in compared to 19 % of Cd-109. Results gained in this experiment are a baseline data to evaluate future released of radioactive material from nuclear power programme facilities within this region. (author)

  20. Amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole

    International Nuclear Information System (INIS)

    Saidov, D.K.; Rakhmonov, R.O.; Khodzhiboev, Yu.; Kukaniev, M.A.; Bandaev, S.

    2015-01-01

    Present article is devoted to amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole. The reaction of new modifications of derivatives of imidazo-[2.1-B]-1.3.4-thiadiazoles-2-bromine-6-p-bromophenyl and 2-alkyl alkylene sulfonyl-6-phenyl imidazo--[2.1-B]-1.3.4-thiadiazole on Mannich with secondary and heterocyclic amines was studied.

  1. Separation of 134Cs and 137Cs from 125I solution for medical applications

    International Nuclear Information System (INIS)

    Ram, Ramu; Dash, Ashutosh; Banerjee, Dayamoy

    2015-01-01

    While neutron irradiation of natural Xe gas followed by wet chemical dissolution of activation products constitutes a successful paradigm for the small scale production 125 I, the concomitant production of 134 Cs and 137 Cs emerged as the primary impediment which necessitates purification of 125 I solution. This paper describes an ion-exchange chromatographic technique using Resorcinol Formaldehyde (RF) resin to purify 125 I solution from 134 Cs and 137 Cs impurities. A thorough investigation of the adsorption parameters of RF resin was carried out to arrive at the experimental conditions resulting optimum retention of 134 Cs and 137 Cs impurities. Based on the experimental findings, an optimized separation procedure was developed in which the neutron irradiated dissolved products at pH ∝ 13 was passed through a chromatography column containing RF resin where in 134 Cs and 137 Cs impurities gets adsorbed leaving behind 125 I to appear in the effluent. The overall recovery of 125 I was >90% with acceptable purity amenable for clinical applications.

  2. 17 CFR 1.34 - Monthly record, “point balance”.

    Science.gov (United States)

    2010-04-01

    ... REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Recordkeeping § 1.34 Monthly record, “point balance”. (a) Each... statement commonly known as a “point balance,” which accrues or brings to the official closing price, or... contracts long and short in the customers' accounts are in balance with those in the carrying futures...

  3. 27 CFR 478.134 - Sale of firearms to law enforcement officers.

    Science.gov (United States)

    2010-04-01

    ... AMMUNITION Records § 478.134 Sale of firearms to law enforcement officers. (a) Law enforcement officers... complete Form 4473 or Form 5300.35. The law enforcement officer purchasing the firearm may purchase a...) In Federal law enforcement offices, the supervisor in charge of the office to which the Federal...

  4. Bent Shaped 1,3,4-Oxadiazole/Thiadiazole heterocyclic rings ...

    Indian Academy of Sciences (India)

    Two series of bent shaped 1,3,4-oxadiazole/thiadiazole heterocyclic ring containing liquid crystalline (LC) compounds were synthesized and characterized by FT-IR, 1H, 13C-NMR and ESI-Mass spectro-scopic techniques. Liquid crystal properties were investigated by polarized optical microscopy and differential scanning ...

  5. 19 CFR 134.47 - Souvenirs and articles marked with trademarks or trade names.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Souvenirs and articles marked with trademarks or... Imported Articles § 134.47 Souvenirs and articles marked with trademarks or trade names. When as part of a trademark or trade name or as part of a souvenir marking, the name of a location in the United States or...

  6. The epigraphic tradition at Labraunda seen in the light of Labraunda inscription no. 134

    DEFF Research Database (Denmark)

    Isager, Signe

    2008-01-01

    An important new inscription was discovered in the sanctuary of Zeus Labraundos in 2002. The inscription belongs to the so-called Olympichos file, and together with I. Labraunda no. 49 it is now numbered I. Labraunda no. 134. The inscription has just been published by Lars Karlsson and Signe Isager...

  7. 28 CFR 13.4 - Procedures: Responsibilities of the Attorney General.

    Science.gov (United States)

    2010-07-01

    ... SPECIAL NUCLEAR MATERIALS REWARDS REGULATIONS § 13.4 Procedures: Responsibilities of the Attorney General... Special Nuclear Materials Rewards Act, the Attorney General shall: (a) Refer such submission for review to... whether that alien and members of his immediate family may receive immigrant visas and be admitted to the...

  8. 20 CFR 220.134 - Medical-vocational guidelines in appendix 2 of this part.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Medical-vocational guidelines in appendix 2... THE RAILROAD RETIREMENT ACT DETERMINING DISABILITY Vocational Considerations § 220.134 Medical-vocational guidelines in appendix 2 of this part. (a) The Dictionary of Occupational Titles includes...

  9. 7 CFR 947.134 - Establishment of list of manufacturers of potato products.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Establishment of list of manufacturers of potato... AGRICULTURE IRISH POTATOES GROWN IN MODOC AND SISKIYOU COUNTIES, CALIF., AND IN ALL COUNTIES IN OREGON, EXCEPT MALHEUR COUNTY Rules and Regulations Safeguards § 947.134 Establishment of list of manufacturers of potato...

  10. 34 CFR 668.134 - Institutional policies and procedures for requesting documentation and receiving secondary...

    Science.gov (United States)

    2010-07-01

    ... STUDENT ASSISTANCE GENERAL PROVISIONS Immigration-Status Confirmation § 668.134 Institutional policies and... immigration status of applicants for title IV, HEA student financial assistance who claim to meet the... eligible noncitizen until the institution has provided the student the opportunity to submit the...

  11. 12 CFR 204.134 - Linked time deposits and transaction accounts.

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) Interpretations § 204.134...) establishes general reserve requirements on transaction accounts and nonpersonal time deposits. Under section... other than to allow the payment of higher interest through the avoidance of reserve requirements. As the...

  12. Neutron Inelastic Scattering on 134Xe at En = 5 - 8 MeV

    Science.gov (United States)

    Kidd, Mary; Tornow, Werner; Finch, Sean; Krishichayan, Fnu; Bhike, Megha

    2017-09-01

    Neutrinoless double-beta decay (0 νββ) studies are both the best way to determine the Majorana nature of the neutrino and determine its effective mass. The two main experiments searching for 0 νββ -decay of 136Xe (Q value = 2457.8 keV) are Kamland-Zen and EXO-200. Though both experiments have enriched 136Xe targets, these targets still contain significant quantities of 134Xe. Recently, a new nuclear level was discovered in 134Xe that decays to the ground state emitting a 2485.7 keV gamma ray. The γ-ray production cross section for this branch was found to be on the order of 10 mb for incident neutron energies of 2.5-4.5 MeV. Here, we have extended the investigation of this level to higher incident neutron energies, and further explore the potential neutron-induced backgrounds on both 134Xe and 136Xe for extended neutron energies. We will report our preliminary results for neutron inelastic scattering on 134Xe in applications to 0 νββ decay searches. NSF PHY-1614348, DE-FG02-97ER41033.

  13. A case study of energy transfer mechanism from uranium to europium in ZnAl2O4 spinel host by photoluminescence spectroscopy

    Science.gov (United States)

    Kumar, Mithlesh; Mohapatra, M.

    2016-04-01

    Zinc aluminate (ZAO), a member of spinel class of inorganic compounds has been of much interest of late due to its wide range of use in catalysis, optical, electronic and ceramic industries. When doped with several lanthanides, this material has proved to be a potential host matrix for phosphors. As lanthanides suffer from poor (direct) excitation and emission cross sections, the use of a co-dopant ion can help to circumvent this and extract better emission from a lanthanide doped ZAO system. In this connection, energy transfer mechanism from uranium to europium in the ZAO host was investigated by photoluminescence spectroscopic technique. It was seen that uranium gets stabilized in the hexavalent state as UO66 - (octahedral uranate) where as the lanthanide ion, Eu is stabilized in its trivalent state in the ZAO host. In the co-doped system, an efficient energy transfer pathway from the uranate to europium ion was observed. Based upon emission and life time data a suitable mechanism was proposed for the energy transfer (quenching) process. It was proposed that after excitation by photons, the uranate ions transfer their energy to nearby 5D1 level of Eu3 + ions which non-radiatively de-excites to the corresponding lower levels of 5D0. Further this 5D0 level decays in a radiative mode to the 7F manifold giving the characteristic emission profile of trivalent Eu. It was proposed that both static and dynamic types of energy transfer mechanism were responsible for this process.

  14. Exploration of spectroscopic properties of solvated tris(thenoyltrifluoroacetonate)(2,2′-bipyridine)europium(III)red hybrid organic complex for solution processed OLEDs and displays

    Energy Technology Data Exchange (ETDEWEB)

    Chitnis, Dipti [Department of Physics, RTM Nagpur University, Nagpur 440033 (India); Thejokalyani, N., E-mail: thejokalyani@rediffmail.com [Department of Applied Physics, Laxminarayan Institute of Technology, Nagpur 440033 (India); Dhoble, S.J. [Department of Physics, RTM Nagpur University, Nagpur 440033 (India)

    2017-05-15

    In order to explore the spectroscopic properties of a novel europium activated hybrid organic tris(thenoyltrifluoroacetonate)(2,2′-bipyridine)europium(III), Eu(TTA){sub 3}bipy phosphor in various solvents at different pH and molar concentrations, UV–vis optical absorption and photoluminescence spectra were carried out. With a variation in the solvent from basic (chloroform, toluene, tetrahydrofuran) to acidic (acetic acid, formic acid) media, staggering differences in optical absorptions and optical densities were noticed with hypsochromic shift in the absorption peaks. The optical density was found to be maximum for the complex with pH= 7.0 and the intensity as well as optical density gradually decreased when pH is lowered to 6.0 or raised to 8.0 (at an interval of 0.5), proving that the complex is pH sensitive. It's optical energy gap and stokes shift values in various organic solvents were also calculated on the basis of Lippert-Mataga plot. The exploration of spectroscopic properties of solvated Eu(TTA){sub 3}bipy complex demonstrates its prospective for solution processed OLEDs and display devices. - Graphical abstract: Pictorial depiction of photoluminescence in solvated Eu(TTA){sub 3}bipy complex under UV light.

  15. Efficacy of the semiempirical sparkle model as compared to ECP ab-initio calculations for the prediction of ligand field parameters of europium (III) complexes

    International Nuclear Information System (INIS)

    Freire, Ricardo O.; Rocha, Gerd B.; Albuquerque, Rodrigo Q.; Simas, Alfredo M.

    2005-01-01

    The second version of the sparkle model for the calculation of lanthanide complexes (SMLC II) as well as ab-initio calculations (HF/STO-3G and HF/3-21G) have been used to calculate the geometries of a series of europium (III) complexes with different coordination numbers (CN=7, 8 and 9), ligating atoms (O and N) and ligands (mono, bi and polydentate). The so-called ligand field parameters, Bqk's, have been calculated from both SMLC II and ab-initio optimized structures and compared to the ones calculated from crystallographic data. The results show that the SMLC II model represents a significant improvement over the previous version (SMLC) and has given good results when compared to ab-initio methods, which demand a much higher computational effort. Indeed, ab-initio methods take around a hundred times more computing time than SMLC. As such, our results indicate that our sparkle model can be a very useful and a fast tool when applied to the prediction of both ground state geometries and ligand field parameters of europium (III) complexes

  16. Novel europium (III)-gatifloxacin complex structure with dual functionality for pH sensing and metal recognition in aqueous environment

    Science.gov (United States)

    Chen, Muhua; Zheng, Yuhui; Gao, Jinwei; Wang, Qianming

    2016-10-01

    A new type of Eu(III)-gatifloxacin complex with characteristic red luminescence has been prepared. Due to the presence of ionization effect linked to the organic chromophore, the molecular fluorescent sensor demonstrated variable pH-sensitive absorption and emission curves. The red emission derived from europium ions was strong during pH range 8-10. Between pH = 7 and 4, the europium emission remained relatively stable and fluorescence signals of gatifloxacin has been improved substantially. Under acidic conditions (pH = 1 to 3), the dramatic changes in the emission colors (from red, yellow to green) were clearly observed. Moreover, the excitation wavelength can be extended into the visible light range (Ex = 411 nm) by using the concentration effect experiment. Importantly, it gave turn-off emissions in the presence of Cu2+ or Fe3+ and the detection limits were determined to be 6.5 μM for Cu2+ and 6.2 μM for Fe3+ respectively.

  17. Emission tunability and local environment in europium-doped OH{sup −}-free calcium aluminosilicate glasses for artificial lighting applications

    Energy Technology Data Exchange (ETDEWEB)

    Farias, Aline M.; Sandrini, Marcelo; Viana, José Renato M.; Baesso, Mauro L.; Bento, Antônio C.; Rohling, Jurandir H. [Departamento de Física, Universidade Estadual de Maringá, Av Colombo, 5790, 87020-900, Maringá, PR (Brazil); Guyot, Yannick [Laboratoire de Physico–Chimie des Matériaux Luminescents, Université de Lyon, Université Claude Bernard Lyon 1, Villeurbanne, UMR 5620 CNRS 69622 (France); De Ligny, Dominique [Department of Materials Science and Engineering, University of Erlangen Nürnberg, Martens str. 5, 91058, Erlangen (Germany); Nunes, Luiz Antônio O. [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador São-Carlense400, 13566-590, São Carlos, SP (Brazil); Gandra, Flávio G. [Instituto de Física Gleb Wataghin, Universidade Estadual de Campinas, 13083-859, Campinas, SP (Brazil); Sampaio, Juraci A. [Lab Ciências Físicas, Universidade Estadual Norte Fluminense, 28013-602, Campos Dos Goytacazes, RJ (Brazil); Lima, Sandro M.; Andrade, Luis Humberto C. [Grupo de Espectroscopia Óptica e Fototérmica, Universidade Estadual de Mato Grosso do Sul-UEMS, Dourados, MS, C. P. 351, CEP 79804-970 (Brazil); and others

    2015-04-15

    The relationship between emission tunability and the local environment of europium ions in OH{sup −}-free calcium aluminosilicate glasses was investigated, focusing on the development of devices for artificial lighting. Significant conversion of Eu{sup 3+} to Eu{sup 2+} was obtained by means of melting the glasses under a vacuum atmosphere and controlling the silica content, resulting in broad, intense, and tunable luminescence ranging from blue to red. Electron spin resonance and X-ray absorption near edge structure measurements enabled correlation of the luminescence behavior of the material with the Eu{sup 2+}/Eu{sup 3+} concentration ratio and changes in the surrounding ions' crystal field. The coordinates of the CIE 1931 chromaticity diagram were calculated from the spectra, and the contour maps showed that the light emitted from Eu{sup 2+} presented broad bands and enhanced color tuning, ranging from reddish-orange to blue. The results showed that these Eu doped glasses can be used for tunable white lighting by combining matrix composition and the adjustment of the pumping wavelength. - Highlights: • Eu{sup 2+}-doped OH{sup −} free calcium aluminosilicate glass as a new source for white lighting. • Correlation between emission tunability and local environment of europium ions. • Significant reduction of Eu{sup 3+} to Eu{sup 2+} by melting the glasses under vacuum atmosphere. • Broad, intense and tunable luminescence ranging from blue to red.

  18. Exploration of spectroscopic properties of solvated tris(thenoyltrifluoroacetonate)(2,2′-bipyridine)europium(III)red hybrid organic complex for solution processed OLEDs and displays

    International Nuclear Information System (INIS)

    Chitnis, Dipti; Thejokalyani, N.; Dhoble, S.J.

    2017-01-01

    In order to explore the spectroscopic properties of a novel europium activated hybrid organic tris(thenoyltrifluoroacetonate)(2,2′-bipyridine)europium(III), Eu(TTA) 3 bipy phosphor in various solvents at different pH and molar concentrations, UV–vis optical absorption and photoluminescence spectra were carried out. With a variation in the solvent from basic (chloroform, toluene, tetrahydrofuran) to acidic (acetic acid, formic acid) media, staggering differences in optical absorptions and optical densities were noticed with hypsochromic shift in the absorption peaks. The optical density was found to be maximum for the complex with pH= 7.0 and the intensity as well as optical density gradually decreased when pH is lowered to 6.0 or raised to 8.0 (at an interval of 0.5), proving that the complex is pH sensitive. It's optical energy gap and stokes shift values in various organic solvents were also calculated on the basis of Lippert-Mataga plot. The exploration of spectroscopic properties of solvated Eu(TTA) 3 bipy complex demonstrates its prospective for solution processed OLEDs and display devices. - Graphical abstract: Pictorial depiction of photoluminescence in solvated Eu(TTA) 3 bipy complex under UV light.

  19. Soil to plant transfer of 134Cs for olive and orange trees: preliminary results

    International Nuclear Information System (INIS)

    Skarlou, V.; Nobeli, C.; Anoussis, J.; Papanicolaou, E.; Haidouti, C.

    1995-01-01

    The objective of this research programme was to calculate values of transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) in a long term glasshouse pot experiment, started in 1994. Radiocaesium contamination in the different tree parts as well as the importance of the storage or cycling of 134 Cs will also be examined. The experiment was conducted in large pots filled with a calcareous, heavy soil (115 kg/pot) where olive and orange trees, two years after grafting were transplanted. The soil was added to the pot in layers ca. 2 cm thick on the top of which the radioactive solution was added in small drops. Caesium-134 as CsCl (0.5 mCi) was added to each pot. The soil in the pots was watered to field capacity and left to stand for eight weeks for the 134 Cs to reach equilibrium. Plant samples were taken at fruit maturity, eight months after transplanting. It is noticed that the length of experimentation is rather short for tree crops and the data should be considered as preliminary ones with indicative tendencies. Under these conditions plant contamination was generally very low in both plant species studied. The concentration ratios (CR) of 134 Cs for the studied crops did not differ much and they ranged from 0.0007 to 0.002 for olive trees and from 0.0006 to 0.001 for orange trees. Leaves compared to other plant parts showed the highest CR value in both crops. Furthermore new leaves and branches of the olive trees showed higher CR values than the old ones by approximately a factor of two. Potassium content of the different plant parts showed significant differences and they were higher in leaves and fruits. There is no correlation between K content and transfer factors of Cs in the different plant parts of both crops. To study the effect of soil type on CRs of 134 Cs for olive and orange trees a similar experiment was established two months later, using a sandy and acid soil. Based on first results, higher values of transfer factors of 134

  20. The effect of the soil pH on 134Cs transfer factors for soybean and sunflower plants; 134Cs fate in the extracted seed-oil

    International Nuclear Information System (INIS)

    Massas, I.; Skarlou, C.; Anoussis, J.; Haidouti, C.; Arapis, G.

    1999-01-01

    The effect of soil pH on 134 Cs TFs as well as the fate of 134 Cs in the extracted oil was studied in a greenhouse experiment with soybean and sunflower plants. A soil with pH 4.2 was used as a basis and its pH value has increased to 5.7, 6.5 and 7.6 (by the addition of different amounts of Ca(OH) 2 ). The lowest TF value was observed in the calcareous soil (pH 7.6), while the highest in the lowest pH (4.2) for the vegetative part and in the pH 6.5 for the edible part for both studied plants. TFs were practically the same for soya plants grown on the three lowest soil pH and reduced significantly only at pH 7.6 for either pods or other plant material. However, the lowest/highest TF was ∼ 4 for pods and ∼ 6 for the other plant material. For the sunflower plants while TFs for other plant material reduced from lowest to highest soil pH by only a factor of 2, for the seeds TFs remained rather constant. The difference in TF between the two studied species in each soil pH was in some cases higher than the difference due to pH effect. When an oil fraction (∼ 20 %) was extracted from seeds of both plants, no 134 Cs was detected. Refs. 4 (author)

  1. Global emissions of refrigerants HCFC-22 and HFC-134a: Unforeseen seasonal contributions

    Science.gov (United States)

    Xiang, Bin; Montzka, Stephen A.; Miller, Scot M.; Elkins, James W.; Moore, Fred L.; Atlas, Elliot L.; Miller, Ben R.; Weiss, Ray F.; Prinn, Ronald G.; Wofsy, Steven C.

    2014-01-01

    HCFC-22 (CHClF2) and HFC-134a (CH2FCF3) are two major gases currently used worldwide in domestic and commercial refrigeration and air conditioning. HCFC-22 contributes to stratospheric ozone depletion, and both species are potent greenhouse gases. In this work, we study in situ observations of HCFC-22 and HFC-134a taken from research aircraft over the Pacific Ocean in a 3-y span [HIaper-Pole-to-Pole Observations (HIPPO) 2009–2011] and combine these data with long-term ground observations from global surface sites [National Oceanic and Atmospheric Administration (NOAA) and Advanced Global Atmospheric Gases Experiment (AGAGE) networks]. We find the global annual emissions of HCFC-22 and HFC-134a have increased substantially over the past two decades. Emissions of HFC-134a are consistently higher compared with the United Nations Framework Convention on Climate Change (UNFCCC) inventory since 2000, by 60% more in recent years (2009–2012). Apart from these decadal emission constraints, we also quantify recent seasonal emission patterns showing that summertime emissions of HCFC-22 and HFC-134a are two to three times higher than wintertime emissions. This unforeseen large seasonal variation indicates that unaccounted mechanisms controlling refrigerant gas emissions are missing in the existing inventory estimates. Possible mechanisms enhancing refrigerant losses in summer are (i) higher vapor pressure in the sealed compartment of the system at summer high temperatures and (ii) more frequent use and service of refrigerators and air conditioners in summer months. Our results suggest that engineering (e.g., better temperature/vibration-resistant system sealing and new system design of more compact/efficient components) and regulatory (e.g., reinforcing system service regulations) steps to improve containment of these gases from working devices could effectively reduce their release to the atmosphere. PMID:25422438

  2. Chemical species of europium (III) in ionic force media 0.02M, 0.1M, and 0.7M NaClO4 at 298 K

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.

    2000-01-01

    In order to know the effects of the controlled or accidental liberation of the europium in the environment, it is necessary to know its chemical behavior in found conditions in oceans, ground and surface water. The behavior of this element in these environments can be controlled mainly by the hydrolysis and its interaction with inorganic and organic ions. (Author)

  3. Kinetic and spectroscopic characterization of the E134A- and E134D-altered dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase from Haemophilus influenzae.

    Science.gov (United States)

    Davis, Ryan; Bienvenue, David; Swierczek, Sabina I; Gilner, Danuta M; Rajagopal, Lakshman; Bennett, Brian; Holz, Richard C

    2006-03-01

    Glutamate-134 (E134) is proposed to act as the general acid/base during the hydrolysis reaction catalyzed by the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase (DapE) from Haemophilus influenzae. To date, no direct evidence has been reported for the role of E134 during catalytic turnover by DapE. In order to elucidate the catalytic role of E134, altered DapE enzymes were prepared in which E134 was substituted with an alanine and an aspartate residue. The Michaelis constant (K (m)) does not change upon substitution with aspartate but the rate of the reaction changes drastically in the following order: glutamate (100% activity), aspartate (0.09%), and alanine (0%). Examination of the pH dependence of the kinetic constants k (cat) and K (m) for E134D-DapE revealed ionizations at pH 6.4, 7.4, and approximately 9.7. Isothermal titration calorimetry experiments revealed a significant weakening in metal K (d) values of E134D-DapE. D134 and A134 perturb the second divalent metal binding site significantly more than the first, but both altered enzymes can still bind two divalent metal ions. Structural perturbations of the dinuclear active site of DapE were also examined for two E134-substituted forms, namely E134D-DapE and E134A-DapE, by UV-vis and electron paramagnetic resonance (EPR) spectroscopy. UV-vis spectroscopy of Co(II)-substituted E134D-DapE and E134A-DapE did not reveal any significant changes in the electronic absorption spectra, suggesting that both Co(II) ions in E134D-DapE and E134A-DapE reside in distorted trigonal bipyramidal coordination geometries. EPR spectra of [Co_(E134D-DapE)] and [Co_(E1341A-DapE] are similar to those observed for [CoCo(DapE)] and somewhat similar to the spectrum of [Co(H(2)O)(6)](2+) which typically exhibit E/D values of approximately 0.1. Computer simulation returned an axial g-tensor with g ((x,y))=2.24 and E/D=0.07; g ( z ) was only poorly determined, but was estimated as 2.5-2.6. Upon the addition of a second Co

  4. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  5. TH-C-19A-12: Two-Dimensional High Spatial-Resolution Dosimeter Using Europium Doped Potassium Chloride

    International Nuclear Information System (INIS)

    Li, H; Yang, D; Xiao, Z; Driewer, J; Han, Z; Low, D

    2014-01-01

    Purpose: Recent research has shown that KCl:Eu2+ has great potential for use in megavoltage radiation therapy dosimetry because this material exhibits excellent storage performance and is reusable due to strong radiation hardness. This work reports our attempts to fabricate 2D KCl:Eu2+ storage phosphor films (SPFs) using both a physical vapor deposition (PVD) method and a tape casting method. Methods: A thin layer of KCl:Eu2+ was deposited on a substrate of borosilicate glass (e.g., laboratory slides) with a PVD system. For tape casting, a homogenous suspension containing storage phosphor particles, liquid vehicle and polymer binder was formed and subsequently cast by doctor-blade onto a polyethylene terephthalate substrate to form a 150 μm thick SPF. Results: X ray diffraction analysis showed that a 10 μm thick PVD sample was composed of highly crystalline KCl. No additional phases were observed, suggesting that the europium activator had completed been incorporated into the KCl matrix. Photostimulated luminescence and photoluminescence spectra suggested that F (Cl−) centers were the electron storage centers post x ray irradiation and that Eu2+ cations acted as luminescence centers in the photostimulation process. The 150 μm thick casted KCl:Eu2+ SPF showed sub-millimeter spatial resolution. Monte Carlo simulations further demonstrated that the admixture of 20% KCl:Eu2+ and 80% low Z polymer binder exhibited almost no energy dependence in a 6 MV beam. KCl:Eu2+ pellet samples showed a large dynamic range from 0.01 cGy to 60 Gy dose-to-water, and saturated at approximately 500 Gy as a Result of its intrinsic high radiation hardness. Conclusions: This discovery research provides strong evidence that KCl:Eu2+ based SPF with associated readout apparatus could Result in a novel electronic film system that has all the desirable features associated with classic radiographic film and, importantly, water equivalence and the capability of permanent identification of

  6. TH-C-19A-12: Two-Dimensional High Spatial-Resolution Dosimeter Using Europium Doped Potassium Chloride

    Energy Technology Data Exchange (ETDEWEB)

    Li, H; Yang, D; Xiao, Z [Washington University School of Medicine, St. Louis, MO (United States); Driewer, J [University of Nebraska Medical Center, Omaha, NE (United States); Han, Z [Brigham and Womens Hospital and Harvard Medical School, Boston, MA (United States); Low, D [UCLA, Los Angeles, CA (United States)

    2014-06-15

    Purpose: Recent research has shown that KCl:Eu2+ has great potential for use in megavoltage radiation therapy dosimetry because this material exhibits excellent storage performance and is reusable due to strong radiation hardness. This work reports our attempts to fabricate 2D KCl:Eu2+ storage phosphor films (SPFs) using both a physical vapor deposition (PVD) method and a tape casting method. Methods: A thin layer of KCl:Eu2+ was deposited on a substrate of borosilicate glass (e.g., laboratory slides) with a PVD system. For tape casting, a homogenous suspension containing storage phosphor particles, liquid vehicle and polymer binder was formed and subsequently cast by doctor-blade onto a polyethylene terephthalate substrate to form a 150 μm thick SPF. Results: X ray diffraction analysis showed that a 10 μm thick PVD sample was composed of highly crystalline KCl. No additional phases were observed, suggesting that the europium activator had completed been incorporated into the KCl matrix. Photostimulated luminescence and photoluminescence spectra suggested that F (Cl−) centers were the electron storage centers post x ray irradiation and that Eu2+ cations acted as luminescence centers in the photostimulation process. The 150 μm thick casted KCl:Eu2+ SPF showed sub-millimeter spatial resolution. Monte Carlo simulations further demonstrated that the admixture of 20% KCl:Eu2+ and 80% low Z polymer binder exhibited almost no energy dependence in a 6 MV beam. KCl:Eu2+ pellet samples showed a large dynamic range from 0.01 cGy to 60 Gy dose-to-water, and saturated at approximately 500 Gy as a Result of its intrinsic high radiation hardness. Conclusions: This discovery research provides strong evidence that KCl:Eu2+ based SPF with associated readout apparatus could Result in a novel electronic film system that has all the desirable features associated with classic radiographic film and, importantly, water equivalence and the capability of permanent identification of

  7. 10 CFR 431.134 - Uniform test methods for the measurement of energy consumption and water consumption of automatic...

    Science.gov (United States)

    2010-01-01

    ... consumption and water consumption of automatic commercial ice makers. 431.134 Section 431.134 Energy... of energy consumption and water consumption of automatic commercial ice makers. (a) Scope. This... consumption, but instead calculate the energy use rate (kWh/100 lbs Ice) by dividing the energy consumed...

  8. 47 CFR 25.134 - Licensing provisions of Very Small Aperture Terminal (VSAT) and C-band Small Aperture Terminal...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Licensing provisions of Very Small Aperture Terminal (VSAT) and C-band Small Aperture Terminal (CSAT) networks. 25.134 Section 25.134 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS...

  9. Synthesis and Biological Activity of 2,5-Bisubstituted Derivatives of 1,3,4-Thiadiazol-2,5-dithiol

    Directory of Open Access Journals (Sweden)

    T. S. Zhivotova

    2013-01-01

    Full Text Available By reaction of 1,3,4-thiadiazol-2,5-dithiol with different organohalogens, chlorides of carboxylic acids, acrylic acid derivatives, alkaloids, and secondary amines, various derivatives of 2,5-bi-substituted 1,3,4-thiadiazole were synthesized, and biological properties of some of them were studied.

  10. 13 CFR 134.614 - What deadlines apply to my application for an award and where do I send it?

    Science.gov (United States)

    2010-01-01

    ... application for an award and where do I send it? 134.614 Section 134.614 Business Credit and Assistance SMALL... and where do I send it? After you have prevailed in an administrative proceeding or in a discrete... award for fees and expenses may still be filed, but it will not be considered by the ALJ until a final...

  11. 13 CFR 134.704 - What are the effects of the appeal on the procurement at issue?

    Science.gov (United States)

    2010-01-01

    ... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the effects of the appeal on the procurement at issue? 134.704 Section 134.704 Business Credit and Assistance SMALL BUSINESS...

  12. 13 CFR 134.703 - When must a person file an appeal from an WOSB or EDWOSB protest determination?

    Science.gov (United States)

    2010-01-01

    ... APPEALS Rules of Practice for Appeals From Women-Owned Small Business Concern (WOSB) and Economically... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must a person file an appeal from an WOSB or EDWOSB protest determination? 134.703 Section 134.703 Business Credit and Assistance...

  13. 13 CFR 134.707 - When does the D/GC transmit the protest file and to whom?

    Science.gov (United States)

    2010-01-01

    ... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When does the D/GC transmit the protest file and to whom? 134.707 Section 134.707 Business Credit and Assistance SMALL BUSINESS...

  14. Performance and energy saving analysis of a refrigerator using hydrocarbon mixture (HC-R134a) as working fluid

    Science.gov (United States)

    Mohtar, M. N.; Nasution, H.; Aziz, A. A.

    2015-12-01

    The use of hydrocarbon mixture as a working fluid in a refrigerator system is rarely explored. Almost all domestic refrigerators use hydroflourocarbon R134a (HFC-R134a) as refrigerants. In this study, hydrocarbon gas (HC-R134a) is used as the alternative refrigerant to replace HFC-R134a. It has a composition of R290 (56%), R600a (54.39%) and additive (0.1%wt) blended for the trials. The experiments were conducted with 105 g and 52.5 g refrigerant mass charge, subjected to internal heat load of 0, 1, 2, 3 and 4 kg respectively. The study investigates the coefficient of performance of the refrigerator (COPR) and energy consumption. The results show that the use of HC-R134a as the replaceable refrigerant can save energy ranging from 2.04% to 7.09%, as compared to the conventional HFC-R134a refrigerant. Naturally, the COPR improvement and temperature distribution using HC-R134a are much better than HFC-R134a

  15. New 1,3,4-Oxadiazole Based Photosensitizers for Dye Sensitized Solar Cells (DSSCs

    Directory of Open Access Journals (Sweden)

    Umer Mehmood

    2015-01-01

    Full Text Available 1,3,4-Oxadiazole based photosensitizers with biphenyl, naphthalene, anthracene, and triphenylamine as the electron-donating moiety were synthesized for solar cell applications. In these photosensitizers, cyano groups were introduced as the electron acceptor and the anchor group because of their high electron-withdrawing ability and strong bonding to the semiconductor. Oxadiazole isomers were used as the π-conjugation system, which bridges the donor-acceptor systems. The electrochemical and optical properties of the sensitizers were investigated both in their native form and upon incorporation into dye sensitized solar cells. The results of UV-visible absorption spectroscopy, electrochemical impedance spectroscopic measurements, and photocurrent voltage characteristics indicate that 1,3,4-oxadiazole pi-spacer with the anthracene moiety has the highest efficiency of 2.58%. Density functional theory was employed to optimize the structures of the sensitizers and the TiO2 cluster.

  16. Synthesis and Antifungal Activity of Novel Sulfone Derivatives Containing 1,3,4-Oxadiazole Moieties

    Directory of Open Access Journals (Sweden)

    Maoguo Tong

    2011-11-01

    Full Text Available A series of new sulfone compounds containing 1,3,4-oxadiazole moieties were synthesized. The structures of these compounds were confirmed by spectroscopic data (IR, 1H- and 13C-NMR and elemental analyses. Antifungal tests indicated that all the title compounds exhibited good antifungal activities against eight kinds of plant pathogenic fungi, and some showed superiority over the commercial fungicide hymexazol. Among them, compounds 5d, 5e, 5f, and 5i showed prominent activity against B. cinerea, with determined EC50 values of 5.21 μg/mL, 8.25 µg/mL, 8.03 µg/mL, and 21.00 µg/mL, respectively. The present work demonstrates that sulfone derivatives such as 5d containing a 1,3,4-oxadiazole moiety can be used as possible lead compounds for the development of potential agrochemicals.

  17. Effect of Rain Acidity Upon Mobility of Cs-134 and Co-60 in Soil

    International Nuclear Information System (INIS)

    Ruangchuay, S.; Harvey, N.W.; Sriyotha, P.

    1998-01-01

    This research was aimed to study the effects of groundwater and acid rain upon the mobility of radionuclides (Cs-134 and Co-60) in contaminated top soil. Clay soil was homogeneously packed in columns with dimension φ.12.5 cm. * 50 cm.. At the top 5 cm. of the columns, soil contaminated with radionuclides was added with the same consistency. Column were kept standing for 4 months in an artificial water table kept at 3 cm. from the bottom. During this period artificial acid rain with pH3, 4.5 and 6 was applied weekly at the top. Soil samples were taken every 30 days for examination of total and extracable radioactivity. It was shown that with the aide of the rain radionuclide movement down the profile was greater, with Co-60 > Cs-134. However acidity of the rain shown no effect on their movement

  18. N-(5-Benzylsulfanyl-1,3,4-thiadiazol-2-yl-2-(piperidin-1-ylacetamide

    Directory of Open Access Journals (Sweden)

    D. S. Ismailova

    2014-03-01

    Full Text Available The title compound, C16H20N4OS2, was synthesized by the reaction of 2-benzylsulfanyl-5-chloroacetamido-1,3,4-thiadiazole and piperidine in a 1:2 ratio. The planes of the acetamide and 1,3,4-thiadiazole units are twisted by 10.8 (4°. The thiadiazole S atom and the acetamide O atom are syn-oriented due to a hypervalent S...O interaction of 2.628 (4 Å. In the crystal, molecules form centrosymmetric dimers via N—H...N hydrogen bonds. These dimers are further connected by C—H...O interactions into (100 layers.

  19. Causes of seasonal variations of Cs-134/137 activity concentrations in surface air

    International Nuclear Information System (INIS)

    Hoetzl, H.; Winkler, R.

    1993-01-01

    In winter months maxima of Cs-134/137 activity concentrations in air are observed at several locations in Europe. To clarify this phenomenon, from October 1991 to November 1992 we performed a program for aerosol collection on a short-term scale based on collecting intervals of 48-72 hours. The local meteorological parameters were determined simultaneously. Statistical analysis of these observations reveiled a highly significant positive correlation between Cs-137 activity concentration and the so-called 'Stagnationsindex'. Based on this relationship the seasonal variations of Cs-134/137 concentrations in ground-level air can be explained by atmospheric inversion conditions frequently occurring during fall- and wintermonths. (orig.) [de

  20. Synthesis and crystal structure of novel fluorescent 1,3,4-oxadiazole-containing carboxylate ligands

    Science.gov (United States)

    Mikhailov, Igor E.; Popov, Leonid D.; Tkachev, Valery V.; Aldoshin, Sergey M.; Dushenko, Galina A.; Revinskii, Yurii V.; Minkin, Vladimir I.

    2018-04-01

    Novel chelating ligands, 3-(5-aryl-1,3,4-oxadiazol-2-yl)acrylic acids and their zinc complexes were synthesized and their spectral and luminescent properties studied. The compounds intensively (quantum efficiencies φ = 0.18-0.76) luminesce in nonpolar solvents in the blue-green region (λmaxPL = 458-504 nm) of the spectrum. Molecular and crystal structures of 3-[5-(4-dimethylaminophenyl)-1,3,4-oxadiazol-2-yl]acrylic acid were established using X-ray crystallography. In crystal, the infinite chains of the molecules lie in the parallel planes and are arranged by the "head to tail" type to provide for strong π-π stacking interactions between the layers facilitating appearance of high electron transport properties and formation of excimers.

  1. Compatibility of manufacturing process fluids with R-134a and polyolester lubricant. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Cavestri, R.C.; Schooley, D.L. [Imagination Resources, Inc., Dublin, OH (United States)

    1996-07-01

    This report includes a broad list of processing fluids that are known to be used to manufacture air conditioning and refrigeration products. Sixty-four process fluids from this list were selected for compatibility studies with R-134a and ICI EMKARATE RL32H (32 ISO) polyolester lubricant. Solutions or suspensions of the process fluid residues in polyolester lubricant were heated for 14 days at 175{degrees}C (347{degrees}F) in evacuated sealed glass tubes containing only valve steel coupons. Miscibility tests were performed at 90 wt.% R-134a, 10 wt.% polyolester lubricant with process fluid residue contaminate and were scanned in 10{degrees}C (18{degrees}F) increments over a temperature range of ambient to -40{degrees}C (-40{degrees}F). Any sign of turbidity, haze formation or oil separation was considered the immiscibility point.

  2. Europium resonance parameters from neutron capture and transmission measurements in the energy range 0.01–200 eV

    International Nuclear Information System (INIS)

    Leinweber, G.; Barry, D.P.; Burke, J.A.; Rapp, M.J.; Block, R.C.; Danon, Y.; Geuther, J.A.; Saglime III, F.J.

    2014-01-01

    Highlights: • Metal samples were sealed and imaged with X-rays to determine sample uniformity. • Eleven new resonances were identified below 100 eV. • The resonance regions of 151 Eu and 153 Eu have been extended from 100 to 200 eV. • The thermal total cross section for 151 Eu was measured, up (9 ± 3)% from ENDF/B-VII.1. • Radiation widths were assigned for all resonances from experimental data. - Abstract: Europium is a good absorber of neutrons suitable for use as a nuclear reactor control material. It is also a fission product in the low-yield tail at the high end of the fission fragment mass distribution. Measurements have been made of the stable isotopes with natural and enriched samples. The linear electron accelerator center (LINAC) at the Rensselaer Polytechnic Institute (RPI) was used to explore neutron interactions with europium in the energy region from 0.01 to 200 eV. Neutron capture and transmission measurements were performed by the time-of-flight technique. Two transmission measurements were performed at flight paths of 15 and 25 m with 6 Li glass scintillation detectors. The neutron capture measurements were performed at a flight path of 25 m with a 16-segment sodium iodide multiplicity detector. Resonance parameters were extracted from the data using the multilevel R-matrix Bayesian code SAMMY. A table of resonance parameters and their uncertainties is presented. To prevent air oxidation metal samples were sealed in airtight aluminum cans in an inert environment. Metal samples of natural europium, 47.8 atom% 151 Eu, 52.2 atom% 153 Eu, as well as metal samples enriched to 98.77 atom% 153 Eu were measured. The measured neutron capture resonance integral for 153 Eu is (9.9 ± 0.4)% larger than ENDF/B-VII.1. The capture resonance integral for 151 Eu is (7 ± 1)% larger than ENDF/B-VII.1. Another significant finding from these measurements was a significant increase in thermal total cross section for 151 Eu, up (9 ± 3)% from ENDF/B-VII.1

  3. Neutron cross section evaluations of europium isotopes in 1 keV - 30 MeV energy range. Format - validation - comparison; Evaluation de sections efficaces pour des neutrons incidents sur des isotopes d'europium aux energies 1 keV - 30 MeV. Format - validation - comparaison

    Energy Technology Data Exchange (ETDEWEB)

    Dossantos-Uzarralde, P.; Le Luel, C.; Bauge, E. [CEA Bruyeres le Chatel, 91 (France). Dept. de Physique Theorique et Appliquee

    2004-07-01

    This paper presents neutron cross section evaluations of Europium isotopes. The cross sections are evaluated in 1 keV - 30 MeV energy range for the isotopes {sup 146}Eu, {sup 147}Eu, {sup 148}Eu, {sup 149}Eu, {sup 150}Eu, {sup 151}Eu, {sup 152}Eu, {sup 153}Eu, {sup 154}Eu in their ground state. This evaluation includes cross section productions of the long life isomeric states. Special attention is put on the options used for the description of the files written in ENDF-6 format. The final issue is a proposal of a new breed of ENDF-6 formatted neutron activation file. (authors)

  4. Closure Report for Corrective Action Unit 134: Aboveground Storage Tanks, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    2009-01-01

    Corrective Action Unit (CAU) 134 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Aboveground Storage Tanks' and consists of the following four Corrective Action Sites (CASs), located in Areas 3, 15, and 29 of the Nevada Test Site: (1) CAS 03-01-03, Aboveground Storage Tank; (2) CAS 03-01-04, Tank; (3) CAS 15-01-05, Aboveground Storage Tank; and (4) CAS 29-01-01, Hydrocarbon Stain

  5. [Lens luxation in dogs: a retrospective study of 134 dogs (2000-2011)].

    Science.gov (United States)

    Betschart; Hässig; Spiess

    2014-03-01

    This retrospective study evaluated cases of lens luxation in dogs that were documented at the University of Zurich Veterinary Teaching Hospital between 2000 and 2011. A total 134 dogs were included in the study. This population of dogs with lens luxation represents 0.41 % of all dogs presented to the Zurich Veterinary Teaching Hospital (32'523) and 3.02 % of all dogs presented to the ophthalmology service during the same time period. The 134 dogs represented over 40 different breeds, including mixed breeds. 63 of the dogs were male, 71 were female. The 134 dogs were divided in primary lens luxation (86 of the 134 dogs, 64 %) and secondary lens luxation (48 dogs, 36 %). The most frequent causes for secondary lens luxation were glaucoma (58 %), cataract (19 %) and trauma (17 %). This study shows the predisposition for primary lens luxations in terrier breeds, Chinese Crested dogs, Pinscher and Spitz. In contrast, Siberian Huskies, Basset Hounds, Bearded Collies, Cairn Terriers, mixed breed dogs, Bolonka Zwetna, Boston Terriers, Borzoi, Doberman, Eurasian, Leonberg, Luzerner Niederlaufhund and Weimaraner suffered significantly more often from secondary lens luxation. There was no sex predilection for primary or secondary lens luxation. Dogs with primary lens luxation were on average 7.39 ± 3.02 years old, which is significantly younger than the dogs with secondary lens luxation (9.12 ± 3.38 years). Dogs with primary lens luxation showed a significantly higher rate of a bilateral development than those with secondary lens luxation (85.5 % of the dogs with primary lens luxation and only 14.5 % of the dogs with secondary lens luxation showed it in both their eyes).

  6. Investigation into the conditions under which HFC134a may become flammable.

    CSIR Research Space (South Africa)

    Kramers, AP

    2002-01-01

    Full Text Available or approaching 180°C would be associated with an onset of catastrophic conditions such as plant room fires and total mechanical failure of equipment. It is suggested in that the guidelines listed in Section 5.2, pertaining to abnormal plant conditions... /lubricant mixtures can become explosive. The work must therefore consider both normal and abnormal operating conditions to which HFC134a may be exposed to empower machine operators, mine maintenance personnel and contractors to take preventative...

  7. MicroRNA-134 as a potential plasma biomarker for the diagnosis of acute pulmonary embolism

    Directory of Open Access Journals (Sweden)

    Liu Yi

    2011-09-01

    Full Text Available Abstract Background Acute pulmonary embolism (APE remains a diagnostic challenge due to a variable clinical presentation and the lack of a reliable screening tool. MicroRNAs (miRNAs regulate gene expression in a wide range of pathophysiologic processes. Circulating miRNAs are emerging biomarkers in heart failure, type 2 diabetes and other disease states; however, using plasma miRNAs as biomarkers for the diagnosis of APE is still unknown. Methods Thirty-two APE patients, 32 healthy controls, and 22 non-APE patients (reported dyspnea, chest pain, or cough were enrolled in this study. The TaqMan miRNA microarray was used to identify dysregulated miRNAs in the plasma of APE patients. The TaqMan-based miRNA quantitative real-time reverse transcription polymerase chain reactions were used to validate the dysregulated miRNAs. The receiver-operator characteristic (ROC curve analysis was conducted to evaluate the diagnostic accuracy of the miRNA identified as the candidate biomarker. Results Plasma miRNA-134 (miR-134 level was significantly higher in the APE patients than in the healthy controls or non-APE patients. The ROC curve showed that plasma miR-134 was a specific diagnostic predictor of APE with an area under the curve of 0.833 (95% confidence interval, 0.737 to 0.929; P Conclusions Our findings indicated that plasma miR-134 could be an important biomarker for the diagnosis of APE. Because of this finding, large-scale investigations are urgently needed to pave the way from basic research to clinical utilization.

  8. Rate of sediment intake by midge larvae (Chironomus plumosus: diptera) using a 134Cs tracer

    International Nuclear Information System (INIS)

    Gerking, S.D.; Berg, A.; Gerard, P.

    1976-01-01

    The food intake and assimilation of midge larvae (Chironomus plumosus) were determined by a 134 Cs technique which utilized the principle that the rate of excretion can be substituted for the rate of absorption when the larvae are in 134 Cs equilibrium with their environment. The larvae were introduced into contaminated sediments until they reached 134 Cs equilibrium. The time of reaching equilibrium and levels of radioactivity were the same at 10 and at 15 0 C (70 hr at a level of 1367 dpm/mg of larva) and were both significantly different from that at 20 0 C (40 hr at 1062 dpm/mg of larva). Cesium-134 elimination was followed on equilibrated larvae for as long as 330 hr. One egestion compartment (fast) and two excretion (medium and slow) compartments could be recognized at the three experimental temperatures. The loss rates from the second and third compartments at 10 0 C were slower and stretched out over longer time periods compared with those at 15 0 C, while the loss rate from the first compartment was much more comparable at the two temperatures. The first and second compartments merged at 20 0 C, while the slow compartment rose to almost three times that at 15 0 C. The food intake was nearly the same at the three temperatures (0.0986, 0.0893 and 0.0876 mg dry sediment/mg of larva/day). Thus, the larvae relied on an increase in assimilation to meet increased metabolic requirements at higher temperatures rather than depending upon a higher food intake. The gross growth efficiencies varied with temperature from 9.9 percent at 10 0 C to 15.1 percent at 15 0 C

  9. The complete multipartite genome sequence of Cupriavidus necator JMP134, a versatile pollutant degrader.

    Directory of Open Access Journals (Sweden)

    Athanasios Lykidis

    Full Text Available BACKGROUND: Cupriavidus necator JMP134 is a Gram-negative beta-proteobacterium able to grow on a variety of aromatic and chloroaromatic compounds as its sole carbon and energy source. METHODOLOGY/PRINCIPAL FINDINGS: Its genome consists of four replicons (two chromosomes and two plasmids containing a total of 6631 protein coding genes. Comparative analysis identified 1910 core genes common to the four genomes compared (C. necator JMP134, C. necator H16, C. metallidurans CH34, R. solanacearum GMI1000. Although secondary chromosomes found in the Cupriavidus, Ralstonia, and Burkholderia lineages are all derived from plasmids, analyses of the plasmid partition proteins located on those chromosomes indicate that different plasmids gave rise to the secondary chromosomes in each lineage. The C. necator JMP134 genome contains 300 genes putatively involved in the catabolism of aromatic compounds and encodes most of the central ring-cleavage pathways. This strain also shows additional metabolic capabilities towards alicyclic compounds and the potential for catabolism of almost all proteinogenic amino acids. This remarkable catabolic potential seems to be sustained by a high degree of genetic redundancy, most probably enabling this catabolically versatile bacterium with different levels of metabolic responses and alternative regulation necessary to cope with a challenging environment. From the comparison of Cupriavidus genomes, it is possible to state that a broad metabolic capability is a general trait for Cupriavidus genus, however certain specialization towards a nutritional niche (xenobiotics degradation, chemolithoautotrophy or symbiotic nitrogen fixation seems to be shaped mostly by the acquisition of "specialized" plasmids. CONCLUSIONS/SIGNIFICANCE: The availability of the complete genome sequence for C. necator JMP134 provides the groundwork for further elucidation of the mechanisms and regulation of chloroaromatic compound biodegradation.

  10. Determination of the hydrolysis constants of Europium (III), in ion strength media 4, 5 and 6 M NaClO{sub 4} at 303 K; Determinacion de las constantes de hidrolisis del Europio (III), en medios de fuerza ionica 4, 5 y 6 M de NaClO{sub 4} a 303 K

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado B, A.; Jimenez R, M.; Solache R, M. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    1999-07-01

    This work was made with the purpose to complete information about the hydrolysis constants of Europium (III) in high ion strength media. So it was determined at a ion forces media 4, 5 and 6 M of sodium perchlorate at 303 K. The method used was the potentiometric with the aid of the Super quad computer program. In high ion strength media, the measurements of p H do not correspond directly to negative logarithm of the concentration of hydrogen ions, by this it is necessary to calibrate the electrode in these conditions. The Europium was hydrolized at pC{sub H} values greater 6 in all cases. The potentiometric method used under the described experimental conditions is adequate to determine the hydrolysis constants of Europium (III). According to the results and diagrams of chemical species of Europium obtained we can conclude that the hydrolysis constants, differ by its distribution but not in its identity. (Author)

  11. Experimental investigation of hydrocarbon mixtures to replace HFC-134a in an automotive air conditioning system

    International Nuclear Information System (INIS)

    Wongwises, Somchai; Kamboon, Amnouy; Orachon, Banchob

    2006-01-01

    This paper presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in automotive air conditioners. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). The measured data are obtained from an automotive air conditioning test facility utilizing HFC-134a as the refrigerant. The air conditioner, with a capacity of 3.5 kW driven by a Diesel engine, is charged and tested with four different ratios of hydrocarbon mixtures. The experiments are conducted at the same surrounding conditions. The temperature and pressure of the refrigerant at every major position in the refrigerant loop, the temperature, flow rate and humidity of air, torque and engine speed are recorded and analyzed. The parameters investigated are the refrigeration capacity, the compressor power and the coefficient of performance (COP). The results show that propane/butane/isobutane: 50%/40%/10% is the most appropriate alternative refrigerant to replace HFC-134a, having the best performance of all the hydrocarbon mixtures investigated

  12. R-134a (1,1,1,2-Tetrafluoroethane) Inhalation Induced Reactive Airways Dysfunction Syndrome.

    Science.gov (United States)

    Doshi, Viral; Kham, Nang; Kulkarni, Shreedhar; Kapitan, Kent; Henkle, Joseph; White, Peter

    2016-01-01

    R-134a (1,1,1,2-tetrafluoroethane) is widely used as a refrigerant and as an aerosol propellant. Inhalation of R-134a can lead to asphyxia, transient confusion, and cardiac arrhythmias. We report a case of reactive airways dysfunction syndrome secondary to R-134a inhalation. A 60-year-old nonsmoking man without a history of lung disease was exposed to an air conditioner refrigerant spill while performing repairs beneath a school bus. Afterward, he experienced worsening shortness of breath with minimal exertion, a productive cough, and wheezing. He was also hypoxic. He was admitted to the hospital for further evaluation. Spirometry showed airflow obstruction with an FEV1 1.97 L (45% predicted). His respiratory status improved with bronchodilators and oral steroids. A repeat spirometry 2 weeks later showed improvement with an FEV1 2.5 L (60% predicted). Six months after the incident, his symptoms had improved, but he was still having shortness of breath on exertion and occasional cough.

  13. Analysis of the direct contamination pathway of 85Sr, 103Ru and 134Cs in soybean

    International Nuclear Information System (INIS)

    Yim, K. M.; Park, D. W.; Park, H. K.; Choi, Y. H.; Choi, S. D.; Lee, C. M.

    2001-01-01

    A solution containing 85 Sr, 103 Cs was sprayed to the aerial part of the soybean plant in a greenhouse at 6 different times before harvest and the direct contamination pathway of the radionuclide analyzed. Plant interception factor showed little difference among radionuclides. The maximum value was 0.93, which was observed at the middle growth stage. Translocation factors 85 Sr, 103 Cs in the soybean seed at harvest were in the range of 4.5x10 -5 ∼2.5x10 -3 , 6.0x10 -5 ∼2.3x10 -4 and 4.5x10 -3 ∼3.0x10 -1 , respectively. They were highest at the 3rd application for 85 Sr and 134 Cs and at the 2nd application for 103 Ru. Translocation factors of 85 Sr and 103 Ru in the soybean shell tended to increase with decreasing time interval between application and harvest but that of 134 Cs was highest at the 2nd application. The fractions of the initial deposition that remained in the soybeam plant at harvest were in the range of 0.14 ∼15.2% for 85 Sr and 103 Ru, 9.9∼41.9% for 134 Cs. These results can be utilized for predicting the radionuclide concentration in mature soybean plant and deciding counter-measures when an accidental deposition of the radionuclides occurs during the growing season of soybean

  14. Effect of waste mica on transfer factors of 134Cs to spinach and lettuce

    International Nuclear Information System (INIS)

    Sreenivasa Chari, M.; Manjaiah, K.M.; Sachdev, P.; Sachdev, M.S.

    2011-01-01

    A greenhouse pot culture experiment was conducted to study the effect of graded levels of waste mica (0, 10, 20 and 40 g kg -1 ) on reducing the radiocesium uptake by spinach (Spinacia olerecea L) and lettuce (Lactuca sativa L.) grown in 134 Cs-contaminated (at 37 k Bq kg -1 soil) Inceptisols, Vertisols and Ultisols. The biomass yield, and potassium content and its uptake by crops have been significantly improved by waste mica application. The crops grown in Vertisols recorded higher biomass yield, and K content and its uptake as compared with Inceptisols and Ultisols. The average 134 Cs transfer factor values recorded were: 0.21, 0.17 and 0.26 at the first cutting, 0.15, 0.12 and 0.28 at the second cutting and 0.07, 0.05 and 0.23 at the third cutting from Inceptisols, Vertisols and Ultisols, respectively. Waste mica significantly suppressed radiocesium uptake, the effect being more pronounced at 40 g mica kg -1 soil. There exists an inverse relationship between the 134 Cs transfer factors with plant potassium content and also the K uptake by the crops. (authors)

  15. An experimental evaluation of the greenhouse effect in the substitution of R134a with CO2

    International Nuclear Information System (INIS)

    Aprea, C.; Greco, A.; Maiorino, A.

    2012-01-01

    This paper addresses the problem of R314a substitution with a natural refrigerant fluid. Attention is devoted to the evaluation of the environmental impact, in terms of greenhouse effect. R134a and R744 (CO 2 ) are compared to one another. The hydrofluorocarbon R134a has a large direct warming impact (GWP), whereas the R744 contribution is negligible. The greenhouse effect is determined by the experimental evaluation of the TEWI index (Total Equivalent Warming Impact) that takes into account both direct and indirect contributions to global warming. This paper compares a commercial R134a refrigeration plant and a prototype R744 system working in a trans-critical cycle. The experimental results clearly show that the latter has a larger TEWI than the system operating with R134a. The indirect contribution to global warming provided by R744 is always greater than that of R134a. This contribution prevails in most cases. Only few operating conditions corresponding to a refrigerating plant working as a classical split system benefits, in terms of greenhouse effect, of the substitution of R134a with R744. -- Highlights: ► A comparison between a classical vapour compression plant and a trans-critical cycle. ► Evaluation of the greenhouse effect in R134a substitution with R744. ► Evaluation of direct and indirect contribution to global warming. ► Minimization of the global warming impact of a R744 transcritical cycle.

  16. Europium(III) complex-functionalized magnetic nanoparticle as a chemosensor for ultrasensitive detection and removal of copper(II) from aqueous solution.

    Science.gov (United States)

    Liu, Jing; Zuo, Wei; Zhang, Wei; Liu, Jian; Wang, Zhiyi; Yang, Zhengyin; Wang, Baodui

    2014-10-07

    Ultrasensitive, accurate detection and separation of heavy metal ions is very important in environmental monitoring and biological detection. In this paper, a highly sensitive and specific detection method for Cu(2+) based on the fluorescence quenching of a europium(III) hybrid magnetic nanoprobe is presented. This nanoprobe can detect Cu(2+) over a wide pH range (5.0-10.0) with a detection limit as low as 0.1 nM and it can be used for detecting Cu(2+) in living cells. After the magnetic separation, the Cu(2+) concentration decreased to 1.18 ppm, which is less than the US EPA drinking water standard (1.3 ppm), and more than 70% Cu(2+) could be removed when the amount of nanocomposite 1 reached 1 mg.

  17. Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

    International Nuclear Information System (INIS)

    Caires, A.C.F.

    1985-01-01

    A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

  18. Sol-gel approach to the novel organic-inorganic hybrid composite films with ternary europium complex covalently bonded with silica matrix

    International Nuclear Information System (INIS)

    Dong Dewen; Yang Yongsheng; Jiang Bingzheng

    2006-01-01

    Novel organic-inorganic hybrid composite films with ternary lanthanide complex covalently bonded with silica matrix were prepared in situ via co-ordination of N-(3-propyltriethoxysilane)-4-carboxyphthalimide (TAT) and 1,10-phenanthroline (Phen) with europium ion (Eu 3+ ) during a sol-gel approach and characterized by the means of spectrofluorimeter, phosphorimeter and infrared spectrophotometer (FTIR). The resulting transparent films showed improved photophysical properties, i.e. increased luminescence intensity and longer luminescence lifetime, compared with the corresponding binary composite films without Phen. All the results revealed that the intense luminescence of the composite film was attributed to the efficient energy transfer from ligands, especially Phen, to chelated Eu 3+ and the reduced non-radiation through the rigid silica matrix and 'site isolation'

  19. Morphine Preconditioning Downregulates MicroRNA-134 Expression Against Oxygen-Glucose Deprivation Injuries in Cultured Neurons of Mice.

    Science.gov (United States)

    Meng, Fanjun; Li, Yan; Chi, Wenying; Li, Junfa

    2016-07-01

    Brain protection by narcotics such as morphine is clinically relevant due to the extensive use of narcotics in the perioperative period. Morphine preconditioning induces neuroprotection in neurons, but it remains uncertain whether microRNA-134 (miR-134) is involved in morphine preconditioning against oxygen-glucose deprivation-induced injuries in primary cortical neurons of mice. The present study examined this issue. After cortical neurons of mice were cultured in vitro for 6 days, the neurons were transfected by respective virus vector, such as lentiviral vector (LV)-miR-control-GFP, LV-pre-miR-134-GFP, LV-pre-miR-134-inhibitor-GFP for 24 hours; after being normally cultured for 3 days again, morphine preconditioning was performed by incubating the transfected primary neurons with morphine (3 μM) for 1 hour, and then neuronal cells were exposed to oxygen-glucose deprivation (OGD) for 1 hour and oxygen-glucose recovery for 12 hours. The neuronal cells survival rate and the amount of apoptotic neurons were determined by MTT assay or TUNEL staining at designated time; and the expression levels of miR-134 were detected using real-time reverse transcription polymerase chain reaction at the same time. The neuronal cell survival rate was significantly higher, and the amount of apoptotic neurons was significantly decreased in neurons preconditioned with morphine before OGD than that of OGD alone. The neuroprotection induced by morphine preconditioning was partially blocked by upregulating miR-134 expression, and was enhanced by downregulating miR-134 expression. The expression of miR-134 was significantly decreased in morphine-preconditioned neurons alone without transfection. By downregulating miR-134 expression, morphine preconditioning protects primary cortical neurons of mice against injuries induced by OGD.

  20. Synthesis and luminescence properties of two novel europium (III) perchlorate complexes with bis(benzylsulfinyl)methane and 1,10-phenanthroline

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wen-Xian, E-mail: nmglwx@163.com [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China); Guo, Feng [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China); Zheng, Yu-Shan [Inner Mongolia Autonomous Region Product Quality Inspection Institute, Hohhot 010010 (China); Cao, Xiao-Fang; Feng, Shu-Yan; Bai, Juan; Xin, Xiao-Dong [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China)

    2014-09-15

    Two novel binary and ternary Europium (III) perchlorate complexes were synthesized. The binary complex was prepared with bis(benzylsulfinyl)methane as ligand, and the ternary complex was with bis(benzylsulfinyl)methane as first ligand and 1,10-Phenanthroline as second ligand. They were characterized by element analysis, molar conductivity, coordination titration analysis, IR, TG-DSC, {sup 1}HNMR and UV spectra. The results indicated that the composition of binary and ternary complexes was EuL{sub 2.5}·(ClO{sub 4}){sub 3}·3H{sub 2}O and Eu{sub 2}L{sub 4}·phen·(ClO{sub 4}){sub 6}·12H{sub 2}O (L=C{sub 6}H{sub 5}CH{sub 2}SOCH{sub 2}SOCH{sub 2}C{sub 6}H{sub 5}), respectively. The fluorescent spectra illustrated that the complexes displayed characteristic Europium (III) ion fluorescence in solid state, indicating the ligands favored energy transfer to the excitation state energy level of it. The strongest characteristic fluorescence emission intensity of the ternary system was 1.87 times as strong as that of the binary system. The fluorescent quantum yields of the Eu (III) ternary and binary complexes were also calculated. Additionally, the phosphorescence spectra and the luminescence mechanisms of the complexes were studied and explained. - Highlights: • Two rare earth complexes are new. And they are stabilized. • The intensities of the two rare earth complexes were all stronger and the lifetimes were longer. • The introduction of the second organic ligand1,10-Phenanthroline enhanced the fluorescence intensity. • The fluorescent quantum yields of two complexes being calculated are both very high.

  1. Extraction of uranium(6), transuranium elements and europium by bidentate neutral phosphorus- and phosphorus-nitrogen-containing reagents with substituent in methylene bridge

    International Nuclear Information System (INIS)

    Kochetkova, N.E.; Kojro, O.Eh.; Nesterova, N.P.; Medved', T.Ya.; Chmutova, M.K.; Myasoedov, B.F.; Kabachnik, M.I.

    1986-01-01

    The influence of substituents in methylene bridge on solubility, extractivity and selectivity of bidentate neutral phosphorus- and phosphorus-nitrogen-containing reagents in the process of U(6), TUE, Eu extraction has been studied. It is ascertained that hydrogen substitution in the bridge of tetraphenylmethylenediphosphine dioxide (1) causes a decrease in the extractivity of reagent as to TPE, uranium (6) and europium. There is no visible regular relation between basicity and extractivity of substituted reagents. Hydrogen substitution in the bridge of diphenyl[diethylcarbamoylmethyl]phosphine oxide (2) causes a decrease in extractivity of the reagent as to TPE, uranium (6) and europium. In contrast to monodentate neutral reagents, when bidentate neutral reagents are used, sometimes no increase in the reagent extractivity with an increase in its basicity is observed. When fragments restricting the conformation mobility of bidentate reagent molecule are introduced in it (here substituents in methylene bridge), it may result in the violation of the regularity, since of all the factors affecting the reagent extractivity the spatial factor may become the prevailing one. On hydrogen substitution in the bridge of 1 separation factors of practically all (with few exceptions) studied pairs of elements increase. Hydrogen substitution in the bridge of 2 causes an increase in separation factor of U (6) /Am pair and it does not affect the separation factor of Am/Eu pair. Hydrogen substitution in the bridge of 1 and 2 does not result in the preparation of more efficient and considerably more selective reagents for extractive isolation and separation of the elements, but some of the substituted reagents (Cl-substituted 1, for instance) may turn out useful for the element separation

  2. A facile one-pot hydrothermal method to prepare europium-doped titania hollow phosphors and their sensitized luminescence properties

    Energy Technology Data Exchange (ETDEWEB)

    Feng Xuan; Yang Ling; Zhang Nianchun [Department of Chemistry and Institute of Nanochemistry, Jinan University, 601 Western Huangpu Road, Guangzhou 510632 (China); Liu Yingliang, E-mail: tliuyl@jnu.edu.c [Department of Chemistry and Institute of Nanochemistry, Jinan University, 601 Western Huangpu Road, Guangzhou 510632 (China)

    2010-09-17

    Research highlights: {yields} The strongest emission intensity was observed with TiO{sub 2}:Eu{sub 0.2} hollow spheres and TiO{sub 2}:Eu{sub 0.2} hollow spheres calcining at 550 {sup o}C. Moreover, the strongest excitation of TiO{sub 2}:Eu{sub 0.2} hollow spheres transferred from 400 to 500 {sup o}C and the effective nonradiative energy transfer from the TiO{sub 2} hollow spheres host matrix to Eu{sup 3+} ions crystal field states was realized due to changes of crystalline field in the environment around Eu{sup 3+} ions occupying Ti{sup 4+} sites. The proposed energy transfer mechanism was that UV light is absorbed in the band of TiO{sub 2} hollow spheres crystal and then the energy is relaxed to the defect states of TiO{sub 2} host. The energy can transfer to the crystal states of Eu{sup 3+} ions ({sup 7}F{sub j}, j = 0, 1, 2, 3 and 4), which results in efficient photoluminescence. The fluorescent intensity of TiO{sub 2}:Eu{sub 0.2} hollow spheres was 2.2 times as strong as that of TiO{sub 2}:Eu{sub 0.2} bulk material. - Abstract: Monodisperse europium-activated titania hollow phosphors had been synthesized by a facile one-pot hydrothermal method using carbon spheres as hard templates. Samples were characterized by X-ray powder diffraction, transmission electron microscopy, X-ray photoelectron spectroscopy, energy dispersive spectrometer and photoluminescence spectrum. The strongest emission intensity was observed with TiO{sub 2}:Eu{sub 0.2} hollow spheres and TiO{sub 2}:Eu{sub 0.2} hollow spheres calcining at 550 {sup o}C. Moreover, the strongest excitation of TiO{sub 2}:Eu{sub 0.2} hollow spheres transferred from 400 to 500 {sup o}C and the effective nonradiative energy transfer from the TiO{sub 2} hollow spheres host matrix to Eu{sup 3+} ions crystal field states was realized due to changes of crystalline field in the environment around Eu{sup 3+} ions occupying Ti{sup 4+} sites. The proposed energy transfer mechanism was that UV light is absorbed in the band

  3. The europium(II) oxide halides Eu{sub 2}OBr{sub 2} and Eu{sub 2}OI{sub 2}; Die Europium(II)-Oxidhalogenide Eu{sub 2}OBr{sub 2} und Eu{sub 2}OI{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Rudolph, Daniel; Schleid, Thomas [Stuttgart Univ. (Germany). Inst. fuer Anorganische Chemie

    2017-07-01

    The syntheses and crystal structures of the two isotypic europium(II) oxide halides Eu{sub 2}OBr{sub 2} and Eu{sub 2}OI{sub 2} are reported. They crystallize orthorhombically in the space group Ibam (Z=4; Eu{sub 2}OBr{sub 2}: a=709.86(5), b=1200.34(9), c=628.71(4) pm; Eu{sub 2}OI{sub 2}: a=739.78(5), b=1295.13(9), c=644.82(4) pm). The unit cell parameters presented here, and thus the interatomic distances of Eu{sub 2}OI{sub 2}, are significantly smaller than the ones reported in the literature, which is explained by the substitution of europium with larger barium cations due to the synthesis route described in the early study. Central building blocks of both crystal structures are trans-edge-connected [OEu{sub 4}]{sup 6+} tetrahedra forming straight {sup 1}{sub ∞}{[OEu"e_4_/_2]"2"+} chains running parallel to the [001] direction. Bundled like a hexagonal rod packing, their interaction is achieved by Br{sup -} or I{sup -} anions for charge compensation.

  4. Application of a room temperature ionic liquid for nuclear spent fuel reprocessing: speciation of trivalent europium and solvatation effects; Application d'un liquide ionique basse temperature pour les procedes de separation: speciation de l'europium trivalent et effets solvatation

    Energy Technology Data Exchange (ETDEWEB)

    Moutiers, G.; Mekki, S. [CEA Saclay, Dept. de Physico-Chimie, Service de Chimie Physique, 91 - Gif sur Yvette (France); Billard, I. [IN2P3/CNRS, 69 - Villeurbanne (France)

    2007-07-01

    One of the solutions proposed for the optimization of the long term storage and conditioning of spent nuclear fuel is to separate actinide and lanthanide both from each other and from other less radioactive metallic species. The industrial proposed processes, based on liquid liquid extraction steps, involve solvents with non negligible vapour pressure and may generate contaminated liquid wastes that will have to be reprocessed. During the last decade, some room-temperature ionic liquids have been studied and integrated into industrial processes. The interest on this class of solvent came out from their 'green' properties (non volatile, non flammable, recyclable, etc...), but also from the variability of their physico-chemical properties (stability, hydrophobicity, viscosity) as a function of the RTIL chemical composition. Indeed, it has been shown that classical chemical industrial processes could be transferred into those media, even more improved, while a certain number of difficulties arising from using traditional solvent can be avoided. In this respect, it could be promising to investigate the ability to use room temperature ionic liquid into the spent nuclear fuel reprocessing field. The aim of this this study is to test the ability of the specific ionic liquid bumimTf{sub 2}N to allow trivalent europium extraction. The choice of this metal is based on the chemical analogy with trivalent minor actinides Curium and Americium which are contributing the greatest part of the long-lived high level radioactive wastes. Handling these elements needs to be very cautious for the safety and radioprotection aspect. Moreover, europium is a very sensitive luminescent probe to its environment even at the microscopic scale. The report is structured with four parts. In a first chapter, we present the main physico-chemical properties of an imidazolium-based ionic liquid family, and then we choose the ionic liquid bumimTf{sub 2}N for the whole thesis and start with

  5. Development of two-stage compression heat pump for hot water supply in commercial use. Research of compatibility with alternative refrigerant, HFC-134a; Gyomuyo nidan asshukushiki kyuto heat pump no kaihatsu. Daitai reibai HFC-134a no tekiyosei kensho

    Energy Technology Data Exchange (ETDEWEB)

    Hashimoto, K.; Hasegawa, H.; Saikawa, M.; Iwatsubo, T.; Mimaki, T. [Central Research Institute of Electric Power Industry, Tokyo (Japan)

    1996-03-01

    Performance of two-stage compression and cascade heating heat pump cycle was evaluated in the case using alternative refrigerant, HFC-134a, instead of CFC-12 through calculations and experiments. Heat source and heat load temperature conditions of CFC-12, HFC-134a, and HCFC-22 were calculated. As a result, this cycle provided equivalent coefficient of performance to use of CFC-12 and HCFC-22. Especially for HFC-134a, discharge gas temperature from compressor was much lower than that of the others, which prevented the heat decomposition of refrigerant. It was found that HFC-134a was suitable refrigerant for high temperature output equipment like this cycle. To grasp the possibility of hot water supply at 65 {degree}C and behavior of lubricating oil which can not be obtained only from calculations, applicability of HFC-134a was investigated. Experiments were conducted using a small test apparatus with electric input of 2 kW. As a result, satisfactory performance was obtained for each evaluation item. Applicability of HFC-134a to the two-stage compression cycle was confirmed. 9 refs., 21 figs., 16 tabs.

  6. Construction of 1,3,4-Oxadiazole and 1,3,4-Thiadiazole Library with a High Level of Skeletal Diversity Based on Branching Diversity-Oriented Synthesis on Solid-Phase Supports.

    Science.gov (United States)

    Ha, Ji-Eun; Yang, Seung-Ju; Gong, Young-Dae

    2018-02-12

    An efficient solid-phase synthetic route for the construction of 1,3,4-oxadiazole and 1,3,4-thiadiazole libraries based on branching diversity-oriented synthesis (DOS) has been developed in this study. The core skeleton resins, 1,3,4-oxadiazole and 1,3,4-thiadiazole, were obtained through desulfurative and dehydrative cyclizations of thiosemicarbazide resin, respectively. Various functional groups have been introduced to the core skeleton resins, such as aryl, amine, amide, urea, thiourea, and an amino acid. Most of the libraries were purified by simple trituration without extraction or column chromatography after cleavage of the products from the solid-supported resin. As a result, we obtained high yields of pure 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives (total numbers = 128). Finally, we confirmed the drug-like properties of our library by calculation of physicochemical properties, displays of the skeletal diversities of the library in 3D-space, and occupation of a broad range of areas by their functional groups.

  7. A simple method for the deconvolution of 134 Cs/137 Cs peaks in gamma-ray scintillation spectrometry

    International Nuclear Information System (INIS)

    Darko, E.O.; Osae, E.K.; Schandorf, C.

    1998-01-01

    A simple method for the deconvolution of 134 Cs / 137 Cs peaks in a given mixture of 134 Cs and 137 Cs using Nal(TI) gamma-ray scintillation spectrometry is described. In this method the 795 keV energy of 134 Cs is used as a reference peak to calculate the activity of the 137 Cs directly from the measured peaks. Certified reference materials were measured using the method and compared with a high resolution gamma-ray spectrometry measurements. The results showed good agreement with the certified values. The method is very simple and does not need any complicated mathematics and computer programme to de- convolute the overlapping 604.7 keV and 661.6 keV peaks of 134 Cs and 137 Cs respectively. (author). 14 refs.; 1 tab., 2 figs

  8. Development of certified matrix reference materials for quality assurance of screening 134Cs and 137Cs in food

    International Nuclear Information System (INIS)

    Ishizu, H.; Yamada, T.

    2013-01-01

    A certified reference material using activated alumina powder certified for activity of 134 Cs and 137 Cs was developed. The results of the verification and the certification are described. The certified reference material can be used for quality assurance of screening activity measurements of 134 Cs and 137 Cs in food/foodstuffs. Commercially available equipments were experimentally tested using the CRM and another CRM including 40 K. The results of these tests are also shown. - Highlights: • CRM of 134 Cs and 137 Cs using activated alumina was developed. • CRM including 134 Cs, 137 Cs and 40 K was also developed. • Results of experimental performance test of commercial inspection equipments using CRMs were shown

  9. Inventory and mitigation opportunities for HFC-134a emissions from nonprofessional automotive service

    Science.gov (United States)

    Zhan, Tao; Potts, Winston; Collins, John F.; Austin, Jeff

    2014-12-01

    Many vehicle owners in the United States recharge their vehicles' air conditioning systems with small containers of hydrofluorocarbon-134a (HFC-134a, CH2FCF3), at a frequency estimated to be once every year on average. Such nonprofessional service produces immediate emissions of this potent greenhouse gas during service and from the residual heel in partially used containers. The nonprofessional operations are also associated with increased delayed refrigerant emissions that occur because owners are less likely to repair leaks than professional technicians. In California, an estimated 1.3 million nonprofessional service operations performed each year generate 0.27 ± 0.07 million metric ton CO2 equivalent (MMTCO2e) of immediate emissions and 0.54 ± 0.08 MMTCO2e of delayed emissions, using a Global Warming Potential of 1300 for HFC-134a. The immediate emissions can be largely mitigated by a regulation that requires self-sealing valves and improved labeling instructions on the containers, a deposit-return-recycling program for the containers, and a consumer education program. If 95% of the used containers were to be returned by consumers for recycling of the container heel, the annual immediate emissions would be reduced by 0.26 ± 0.07 MMTCO2e. In the United States, an estimated 24 million nonprofessional service operations are performed each year, generating 5.1 ± 1.4 MMTCO2e of immediate emissions and 10.4 ± 1.5 MMTCO2e of delayed emissions. Mitigation measures equivalent to the California regulation would reduce nationwide immediate emissions by 4.9 ± 1.4 MMTCO2e, if 95% of the used cans were returned for recycling. These business-as-usual emissions and mitigation potentials are projected to stay approximately constant until around 2022, and remain at significant levels into the 2030s.

  10. Recombinant human parathyroid hormone related protein 1-34 and 1-84 and their roles in osteoporosis treatment.

    Directory of Open Access Journals (Sweden)

    Hua Wang

    Full Text Available Osteoporosis is a common disorder characterized by compromised bone strength that predisposes patients to increased fracture risk. Parathyroid hormone related protein (PTHrP is one of the candidates for clinical osteoporosis treatment. In this study, GST Gene Fusion System was used to express recombinant human PTHrP (hPTHrP 1-34 and 1-84. To determine whether the recombinant hPTHrP1-34 and 1-84 can enhance renal calcium reabsorption and promote bone formation, we examined effects of recombinant hPTHrP1-34 and 1-84 on osteogenic lineage commitment in a primary bone marrow cell culture system and on osteoporosis treatment. Results revealed that both of recombinant hPTHrP1-34 and 1-84 increased colony formation and osteogenic cell differentiation and mineralization in vitro; however, the effect of recombinant hPTHrP1-84 is a little stronger than that of hPTHrP1-34. Next, ovariectomy was used to construct osteoporosis animal model (OVX to test activities of these two recombinants in vivo. HPTHrP1-84 administration elevated serum calcium by up-regulating the expression of renal calcium transporters, which resulted in stimulation of osteoblastic bone formation. These factors contributed to augmented bone mass in hPTHrP1-84 treated OVX mice but did not affect bone resorption. There was no obvious bone mass alteration in hPTHrP1-34 treated OVX mice, which may be, at least partly, associated with shorter half-life of hPTHrP1-34 compared to hPTHrP1-84 in vivo. This study implies that recombinant hPTHrP1-84 is more effective than hPTHrP1-34 to enhance renal calcium reabsorption and to stimulate bone formation in vivo.

  11. Assessment of propane/commercial butane mixtures as possible alternatives to R134a in domestic refrigerators

    International Nuclear Information System (INIS)

    Fatouh, M.; El Kafafy, M.

    2006-01-01

    The possibility of using hydrocarbon mixtures as working fluids to replace R134a in domestic refrigerators has been evaluated through a simulation analysis in the present work. The performance characteristics of domestic refrigerators were predicted over a wide range of evaporation temperatures (-35 to -10 o C) and condensation temperatures (40-60 deg. C) for various working fluids such as R134a, propane, commercial butane and propane/iso-butane/n-butane mixtures with various propane mass fractions. The performance characteristics of the considered domestic refrigerator were identified by the coefficient of performance (COP), volumetric cooling capacity, cooling capacity, condenser capacity, input power to compressor, discharge temperature, pressure ratio and refrigerant mass flow rate. The results showed that pure propane could not be used as a drop in replacement for R134a in domestic refrigerators because of its high operating pressures and low COP. Commercial butane yields many desirable characteristics but requires a compressor change. The coefficient of performance of the domestic refrigerator using a ternary hydrocarbon mixture with propane mass fractions from 0.5 to 0.7 is higher than that of R134a. Comparison among the considered working fluids confirmed that the average refrigerant mass flow rate of the propoane/commercial butane mixture is 50% lower than that of R134a. Also, the results indicated that R134a and the propoane/commercial butane mixture with 60% propane mass concentration have approximately the same values of saturation pressure, compressor discharge temperature, condenser heat load, input power, cooling capacity and volumetric cooling capacity. However, the pressure ratio of the hydrocarbon mixture with 60% propane is lower than that of R134a by about 11.1%. Finally, the reported results confirmed that the propane/iso-butane/n-butane mixture with 60% propane is the best drop in replacement for R134a in domestic refrigerators under normal

  12. Synthesis and antimicrobial properties of 1,3,4-oxadiazole analogs containing dibenzosuberone moiety

    Energy Technology Data Exchange (ETDEWEB)

    Moger, Manjunath [Mangalore University, Karnataka (India). Department of Chemistry; Satam, Vijay; Paniraj, A.S.; Gopinath, Vadiraj S.; Hindupur, Rama Mohan; Pati, Hari N., E-mail: hari.pati@advinus.com [Advinus Therapeutics Ltd., 21 and 22, Phase II, Peenya Industrial Area, Karnataka (India); Govindaraju, Darshan Raj C. [Department of Bio-Medicinal Research, Vidya Herbs Pvt. Ltd., Karnataka (India)

    2014-01-15

    A series of ten novel 1,3,4-oxadiazole analogs containing dibenzosuberone moiety were synthesized using linear as well as convergent synthesis approach. All the compounds were characterized by mass spectrometry, infrared (IR), {sup 1}H and {sup 13}C nuclear magnetic resonance ({sup 1}H NMR and {sup 13}C NMR) spectroscopies and elemental analysis. These compounds were evaluated for antibacterial and antifungal activities. Among ten analogs, four compounds, namely, 8a, 8d, 8e and 8j were found to be highly active antibacterial and antifungal agents (author)

  13. The relation between carbon monoxide emission and visual extinction in cloud L134

    International Nuclear Information System (INIS)

    Tucker, K.D.; Dickman, R.L.; Encrenaz, P.J.; Kutner, M.L.

    1976-01-01

    Emission from the J=1→0 transition of carbon monoxide has been mapped over an area of 40' x 55' in cloud L134, and visual extinctions over the entire cloud have been obtained by means of star counts. Line intensities of > or =2 K are observable down to an extinction level of about one magnitude. From observations of the J=1→0 transition of the 13 CO isotopic species at 18 locations in the cloud, we have found a linear correlation between the local thermodynamic equilibrium (LTE) column densities of 13 CO and magnitudes of visual extinction

  14. Trichloroethylene degradation by two independent aromatic-degrading pathways in Alcaligenes eutrophus JMP134.

    OpenAIRE

    Harker, A R; Kim, Y

    1990-01-01

    The bacterium Alcaligenes eutrophus JMP134(pJP4) degrades trichloroethylene (TCE) by a chromosomal phenol-dependent pathway and by the plasmid-encoded 2,4-dichlorophenoxyacetic acid pathway. The two pathways were independent and exhibited different rates of removal and capacities for quantity of TCE removed. The phenol-dependent pathway was more rapid (0.2 versus 0.06 nmol of TCE removed per min per mg of protein) and consumed all detectable TCE. The 2,4-dichlorophenoxyacetic acid-dependent p...

  15. Synthesis and Bioassay of a New Class of Furanyl-1,3,4-Oxadiazole Derivatives

    Directory of Open Access Journals (Sweden)

    Galila A. Yacout

    2013-07-01

    Full Text Available Tyrosinase enzyme is a monophenol monoxygenase enzyme, which plays an important role in human as a rate limiting step enzyme for different specific metabolic pathways, as well as its useful application in industry and agriculture. So this study was carried out to test the effect of newly prepared compounds containing 1,3,4-oxadiazoles with different substituted groups on tyrosinase enzyme activity, hoping to use them in the treatment of some diseases arising from tyrosinase activity disorders such as Parkinson’s disease, schizophrenia, autism, attention deficit, hyperactivity disorder, and cancer.

  16. Cesium-134 and strontium-85 turnover rates in the centipede Scolopocryptops nigridia McNeill

    International Nuclear Information System (INIS)

    Yates, L.R.; Crossley, D.A. Jr.

    1979-07-01

    Radioactive tracers are providing significant information about the ecology of food chains, including such phenomena as accumulation of radioactive fission products, movement of materials along food chains, assimilation and ingestion rates, and nutrient accumulation and turnover. In this study the ingestion, assimilation and turnover to two radioactive tracers were investigated for Scolopocryptops nigridia, an abundant species in forests of the southeastern United States. The two tracers utilized, cesium-134 and strontium-85, are metabolic analogs of potassium and calcium, respectively. The research was performed as part of a larger investigation on the population ecology of the centipede species, emphasizing its relations to nutrient cycling and energy flow in a forest floor system

  17. 2-Isobutyl-6-(4-methoxyphenylimidazo[2,1-b][1,3,4]thiadiazole

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2011-02-01

    Full Text Available In the title compound, C15H17N3OS, the dihedral angle between the statistically planar imidazo[2,1-b][1,3,4]thiadiazole fused-ring system (r.m.s. deviation = 0.002 Å and the methyoxbenzene ring is 4.52 (6°. In the crystal, molecules are arranged into columns and stacked down the a axis. The crystal structure is stabilized by weak C—H...π and π–π interactions [centroid–centroid separations = 3.6053 (8 and 3.7088 (7 Å].

  18. Structure of 2{sub 1,2}{sup +} states in {sup 132,134,136}Te

    Energy Technology Data Exchange (ETDEWEB)

    Severyukhin, A. P., E-mail: sever@theor.jinr.ru; Arsenyev, N. N. [Joint Institute for Nuclear Research, Bogoliubov Laboratory of Theoretical Physics (Russian Federation); Pietralla, N.; Werner, V. [Technische Universität Darmstadt, Institut für Kernphysik (Germany)

    2016-07-15

    Starting fromthe Skyrme interaction f- together with the volume pairing interaction, we study the g factors for the 2{sub 1,2}{sup +} excitations of {sup 132,134,136}Te. The coupling between one- and two-phonon terms in the wave functions of excited states is taken into account within the finite-rank separable approximation. Using the same set of parameters we describe the available experimental data and give the prediction for {sup 136}Te, g(2{sub 1}{sup +}) = −0.18 in comparison to +0.32 in the case of {sup 132}Te.

  19. Lifetimes of low-lying states in 132Nd and 134Nd

    International Nuclear Information System (INIS)

    Kruecken, R.; Mullins, S.M.; Thornley, D.J.; Kirwan, A.J.; Nolan, P.J.; Regan, P.H.; Wadsworth, R.

    1995-01-01

    Lifetimes of low-lying states have been measured in 132 Nd and 134 Nd using the coincidence-plunger technique. The reaction 32 S+ 105 Pd was used at a bombarding energy of 152 MeV. The measurement has been performed at the NSF Daresbury using the ESSA 30 array. The differential decay-curve method (DDCM) was used to analyze the recoil-distance Doppler-shift (RDDS) data. The experimental B(E2) values in 132 Nd are well described by the predictions of the rotational model and the IBM in the O(6) limit. ((orig.))

  20. Investigations on caesium 134 and 137 contamination of game hunted for food in Hessia

    International Nuclear Information System (INIS)

    Hadlock, R.M.; Harju, H.; Sattler, E.L.; Wagner, G.

    1990-01-01

    The amount of caesium 134 and 137 in Hessian game hunted for food (556 animals) after the reactor accident at Chernobyl was investigated. Comparisons have been made before and after the accident. Although there was only a very low level of contamination, the contamination rate of different species varied; on average, the Red Deer showed the highest activity (130 Bq/kg). The level of caesium contamination was mostly influenced by the permanent habitat of the animals. The main influence was due to regional, geographical and meteorological conditions. The influence of age or sex could not be determined. The contamination rate was shown to decrease with time [de

  1. ANALISIS PERBANDINGAN EVAPORATOR KULKAS (LEMARI ES DENGAN MENGUNAKAN REFRIGERANT R-22 DAN R-134A

    Directory of Open Access Journals (Sweden)

    Imam Faozan

    2017-03-01

    Full Text Available Tulisan ini bertujuan untuk mengetahui komponen mesin refrigerasi khususnya pembahasan evaporator. Dalam penelitian ini digunakan lemari pendingin (kulkas sederhana untuk pengawetan dan pendinginan bahan makanan dalam rumah tangga. Untuk refrigerant yang digunakan adalah Refrigerant Freon  R – 22 dan  Freon R - 134a sebagai perbandingan dan untuk mengetahui performance evaporator ( COP pada mesin refrigerasi untuk rumah tangga. Lemari pendingin yang dianalisa berukuran tinggi  = 1 m, panjang  = 0,55 m  dan lebar 0,5 m. Temperatur evaporasi = -5°C dan temperature kondensasi = 40°C.

  2. 134Cs foliar contamination of vine: translocation to grapes and transfer to wine

    International Nuclear Information System (INIS)

    Carini, F.; Anguissola Scotti, I.; Montruccoli, M.; Silva, S.

    1996-01-01

    Grape vines growing in pots placed in open field were contaminated by sprinkling an aqueous solution of carrier free 134 Cs. Activity was determined in acini and must at the ripening stage. Interception and Translocation Factors (TLF) were quantified. They strictly depend on the state of growth of the crop. Wine was produced by a laboratory process and analysed as to radiocesium. Transfer parameters, F r and P e , were calculated to predict radiocesium concentration in wine: it is 0.6 times the activity found in grapes. The leaf fruit translocation seems to be the dominant process in the contamination of acini when compared to direct deposition. (author)

  3. Solvent Induced Disulfide Bond Formation in 2,5-dimercapto-1,3,4-thiadiazole

    OpenAIRE

    Palanisamy Kalimuthu; Palraj Kalimuthu; S. Abraham John

    2007-01-01

    Disulfide bond formation is the decisive event in the protein folding to determine the conformation and stability of protein. To achieve this disulfide bond formation in vitro, we took 2,5-dimercapto-1,3,4-thiadiazole (DMcT) as a model compound. We found that disulfide bond formation takes place between two sulfhydryl groups of DMcT molecules in methanol. UV-Vis, FT-IR and mass spectroscopic as well as cyclic voltammetry were used to monitor the course of reaction. We proposed a mechanism for...

  4. Coulomb excitation of neutron-rich $^{134-136}$Sn isotopes

    CERN Multimedia

    We propose to study excited states in the isotopes $^{134,136}$Sn by $\\gamma$-ray spectroscopy following "safe" Coulomb excitation. The experiment aims to investigate the evolution of quadrupole collectivity beyond the magic shell closure at N = 82 by the determination of B(E2) values and electric quadrupole moments $\\mathcal{Q}_2$. Recent shell-model calculations using realistic interactions predict possible enhanced collectivity in neutron-rich regions. Evidence for this could be obtained by this experiment. Furthermore, the currently unknown excitation energies of the 2$^+_{1}$ and 4$^+_{1}$ states in $^{136}$Sn will be measured for the first time.

  5. Cupriavidus necator JMP134 rapidly reduces furfural with a Zn-dependent alcohol dehydrogenase.

    Science.gov (United States)

    Li, Qunrui; Metthew Lam, L K; Xun, Luying

    2011-11-01

    Ethanol is a renewable biofuel, and it can be produced from lignocellulosic biomass. The biomass is usually converted to hydrolysates that consist of sugar and sugar derivatives, such as furfural. Yeast ferments sugar to ethanol, but furfural higher than 3 mM is inhibitory. It can take several days for yeast cells to reduce furfural to non-inhibitory furfuryl alcohol before producing ethanol. Bioreduction of furfural to furfuryl alcohol before fermentation may relieve yeast from furfural toxicity. We observed that Cupriavidus necator JMP134, a strict aerobe, rapidly reduced 17 mM furfural to less than 3 mM within 14 min with cell turbidity of 1.0 at 600 nm at 50°C. The rapid reduction consumed ethanol. The "furfural reductase" (FurX) was purified, and it oxidized ethanol to acetaldehyde and reduced furfural to furfuryl alcohol with NAD(+) as the cofactor. The protein was identified with mass spectrometry fingerprinting to be a hypothetical protein belonging to Zn-dependent alcohol dehydrogenase family. The furX-inactivation mutant of C. necator JMP134 lost the ability to rapidly reduce furfural, and Escherichia coli producing recombinant FurX gained the ability. Thus, an alcohol dehydrogenase enabled bacteria to rapidly reduce furfural with ethanol as the reducing power.

  6. Clinical, ultrasonographic, and roentgenographic study in 134 asymptomatic gallstone carriers; Is oral ursodeoxycholic acid treatment worhtwhile

    Energy Technology Data Exchange (ETDEWEB)

    Lirussi, F.; Passera, D.; Iemmolo, R.M.; Nassuato, G.; Okolicsanyi, L. (Inst. of Medicine, Univ. of Parma (Italy))

    1993-03-01

    The authors investigated retrospectively the ultrasonographic and roentgenographic characteristics of the gallstones and the gallbladder in 134 symtom-free carriers and evaluated prospectively the outcome and side effects of 6 to 24 months' ursodeoxycholic acid (UDCA) therapy in 36 individuals with silent stones. Two-thirds of the 134 subjects had multiple stones, and 71 to 75% had stones less than 15 mm in diameter. Gallstone calcification was detected in 13%. A non-functioning gallbladder was observed in 19%, whereas gallbladder contraction was normal in 64 of 76 gallstone carriers. With regard to oral bile acid treatment, complete and partial dissolutions were achieved in 7 and 9 of 33 subjects, respectively (48.5%). Development of a non-functioning gallbladder occurred in 9%, and acquired gallstone calcification was seen in another 15%. It is concluded that: (i) the characteristics of the gallstones and the gallbladder are similar to those observed in symptomatic patients, and (ii) UDCA therapy may be given in selected symptom-free carriers for no more than 6 to 12 months. Thereafter, it does not appear to be cost-effective. 23 refs., 2 figs., 3 tabs.

  7. Antimicrobial activities of pyridinium-tailored pyrazoles bearing 1,3,4-oxadiazole scaffolds

    Directory of Open Access Journals (Sweden)

    Lei Zhou

    2017-11-01

    Full Text Available Herein, a series of pyridinium-tailored 5-trifluoromethylpyrazoles containing 1,3,4-oxadiazole moieties were constructed through coupling key pharmaceutical fragments of pyridinium, pyrazole, and 1,3,4-oxadiazole scaffolds in single molecular architecture. Antimicrobial results suggested that this kind of compounds exhibited significant activities against three types of pathogenic bacteria and six fungal strains in vitro. The minimal EC50 values of designed compounds against Xanthomonas oryzae pv. oryzae, Ralstonia solanacearum, and Xanthomonas axonopodis pv. citri could reach to 0.467, 1.04, and 0.600 μg/mL, respectively, through tuning and optimizing N-substituents, bridging atom, and alkyl length of the tailor. Antifungal assays revealed that all title molecules possessed considerable activity against Botrytis cinerea with the minimal EC50 value up to 2.71 μg/mL; and compounds I-8, I-10, I-12, II-12, and IV-12 showed the strongest growth suppression toward Rhizoctonia solani with EC50 values ranging from 10.2 to 24.0 μg/mL. Given the above results, this kind of compounds could serve as new lead compounds in the research of antimicrobial chemotherapy.

  8. Functional analysis of α1,3/4-fucosyltransferase VI in human hepatocellular carcinoma cells

    International Nuclear Information System (INIS)

    Guo, Qiya; Guo, Bin; Wang, Yingming; Wu, Jun; Jiang, Wenjun; Zhao, Shenan; Qiao, Shouyi; Wu, Yanhua

    2012-01-01

    Highlights: ► Human FUT6 is up-regulated in HCC tissues. ► Expression of FUT6 promotes G0/G1-S transition and cell growth. ► FUT6 confers a growth advantage in vivo. ► FUT6 suppresses p21 expression through modulating PI3K/Akt signaling. -- Abstract: The α1,3/4-fucosyltransferases (FUT) subfamily are key enzymes in cell surface antigen synthesis during various biological processes. A novel role of FUTs in tumorigenesis has been discovered recently, however, the underlying mechanism remains largely unknown. Here, we characterized FUT6, a member of α1,3/4-FUT subfamily, in human hepatocellular carcinoma (HCC). In HCC tissues, the expression levels of FUT6 and its catalytic product SLe x were significantly up-regulated. Overexpression of FUT6 in HCC cells enhanced S-phase cell population, promoted cell growth and colony formation ability. Moreover, subcutaneously injection of FUT6-overexpressing cells in nude mice promoted cell growth in vivo. In addition, elevating FUT6 expression markedly induced intracellular Akt phosphorylation, and suppressed the expression of the cyclin-dependent kinases inhibitor p21. Bath application of the PI3K inhibitor blocked FUT6-induced Akt phosphorylation, p21 suppression and cell proliferation. Our results suggest that FUT6 plays an important role in HCC growth by regulating the PI3K/Akt signaling pathway.

  9. Determination of distribution ratio for 60Co, 85Sr and 134Cs in loess medium

    International Nuclear Information System (INIS)

    Tanaka, Tadao; Ogawa, Hiromichi; Zhentang Li; Hui Wang; Kamiyama, Hideo.

    1994-06-01

    Distribution ratio R for 60 Co, 85 Sr and 134 Cs between loess and ground water was measured by using 16 loess samples taken from the field test site of China Institute for Radiation Protection, in which the field test of radionuclide migration had been performed. The R of each radionuclide was taken nearly constant value among 16 samples. This revealed that the site can be regarded as uniform loess medium from the view point of sorption ability. The sorption ability between the three radionuclides was the order of 134 Cs > 60 Co >> 85 Sr. The 85 Sr was an available nuclide for examining the migration phenomena, because 85 Sr might easily migrate in the loess medium due to its low sorption ability. The results of parametric check suggested that it is necessary to select the valid temperature and pH for determining the R value. The sorption of Sr on the loess was dominated by reversible ion-exchange reaction, while that of Co and Cs was dominated by irreversible one. (author)

  10. The removal of 134Cs from radioactive process waste water by coprecipitate flotation

    International Nuclear Information System (INIS)

    Aziz, M.; Shakir, K.; Benyamin, K.

    1986-01-01

    The coprecipitate flotation of 134 Cs from radioactive process waste water using copper ferrocyanide as a coprecipitating agent and sodium lauryl sulphate, cetyl trimethyl ammonium bromide or gelatin as collector was extensively investigated to establish the best conditions for caesium removal with each of the collectors under test. The investigated parameters include the collector dosage, the Cu 2+ /Fe(CN) 6 4- ratio, the caesium, potassium, sodium and calcium ion concentrations, the ageing time period of the Cu 2+ - Fe(CN) 6 4- - 134 Cs - water system and the bubbling time duration. The results indicate that copper ferrocyanide has a high affinity for caesium and can preferentially co-precipitate it in presence of relatively high amounts of other alkali or alkaline earth cations. For the alkali metals the affinity increases in the order Na < K < Cs. Under the optimal conditions removals higher than 99% could be achieved with any of the tested collectors. The results are discussed in terms of the ion exchange properties of copper ferrocyanide and collector behaviour. Advantages of the coflotation technique over other methods are enumerated. (Auth.)

  11. Decomposition of SF6-R134a effluents by RF plasma

    International Nuclear Information System (INIS)

    Joshi, Avinash V.

    2012-01-01

    The efficiency of recovery achieved by open or closed loop extraction of RPC exhaust gases is in the range of 90-95% under optimum conditions. For a large detector setup operating on one volume change per day basis, a 5% loss amounts to discharging 50 kg of R134a and 0.5 kg of SF 6 into atmosphere every day. The emissions are equivalent to create nearly 50 000 m 3 of carbon dioxide daily. The gas emissions need to be completely converted to safer compounds. The gases such as R134a and SF 6 are stable compounds. In order to decompose these, the mixture is first activated by adding of 50% oxygen and 2% argon and under typical RF plasma conditions of 13.56 MHz, 1 Torr pressure and 0.2 W/cm 2 power density. The chemical reaction takes place on the surface of a silicon electrode. The product of the reaction is mainly SiF 4 (gas), which is further hydrolyzed to form HF solution and silicon hydroxide sludge. More than 90% of the effluent gas mixture can be effectively removed by this method.

  12. Effects of cilostazol and k-134 on reconstructive surgery using prosthetic grafts in the abdominal aorta of beagle dogs.

    Science.gov (United States)

    Inoue, Yoshinori; Sugano, Norihide; Jibiki, Masatoshi; Kudo, Toshifumi; Iwai, Takehisa

    2008-01-01

    Problems associated with prosthetic graft replacement are stenosis at the anastomosis site and thrombus formation on the inner surface. Cilostazol is known to have antiplatelet activity and inhibit vascular smooth muscle cell proliferation and neointima thickening. A cilostazol derivative, (-)-6-[3-[3-cyclopropyl-3-[(1R,2R)-2-hydroxycyclohexyl]ureido]-propoxy]-2-(1H)-quinolinone (K-134), has more potent anti-platelet activity and anti-neointimal thickening activity than cilostazol in the in-vitro platelet aggregation and in-vivo anti-hyperplastic activity assay. The aim of this study was to investigate effects of cilostazol and K-134 on thrombus formation and neointimal thickening at the site of prosthetic graft replacement. Beagle dogs underwent infrarenal abdominal aortic resection with straight Dacron graft replacement, which were allocated to the control, cilostazol, and K-134 groups. Two dogs were dead without confirming the cause of death. After 6 months, all dogs were necropsied. All prosthetic grafts were patent in each group. Ratios of red thrombus to prosthetic graft area were 0.3+/-6.4%, and 3.3+/-4.5% in the cilostazol and K-134 groups, respectively, which were significant different from that in the control group (24.4+/-16.8%). However, no clear difference was seen among the 3 groups with respect to neointimal thickness (control group, 0.70+/-0.13 mm; cilostazol group, 0.59+/-0.14 mm; K-134 group, 0.67+/-0.14 mm). Cilostazol and K-134 significantly inhibited thrombus formation on the inner surface of the prosthetic graft at 6 months after graft replacement. Neointimal thickening on the inner surface was slight even in control-group animals, and the effects of cilostazol and K-134 on such thickening were unclear.

  13. MicroRNA-134 regulates lung cancer cell H69 growth and apoptosis by targeting WWOX gene and suppressing the ERK1/2 signaling pathway

    International Nuclear Information System (INIS)

    Chen, Tianjun; Gao, Fei; Feng, Sifang; Yang, Tian; Chen, Mingwei

    2015-01-01

    MicroRNAs have been shown to act as crucial modulators during carcinogenesis. Recent studies have implied that miR-134 expression associated with epithelial-to-mesenchymal transition phenotype and invasive potential of NSCLC cells. Our study investigated the pathogenic implications of miR-134 in small cell lung cancer (SCLC). Overexpression or inhibition MiR-134 expression by miR-134 mimics or miR-134 inhibitors (anti-miR-134) in SCLC cell lines was detected using qRT-PCR. Lactate dehydrogenase (LDH) assay, MTT assays and flow cytometry were performed in order to clarify the growth and apoptosis of SCLC cells which had been transfected with miR-134 mimics or anti-miR-134. WWOX expression in H69 cells was detected by qRT-PCR and western blot, respectively. The results showed that overexpression miR-134 was significantly promoting SCLC cells growth and inhibit its apoptosis. In addition, reduced miR-134 expression was significantly correlated with cell growth inhibition and apoptosis promotion. Furthermore, transfection of miR-134 mimics into the SCLC cells markedly down-regulated the level of WWOX, whereas, anti-miR-134 up-regulated WWOX expression. We also found that overexpression WWOX attenuate miR-134 induced H69 cells growth, and promote cell apoptosis. Moreover, miR-134 promoted cell proliferation and inhibit apoptosis via the activation of ERK1/2 pathway. These findings suggest that miR-134 may be an ideal diagnostic and prognostic marker, and may be attributed to the molecular therapy of SCLC. - Highlights: • MiR-134 play roles in small cell lung cancer cell growth and apoptosis. • MiR-134 negative regulated the level of WWOX in H69 cells. • WWOX overexpression attenuate miR-134 induced H69 cells growth. • MiR-134 promotes cell growth via the activation of ERK1/2 pathway

  14. Design, synthesis, characterization, and OFET properties of amphiphilic heteroleptic tris(phthalocyaninato) europium(III) complexes. The effect of crown ether hydrophilic substituents.

    Science.gov (United States)

    Gao, Yingning; Ma, Pan; Chen, Yanli; Zhang, Ying; Bian, Yongzhong; Li, Xiyou; Jiang, Jianzhuang; Ma, Changqin

    2009-01-05

    Two amphiphilic heteroleptic tris(phthalocyaninato) europium complexes with hydrophilic crown ether heads and hydrophobic octyloxy tails [Pc(mCn)(4)]Eu[Pc(mCn)(4)]Eu[Pc(OC(8)H(17))(8)] [m = 12, n = 4, H(2)Pc(12C4)(4) = 2,3,9,10,16,17,23,24-tetrakis(12-crown-4)phthalocyanine; m = 18, n = 6, H(2)Pc(18C6)(4) = 2,3,9,10,16,17,23,24-tetrakis(18-crown-6)phthalocyanine; H(2)Pc(OC(8)H(17))(8) = 2,3,9,10,16,17,23,24-octakis(octyloxy)phthalocyanine] (1, 2) were designed and prepared from the reaction between homoleptic bis(phthalocyaninato) europium compound [Pc(mCn)(4)]Eu[Pc(mCn)(4)] (m = 12, n = 4; m = 18, n = 6) and metal-free H(2)Pc(OC(8)H(17))(8) in the presence of Eu(acac)(3).H(2)O (Hacac = acetylacetone) in boiling 1,2,4-trichlorobenzene. These novel sandwich triple-decker complexes were characterized by a wide range of spectroscopic methods and electrochemically studied. With the help of the Langmuir-Blodgett technique, these typical amphiphilic triple-decker complexes were fabricated into organic field effect transistors (OFET) with top contact configuration on bare SiO(2)/Si substrate, hexamethyldisilazane-treated SiO(2)/Si substrate, and octadecyltrichlorosilane (OTS)-treated SiO(2)/Si substrate, respectively. The device performance is revealed to be dependent on the species of crown ether substituents and substrate surface treatment. OFETs fabricated from the triple decker with 12-crown-4 hydrophilic substituents, 1, allow the hole transfer in the direction parallel to the aromatic phthalocyanine rings. In contrast, the devices of a triple-decker compound containing 18-crown-6 as hydrophilic heads, 2, transfer holes in a direction along the long axis of the assembly composed of face-to-face aggregated triple-decker molecules, revealing the effect of molecular structure, specifically the crown ether substituents on the film structure and OFET functional properties. The carrier mobility for hole as high as 0.33 cm(2) V(-1) s(-1) and current modulation of 7.91 x 10

  15. Europium-decorated graphene quantum dots as a fluorescent probe for label-free, rapid and sensitive detection of Cu{sup 2+} and L-cysteine

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Liping [College of Life Sciences, Fujian Agriculture and Forestry University, Fuzhou, 350002 (China); Song, Xinhong; Chen, Yiying; Rong, Mingcong; Wang, Yiru [Department of Chemistry and the MOE Key Laboratory of Spectrochemical Analysis & Instrumentation, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen, 361005 (China); Zhao, Li; Zhao, Tingting [Xiamen Huaxia College, Xiamen, 361024 (China); Chen, Xi, E-mail: xichen@xmu.edu.cn [Department of Chemistry and the MOE Key Laboratory of Spectrochemical Analysis & Instrumentation, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen, 361005 (China); State Key Laboratory of Marine Environmental Science, Xiamen University, Xiamen, 361005 (China)

    2015-09-03

    In this work, europium-decorated graphene quantum dots (Eu-GQDs) were prepared by treating three-dimensional Eu-decorated graphene (3D Eu-graphene) via a strong acid treatment. Various characterizations revealed that Eu atoms were successfully complexed with the oxygen functional groups on the surface of graphene quantum dots (GQDs) with the atomic ratio of 2.54%. Compared with Eu free GQDs, the introduction of Eu atoms enhanced the electron density and improved the surface chemical activities of Eu-GQDs. Therefore, the obtained Eu-GQDs were used as a novel “off-on” fluorescent probe for the label-free determination of Cu{sup 2+} and L-cysteine (L-Cys) with high sensitivity and selectivity. The fluorescence intensity of Eu-GQDs was quenched in the presence of Cu{sup 2+} owing to the coordination reaction between Cu{sup 2+} and carboxyl groups on the surface of the Eu-GQDs. The fluorescence intensity of Eu-GQDs recovered with the subsequent addition of L-Cys because of the strong affinity of Cu{sup 2+} to L-Cys via the Cu–S bond. The experimental results showed that the fluorescence variation of the proposed approach had a good linear relationship in the range of 0.1–10 μM for Cu{sup 2+} and 0.5–50 μM for L-Cys with corresponding detection limits of 0.056 μM for Cu{sup 2+} and 0.31 μM for L-Cys. The current approach also displayed a special response to Cu{sup 2+} and L-Cys over the other co-existing metal ions and amino acids, and the results obtained from buffer-diluted serum samples suggested its applicability in biological samples. - Highlights: • The europium-decorated graphene quantum dots (Eu-GQDs) have been successfully prepared. • Various characterizations results proved that Eu atoms were successfully introduced into graphene quantum dots. • The introduced Eu atoms changed the electron density and surface chemical activities of Eu-GQDs. • Eu-GQDs were used as an “off-on” fluorescent probe for Cu{sup 2+} and L-cysteine detection

  16. Direct or photostimulated luminescence after X-Ray irradiation of divalent europium in alkaline earth compounds containing some halides; Luminescence directe ou photostimulee apres irradiation X de l'europium divalent dans des familles de composes alcalino-terreux comportant un halogene

    Energy Technology Data Exchange (ETDEWEB)

    Merigou, C

    1990-10-15

    With a view for digitizing of radiological images, the luminescent properties of divalent europium in diverse halogen compounds involving strontium or barium have been studied. In halogen-rich compounds (MCl{sub 2}, M{sub 4}OCl{sub 6}, M{sub 5}SiO{sub 4}Cl{sub 6},... where M is Sr or Ba), the thermal extinction of the emission begins only above 300 K. High densities of coloured spots have been produced with X-ray irradiation. The combining of these 2 features has led to the obtention of high yields for argon laser stimulated luminescence in the case of Sr{sub 5}SiO{sub 4}Cl{sub 5}Br:Eu halogen silicate. Although these yields are high they stay below that of BaXF:Eu which is usually used in photon-stimulated screens.

  17. The radioimmunotoxicological and radiogenotoxicological effect induced by 134Cs retention in the whole body and skeleton and germ system

    International Nuclear Information System (INIS)

    Zhu Shoupeng; Xia Fen; Yang Weidong

    1993-05-01

    A fitted equation to describe the retention of 134 Cs in whole body is obtained by a whole body counter. The equation consists of two half-life components, the fast component is T 1/2 = 0.07 d and the slow component is T 1/2 = 16.14 d. Two fitted equations describing the retention of 134 Cs in skeleton and testes are also introduced. The T 1/2 in skeleton is 5.73 d and in testes is 5.21 d. The results of investigating radioimmunotoxicological effect induced by 134 Cs show that the inhibition of thymus cells is higher than bone marrow cells, the spleen T-lymphocytes is more sensitive to 134 Cs than B-lymphocytes and lymphocytes of peripheral immune organ are more sensitive to radiation than central immune cells and thymus cells. The study of radiogenotoxicological effect induced by 134 Cs shows that the chromosome aberration frequencies and PCE micronucleus formation in bone marrow cells are significantly high, it can induce chromosome aberrations of spermatogonia and increases the abnormality of sperm. The relations between injected dose and abnormalities can be expressed by power functions

  18. FAM134B, the Selective Autophagy Receptor for Endoplasmic Reticulum Turnover, Inhibits Replication of Ebola Virus Strains Makona and Mayinga.

    Science.gov (United States)

    Chiramel, Abhilash I; Dougherty, Jonathan D; Nair, Vinod; Robertson, Shelly J; Best, Sonja M

    2016-10-15

    Selective autophagy of the endoplasmic reticulum (termed ER-phagy) is controlled by members of the FAM134 reticulon protein family. Here we used mouse embryonic fibroblasts from mice deficient in FAM134B to examine the role of the ER in replication of historic (Mayinga) or contemporary (Makona GCO7) strains of Ebola virus (EBOV). Loss of FAM134B resulted in 1-2 log 10 higher production of infectious EBOV, which was associated with increased production of viral proteins GP and VP40 and greater accumulation of nucleocaspid lattices. In addition, only 10% of wild-type cells contained detectable nucleoprotein, whereas knockout of FAM134B resulted in 80% of cells positive for nucleoprotein. Together, these data suggest that FAM134B-dependent ER-phagy is an important limiting event in EBOV replication in mouse cells and may have implications for further development of antiviral therapeutics and murine models of infection. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  19. All-atom simulation study of protein PTH(1-34) by using the Wang-Landau sampling method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung-Yeon [Korea National University of Transportation, Chungju (Korea, Republic of); Kwak, Woo-Seop [Chosun University, Gwangju (Korea, Republic of)

    2014-12-15

    We perform simulations of the N-terminal 34-residue protein fragment PTH(1-34), consisting of 581 atoms, of the 84-residue human parathyroid hormone by using the all-atom ECEPP/3 force field and the Wang-Landau sampling method. Through a massive high-performance computation, the density of states and the partition function Z(T), as a continuous function of T, are obtained for PTH(1-34). From the continuous partition function Z(T), the partition function zeros of PTH(1-34) are evaluated for the first time. From both the specific heat and the partition function zeros, two characteristic transition temperatures are obtained for the all-atom protein PTH(1-34). The higher transition temperature T{sub 1} and the lower transition temperature T{sub 2} of PTH(1-34) can be interpreted as the collapse temperature T{sub θ} and the folding temperature T{sub f} , respectively.

  20. Mobility of superficially applied caesium-134 and strontium-85 in apple branches under precipitation-free conditions

    International Nuclear Information System (INIS)

    Bengtsson, G.B.

    1992-01-01

    The recovery of superficially applied 134 Cs + and 85 Sr 2+ in apple branches protected from precipitation decreased with time. Translocation of 134 Cs to uncontaminated branches declined rapidly with the distance from the contaminated branches. Extensive translocation of 134 Cs from foliage to fruits occurred within the same branch: after 84 d, 50% of the recovered activity was found in fruits and most of it in the edible part (excluding peel). On the other hand, 85 Sr was less mobile and in virtually all fruit 85 Sr was in the peel. Rinsing leaves removed 30% of both radionuclides 1 d after contamination and decreasing fractions later on. Rinsing fruits removed up to 62% of the peel radionuclides. Further rinses and washes (plus detergent) of fruits showed that 134 Cs had the same distribution in the outer skin as 85 Sr and that the ratio of the two nuclides was close to the ratio in the contamination solution. This indicates that apple skin is a barrier not only to 85 Sr, but probably also to 134 Cs. Unaccounted for disappearance of radioactivity from fruits and leaves could have been a result to field losses of small superficial particles. (author)