WorldWideScience

Sample records for europaea physiologiae clinicae

  1. Fauna Europaea

    DEFF Research Database (Denmark)

    Pape, Thomas; Beuk, Paul; Pont, Adrian Charles

    2015-01-01

    Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all extant multicellular European terrestrial and freshwater animals and their geographical distribution at the level of countries and major islands (east of the Urals and excluding...... density, and the more fertile habitats are extensively cultivated. This has undoubtedly increased the extinction risk for numerous species of brachyceran flies, yet with the recent re-discovery of Thyreophoracynophila (Panzer), there are no known cases of extinction at a European level. However, few...

  2. La filosofia clinica di Wittgenstein

    Directory of Open Access Journals (Sweden)

    Lorenzo Ghirelli

    2017-01-01

    Full Text Available Intento del presente saggio è quello di tracciare le linee principali della filosofia di Wittgenstein definendone l’orizzonte operativo e la strategia d’azione. Seguiremo inizialmente i cambiamenti nella concezione del linguaggio e del significato del filosofo austriaco utilizzandoli come traccia per registrare le corrispondenti revisioni degli obiettivi, delle tecniche e delle forme del far filosofia da lui proposte. Cercheremo poi di analizzare la pratica filosofica prospettata dal Wittgenstein maturo evidenziandone alcuni aspetti che ci consentiranno di qualificarla come clinica.

  3. Fauna Europaea - Orthopteroid orders.

    Science.gov (United States)

    Heller, Klaus-Gerhard; Bohn, Horst; Haas, Fabian; Willemse, Fer; de Jong, Yde

    2016-01-01

    Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all extant European terrestrial and freshwater animals, their geographical distribution at the level of countries and major islands (west of the Urals and excluding the Caucasus region), and some additional information. The Fauna Europaea project comprises about 230,000 taxonomic names, including 130,000 accepted species and 14,000 accepted subspecies, which is much more than the originally projected number of 100,000 species. Fauna Europaea represents a huge effort by more than 400 contributing specialists throughout Europe and is a unique (standard) reference suitable for many users in science, government, industry, nature conservation and education. The "Orthopteroid orders" is one of the 58 Fauna Europaea major taxonomic groups. It contains series of mostly well-known insect orders: Embiodea (webspinners), Dermaptera (earwigs), Phasmatodea (walking sticks), Orthoptera s.s. (grasshoppers, crickets, bush-crickets) and Dictyoptera with the suborders Mantodea (mantids), Blattaria (cockroaches) and Isoptera (termites). For the Orthopteroid orders, data from 35 families containing 1,371 species are included in this paper.

  4. Fauna Europaea: Mollusca - Bivalvia

    NARCIS (Netherlands)

    Araujo, R.; de Jong, Y.

    2015-01-01

    Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all living European land and freshwater animals, their geographical distribution at country level (up to the Urals, excluding the Caucasus region), and some additional information. The

  5. Fauna Europaea - Orthopteroid orders

    NARCIS (Netherlands)

    Heller, K.-G.; Bohn, H.; Haas, F.; Willemse, F.; de Jong, Y.

    2016-01-01

    Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all extant European terrestrial and freshwater animals, their geographical distribution at the level of countries and major islands (west of the Urals and excluding the Caucasus region),

  6. Fauna Europaea: Helminths (Animal Parasitic)

    Czech Academy of Sciences Publication Activity Database

    Gibson, D. I.; Bray, R. A.; Hunt, D.; Georgiev, B. B.; Scholz, Tomáš; Harris, P.D.; Bakke, T.A.; Pomajska, T.; Niewiadomska, K.; Kostadinova, Aneta; Tkach, V.; Bain, O.; Durette-Desset, M.-C.; Gibbons, L.; Moravec, František; Petter, A.; Dimitrova, Z.M.; Buchmann, K.; Valtonen, E. T.; de Jong, Y.

    -, č. 2 (2014), e1060 ISSN 1314-2828 Institutional support: RVO:60077344 Keywords : Acanthocephala * Biodiversity * Biodiversity Informatics * Cestoda * Fauna Europaea * Helminth * Monogenea * Nematoda * Parasite * Taxonomic indexing * Taxonomy * Trematoda * Zoology Subject RIV: EB - Genetics ; Molecular Biology

  7. Fauna Europaea – Orthopteroid orders

    Science.gov (United States)

    Bohn, Horst; Haas, Fabian; Willemse, Fer

    2016-01-01

    Abstract Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all extant European terrestrial and freshwater animals, their geographical distribution at the level of countries and major islands (west of the Urals and excluding the Caucasus region), and some additional information. The Fauna Europaea project comprises about 230,000 taxonomic names, including 130,000 accepted species and 14,000 accepted subspecies, which is much more than the originally projected number of 100,000 species. Fauna Europaea represents a huge effort by more than 400 contributing specialists throughout Europe and is a unique (standard) reference suitable for many users in science, government, industry, nature conservation and education. The “Orthopteroid orders“ is one of the 58 Fauna Europaea major taxonomic groups. It contains series of mostly well-known insect orders: Embiodea (webspinners), Dermaptera (earwigs), Phasmatodea (walking sticks), Orthoptera s.s. (grasshoppers, crickets, bush-crickets) and Dictyoptera with the suborders Mantodea (mantids), Blattaria (cockroaches) and Isoptera (termites). For the Orthopteroid orders, data from 35 families containing 1,371 species are included in this paper. PMID:27660531

  8. An evening at "La Clinica del Pueblo".

    Science.gov (United States)

    Shefsky, M L

    1986-01-01

    This article describes a typical evening at the Clinica del Pueblo in the Hispanic neighborhood of Adams-Morgan in Washington, D.c. The Clinical del Pueblo began operating in 1983 in response to the urgen medical needs of Central American refugees arriving in the Washington D.c. area. The refugees bring with them severe trauma, fear, and health problems caused by the civil was and exacerbated by inadequate or non-existant health services. Approximately 80,000 Salvadoran refugees live in the area. They do not receive adequate health care for 3 reasons. 1) Because the US goverment is unwilling to recognize them as true refugees, they live with the constant threat of deportatin back to the violence from which they have fled. 2) Refugees lack the ability to pay for private care. 3) Langauage and culture create frightening barriers to health care for the refugees. For those who do seek care, these barriers can lead to the inadequate or incomplete diagnoses and poor compliance and follow-up. Plenty International and the Central American Refugee Center responded to these problems by organizing a free clinic to provide not only medical care but also a training course for volunteers. The director of the clinic organizes the course, the classes are taught by a variety of people including the clinic's volunteer physicians, nurses, and public health educators as well as graduates of previus training courses and people from the wider community. The services of the clinic reach only a small portion of the population in need. However, the fact that free medical services are now available to some Central American refugees make the Clinica del Pueblo an important program.

  9. Automated Transformation of CDISC ODM to OpenClinica.

    Science.gov (United States)

    Gessner, Sophia; Storck, Michael; Hegselmann, Stefan; Dugas, Martin; Soto-Rey, Iñaki

    2017-01-01

    Due to the increasing use of electronic data capture systems for clinical research, the interest in saving resources by automatically generating and reusing case report forms in clinical studies is growing. OpenClinica, an open-source electronic data capture system enables the reuse of metadata in its own Excel import template, hampering the reuse of metadata defined in other standard formats. One of these standard formats is the Operational Data Model for metadata, administrative and clinical data in clinical studies. This work suggests a mapping from Operational Data Model to OpenClinica and describes the implementation of a converter to automatically generate OpenClinica conform case report forms based upon metadata in the Operational Data Model.

  10. Fauna Europaea: Helminths (Animal Parasitic

    Directory of Open Access Journals (Sweden)

    David Gibson

    2014-09-01

    Full Text Available Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms of all living European land and freshwater animals, their geographical distribution at country level (up to the Urals, excluding the Caucasus region, and some additional information. The Fauna Europaea project covers about 230,000 taxonomic names, including 130,000 accepted species and 14,000 accepted subspecies, which is much more than the originally projected number of 100,000 species. This represents a huge effort by more than 400 contributing specialists throughout Europe and is a unique (standard reference suitable for many users in science, government, industry, nature conservation and education. Helminths parasitic in animals represent a large assemblage of worms, representing three phyla, with more than 200 families and almost 4,000 species of parasites from all major vertebrate and many invertebrate groups. A general introduction is given for each of the major groups of parasitic worms, i.e. the Acanthocephala, Monogenea, Trematoda (Aspidogastrea and Digenea, Cestoda and Nematoda. Basic information for each group includes its size, host-range, distribution, morphological features, life-cycle, classification, identification and recent key-works. Tabulations include a complete list of families dealt with, the number of species in each and the name of the specialist responsible for data acquisition, a list of additional specialists who helped with particular groups, and a list of higher taxa dealt with down to the family level. A compilation of useful references is appended.

  11. Fauna Europaea - all European animal species on the web

    DEFF Research Database (Denmark)

    de Jong, Yde; Verbeek, Melina; Michelsen, Verner

    2014-01-01

    Abstract Fauna Europaea is Europe's main zoological taxonomic index, making the scientific names and distributions of all living, currently known, multicellular, European land and freshwater animals species integrally available in one authoritative database. Fauna Europaea covers about 260...

  12. Book review. Semeiologia Clinica Veterinaria. (a cura di Paolo Ciaramella

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-09-01

    Full Text Available Il grado di specializzazione raggiunto nel settore clinico veterinario non è dissimile da quello presente in campo umano, soprattutto se si pensa agli animali d'affezione che sono oramai considerati parte integrante di una società moderna e civile in cui anche il fattore benessere animale ha acquisito importanza non secondaria, in particolare nell'allevamento degli animali da reddito. In questo contesto è sempre più richiesta la figura di uno specialista competente e aggiornato, in grado di risolvere in modo adeguato le problematiche che gli vengono proposte, in un mercato in concorrenza che non contempla imperizia, inesperienza e ignoranza professionale. Lo studio della semeiologia clinica è uno dei primi passi di questo lungo e affascinate cammino che permette di apprendere un metodo di analisi sistematico, affidabile, efficiente e accurato per educare il futuro medico veterinario verso le procedure della buona pratica clinica. La semeiotica insegna ad allenare i propri sensi: a guardare attraverso l'osservazione diretta e indiretta, a sentire ascoltando suoni o rumori, a percepire sensazioni tattili e, non da ultimo, a saper discernere con cognizione e competenza quando ricorrere alle indagini strumentali e di laboratorio; sempre e comunque nella consapevolezza che non possono in nessun modo sostituire l'esame fisico diretto del paziente. Paolo Ciaramella, professore ordinario di Clinica Medica Veterinaria all'Università Federico II di Napoli, presenta così il volume che ha curato: "L'idea di questo libro ha preso forma durante un simposio di medicina interna tenutosi a Torino nel 2008. Con alcuni colleghi presenti si pensò alla possibilità di elaborare un nuovo testo di Semeiotica Medica che potesse ampliare e aggiornare il glorioso Messieri e Moretti, non tanto perché esso avesse perduto il suo valore intrinseco, quanto piuttosto perché nel corso degli anni sono cambiate la patologia animale e con essa la semeiotica e la clinica

  13. [Analysis of utilization of information in the journal Medicina Clinica].

    Science.gov (United States)

    Aleixandre, R; Giménez Sánchez, J V; Terrada, M L; López Piñero, J M

    1994-09-10

    Scientific communication knowledge is specifically based in the analysis of the bibliographic references inside the publications. Pattern and laws determining the information consumption in the items of the journal Medicina Clinica are investigated in the present study as its own aim. An analysis was performed on the 13,286 references downloaded from 618 papers published by the journal in 1990. With dBASE IV was generated a database for the management of the information; data was distributed in several tables through criteria of age, documentary types, countries, journals and Bradford zones. The analysed references belong to 1,241 different journals, 110 from Spain. Being two thirds of the total sum, the publications from United States and United Kingdom have received more citations than those from Spain. The publications from european countries, like France, Germany and Italy, are scarcely present. Bradford core is constituted by the journals Medicina Clinica and The Lancet. The analysis of the bibliographic references available from the articles in this journal is able to produce knowledge on the information consumption by the practitioners; its usefulness as a complementary utility to the Indice de Citas e Indicadores Bibliométricos de Revistas Españolas de Medicina Interna y sus especialidades 1990 must be considered.

  14. Somatic Embryogenesis in Olive (Olea europaea L. subsp. europaea var. sativa and var. sylvestris).

    Science.gov (United States)

    Rugini, Eddo; Silvestri, Cristian

    2016-01-01

    Protocols for olive somatic embryogenesis from zygotic embryos and mature tissues have been described for both Olea europaea sub. europaea var. sativa and var. sylvestris. Immature zygotic embryos (no more than 75 days old), used after fruit collection or stored at 12-14 °C for 2-3 months, are the best responsive explants and very slightly genotype dependent, and one single protocol can be effective for a wide range of genotypes. On the contrary, protocols for mature zygotic embryos and for mature tissue of cultivars are often genotype specific, so that they may require many adjustments according to genotypes. The use of thidiazuron and cefotaxime seems to be an important trigger for induction phase particularly for tissues derived from cultivars. Up to now, however, the application of this technique for large-scale propagation is hampered also by the low rate of embryo germination; it proves nonetheless very useful for genetic improvement.

  15. Acta Clinica Croatica: progress of a journal step by step.

    Science.gov (United States)

    Ramljak, Gordana

    2014-03-01

    The journal Acta Clinica Croatica (ACC) was founded in 1962 under the title Anali Bolnice Dr. M. Stojanović. In 1995, the title of the journal was changed into its present form and ever since all papers have been published in English. In 2000, the electronic (online) edition of the ACC was released in addition to the print version. The paper presents development of the journal from 1962 to 2012 based on the analysis of the following SCOPUS citation index parameters: type and number of documents published in the journal; number of citations; and number of domestic and foreign authors. The studied period was analyzed in three time segments: the period from 1995 to 1999, the period from 2000 to 2006 and the period from 2007 to 2012. The same parameters were analyzed in the Web of Science/SCI-Expanded bibliographic and citation index for the 2007-2012 period. The increasing number of documents, authors (both domestic and foreign) and citations demonstrates gradual rise in the quality, visibility and impact of the journal. The fifty years of experience show that a goal, at first very distant and almost unachievable, may be reached by progressing step by step.

  16. Pier Diego Siccardi (1880-1917) and the "Clinica del Lavoro" in the trench warfare.

    Science.gov (United States)

    Riva, Michele Augusto; Caramella, Michela; Turato, Massimo; Cesana, Giancarlo

    2017-12-14

    The year 2017 marks the centenary of the death of the Italian scientist Pier Diego Siccardi (1880-1917), one of Luigi Devoto's assistants at the "Clinica del Lavoro" in Milan. To commemorate Siccardi and to describe the activities of the physicians of the "Clinica del Lavoro" during World War I. A comprehensive analysis was conducted on scientific papers written by Pier Diego Siccardi and by other physicians belonging to the Clinica del Lavoro, in the period 1915-1918. During the Great War, the Clinica del Lavoro became a military hospital, even though it indirectly maintained a role in Occupational Health, assisting women who had started to work to replace the men sent to the front. Devoto and his assistants were drafted as Army doctors, but continued their research activities while at the front; focusing on the diseases that affected the soldiers, mainly infections. Bleeding fevers and jaundice were endemic among Italian troops, but their etiology was unknown. Pier Diego Siccardi identified this syndrome as an infection caused by a spirochete, and was the first one to isolate the infectious agent. Siccardi prematurely died of the same disease as a consequence of a laboratory accident, which provided further confirmation for his research. The heroic life of Siccardi and his tragic death testify the important activities of the scientists of the "Clinica del Lavoro" in the years of the Great War.

  17. Oncology patients hospitalized in the Clinicas Hospital Dr. Manuel Quintela

    International Nuclear Information System (INIS)

    Arostegui, M.; Borba, M.; Caldarelli, D.; Eguiia, A.; Fernandez, E.; Peleteiro, M.; Pereira, C.; Vico, M.

    2004-01-01

    This work was carried out by a nursery licensed group in the Clinicas Hospital - Dr. Manuel Quintela.The nature and functioning of Services and the allocation of resources, are essential for the analysis of the Survey of the hospitalized oncology patients in the Institution. To develop a model of care that constitutes a health care as well as teaching and research in the country regarding the quality of care was defined the following topics: lower risks for the patient, safer care, personal trained and specialized to promote relationship between the offering and the person receiving the service. The assessment and management performance of the services involved in the operation are the result of the degree of user satisfaction. Objective: To determine the human and material necessary for the care of cancer resources users, considering their number, treatment, complications and nursing care derived from each pathology and stage of disease. Methodology: A comparative descriptive study of the same population was conducted in two transverse sections in relation to two different times which are based on the design of a form that allowed hospitalized to collect information on users 6/12/03 and 6/16/04. Other instruments used were the clinical history and the daily census staff Patients and Nursing Division. Results and conclusions: A comparative descriptive analysis already mentioned are: increased internships and cancer patients; between 50 and 64 is the highest number of patients; diagnoses Face and Neck and maintain the Digestive System more cases; the number of patients doubles and Hematology Neurological from one to another period. Chemotherapy is the treatment choice and there is a decrease in the surgical and medical; more patients in the study; in the origin, Montevideo has the largest number of patients followed by Canelones. Line of nursing intervention will be carried out in short, medium and long term

  18. Traditional Uses, Phytochemistry, and Pharmacology of Olea europaea (Olive

    Directory of Open Access Journals (Sweden)

    Muhammad Ali Hashmi

    2015-01-01

    Full Text Available Aim of the Review. To grasp the fragmented information available on the botany, traditional uses, phytochemistry, pharmacology, and toxicology of Olea europaea to explore its therapeutic potential and future research opportunities. Material and Methods. All the available information on O. europaea was collected via electronic search (using Pubmed, Scirus, Google Scholar, and Web of Science and a library search. Results. Ethnomedical uses of O. europaea are recorded throughout the world where it has been used to treat various ailments. Phytochemical research had led to the isolation of flavonoids, secoiridoids, iridoids, flavanones, biophenols, triterpenes, benzoic acid derivatives, isochromans, and other classes of secondary metabolites from O. europaea. The plant materials and isolated components have shown a wide spectrum of in vitro and in vivo pharmacological activities like antidiabetic, anticonvulsant, antioxidant, anti-inflammatory, immunomodulatory, analgesic, antimicrobial, antiviral, antihypertensive, anticancer, antihyperglycemic, antinociceptive, gastroprotective, and wound healing activities. Conclusions. O. europaea emerged as a good source of traditional medicine for the treatment of various ailments. The outcomes of phytochemical and pharmacological studies reported in this review will further expand its existing therapeutic potential and provide a convincing support to its future clinical use in modern medicine.

  19. Traditional Uses, Phytochemistry, and Pharmacology of Olea europaea (Olive)

    Science.gov (United States)

    Hashmi, Muhammad Ali; Khan, Afsar; Hanif, Muhammad; Farooq, Umar; Perveen, Shagufta

    2015-01-01

    Aim of the Review. To grasp the fragmented information available on the botany, traditional uses, phytochemistry, pharmacology, and toxicology of Olea europaea to explore its therapeutic potential and future research opportunities. Material and Methods. All the available information on O. europaea was collected via electronic search (using Pubmed, Scirus, Google Scholar, and Web of Science) and a library search. Results. Ethnomedical uses of O. europaea are recorded throughout the world where it has been used to treat various ailments. Phytochemical research had led to the isolation of flavonoids, secoiridoids, iridoids, flavanones, biophenols, triterpenes, benzoic acid derivatives, isochromans, and other classes of secondary metabolites from O. europaea. The plant materials and isolated components have shown a wide spectrum of in vitro and in vivo pharmacological activities like antidiabetic, anticonvulsant, antioxidant, anti-inflammatory, immunomodulatory, analgesic, antimicrobial, antiviral, antihypertensive, anticancer, antihyperglycemic, antinociceptive, gastroprotective, and wound healing activities. Conclusions. O. europaea emerged as a good source of traditional medicine for the treatment of various ailments. The outcomes of phytochemical and pharmacological studies reported in this review will further expand its existing therapeutic potential and provide a convincing support to its future clinical use in modern medicine. PMID:25802541

  20. Gene expression profiles of Nitrosomonas europaea, an obligate chemolitotroph

    Energy Technology Data Exchange (ETDEWEB)

    Daniel J Arp

    2005-06-15

    Nitrosomonas europaea is an aerobic lithoautotrophic bacterium that uses ammonia (NH3) as its energy source. As a nitrifier, it is an important participant in the nitrogen cycle, which can also influence the carbon cycle. The focus of this work was to explore the genetic structure and mechanisms underlying the lithoautotrophic growth style of N. europaea. Whole genome gene expression. The gene expression profile of cells in exponential growth and during starvation was analyzed using microarrays. During growth, 98% of the genes increased in expression at least two fold compared to starvation conditions. In growing cells, approximately 30% of the genes were expressed eight fold higher, Approximately 10% were expressed more than 15 fold higher. Approximately 3% (91 genes) were expressed to more than 20 fold of their levels in starved cells. Carbon fixation gene expression. N. europaea fixes carbon via the Calvin-Benson-Bassham (CBB) cycle via a type I ribulose bisphosphate carboxylase/oxygenase (RubisCO). This study showed that transcription of cbb genes was up-regulated when the carbon source was limited, while amo, hao and other energy harvesting related genes were down-regulated. Iron related gene expression. Because N. europaea has a relatively high content of hemes, sufficient Fe must be available in the medium for it to grow. The genome revealed that approximately 5% of the coding genes in N. europaea are dedicated to Fe transport and assimilation. Nonetheless, with the exception of citrate biosynthesis genes, N. europaea lacks genes for siderophore production. The Fe requirements for growth and the expression of the putative membrane siderophore receptors were determined. The N. europaea genome has over 100 putative genes ({approx}5% of the coding genes) related to Fe uptake and its siderophore receptors could be grouped phylogenetically in four clusters. Fe related genes, such as a number of TonB-dependent Fe-siderophore receptors for ferrichrome and

  1. Gene expression profiles of Nitrosomonas europaea, an obligate chemolitotroph

    Energy Technology Data Exchange (ETDEWEB)

    Daniel J. Arp

    2005-05-25

    Nitrosomonas europaea is an aerobic lithoautotrophic bacterium that uses ammonia (NH3) as its energy source. As a nitrifier, it is an important participant in the nitrogen cycle, which can also influence the carbon cycle. The focus of this work was to explore the genetic structure and mechanisms underlying the lithoautotrophic growth style of N. europaea. Whole genome gene expression: The gene expression profile of cells in exponential growth and during starvation was analyzed using microarrays. During growth, 98% of the genes increased in expression at least two fold compared to starvation conditions. In growing cells, approximately 30% of the genes were expressed eight fold higher, Approximately 10% were expressed more than 15 fold higher. Approximately 3% (91 genes) were expressed to more than 20 fold of their levels in starved cells. Carbon fixation gene expression: N. europaea fixes carbon via the Calvin-Benson-Bassham (CBB) cycle via a type I ribulose bisphosphate carboxylase/oxygenase (RubisCO). This study showed that transcription of cbb genes was up-regulated when the carbon source was limited, while amo, hao and other energy harvesting related genes were down-regulated. Iron related gene expression: Because N. europaea has a relatively high content of hemes, sufficient Fe must be available in the medium for it to grow. The genome revealed that approximately 5% of the coding genes in N. europaea are dedicated to Fe transport and assimilation. Nonetheless, with the exception of citrate biosynthesis genes, N. europaea lacks genes for siderophore production. The Fe requirements for growth and the expression of the putative membrane siderophore receptors were determined. The N. europaea genome has over 100 putative genes ({approx}5% of the coding genes) related to Fe uptake and its siderophore receptors could be grouped phylogenetically in four clusters. Fe related genes, such as a number of TonB-dependent Fe-siderophore receptors for ferrichrome and

  2. Prevalence of Toxoplasma gondii in common moles (Talpa europaea)

    NARCIS (Netherlands)

    Krijger, I.M.; Cornelissen, J.B.W.J.; Wisselink, H.J.; Meerburg, B.G.

    2014-01-01

    Background The prevalence of Toxoplasma gondii in common moles, Talpa europaea, was investigated in order to determine whether moles can serve as an indicator species for T. gondii infections in livestock. Findings In total, 86 moles were caught from 25 different sites in the Netherlands. Five

  3. Nitrite as a stimulus for ammonia-starved Nitrosomonas europaea

    NARCIS (Netherlands)

    Laanbroek, H.J.; Bär-Gilissen, M.J.; Hoogveld, H.L.

    2002-01-01

    Ammonia-starved cells of Nitrosomonas europaea are able to preserve a high level of ammonia-oxidizing activity in the absence of ammonium. However, when the nitrite-oxidizing cells that form part of the natural nitrifying community do not keep pace with the ammonia-oxidizing cells, nitrite

  4. Fauna Europaea – all European animal species on the web

    Directory of Open Access Journals (Sweden)

    Yde de Jong

    2014-09-01

    Fauna Europaea provides a public web portal at faunaeur.org with links to other key biodiversity services, is installed as a taxonomic backbone in wide range of biodiversity services and actively contributes to biodiversity informatics innovations in various initiatives and EC programs.

  5. Olea europaea Linn (Oleaceae) Fruit Pulp Extract Exhibits Potent ...

    African Journals Online (AJOL)

    Olea europaea Linn (Oleaceae) Fruit Pulp Extract Exhibits Potent Antioxidant Activity and Attenuates Neuroinflammatory Responses in Lipopolysaccharide- Stimulated Microglial Cells. M-S Kim, S Koppula, S-H Jung, J-Y Kim, H-R Lee, S-R Lee, Y-D Park, K-A Lee, T-K Park, H Kang ...

  6. Olea europaea Linn (Oleaceae) Fruit Pulp Extract Suppresses Sterol ...

    African Journals Online (AJOL)

    Purpose: To investigate the molecular mechanisms underlying the role of Olea europaea Linn (Oleaceae) fruit pulp extract (OPF) in the prevention of high glucose-induced lipid accumulation in human HepG2 hepatocytes. Methods: HepG2 cells were pretreated with various concentration of OPF (0, 10, 20, 40 and 80 µg/ml) ...

  7. Genetic variation within the olive (Olea europaea L.) cultivar Oblica ...

    African Journals Online (AJOL)

    USER

    2010-05-17

    May 17, 2010 ... Genetic variation within the olive (Olea europaea L.) cultivar Oblica detected using amplified fragment length polymorphism (AFLP) markers. Frane Strikic1*, Dunja Bandelj Mavsar2, Slavko Perica1, Zlatko Cmelik3, Zlatko Satovic3 and. Branka Javornik4. 1Institute for Adriatic Crops and Karst Reclamation ...

  8. Spiders in Fauna Europaea: dual use of the database

    Directory of Open Access Journals (Sweden)

    Helsdingen, Peter J. van

    2012-07-01

    Full Text Available The history and current work of the project Fauna Europaea is outlined. The different sources used for building up the database and the efforts to keep it updated are described. Available models of national checklists are discussed and the ideal checklist is described. The double use of the database as a matrix behind the official site of Fauna Europaea – as well as a directly visible document on the website of the European Society of Arachnology – are indicated and the differences in transparency, links to literature sources, and facilities such as distribution maps and calculations of numbers of scores per species or of species per country are discussed. The future of the project is briefly outlined. The need for a European identification tool for spiders is stressed.

  9. Biological Significance of Seed Oil and Polyphenolic of Olea europaea

    OpenAIRE

    Mohammad Asif

    2013-01-01

    The olive tree Olea europaea have beneficial properties. Mainly used parts of the olive tree are fruits and seeds. Seeds oil of olive is used as a major component of the “diet.” Chief active components of olive oil include oleic acid, a monounsaturated fatty acid, polyphenolics and squalene. These main phenolic components are hydroxytyrosol, tyrosol, and oleuropein, which occur in highest amounts in virgin olive oil and have antioxidant properties. Olive oil has shown activity in against canc...

  10. Genome sequence of the olive tree, Olea europaea.

    Science.gov (United States)

    Cruz, Fernando; Julca, Irene; Gómez-Garrido, Jèssica; Loska, Damian; Marcet-Houben, Marina; Cano, Emilio; Galán, Beatriz; Frias, Leonor; Ribeca, Paolo; Derdak, Sophia; Gut, Marta; Sánchez-Fernández, Manuel; García, Jose Luis; Gut, Ivo G; Vargas, Pablo; Alioto, Tyler S; Gabaldón, Toni

    2016-06-27

    The Mediterranean olive tree (Olea europaea subsp. europaea) was one of the first trees to be domesticated and is currently of major agricultural importance in the Mediterranean region as the source of olive oil. The molecular bases underlying the phenotypic differences among domesticated cultivars, or between domesticated olive trees and their wild relatives, remain poorly understood. Both wild and cultivated olive trees have 46 chromosomes (2n). A total of 543 Gb of raw DNA sequence from whole genome shotgun sequencing, and a fosmid library containing 155,000 clones from a 1,000+ year-old olive tree (cv. Farga) were generated by Illumina sequencing using different combinations of mate-pair and pair-end libraries. Assembly gave a final genome with a scaffold N50 of 443 kb, and a total length of 1.31 Gb, which represents 95 % of the estimated genome length (1.38 Gb). In addition, the associated fungus Aureobasidium pullulans was partially sequenced. Genome annotation, assisted by RNA sequencing from leaf, root, and fruit tissues at various stages, resulted in 56,349 unique protein coding genes, suggesting recent genomic expansion. Genome completeness, as estimated using the CEGMA pipeline, reached 98.79 %. The assembled draft genome of O. europaea will provide a valuable resource for the study of the evolution and domestication processes of this important tree, and allow determination of the genetic bases of key phenotypic traits. Moreover, it will enhance breeding programs and the formation of new varieties.

  11. Nonsterol Triterpenoids as Major Constituents of Olea europaea

    Science.gov (United States)

    Stiti, Naïm; Hartmann, Marie-Andrée

    2012-01-01

    Plant triterpenoids represent a large and structurally diverse class of natural products. A growing interest has been focused on triterpenoids over the past decade due to their beneficial effects on human health. We show here that these bioactive compounds are major constituents of several aerial parts (floral bud, leaf bud, stem, and leaf) of olive tree, a crop exploited so far almost exclusively for its fruit and oil. O. europaea callus cultures were analyzed as well. Twenty sterols and twenty-nine nonsteroidal tetra- and pentacyclic triterpenoids belonging to seven types of carbon skeletons (oleanane, ursane, lupane, taraxerane, taraxastane, euphane, and lanostane) were identified and quantified by GC and GC-MS as free and esterified compounds. The oleanane-type compounds, oleanolic acid and maslinic acid, were largely predominant in all the organs tested, whereas they are practically absent in olive oil. In floral buds, they represented as much as 2.7% of dry matter. In callus cultures, lanostane-type compounds were the most abundant triterpenoids. In all the tissues analyzed, free and esterified triterpene alcohols exhibited different distribution patterns of their carbon skeletons. Taken together, these data provide new insights into largely unknown triterpene secondary metabolism of Olea europaea. PMID:22523691

  12. Evaluation of skin entry kerma in radiological examinations at the Hospital de Clinicas, Parana, Brazil

    International Nuclear Information System (INIS)

    Porto, Lorena E.; Schelin, Hugo R.; Santos, Amanda C. dos; Bunick, Ana Paula; Paschuk, Sergei; Denyak, Valeriy; Tilly Junior, Joao G.; Khoury, Helen J.

    2011-01-01

    This paper evaluates the skin entry dose of pediatric and adults patients when submitted to radiological examinations at the Hospital de Clinicas do Parana, Brazil, as part integrate of the data assessment of International Atomic Energy Agency (IAEA) for Latin America. It was performed measurements of dose for evaluation of skin entry kerma in pediatric patients in thorax AP/PA examinations, adults of thorax in AP/PA, cranio caudal mammography and median lateral and patients of computerized tomography in examination of head, thorax and abdomen. The obtained data demonstrate the necessity of verification of diagnostic analysis standards. The great value amplitudes demonstrate the incompatibility of examination executions with those recommended by the literature. The dose values presented partially inside the range recommended and the other over the expected for the due examination when compared with the literature

  13. Photosynthetic characteristics of olive tree (Olea europaea) bark.

    Science.gov (United States)

    Filippou, Manolis; Fasseas, Costas; Karabourniotis, George

    2007-07-01

    Functional and structural characteristics of corticular photosynthesis of sun-exposed bark of olive tree (Olea europaea L.) were examined. Stomata are only sporadically present during stem primary growth. Light transmission through the phellem was age dependent, decreasing rapidly in stems older than five years of age. Light transmission was also low in pubescent 1-year-old stems. Light transmission was about 50% higher in wet phellem than in dry phellem. Photosynthetic capacity on a unit area basis (measured with an oxygen disc electrode at 27 degrees C and about 5% CO(2) on chlorophyllous tissue discs isolated from the stem) was higher in 1-, 20- and 30-year-old stems compared with 2-10-year-old stems. Low chlorophyll a/b ratio and light compensation points were recorded in olive stems with low phellem light transmission, in accordance with the shade acclimation hypothesis. The intrinsic photochemical efficiency of photosystem II of all stems, especially young stems, was less than that of the leaves. Our results show that olive tree bark possesses an efficient photosynthetic mechanism that may significantly contribute not only to the reduction in concentrations of CO(2) in the inner bark, but also to whole-tree carbon balance.

  14. Olive plants (Olea europaea L.) as a bioindicator for pollution.

    Science.gov (United States)

    Eliwa, Amal Mohamed; Kamel, Ehab Abdel-Razik

    2013-06-15

    In the present work, olive plant (Olea europaea L.) was used as a biological indicator for pollution in which, molecular and physiological parameters were studied. Olive plants were collected from polluted and non-polluted areas in Jeddah - Saudi Arabia, traffic area as an air polluted area, sewage treatment station as water polluted area, industrial area as solid waste polluted, costal area as marine polluted area and an area without a direct source of pollution far away from the city center, which was used as control. These changes conducted with nucleic acid content, minerals content, pigments and some growth parameters. Results showed significant reductions in DNA and RNA contents under all polluted sites. Mineral contents were varied widely depending on the different pollutants and locations of olive plant. Generally, micro-elements varied (increase/decrease) significantly within collected samples and the source of pollution. All growth parameters were decreased significantly within the studied samples of all pollutant areas except the relative water content was increased. The content of chlorophyll a has decreased highly significantly in all polluted leaves. While the content of chlorophyll b has increased significantly in all polluted leaves especially in air polluted leaves. The total content of carotenoid pigments has decreased highly significantly in all polluted leaves. It was concluded that olive plant can be used as a biological indicator to the environmental pollutants.

  15. Molecular studies in olive (Olea europaea L.): overview on DNA markers applications and recent advances in genome analysis.

    Science.gov (United States)

    Bracci, T; Busconi, M; Fogher, C; Sebastiani, L

    2011-04-01

    Olive (Olea europaea L.) is one of the oldest agricultural tree crops worldwide and is an important source of oil with beneficial properties for human health. This emblematic tree crop of the Mediterranean Basin, which has conserved a very wide germplasm estimated in more than 1,200 cultivars, is a diploid species (2n = 2x = 46) that is present in two forms, namely wild (Olea europaea subsp. europaea var. sylvestris) and cultivated (Olea europaea subsp. europaea var. europaea). In spite of its economic and nutritional importance, there are few data about the genetic of olive if compared with other fruit crops. Available molecular data are especially related to the application of molecular markers to the analysis of genetic variability in Olea europaea complex and to develop efficient molecular tools for the olive oil origin traceability. With regard to genomic research, in the last years efforts are made for the identification of expressed sequence tag, with particular interest in those sequences expressed during fruit development and in pollen allergens. Very recently the sequencing of chloroplast genome provided new information on the olive nucleotide sequence, opening the olive genomic era. In this article, we provide an overview of the most relevant results in olive molecular studies. A particular attention was given to DNA markers and their application that constitute the most part of published researches. The first important results in genome analysis were reported.

  16. Isolation and identification of radical scavengers in olive tree (Olea europaea) wood

    NARCIS (Netherlands)

    Pérez-Bonilla, M.; Salido, S.; Beek, van T.A.; Linares-Palomino, P.J.; Altarejos, J.; Nogueras, M.; Sánchez, A.

    2006-01-01

    Several extracts of Olea europaea wood (Picual olive cultivar) were obtained with solvents of different polarity and their antioxidant activities determined. The active compounds were detected in fractions of an ethyl acetate extract using HPLC with on-line radical scavenging detection. After

  17. Yeast functional screen to identify genes conferring salt stress tolerance in Salicornia europaea

    Directory of Open Access Journals (Sweden)

    Yoshiki eNakahara

    2015-10-01

    Full Text Available Salinity is a critical environmental factor that adversely affects crop productivity. Halophytes have evolved various mechanisms to adapt to saline environments. Salicornia europaea L. is one of the most salt-tolerant plant species. It does not have special salt-secreting structures like a salt gland or salt bladder, and is therefore a good model for studying the common mechanisms underlying plant salt tolerance. To identify candidate genes encoding key proteins in the mediation of salt tolerance in S. europaea, we performed a functional screen of a cDNA library in yeast. The library was screened for genes that allowed the yeast to grow in the presence of 1.3 M NaCl. We obtained three full-length S. europaea genes that confer salt tolerance. The genes are predicted to encode (1 a novel protein highly homologous to thaumatin-like proteins, (2 a novel coiled-coil protein of unknown function, and (3 a novel short peptide of 32 residues. Exogenous application of a synthetic peptide corresponding to the 32 residues improved salt tolerance of Arabidopsis. The approach described in this report provides a rapid assay system for large-scale screening of S. europaea genes involved in salt stress tolerance and supports the identification of genes responsible for such mechanisms. These genes may be useful candidates for improving crop salt tolerance by genetic transformation.

  18. Comparative proteomic analysis of differentially expressed proteins in shoots of Salicornia europaea under different salinity.

    Science.gov (United States)

    Wang, Xuchu; Fan, Pengxiang; Song, Hongmiao; Chen, Xianyang; Li, Xiaofang; Li, Yinxin

    2009-07-01

    Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is a succulent annual euhalophyte and one of the most salt tolerant plant species. The elucidation of its salt tolerance mechanism is of significance for generating salt-tolerant crops. In this study, we provided high resolution of proteome reference maps of S. europaea shoot and obtained evidence on the salt tolerance mechanism by analyzing the proteomic responses of this plant to high salinity. Our results demonstrated significant variations existed in 196 out of 1880 protein spots detected on CBB stained 2-DE gels. Of these, 111 proteins were identified by mass spectrometry. Among them, the majority was energy production and conversion related proteins, followed by photosynthesis and carbohydrate metabolism associated enzymes. Analysis of protein expression patters revealed that energy production and ion homeostasis associated proteins played important roles for this plant salt tolerance ability. Hierarchical clustering results revealed many proteins were involved in S. europaea salt tolerance mechanism as a dynamic network. Finally, based on our proteomic results, we brought forward a possible schematic representation of mechanism associated with the systematic salt tolerance phenotype in S. europaea.

  19. Yeast functional screen to identify genes conferring salt stress tolerance in Salicornia europaea.

    Science.gov (United States)

    Nakahara, Yoshiki; Sawabe, Shogo; Kainuma, Kenta; Katsuhara, Maki; Shibasaka, Mineo; Suzuki, Masanori; Yamamoto, Kosuke; Oguri, Suguru; Sakamoto, Hikaru

    2015-01-01

    Salinity is a critical environmental factor that adversely affects crop productivity. Halophytes have evolved various mechanisms to adapt to saline environments. Salicornia europaea L. is one of the most salt-tolerant plant species. It does not have special salt-secreting structures like a salt gland or salt bladder, and is therefore a good model for studying the common mechanisms underlying plant salt tolerance. To identify candidate genes encoding key proteins in the mediation of salt tolerance in S. europaea, we performed a functional screen of a cDNA library in yeast. The library was screened for genes that allowed the yeast to grow in the presence of 1.3 M NaCl. We obtained three full-length S. europaea genes that confer salt tolerance. The genes are predicted to encode (1) a novel protein highly homologous to thaumatin-like proteins, (2) a novel coiled-coil protein of unknown function, and (3) a novel short peptide of 32 residues. Exogenous application of a synthetic peptide corresponding to the 32 residues improved salt tolerance of Arabidopsis. The approach described in this report provides a rapid assay system for large-scale screening of S. europaea genes involved in salt stress tolerance and supports the identification of genes responsible for such mechanisms. These genes may be useful candidates for improving crop salt tolerance by genetic transformation.

  20. Degradation of halogenated aliphatic compounds by the ammonia- oxidizing bacterium Nitrosomonas europaea.

    OpenAIRE

    Vannelli, T; Logan, M; Arciero, D M; Hooper, A B

    1990-01-01

    Suspensions of Nitrosomonas europaea catalyzed the ammonia-stimulated aerobic transformation of the halogenated aliphatic compounds dichloromethane, dibromomethane, trichloromethane (chloroform), bromoethane, 1,2-dibromoethane (ethylene dibromide), 1,1,2-trichloroethane, 1,1,1-trichloroethane, monochloroethylene (vinyl chloride), gem-dichloroethylene, cis- and trans-dichloroethylene, cis-dibromoethylene, trichloroethylene, and 1,2,3-trichloropropane, Tetrachloromethane (carbon tetrachloride),...

  1. Abiotic factors influencing the occurrence of Salicornia europaea in West Estonia

    OpenAIRE

    Hulisz, Piotr; Elvisto, Tina; Karasiewicz, Mirosław T.; Piernik, Agnieszka

    2011-01-01

    The occurrence of Salicornia europaea in Western Estonia (Kassari and Topu bays) is the result of complex processes occurring in the Baltic coastal zone and conditioned by such abiotic factors as topography, lithology, hydrogeology and climate. This is reflected by very high salinity level of groundwater and soils.

  2. Headspace volatile composition of the flowers of Caralluma europaea N.E.Br. (Apocynaceae).

    Science.gov (United States)

    Formisano, Carmen; Senatore, Felice; Della Porta, Giovanna; Scognamiglio, Mariarosa; Bruno, Maurizio; Maggio, Antonella; Rosselli, Sergio; Zito, Pietro; Sajeva, Maurizio

    2009-11-11

    The volatile constituents of the flowers of Caralluma europaea (Guss.) N.E.Br (Apocynaceae) from Lampedusa Island were analyzed by a headspace GC method. The analyses allowed the identification and quantification of 41 compounds. The main components were, among the monoterpenoids, terpinolene (23.3%), alpha-terpinene (19.1%) and linalool (18.4%), whereas, among the carbonylic compounds the major constituents were heptanal (2.0%), octanoic acid (2.4%) and hexanoic acid (1.7%). The presence of a nitrogen containing compound, indole (0.8%) and of a sulphur containing compound, dimethylsulphide (t), noteworthy. The compounds found in the flowers of C. europaea have been compared with data available in the literature as regard to their odor, presence in other sapromyiophilous taxa, possible role as semiochemicals, and presence in decaying organic matter. 89.3% of total constituents have been described in other sapromyiophilous taxa. Some of the compounds are present in several types of decaying organic matter (excrements, decomposing bodies, and spoiled fish, etc). Several volatiles found in C. europaea flowers are used as semiochemicals by Hymenoptera, Coleoptera, Diptera, Lepidoptera and other insects. Sixteen volatiles, accounting for 32.4% of the total constituents, are described as attractants of some Diptera families, with a biology linked to decaying organic matter. Our data thus confirm that C. europaea floral bouquet falls within the sapromyiophilous pollination syndrome.

  3. Blood transfusion utilization and recipient survival at Hospital das Clinicas in São Paulo, Brazil

    Science.gov (United States)

    Goncalez, TT; Sabino, EC; Capuani, L; Liu, J; Wright, DJ; Walsh, JH; Ferreira, JE; Chamone, DA; Busch, MP; Custer, B

    2013-01-01

    Background The characteristics of blood recipients including diagnoses associated with transfusion and post-transfusion survival are unreported in Brazil. The goals of this analysis were: 1) to describe blood utilization according to clinical diagnoses and patient characteristics at a large public hospital, Hospital das Clinicas (HC), a tertiary teaching hospital and trauma center in the city of Sao Paulo; 2) to determine the factors associated with survival of blood recipients. Methods A retrospective cross-sectional analysis was conducted on all inpatients in 2004. Data came from three sources were merged: HC electronic admission files, blood issue files, and the national death registry. The first two files consist of data about patient characteristics, clinical diagnosis, and transfusion information. Analyses comparing transfused and non-transfused patients were conducted. The third file was used to determine survival status of recipients up to three years after last transfusion. Logistic regression was conducted among transfused patients to examine survival curves and characteristics associated with follow up patient survival. Results In 2004, 30,779 patients were admitted to HC, with 3,835 (12.4%) transfused. These patients had 10,479 transfusions episodes, consisting of 39,561 transfused components; 16,748 (42%) red cells, 15,828 (40%) platelets and 6,190 (16%) plasma. The median number of components transfused was 3 (range 1 – 656) per patient admission. Mortality during hospitalization was dramatically different for patients whose admissions included transfusion or not (24% vs. 4%). After 1 year, 56% of transfusion recipients were alive. The multivariable model of factors associated with mortality following transfusion showed that the most significant factors in descending order were hospital ward, increasing age, increasing number of components transfused, and type of components received. Conclusion Ward and transfusion are markers of underlying medical

  4. Evaluation of skin entry kerma in radiological examinations at the Hospital de Clinicas, Parana, Brazil; Avaliacao de kerma de entrada na pele em exames radiologicos no Hospital de Clinicas do Parana, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Porto, Lorena E.; Schelin, Hugo R.; Santos, Amanda C. dos; Bunick, Ana Paula; Paschuk, Sergei; Denyak, Valeriy [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Tilly Junior, Joao G. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Hospital de Clinicas; Khoury, Helen J., E-mail: khoury@ufpe.b [Universidade Federal de Pernambuco (UFPE/DEN), Recife, PE (Brazil). Dept. de Energia Nuclear

    2011-10-26

    This paper evaluates the skin entry dose of pediatric and adults patients when submitted to radiological examinations at the Hospital de Clinicas do Parana, Brazil, as part integrate of the data assessment of International Atomic Energy Agency (IAEA) for Latin America. It was performed measurements of dose for evaluation of skin entry kerma in pediatric patients in thorax AP/PA examinations, adults of thorax in AP/PA, cranio caudal mammography and median lateral and patients of computerized tomography in examination of head, thorax and abdomen. The obtained data demonstrate the necessity of verification of diagnostic analysis standards. The great value amplitudes demonstrate the incompatibility of examination executions with those recommended by the literature. The dose values presented partially inside the range recommended and the other over the expected for the due examination when compared with the literature

  5. AAU-Specific RNA Cleavage Mediated by MazF Toxin Endoribonuclease Conserved in Nitrosomonas europaea

    Directory of Open Access Journals (Sweden)

    Tatsuki Miyamoto

    2016-06-01

    Full Text Available Nitrosomonas europaea carries numerous toxin-antitoxin systems. However, despite the abundant representation in its chromosome, studies have not surveyed the underlying molecular functions in detail, and their biological roles remain enigmatic. In the present study, we found that a chromosomally-encoded MazF family member, predicted at the locus NE1181, is a functional toxin endoribonuclease, and constitutes a toxin-antitoxin system, together with its cognate antitoxin, MazE. Massive parallel sequencing provided strong evidence that this toxin endoribonuclease exhibits RNA cleavage activity, primarily against the AAU triplet. This sequence-specificity was supported by the results of fluorometric assays. Our results indicate that N. europaea alters the translation profile and regulates its growth using the MazF family of endoribonuclease under certain stressful conditions.

  6. Polyphenols benefits of olive leaf (Olea europaea L) to human health.

    Science.gov (United States)

    Vogel, Patrícia; Kasper Machado, Isabel; Garavaglia, Juliano; Zani, Valdeni Terezinha; de Souza, Daiana; Morelo Dal Bosco, Simone

    2014-12-17

    The phenolic compounds present in olive leaves (Olea europaea L.) confer benefits to the human health. To review the scientific literature about the benefits of the polyphenols of olive leaves to human health. Literature review in the LILACS-BIREME, SciELO and MEDLINE databases for publications in English, Portuguese and Spanish with the descriptors "Olea europaea", "olive leaves", "olive leaf", "olive leaves extracts", "olive leaf extracts", "phenolic compounds", "polyphenols", "oleuropein", "chemical composition", and "health". There were identified 92 articles, but only 38 related to the objectives of the study and 9 articles cited in the works were included due to their relevance. The phenolic compounds present in olive leaves, especially the oleuropein, are associated to antioxidant, antihypertensive, hypoglycemic, hypocholesterolemic and cardioprotective activity. Furthermore, studies associate the oleuropein to an anti-inflammatory effect in trauma of the bone marrow and as a support in the treatment of obesity. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  7. Characteristics, Phytochemical Analysis and Biological Activities of Extracts from Tunisian Chetoui Olea europaea Variety

    OpenAIRE

    Ines Khlif; Karim Jellali; Thomas Michel; Maria Halabalaki; Alexios Leandros Skaltsounis; Noureddine Allouche

    2015-01-01

    This study selected 10 extracts from Tunisian chetoui O. europaea variety for their total phenolics, flavonoids, and phytochemical analyses as well as for their antioxidant and antimicrobial activities determination. The in vitro antioxidant property was investigated using DPPH, ferric reducing antioxidant capacity (FRAP), oxygen reducing antioxidant capacity (ORAC), and β-carotene-linoleic acid bleaching assays while antimicrobial activity was evaluated using macrodilutions method. For all o...

  8. Degradation of halogenated aliphatic compounds by the ammonia- oxidizing bacterium Nitrosomonas europaea.

    Science.gov (United States)

    Vannelli, T; Logan, M; Arciero, D M; Hooper, A B

    1990-01-01

    Suspensions of Nitrosomonas europaea catalyzed the ammonia-stimulated aerobic transformation of the halogenated aliphatic compounds dichloromethane, dibromomethane, trichloromethane (chloroform), bromoethane, 1,2-dibromoethane (ethylene dibromide), 1,1,2-trichloroethane, 1,1,1-trichloroethane, monochloroethylene (vinyl chloride), gem-dichloroethylene, cis- and trans-dichloroethylene, cis-dibromoethylene, trichloroethylene, and 1,2,3-trichloropropane, Tetrachloromethane (carbon tetrachloride), tetrachloroethylene (perchloroethylene), and trans-dibromoethylene were not degraded. PMID:2339874

  9. Fauna Europaea: Coleoptera 2 (excl. series Elateriformia, Scarabaeiformia, Staphyliniformia and superfamily Curculionoidea)

    Science.gov (United States)

    Alonso Zarazaga, Miguel-Angel; Slipinski, Adam; Nilsson, Anders; Jelínek, Josef; Taglianti, Augusto Vigna; Turco, Federica; Otero, Carlos; Canepari, Claudio; Kral, David; Liberti, Gianfranco; Sama, Gianfranco; Nardi, Gianluca; Löbl, Ivan; Horak, Jan; Kolibac, Jiri; Háva, Jirí; Sapiejewski, Maciej; Jäch, Manfred; Bologna, Marco Alberto; Biondi, Maurizio; Nikitsky, Nikolai B.; Mazzoldi, Paolo; Zahradnik, Petr; Wegrzynowicz, Piotr; Constantin, Robert; Gerstmeier, Roland; Zhantiev, Rustem; Fattorini, Simone; Tomaszewska, Wioletta; Rücker, Wolfgang H.; Vazquez-Albalate, Xavier; Cassola, Fabio; Angelini, Fernando; Johnson, Colin; Schawaller, Wolfgang; Regalin, Renato; Baviera, Cosimo; Rocchi, Saverio; Cianferoni, Fabio; Beenen, Ron; Schmitt, Michael; Sassi, David; Kippenberg, Horst; Zampetti, Marcello Franco; Trizzino, Marco; Chiari, Stefano; Carpaneto, Giuseppe Maria; Sabatelli, Simone

    2015-01-01

    Abstract Fauna Europaea provides a public web-service with an index of scientific names (including synonyms) of all living European land and freshwater animals, their geographical distribution at country level (up to the Urals, excluding the Caucasus region), and some additional information. The Fauna Europaea project covers about 230,000 taxonomic names, including 130,000 accepted species and 14,000 accepted subspecies, which is much more than the originally projected number of 100,000 species. This represents a huge effort by more than 400 contributing specialists throughout Europe and is a unique (standard) reference suitable for many users in science, government, industry, nature conservation and education. Coleoptera represent a huge assemblage of holometabolous insects, including as a whole more than 200 recognized families and some 400,000 described species worldwide. Basic information is summarized on their biology, ecology, economic relevance, and estimated number of undescribed species worldwide. Little less than 30,000 species are listed from Europe. The Coleoptera 2 section of the Fauna Europaea database (Archostemata, Myxophaga, Adephaga and Polyphaga excl. the series Elateriformia, Scarabaeiformia, Staphyliniformia and the superfamily Curculionoidea) encompasses 80 families (according to the previously accepted family-level systematic framework) and approximately 13,000 species. Tabulations included a complete list of the families dealt with, the number of species in each, the names of all involved specialists, and, when possible, an estimate of the gaps in terms of total number of species at an European level. A list of some recent useful references is appended. Most families included in the Coleoptera 2 Section have been updated in the most recent release of the Fauna Europaea index, or are ready to be updated as soon as the FaEu data management environment completes its migration from Zoological Museum Amsterdam to Berlin Museum für Naturkunde

  10. Global metabolomic responses of Nitrosomonas europaea 19718 to cold stress and altered ammonia feeding patterns.

    Science.gov (United States)

    Lu, Huijie; Ulanov, Alexander V; Nobu, Masaru; Liu, Wen-Tso

    2016-02-01

    The model ammonia-oxidizing bacterium Nitrosomonas europaea represents one of the environmentally and biotechnologically significant microorganisms. Genome-based studies over the last decade have led to many intriguing discoveries about its cellular biochemistry and physiology. However, knowledge regarding the regulation of overall metabolic routes in response to various environmental stresses is limited due to a lack of comprehensive, time-resolved metabolomic analyses. In this study, gas chromatography-mass spectrometry (GC-MS)-based metabolic profiling was performed to characterize the temporal variations of N. europaea 19718 intercellular metabolites in response to varied temperature (23 and 10 °C) and ammonia feeding patterns (shock loading and continuous feeding of 20 mg N/L). Approximately 87 metabolites were successfully identified and mapped to the existing pathways of N. europaea 19718, allowing interpretation of the influence of temperature and feeding pattern on metabolite levels. In general, varied temperature had a more profound influence on the overall metabolism than varied feeding patterns. Total extracellular metabolite concentrations (relative to internal standards and normalized to biomass weight) were lower under cold stress and shock loading conditions compared with the control (continuous feeding at 23 °C). Cold stress caused the widespread downregulation of metabolites involved in central carbon metabolism, amino acid, and lipid synthesis (e.g., malonic acid, succinic acid, putrescine, and phosphonolpyruvate). Metabolites that showed differences under varied feeding patterns were mainly involved in nucleotide acid, amino acid, and lipid metabolism (e.g., adenine, uracil, and spermidine). This study highlighted the roles of central carbon and nitrogen metabolism in countering cold stress and altered ammonia availability. In addition, transcriptomic, proteomic, and metabolomic data from three studies on N. europaea were compared to achieve a

  11. Global metabolomic responses of Nitrosomonas europaea 19718 to cold stress and altered ammonia feeding patterns

    KAUST Repository

    Lu, Huijie

    2015-11-05

    © 2015 Springer-Verlag Berlin Heidelberg The model ammonia-oxidizing bacterium Nitrosomonas europaea represents one of the environmentally and biotechnologically significant microorganisms. Genome-based studies over the last decade have led to many intriguing discoveries about its cellular biochemistry and physiology. However, knowledge regarding the regulation of overall metabolic routes in response to various environmental stresses is limited due to a lack of comprehensive, time-resolved metabolomic analyses. In this study, gas chromatography–mass spectrometry (GC-MS)-based metabolic profiling was performed to characterize the temporal variations of N. europaea 19718 intercellular metabolites in response to varied temperature (23 and 10 °C) and ammonia feeding patterns (shock loading and continuous feeding of 20 mg N/L). Approximately 87 metabolites were successfully identified and mapped to the existing pathways of N. europaea 19718, allowing interpretation of the influence of temperature and feeding pattern on metabolite levels. In general, varied temperature had a more profound influence on the overall metabolism than varied feeding patterns. Total extracellular metabolite concentrations (relative to internal standards and normalized to biomass weight) were lower under cold stress and shock loading conditions compared with the control (continuous feeding at 23 °C). Cold stress caused the widespread downregulation of metabolites involved in central carbon metabolism, amino acid, and lipid synthesis (e.g., malonic acid, succinic acid, putrescine, and phosphonolpyruvate). Metabolites that showed differences under varied feeding patterns were mainly involved in nucleotide acid, amino acid, and lipid metabolism (e.g., adenine, uracil, and spermidine). This study highlighted the roles of central carbon and nitrogen metabolism in countering cold stress and altered ammonia availability. In addition, transcriptomic, proteomic, and metabolomic data from three

  12. Implementation of radioactive wastes management system in nuclear medicine service of Hospital das Clinicas of Universidade de Campinas - UNICAMP, in Sao Paulo State, Brazil

    International Nuclear Information System (INIS)

    Rinaldi Neto, A.; Coelho, R.F.; Brunetto, S.Q.

    2001-01-01

    This work reports the experience acquired at the Servico de Medicina Nuclear of the Hospital de Clinicas/UNICAMP (SMN/HC) in planning and implementing the management system of radioactive waste. This system respects the Comissao Nacional de Energia Nuclear' (CNEN) standards and has been of relatively easy and simple performance, without disturbing the SMN/HC's routine. It has also proof to keep its quality along the time. (author)

  13. Global transcriptome profiling of Salicornia europaea L. shoots under NaCl treatment.

    Science.gov (United States)

    Ma, Jinbiao; Zhang, Meiru; Xiao, Xinlong; You, Jinjin; Wang, Junru; Wang, Tao; Yao, Yinan; Tian, Changyan

    2013-01-01

    Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is well adapted to extreme saline environments with more than 1,000 mM NaCl in the soil, so it could serve as an important model species for studying halophilic mechanisms in euhalophytes. To obtain insights into the molecular basis of salt tolerance, we present here the first extensive transcriptome analysis of this species using the Illumina HiSeq™ 2000. A total of 41 and 39 million clean reads from the salt-treated (Se200S) and salt-free (SeCKS) tissues of S. europaea shoots were obtained, and de novo assembly produced 97,865 and 101,751 unigenes, respectively. Upon further assembly with EST data from both Se200S and SeCKS, 109,712 high-quality non-redundant unigenes were generated with a mean unigene size of 639 bp. Additionally, a total of 3,979 differentially expressed genes (DEGs) were detected between the Se200S and SeCKS libraries, with 348 unigenes solely expressed in Se200S and 460 unigenes solely expressed in SeCKS. Furthermore, we identified a large number of genes that are involved in ion homeostasis and osmotic adjustment, including cation transporters and proteins for the synthesis of low-molecular compounds. All unigenes were functionally annotated within the COG, GO and KEGG pathways, and 10 genes were validated by qRT-PCR. Our data contains the extensive sequencing and gene-annotation analysis of S. europaea. This genetic knowledge will be very useful for future studies on the molecular adaptation to abiotic stress in euhalophytes and will facilitate the genetic manipulation of other economically important crops.

  14. Global transcriptome profiling of Salicornia europaea L. shoots under NaCl treatment.

    Directory of Open Access Journals (Sweden)

    Jinbiao Ma

    Full Text Available Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is well adapted to extreme saline environments with more than 1,000 mM NaCl in the soil, so it could serve as an important model species for studying halophilic mechanisms in euhalophytes. To obtain insights into the molecular basis of salt tolerance, we present here the first extensive transcriptome analysis of this species using the Illumina HiSeq™ 2000.A total of 41 and 39 million clean reads from the salt-treated (Se200S and salt-free (SeCKS tissues of S. europaea shoots were obtained, and de novo assembly produced 97,865 and 101,751 unigenes, respectively. Upon further assembly with EST data from both Se200S and SeCKS, 109,712 high-quality non-redundant unigenes were generated with a mean unigene size of 639 bp. Additionally, a total of 3,979 differentially expressed genes (DEGs were detected between the Se200S and SeCKS libraries, with 348 unigenes solely expressed in Se200S and 460 unigenes solely expressed in SeCKS. Furthermore, we identified a large number of genes that are involved in ion homeostasis and osmotic adjustment, including cation transporters and proteins for the synthesis of low-molecular compounds. All unigenes were functionally annotated within the COG, GO and KEGG pathways, and 10 genes were validated by qRT-PCR.Our data contains the extensive sequencing and gene-annotation analysis of S. europaea. This genetic knowledge will be very useful for future studies on the molecular adaptation to abiotic stress in euhalophytes and will facilitate the genetic manipulation of other economically important crops.

  15. Kinetic parameter estimation in N. europaea biofilms using a 2-D reactive transport model.

    Science.gov (United States)

    Lauchnor, Ellen G; Semprini, Lewis; Wood, Brian D

    2015-06-01

    Biofilms of the ammonia oxidizing bacterium Nitrosomonas europaea were cultivated to study microbial processes associated with ammonia oxidation in pure culture. We explored the hypothesis that the kinetic parameters of ammonia oxidation in N. europaea biofilms were in the range of those determined with batch suspended cells. Oxygen and pH microelectrodes were used to measure dissolved oxygen (DO) concentrations and pH above and inside biofilms and reactive transport modeling was performed to simulate the measured DO and pH profiles. A two dimensional (2-D) model was used to simulate advection parallel to the biofilm surface and diffusion through the overlying fluid while reaction and diffusion were simulated in the biofilm. Three experimental studies of microsensor measurements were performed with biofilms: i) NH3 concentrations near the Ksn value of 40 μM determined in suspended cell tests ii) Limited buffering capacity which resulted in a pH gradient within the biofilms and iii) NH3 concentrations well below the Ksn value. Very good fits to the DO concentration profiles both in the fluid above and in the biofilms were achieved using the 2-D model. The modeling study revealed that the half-saturation coefficient for NH3 in N. europaea biofilms was close to the value measured in suspended cells. However, the third study of biofilms with low availability of NH3 deviated from the model prediction. The model also predicted shifts in the DO profiles and the gradient in pH that resulted for the case of limited buffering capacity. The results illustrate the importance of incorporating both key transport and chemical processes in a biofilm reactive transport model. © 2014 Wiley Periodicals, Inc.

  16. [Study on the enrichment of oleuropein from Olea europaea leaves with macroporous resin D-101].

    Science.gov (United States)

    Dang, Jian-zhang; Zhang, Xing-sheng; Huang, Xiao-yu; Feng, Li-xiong

    2007-04-01

    To study the conditions and parameters of the enrichment of oleuropein with macroporous resin. Aqueous extract of Olea europaea leaves prepared through microwave extraction was adsorbed directly with macroporous resin D-101 and the impurities such sugar were washed out by water then oleuropein was eluted by 70% ethanol. HPLC was used to determine the content of oleuropein. The contents of oleuropein increased from 5% to 21.6% in the solid, with 88.6% of recovery rate. Macroporous resin D-101 fits in purification of water-soluble oleuropein. The process is simple and convenient and can be used for industrial production.

  17. Extraction and Characterization of Lipids from Salicornia virginica and Salicornia europaea

    Science.gov (United States)

    Kulis,Michael J.; Hepp, Aloysius F.; Pham, Phong X.; Ribita, Daniela; Bomani, Bilal M. M.; Duraj, Stan A.

    2010-01-01

    The lipid content from Salicornia virginica and Salicornia europaea is investigated. The plants are leafless halophytes with seeds contained in terminal nodes. The lipids, in the form of cell membranes and oil bodies that come directly from the node cells, are observed using fluorescence microscopy. Two extraction methods as well as the results of extracting from the seeds and from the entire nodes are described. Characterization of the fatty acid components of the lipids using Gas Chromatography in tandem with Mass Spectroscopy is also described. Comparisons are made between the two methods and between the two plant materials as lipid sources.

  18. [Mobbing and its effects on health. the experience of the "Clinica del Lavoro Luigi Devoto" in Milan].

    Science.gov (United States)

    Punzi, Silvia; Cassitto, Maria Grazia; Castellini, Giovanna; Costa, G; Gilioli, R

    2007-01-01

    There is increasing interest in research, prevention and management of mobbing in the field of occupational psychosocial risks. To describe mobbing and its health effects by analysis of the cases examined from 1997 to 2003 at the Department of Occupational Health "Clinica del Lavoro Luigi Devoto" in Milan. A total of 226 clinical records of patients who reported a mobbing situation when undergoing medical examination were selected out of 2455 patients examined for stress-related disorders. The percentage of women was higher (53.1%) than in men (46.9%) with a prevalent age range of 35-54 years. There was a great variety of jobs, especially white-collars and workers in large service companies. In one third of the cases, mobbing occurred within 4 years from beginning of employment and mostly after company reorganization and management changes. The most frequent negative acts included social isolation and demotion. The most frequent symptoms were exhaustion, sleep, mood and sexual disorders. The number of symptoms was not related to the duration of mobbing but to the number and frequency of negative actions. 61.1% of the subjects took psychotropic drugs. Occupational health physicians play an essential role in primary prevention (information on occupational risks) and in early diagnosis and rehabilitation and could act as mediators between workers and enterprises.

  19. High-throughput deep sequencing reveals that microRNAs play important roles in salt tolerance of euhalophyte Salicornia europaea.

    Science.gov (United States)

    Feng, Juanjuan; Wang, Jinhui; Fan, Pengxiang; Jia, Weitao; Nie, Lingling; Jiang, Ping; Chen, Xianyang; Lv, Sulian; Wan, Lichuan; Chang, Sandra; Li, Shizhong; Li, Yinxin

    2015-02-26

    microRNAs (miRNAs) are implicated in plant development processes and play pivotal roles in plant adaptation to environmental stresses. Salicornia europaea, a salt mash euhalophyte, is a suitable model plant to study salt adaptation mechanisms. S. europaea is also a vegetable, forage, and oilseed that can be used for saline land reclamation and biofuel precursor production on marginal lands. Despite its importance, no miRNA has been identified from S. europaea thus far. Deep sequencing was performed to investigate small RNA transcriptome of S. europaea. Two hundred and ten conserved miRNAs comprising 51 families and 31 novel miRNAs (including seven miRNA star sequences) belonging to 30 families were identified. About half (13 out of 31) of the novel miRNAs were only detected in salt-treated samples. The expression of 43 conserved and 13 novel miRNAs significantly changed in response to salinity. In addition, 53 conserved and 13 novel miRNAs were differentially expressed between the shoots and roots. Furthermore, 306 and 195 S. europaea unigenes were predicted to be targets of 41 conserved and 29 novel miRNA families, respectively. These targets encoded a wide range of proteins, and genes involved in transcription regulation constituted the largest category. Four of these genes encoding laccase, F-box family protein, SAC3/GANP family protein, and NADPH cytochrome P-450 reductase were validated using 5'-RACE. Our results indicate that specific miRNAs are tightly regulated by salinity in the shoots and/or roots of S. europaea, which may play important roles in salt tolerance of this euhalophyte. The S. europaea salt-responsive miRNAs and miRNAs that target transcription factors, nucleotide binding site-leucine-rich repeat proteins and enzymes involved in lignin biosynthesis as well as carbon and nitrogen metabolism may be applied in genetic engineering of crops with high stress tolerance, and genetic modification of biofuel crops with high biomass and regulatable

  20. Spencermartinsiella europaea gen. nov., sp. nov., a new member of the family Trichomonascaceae.

    Science.gov (United States)

    Péter, Gábor; Dlauchy, Dénes; Tornai-Lehoczki, Judit; Suzuki, Motofumi; Kurtzman, Cletus P

    2011-04-01

    Ten strains of a novel heterothallic yeast species were isolated from rotten wood collected at different locations in Hungary. Analysis of gene sequences for the D1/D2 domain of the large subunit rRNA, as well as analysis of concatenated gene sequences for the nearly complete nuclear large subunit rRNA, nuclear small subunit rRNA and translation elongation factor 1-α, placed the novel species in the family Trichomonascaceae, but showed that it was distinct from all currently recognized genera. The name Spencermartinsiella europaea gen. nov., sp. nov. is proposed to accommodate the new genus and novel species. The novel species could be distinguished from recognized species of neighbouring genera on the basis of standard phenotypic characteristics. The type and isotype strains of Spencermartinsiella europaea are NCAIM Y.01817(T) ( = NRRL Y-48265(T) =  CBS 11730(T)) and NCAIM Y.01819(I) ( = NRRL Y-48266(I) = CBS 11731(I)), respectively.

  1. Essential oil composition of stems and fruits of Caralluma europaea N.E.Br. (Apocynaceae).

    Science.gov (United States)

    Zito, Pietro; Sajeva, Maurizio; Bruno, Maurizio; Maggio, Antonella; Rosselli, Sergio; Formisano, Carmen; Senatore, Felice

    2010-01-27

    The essential oil of the stems and fruits of Caralluma europaea (Guss.) N.E.Br. (Apocynaceae) from Lampedusa Island has been obtained by hydrodistillation and its composition analyzed. The analyses allowed the identification and quantification of 74 volatile compounds, of which 16 were aromatic and 58 non-aromatic. Stems and fruits contained 1.4% and 2.7% of aromatic compounds respectively, while non-aromatic were 88.3% and 88.8%. Non-aromatic hydrocarbons were the most abundant compounds in both organs, followed by fatty acids. Data showed differences in the profiles between stems and fruits which shared only eighteen compounds; stems accounted for 38 compounds while fruits for 53. Fruits showed a higher diversity especially in aromatic compounds with twelve versus four in stems. Among the volatiles identified in stems and fruits of C. europaea 26 are present in other taxa of Apocynaceae, 52 are semiochemicals for many insects, and 21 have antimicrobial activity. The possible ecological role of the volatiles found is briefly discussed.

  2. Phenolic Compounds from Olea europaea L. Possess Antioxidant Activity and Inhibit Carbohydrate Metabolizing Enzymes In Vitro

    Directory of Open Access Journals (Sweden)

    Nadia Dekdouk

    2015-01-01

    Full Text Available Phenolic composition and biological activities of fruit extracts from Italian and Algerian Olea europaea L. cultivars were studied. Total phenolic and tannin contents were quantified in the extracts. Moreover 14 different phenolic compounds were identified, and their profiles showed remarkable quantitative differences among analysed extracts. Moreover antioxidant and enzymatic inhibition activities were studied. Three complementary assays were used to measure their antioxidant activities and consequently Relative Antioxidant Capacity Index (RACI was used to compare and easily describe obtained results. Results showed that Chemlal, between Algerian cultivars, and Coratina, among Italian ones, had the highest RACI values. On the other hand all extracts and the most abundant phenolics were tested for their efficiency to inhibit α-amylase and α-glucosidase enzymes. Leccino, among all analysed cultivars, and luteolin, among identified phenolic compounds, were found to be the best inhibitors of α-amylase and α-glucosidase enzymes. Results demonstrated that Olea europaea fruit extracts can represent an important natural source with high antioxidant potential and significant α-amylase and α-glucosidase inhibitory effects.

  3. Possible combinations of electronic data capture and randomization systems. principles and the realization with RANDI2 and OpenClinica.

    Science.gov (United States)

    Schrimpf, D; Haag, M; Pilz, L R

    2014-01-01

    Clinical trials (CT) are in a wider sense experiments to prove and establish clinical benefit of treatments. Nowadays electronic data capture systems (EDCS) are used more often bringing a better data management and higher data quality into clinical practice. Also electronic systems for the randomization are used to assign the patients to the treatments. If the mentioned randomization system (RS) and EDCS are used, possibly identical data are collected in both, especially by stratified randomization. This separated data storage may lead to data inconsistency and in general data samples have to be aligned. The article discusses solutions to combine RS and EDCS. In detail one approach is realized and introduced. Different possible settings of combination of EDCS and RS are determined and the pros and cons for each solution are worked out. For the combination of two independent applications the necessary interfaces for the communication are defined. Thereby, existing standards are considered. An example realization is implemented with the help of open-source applications and state-of-the-art software development procedures. Three possibilities of separate usage or combination of EDCS and RS are presented and assessed: i) the complete independent usage of both systems; ii) realization of one system with both functions; and iii) two separate systems, which communicate via defined interfaces. In addition a realization of our preferred approach, the combination of both systems, is introduced using the open source tools RANDI2 and OpenClinica. The advantage of a flexible independent development of EDCS and RS is shown based on the fact that these tool are very different featured. In our opinion the combination of both systems via defined interfaces fulfills the requirements of randomization and electronic data capture and is feasible in practice. In addition, the use of such a setting can reduce the training costs and the error-prone duplicated data entry.

  4. Virtual-reality-based attention assessment of ADHD: ClinicaVR: Classroom-CPT versus a traditional continuous performance test.

    Science.gov (United States)

    Neguț, Alexandra; Jurma, Anda Maria; David, Daniel

    2017-08-01

    Virtual-reality-based assessment may be a good alternative to classical or computerized neuropsychological assessment due to increased ecological validity. ClinicaVR: Classroom-CPT (VC) is a neuropsychological test embedded in virtual reality that is designed to assess attention deficits in children with attention deficit hyperactivity disorder (ADHD) or other conditions associated with impaired attention. The present study aimed to (1) investigate the diagnostic validity of VC in comparison to a traditional continuous performance test (CPT), (2) explore the task difficulty of VC, (3) address the effect of distractors on the performance of ADHD participants and typically-developing (TD) controls, and (4) compare the two measures on cognitive absorption. A total of 33 children diagnosed with ADHD and 42 TD children, aged between 7 and 13 years, participated in the study and were tested with a traditional CPT or with VC, along with several cognitive measures and an adapted version of the Cognitive Absorption Scale. A mixed multivariate analysis of covariance (MANCOVA) revealed that the children with ADHD performed worse on correct responses had more commissions and omissions errors than the TD children, as well as slower target reaction times . The results showed significant differences between performance in the virtual environment and the traditional computerized one, with longer reaction times in virtual reality. The data analysis highlighted the negative influence of auditory distractors on attention performance in the case of the children with ADHD, but not for the TD children. Finally, the two measures did not differ on the cognitive absorption perceived by the children.

  5. Resposta neuro-imuno-endocrinologica da pele relacionada ao fotoenvelhecimento : avaliação in vitro e clinica de um novo composto como alternativa terapeutica em dermatologia

    OpenAIRE

    Gustavo de Campos Dieamant

    2008-01-01

    Resumo: O envelhecimento cutâneo é resultado de dois processos independentes, clinica e biologicamente distintos, que afetam a pele simultaneamente. Ao primeiro, conhecido como "relógio biológico", damos o nome de envelhecimento intrínseco, o qual afeta a pele na mesma proporção em que órgãos internos são afetados, como por exemplo, a lenta e irreversível degeneração tecidual. O segundo, denominado fotoenvelhecimento, é resultado da exposição da pele a agentes agressores ambientais, primeiram...

  6. Evaluation of the effects of Olea europaea L. subsp. africana (Mill.) P.S. Green (Oleaceae) leaf methanol extract against castor oil-induced diarrhoea in mice.

    Science.gov (United States)

    Amabeoku, George J; Bamuamba, Kapinga

    2010-03-01

    Olea europaea L. subsp. africana (Mill.) P.S. Green is widely used in South Africa by traditional medicine practitioners to treat diarrhoea. However, little is known scientifically about this South African species in the treatment of diarrhoea. The main aim of the study therefore was to investigate the antidiarrhoeal effect of the leaf methanol extract of the plant species in mice. The antidiarrhoeal activity of the leaf methanol extract of O. europaea subsp. africana was studied using a castor oil-induced diarrhoeal test. The antipropulsive activity of the plant extract was also investigated using the charcoal meal transit test. Standard methods were used to investigate the acute toxicity and effect of O. europaea subsp. africana on castor oil-induced intraluminal fluid accumulation. Leaf methanol extract of O. europaea subsp. africana and loperamide, a standard antidiarrhoeal drug, significantly reduced the number of diarrhoeal episodes induced by castor oil, significantly decreased the stool mass, significantly delayed the onset of the diarrhoea and protected the animals against castor oil-induced diarrhoea. Both O. europaea subsp. africana and loperamide significantly decreased the gastrointestinal transit of charcoal meal and castor oil-induced intraluminal fluid accumulation in mice. The LD50 value was found to be 3475 mg/kg (p.o.). The results obtained suggest that the leaf methanol extract of O. europaea subsp. africana has an antidiarrhoeal property and that, given orally, it may be non-toxic and/or safe in mice.

  7. MELiSSA third compartment: Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures in bioreactors

    Science.gov (United States)

    Cruvellier, Nelly; Lasseur, Christophe; Poughon, Laurent; Creuly, Catherine; Dussap, Gilles

    Nitrogen is a key element for the life and its balance on Earth is regulated by the nitrogen cycle. This loop includes several steps among which nitrification that permits the transformation of the ammonium into nitrate. The MELiSSA loop is an artificial ecosystem designed for life support systems (LSS). It is based on the carbon and nitrogen cycles and the recycling of the non-edible part of the higher plants and the waste produced by the crew. In this order, all the wastes are collected in the first compartment to degrade them into organic acids and CO2. These compounds are joining the second compartment which is a photoheterotrophic compartment where at the outlet an organic-free medium containing ammonium is produced. This solution will be the substrate of the third compartment where nitrification is done. This compartment has to oxidize the ammonium into nitrate, and this biological reaction needs two steps. In the MELiSSA loop, the nitrification is carried out by two bacteria: Nitrosomonas europaea ATCC® 19718™ which is oxidizing ammonia into nitrite and Nitrobacter winogradskyi ATCC® 25391™ which is producing nitrate from nitrite in the third compartment. These two bacteria are growing in axenic conditions on a fixed bed bioreactor filled with Biostyr® beads. The nitrogen compounds are controlled by Ionic Chromatography and colorimetric titration for each sample. The work presented here deals with the culture of both bacteria in pure cultures and mixed cultures in stirred and aerated bioreactors of different volumes. The first aim of our work is the characterization of the bacteria growth in bioreactors and in the nitrifying fixed-bed column. The experimental results confirm that the growth is slow; the maximal growth rate in suspended cultures is 0.054h-1 for Nitrosomonas europaea and 0.022h-1 for Nitrobacter winogradskyi. Mixed cultures are difficult to control and operate but one could be done for more than 500 hours. The characterization of the

  8. Early performance of Olea europaea cv. Arbequina, Picual and Frantoio in the southern Atacama Desert

    Directory of Open Access Journals (Sweden)

    Freddy Mora

    2008-01-01

    Full Text Available The cultivars Arbequina, Picual and Frantoio of Olea europaea are cultivated in severalMediterranean countries. In 1999, these cultivars were planted at three locations in the region of Coquimbo,an arid, Mediterranean-like area in Chile. A generalized linear modeling approach was used in view of thenon-normal distribution of the agronomic data sets. Fruit yield (harvests of 2002-2003, precocity (2002 andtree survival (after four growing seasons differed significantly between the cultivars. Arbequina and Picualhad a positive effect on the yield. Picual was the earliest cultivar at two sites. The survival rate of Frantoio washigh at the three sites (90-100%, as opposed to Picual (56-83%. The approach of Generalized Linear Modelswas particularly useful where the assumption of normality was not satisfied. The selection of cultivars ispromising in this arid region of Chile, while the success will depend on the selection of well-adapted genotypesto a particular location.

  9. Olive tree (Olea europaea) leaves: potential beneficial effects on human health.

    Science.gov (United States)

    El, Sedef N; Karakaya, Sibel

    2009-11-01

    Olive tree (Olea europaea L.) leaves have been widely used in traditional remedies in European and Mediterranean countries such as Greece, Spain, Italy, France, Turkey, Israel, Morocco, and Tunisia. They have been used in the human diet as an extract, an herbal tea, and a powder, and they contain many potentially bioactive compounds that may have antioxidant, antihypertensive, antiatherogenic, anti-inflammatory, hypoglycemic, and hypocholesterolemic properties. One of these potentially bioactive compounds is the secoiridoid oleuropein, which can constitute up to 6-9% of dry matter in the leaves. Other bioactive components found in olive leaves include related secoiridoids, flavonoids, and triterpenes. The evidence supporting the potentially beneficial effects of olive leaves on human health are presented in this brief review.

  10. Genetic Markers Analyses and Bioinformatic Approaches to Distinguish Between Olive Tree (Olea europaea L.) Cultivars.

    Science.gov (United States)

    Ben Ayed, Rayda; Ben Hassen, Hanen; Ennouri, Karim; Rebai, Ahmed

    2016-12-01

    The genetic diversity of 22 olive tree cultivars (Olea europaea L.) sampled from different Mediterranean countries was assessed using 5 SNP markers (FAD2.1; FAD2.3; CALC; SOD and ANTHO3) located in four different genes. The genotyping analysis of the 22 cultivars with 5 SNP loci revealed 11 alleles (average 2.2 per allele). The dendrogram based on cultivar genotypes revealed three clusters consistent with the cultivars classification. Besides, the results obtained with the five SNPs were compared to those obtained with the SSR markers using bioinformatic analyses and by computing a cophenetic correlation coefficient, indicating the usefulness of the UPGMA method for clustering plant genotypes. Based on principal coordinate analysis using a similarity matrix, the first two coordinates, revealed 54.94 % of the total variance. This work provides a more comprehensive explanation of the diversity available in Tunisia olive cultivars, and an important contribution for olive breeding and olive oil authenticity.

  11. Polyploidy in the olive complex (Olea europaea): Evidence from flow cytometry and nuclear microsatellite analyses

    DEFF Research Database (Denmark)

    Besnard, G.; Garcia-Verdugo, C.; Rubio de Casas, R.

    2008-01-01

    Background: Phylogenetic and phylogeographic investigations have been previously performed to study the evolution of the olive tree complex (Olea europaea). A particularly high genomic diversity has been found in north-west Africa. However, to date no exhaustive study has been addressed to infer...... putative polyploidization events and their evolutionary significance in the diversification of the olive tree and its relatives. Methods: Representatives of the six olive subspecies were investigated using (a) flow cytometry to estimate genome content, and (b) six highly variable nuclear microsatellites....... Lastly, abnormalities in chromosomes inheritance leading to aneuploid formation were revealed using microsatellite analyses in the offspring from the controlled cross in subsp. maroccana. Conclusions: This study constitutes the first report for multiple polyploidy in olive tree relatives. Formation...

  12. Feeding and Development of Emerald Ash Borer (Coleoptera: Buprestidae) on Cultivated Olive, Olea europaea.

    Science.gov (United States)

    Cipollini, Don; Rigsby, Chad M; Peterson, Donnie L

    2017-08-01

    We examined the suitability of cultivated olive, Olea europaea L., as a host for emerald ash borer, Agrilus planipennis Fairmaire. In a bioassay using cut stems from a field-grown olive tree (cv. 'Manzanilla') we found that 45% of larvae that had emerged from eggs used to inoculate stems, were recovered alive, many as larvae or prepupae, during periodic debarking of a subset of stems. Three intact stems that 19 larvae successfully entered were exposed to a simulated overwintering treatment. Four live adults emerged afterwards, and an additional pupa and several prepupae were discovered after debarking these stems. Cultivated olive joins white fringetree as one of the two species outside of the genus Fraxinus capable of supporting the development of emerald ash borer from neonate to adult. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. Tratamento cirurgico do hidrocefalo em crianças: I - evolução clinica e mortalidade

    Directory of Open Access Journals (Sweden)

    Benedicto Oscar Colli

    1981-12-01

    Full Text Available São analisadas a evolução clinica e a mortalidade de 57 crianças hidrocéfalas submetidas a tratamento cirúrgico, no periodo de 1970 a 1980. As causas de hidrocéfalo foram malformação congênita (42,1%, infecção meníngea (36,8% e neoplasias (21,1%. A implantação de reservatório no couro cabeludo, em comunicação com o ventrículo lateral e a derivação externa do LCR foram utilizadas com bons resultados no controle transitório da hipertensão intracraniana em crianças com hidrocéfalo e infecção ventricular. A ventriculocisternostomia transhipotalâmica apresentou bons resultados no controle da hipertensão intracraniana em crianças com hidrocéfalo por processos não inflamatórios. A DVA, apesar de pouco utilizada, controlou a hipertensão intracraniana em 85,7% dos casos e ocasionou uma mortalidade operatória de 25,7%. A DVP controlou a hipertensão intracraniana em 89,4% dos casos no pós-operatório imediato e ao final de 18 meses 88,2% dos sobreviventes encontravam-se sem hipertensão intracraniana. A mortalidade global destas crianças foi de 34%. Entre os sobreviventes dos grupos de crianças com hidrocéfalo congênito e pós-infecção meníngea 27,3% eram normais ao final do primeiro trimestre e 50% ao final de 24 meses. A mortalidade operatória nestes grupos foi de 25% e a principal causa de morte operatória foi a infecção meníngea.

  14. Recent developments in olive (Olea europaea L.) genetics and genomics: applications in taxonomy, varietal identification, traceability and breeding.

    Science.gov (United States)

    Sebastiani, L; Busconi, M

    2017-09-01

    The latest results in DNA markers application and genomic studies in olive. Olive (Olea europaea L.) is among the most ancient tree crops worldwide and the source of oil beneficial for human health. Despite this, few data on olive genetics are available in comparison with other cultivated plant species. Molecular information is mainly linked to molecular markers and their application to the study of DNA variation in the Olea europaea complex. In terms of genomic research, efforts have been made in sequencing, heralding the era of olive genomic. The present paper represents an update of a previous review work published in this journal in 2011. The review is again mainly focused on DNA markers, whose application still constitutes a relevant percentage of the most recently published researches. Since the olive genomic era has recently started, the latest results in this field are also being discussed.

  15. Effects of UV-B radiation on Olea europaea: comparisons between a greenhouse and a field experiment

    Energy Technology Data Exchange (ETDEWEB)

    Liakoura, V.; Stavrianakou, S.; Liakopoulos, G.; Karabourniotis, G. [Athens Agricultural Univ. Dept. of Agricultural Biotechnology, Athens (Greece); Manetas, Y. [Patras Univ, Dept, of Biology, Patras (Greece)

    1999-11-01

    Olea europaea plants were grown in the field with or without supplemental ultraviolet B radiation equivalent to the increase at ground level resulting from a 15 per cent depletion in stratospheric ozone concentration. After one year, their morphology, anatomy and physiology were compared with that of plants grown in a greenhouse and exposed for four months to either zero UV-B radiation or UV-B radiation equivalent to that of supplemented outdoor treatment. Results showed an increase in adaxial epidermal thickness and reduced total protein concentration in plants grown in the field, in contrast to greenhouse-grown plants which under the influence of UV-B radiation showed significant increases in abaxial cutical thickness and trichome UV-B absorbing compounds. These observations suggest that Olea europaea plants have a high UV-B tolerance and are not affected by increase in UV-B radiation. 23 refs., 1 tab.

  16. Community structure variability of Uropodina mites (Acari: Mesostigmata) in nests of the common mole, Talpa europaea, in Central Europe

    OpenAIRE

    Napiera?a, Agnieszka; M?dra, Anna; Leszczy?ska-Deja, Kornelia; Gwiazdowicz, Dariusz J.; Go?dyn, Bart?omiej; B?oszyk, Jerzy

    2016-01-01

    Underground nests of Talpa europaea, known as the common mole, are very specific microhabitats, which are also quite often inhabited by various groups of arthropods. Mites from the suborder Uropodina (Acari: Mesostigmata) are only one of them. One could expect that mole nests that are closely located are inhabited by communities of arthropods with similar species composition and structure. However, results of empirical studies clearly show that even nests which are close to each other can be ...

  17. Encyclopaedia Europaea

    DEFF Research Database (Denmark)

    Sørensen, Gert

    depends on the conceptual or ideological constellation in which it takes part. This volume on one hand demonstrates the role of notions of identity in a variety of European contexts, and on the other hand highlights how there may be reasons to challenge the use of the term and corresponding social......, cultural, and political practices. Notions of national identity and national politics are challenged by European integration, as well as by increasing demographic heterogeneity due to migration, and migrants experience conflicts of identification stemming from clashes between cultural heritage...

  18. Encyclopaedia Europaea

    DEFF Research Database (Denmark)

    Sørensen, Gert

    Identity is a keyword in a number of academic fields as well as in public debate and in politics. During the last decades, references to identity have proliferated, yet there is no simple definition available that corresponds to the use of the notion in all contexts. The significance of the notio...... Christian Lammers, Saxo-Instituttet - Arkæologi, Etnologi, Historie og Græsk og Latin; Gert Sørensen, Institut for Engelsk, Germansk og Romansk ; Anne Ring Petersen, Institut for Kunst- og Kulturvidenskab...

  19. Lavado Broncoalveolar: Utilidade clinica

    Directory of Open Access Journals (Sweden)

    Ana Cristina Mendes

    2000-05-01

    Full Text Available RESUMO: O presente trabalho consiste na compilação de textos obtidos dos participantes na reunião sobre 'Utilidade clínica do LBA' que decorrcu em 1998 sob a organização da Comissão de Trabalho de Doenças do Interstício Pulmonar. A reunião consistiu numa exaustiva revisão do contributo clínico que esta técnica oferece e da discussão práctica de casos clínicos. Escolhemos quatro textos originais respectivamente sobre Pneumonia de Hipersensibilidade, Suberose em particular, Neoplasias e Patologia infecciosa. Ilustramos as potencialidades da La vagem Broncoalveolar com cinco casos clínicos: proteinose alveolar, pneumonia a Pneumocistis carinii, alvcolite alérgica extrínseca, sarcoidosc, carcinoma do pulmão e hemorragia pulmonar por Granulomalose de Wegener.REV PORT PNEUMOL 2000; VI (3: 185-186 ABSTRACT: The present work consists of a collection of papers that came out from the meeting 'Bronchoalveolar Lavage: clinical usefulness'. The meeting took place 199R and was organised by the Task Group on Interstitial Lung Diseases. The speakers went trough an extensive review of the clinical usefulness of the technique and then clinical cases were discussed. We choose four original papers on Hypersensitivity pneumonitis, Suberosis, Neoplasms and Infection. Five clinical cases are presented: alveolar protcinosis, Pneumocystis carinii pneumonia, Hypersensitivity pneumonitis, Sarcoidosis, lung cancer and alveolar haemorrhage on a setting of Wegener Granulomatosis.REV PORT PNEUMOL 2000; VI (3: 185-186

  20. Profundization of acetabular cup uncemented in total substitution of hip in-patient with acetabular dysplasia - Experience university hospital - Clinica San Rafael

    International Nuclear Information System (INIS)

    Dimian Mayorga, Omar David; Sandoval Daza, Alejandro; Vargas Turriago, Marcela; Perez Torres, Javier

    2005-01-01

    14 patients with acetabular dysplasia were treated at Hospital Universitario Clinica San Rafael with total hip arthroplasty with uncemented cup internization. According to Crowe classification, one was type 1, eight were type 2 and five were type 3. The average follow up was twenty-four months. The Harris hip score was used for the clinical evaluation with a pre operative average of 35 points and 37 points post operative. The average cup internization was four millimeters, with an average cup protrutio of 47% and an average of cup coverage of 81%. The average internization of the femoral head's center was 26mm. screws for cup fixation were used in 3 patients. We did not have complications nor implant revision at the time of follow up

  1. Aggiornamento sulla distribuzione di Talpa europaea in Umbria

    Directory of Open Access Journals (Sweden)

    A.M. Paci

    2003-10-01

    Full Text Available L?Umbria, in ragione della sua posizione centrale nella Penisola, appare particolarmente interessante dal punto di vista biogeografico. Per quanto riguarda le talpe, ad esempio, sono presenti tutti i taxa italiani ma, essendo ancora scarse e frammentarie le informazioni sulla loro distribuzione regionale, viene intanto aggiornato lo status di T. europaea con la sintesi di alcuni dati inediti raccolti nella provincia di Perugia: Zoccolanti, Città di Castello, 300 m as pa, 13-IV-2001; Monte Maggiore, Città di Castello, 605 m bc pa vu, 13-VI-2003; San Secondo, Città di Castello, 260 m ci pb vf, 3-VI-1995 / 9-V-2001; Lugnano, Città di Castello, 260 m ci pb vf, 25-XI-1992; Niccone, Umbertide, 250 m ce pb vf 14-VI-2003; Pietralunga, 505 m as pa, 19-IV-2002; Monte Cucco, Sigillo, 1050 m bc bm vu, 5-V-2003 Castiglione, Gubbio, 840 m bc pa, 30-V-1999; Schifanoia, Valfabbrica, 350 m bc pa, 30-V-2000; Oscano, Perugia, 470 m bc pa, 2002; Monte Melino, Magione, 225 m ci ps vt, 19-I-2001; Sant?Arcangelo, Magione; 260 m zu ps vt, IV-2002; Città della Pieve, 500 m as pa, 29-VI-2001 (bc bosco di caducifoglie, ce colture estensive, ci colture intensive, as area suburbana, zu zona umida, pa piano bioclimatico altocollinare, pb piano bioclimatico bassocollinare, bm piano bioclimatico bassomontano, ps piano bioclimatico collinare submediterraneo, vu variante umida, vf variante fredda, vt variante temperata. In letteratura la specie viene segnalata anche nel Comune di Assisi. In due località dell?Umbria nord-orientale ? Pietralunga e Monte Cucco - T. europaea è risultata in parapatria con T. caeca mentre, da recentissima bibliografia, entrerebbe in contatto con T. romana nella fascia centrale della regione. Contemporaneamente si è creduto opportuno riportare notizie relative ad individui marchigiani

  2. Activity-Based Protein Profiling of Ammonia Monooxygenase in Nitrosomonas europaea

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, Kristen; Sadler, Natalie C.; Wright, Aaron T.; Yeager, Chris; Hyman, Michael R.; Löffler, F. E.

    2016-01-29

    Nitrosomonas europaeais an aerobic nitrifying bacterium that oxidizes ammonia (NH3) to nitrite (NO2) through the sequential activities of ammonia monooxygenase (AMO) and hydroxylamine dehydrogenase (HAO). Many alkynes are mechanism-based inactivators of AMO, and here we describe an activity-based protein profiling method for this enzyme using 1,7-octadiyne (17OD) as a probe. Inactivation of NH4+-dependent O2uptake byN. europaeaby 17OD was time- and concentration-dependent. The effects of 17OD were specific for ammonia-oxidizing activity, andde novoprotein synthesis was required to reestablish this activity after cells were exposed to 17OD. Cells were reacted with Alexa Fluor 647 azide using a copper-catalyzed azide-alkyne cycloaddition (CuAAC) (click) reaction, solubilized, and analyzed by SDS-PAGE and infrared (IR) scanning. A fluorescent 28-kDa polypeptide was observed for cells previously exposed to 17OD but not for cells treated with either allylthiourea or acetylene prior to exposure to 17OD or for cells not previously exposed to 17OD. The fluorescent polypeptide was membrane associated and aggregated when heated with β-mercaptoethanol and SDS. The fluorescent polypeptide was also detected in cells pretreated with other diynes, but not in cells pretreated with structural homologs containing a single ethynyl functional group. The membrane fraction from 17OD-treated cells was conjugated with biotin-azide and solubilized in SDS. Streptavidin affinity-purified polypeptides were on-bead trypsin-digested, and amino acid sequences of the peptide fragments were determined by liquid chromatography-mass spectrometry (LC-MS) analysis. Peptide fragments from AmoA were the predominant peptides detected in 17OD-treated samples. In-gel digestion and

  3. Distribution of Nitrosomonas europaea and Nitrobacter winogradskyi in an autotrophic nitrifying biofilm reactor as depicted by molecular analyses and mathematical modelling.

    Science.gov (United States)

    Montràs, Anna; Pycke, Benny; Boon, Nico; Gòdia, Francesc; Mergeay, Max; Hendrickx, Larissa; Pérez, Julio

    2008-03-01

    The autotrophic two-species biofilm from the packed bed reactor of a life-support system, containing Nitrosomonas europaea ATCC 19718 and Nitrobacter winogradskyi ATCC 25391, was analysed after 4.8 years of continuous operation performing complete nitrification. Real-time quantitative polymerase chain reaction (Q-PCR) was used to quantify N. europaea and N. winogradskyi along the vertical axis of the reactor, revealing a spatial segregation of N. europaea and N. winogradskyi. The main parameters influencing the spatial segregation of both nitrifiers along the bed were assessed through a multi-species one-dimensional biofilm model generated with AQUASIM software. The factor that contributed the most to this distribution profile was a small deviation from the flow pattern of a perfectly mixed tank towards plug-flow. The results indicate that the model can estimate the impact of specific biofilm parameters and predict the nitrification efficiency and population dynamics of a multispecies biofilm.

  4. Molecular analysis of the interaction between Olea europaea and the biotrophic fungus Spilocaea oleagina.

    Science.gov (United States)

    Benitez, Yoselin; Botella, Miguel A; Trapero, Antonio; Alsalimiya, Mohammed; Caballero, Jose Luis; Dorado, Gabriel; Muñoz-Blanco, Juan

    2005-07-01

    SUMMARY The mitosporic fungus Spilocaea oleagina is an obligate biotroph of olive (Olea europaea) causing a scab disease associated with leaf fall and substantial losses in production. Using differential display we have identified 162 cDNA fragments corresponding to transcripts that show altered abundance during the defence response of a resistant olive cultivar to S. oleagina. Detailed analyses of 21 selected genes by real-time quantitative RT-PCR revealed different kinetics of induction. Genes involved in signalling, transcriptional control, oxidative stress, biotic and abiotic stress, and several genes with unknown function were found to be induced rapidly after infection. In contrast, genes involved in metabolism and cellular maintenance showed delayed induction. The induction of the selected genes in a susceptible cultivar was delayed and/or reduced during the response to S. oleagina. Interestingly, the basal expression of some genes in the uninfected resistant cultivar was higher than in the susceptible one, suggesting a constitutive activation of defence responses. Expression of these genes in response to salicylic acid, methyl jasmonate, a mixture of both, ethephon, hydrogen peroxide, menadione and wounding was also investigated. The results are discussed in relation to the molecular bases and signalling events involved in this biotrophic interaction.

  5. 454 Pyrosequencing of Olive (Olea europaea L. Transcriptome in Response to Salinity.

    Directory of Open Access Journals (Sweden)

    Christos Bazakos

    Full Text Available Olive (Olea europaea L. is one of the most important crops in the Mediterranean region. The expansion of cultivation in areas irrigated with low quality and saline water has negative effects on growth and productivity however the investigation of the molecular basis of salt tolerance in olive trees has been only recently initiated. To this end, we investigated the molecular response of cultivar Kalamon to salinity stress using next-generation sequencing technology to explore the transcriptome profile of olive leaves and roots and identify differentially expressed genes that are related to salt tolerance response. Out of 291,958 obtained trimmed reads, 28,270 unique transcripts were identified of which 35% are annotated, a percentage that is comparable to similar reports on non-model plants. Among the 1,624 clusters in roots that comprise more than one read, 24 were differentially expressed comprising 9 down- and 15 up-regulated genes. Respectively, inleaves, among the 2,642 clusters, 70 were identified as differentially expressed, with 14 down- and 56 up-regulated genes. Using next-generation sequencing technology we were able to identify salt-response-related transcripts. Furthermore we provide an annotated transcriptome of olive as well as expression data, which are both significant tools for further molecular studies in olive.

  6. In vitro propagation of olive (Olea europaea L.) by nodal segmentation of elongated shoots.

    Science.gov (United States)

    Lambardi, Maurizio; Ozudogru, Elif Aylin; Roncasaglia, Romano

    2013-01-01

    Olive (Olea europaea L.), long-living, ever-green fruit tree of the Old World, has been part of a traditional landscape in the Mediterranean area for centuries. Both the fruits consumed after processing and the oil extracted from the fruits are among the main components of the Mediterranean diet, widely used for salads and cooking, as well as for preserving other food. Documentations show that the ancient use of this beautiful tree also includes lamp fuel production, wool treatment, soap production, medicine, and cosmetics. However, unlike the majority of the fruit species, olive propagation is still a laborious practice. As regards traditional propagation, rooting of cuttings and grafting stem segments onto rootstocks are possible, former being achieved only when the cuttings are collected in specific periods (spring or beginning of autumn), and latter only when skilled grafters are available. In both the cases, performance of the cultivars varies considerably. The regeneration of whole plants from ovules, on the other hand, is used only occasionally. Micropropagation of olive is not easy mainly due to explant oxidation, difficulties in explant disinfection, and labor-oriented establishment of in vitro shoot cultures. However today, the progress in micropropagation technology has made available the complete protocols for several Mediterranean cultivars. This chapter describes a micropropagation protocol based on the segmentation of nodal segments obtained from elongated shoots.

  7. Impacts of ammonia on zinc oxide nanoparticle toxicity to Nitrosomonas europaea

    Science.gov (United States)

    Wu, Junkang; Chang, Yan; Gao, Huan; Yu, Ran

    2017-05-01

    A Although the toxicity effects of engineering nanoparticles (NPs) in biological wastewater nitrogen removal (BNR) system have been extensively attracted, the impacts of co-existing contaminants from wastewater on NP toxicity have been less addressed. In this study, the effects of ammonia on ZnO NP toxicity to typical ammonia oxidizing bacteria-Nitrosomonas europaea were investigated, as indicated by the cell density, membrane integrity, ammonia oxidation rate, and AMO activity. After 6-h’s exposure to 10 mg/L ZnO NPs, the cell density, membrane integrity, ammonia oxidation rate, and AMO activity was dramatically suppressed despite of the increasing ammonia loading. Ammonia at varying concentrations did not obviously affect ZnO NPs toxicity to cell density. The presence of ammonia at 100 or 200 mg/L significantly alleviated the antibacterial effects of ZnO NPs on cells. The reduction of the concentration of released Zn2+ might be responsible for the compromised ZnO NPs toxicity. However, the presence of extremely dosed ammonia at 200 mg/L imposed restrictions on further alleviation of ZnO NPs toxicities probably due to the production of free ammonia and acclamation of nitrite. All these findings would provide new insights for risk assessment of the combined effects of NPs with other co-existing contaminants in the BNR system.

  8. Production of triterpene acids by cell suspension cultures of Olea europaea.

    Science.gov (United States)

    Saimaru, Hiroshi; Orihara, Yutaka; Tansakul, Pimpimon; Kang, Young-Hwa; Shibuya, Masaaki; Ebizuka, Yutaka

    2007-05-01

    Olive (Olea europaea) contains large quantity of triterpene acids including oleanolic acid (6) as a major one. Varieties of biological activities exhibited by triterpene acids attracted our attentions, especially from pharmaceutical viewpoints. Cell culture of olive plant was induced and its triterpene constituents were studied. From the cell suspension cultures, six ursane type triterpene acids; ursolic acid (9), pomolic acid (10), rotundic acid (11), tormentic acid (12), 2alpha-hydroxyursolic acid (13) and 19alpha-hydroxyasiatic acid (14), and two oleanane type acids; oleanolic acid and maslinic acid (7), have been isolated. Quantity of ursane type triterpene acids produced by cell cultures was larger than that of oleanane type. Further, a multifunctional oxidosqualene cyclase (OSC) named OEA was cloned by homology based PCRs from the same cultured cells. Major product of OEA is alpha-amyrin (ursane skeleton), showing good accordance to higher content of ursane-type triterpene acids in the cultured cells, and strongly suggesting OEA to be a major contributor OSC for their production.

  9. Identification and Characterization of the Iridoid Synthase Involved in Oleuropein Biosynthesis in Olive (Olea europaea) Fruits*

    Science.gov (United States)

    Kries, Hajo; Panara, Francesco; Baldoni, Luciana; O'Connor, Sarah E.; Osbourn, Anne

    2016-01-01

    The secoiridoids are the main class of specialized metabolites present in olive (Olea europaea L.) fruit. In particular, the secoiridoid oleuropein strongly influences olive oil quality because of its bitterness, which is a desirable trait. In addition, oleuropein possesses a wide range of pharmacological properties, including antioxidant, anti-inflammatory, and anti-cancer activities. In accordance, obtaining high oleuropein varieties is a main goal of molecular breeding programs. Here we use a transcriptomic approach to identify candidate genes belonging to the secoiridoid pathway in olive. From these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive fruits. OeISY, the first pathway gene characterized for this type of secoiridoid, is a potential target for breeding programs in a high value secoiridoid-accumulating species. PMID:26709230

  10. 454 Pyrosequencing of Olive (Olea europaea L.) Transcriptome in Response to Salinity.

    Science.gov (United States)

    Bazakos, Christos; Manioudaki, Maria E; Sarropoulou, Elena; Spano, Thodhoraq; Kalaitzis, Panagiotis

    2015-01-01

    Olive (Olea europaea L.) is one of the most important crops in the Mediterranean region. The expansion of cultivation in areas irrigated with low quality and saline water has negative effects on growth and productivity however the investigation of the molecular basis of salt tolerance in olive trees has been only recently initiated. To this end, we investigated the molecular response of cultivar Kalamon to salinity stress using next-generation sequencing technology to explore the transcriptome profile of olive leaves and roots and identify differentially expressed genes that are related to salt tolerance response. Out of 291,958 obtained trimmed reads, 28,270 unique transcripts were identified of which 35% are annotated, a percentage that is comparable to similar reports on non-model plants. Among the 1,624 clusters in roots that comprise more than one read, 24 were differentially expressed comprising 9 down- and 15 up-regulated genes. Respectively, inleaves, among the 2,642 clusters, 70 were identified as differentially expressed, with 14 down- and 56 up-regulated genes. Using next-generation sequencing technology we were able to identify salt-response-related transcripts. Furthermore we provide an annotated transcriptome of olive as well as expression data, which are both significant tools for further molecular studies in olive.

  11. Characterization of antioxidant enzymes and peroxisomes of olive (Olea europaea L.) fruits.

    Science.gov (United States)

    Lopez-Huertas, Eduardo; del Río, Luis A

    2014-10-15

    The presence of peroxisomes in olive (Olea europaea L.) fruits and different antioxidant enzymes occurring in this plant tissue is reported for the first time. Ultrastructural analysis showed that olive cells were characterized by the presence of large vacuoles and lipid drops. Plastids, mitochondria and peroxisomes were placed near the cell wall, showing some type of association with it. Olive fruit peroxisomes were purified by sucrose density-gradient centrifugation, and catalase, glutathione reductase and ascorbate peroxidase were found in peroxisomes. In olive fruit tissue the presence of a battery of antioxidant enzymes was demonstrated, including catalase, four superoxide dismutase isozymes (mainly an Fe-SOD plus 2 Cu,Zn-SOD and a Mn-SOD), all the enzymes of the ascorbate-glutathione cycle, reduced and oxidized glutathione, ascorbate, and four NADPH-recycling dehydrogenases. The knowledge of the full composition of antioxidants (enzymatic and non-enzymatic) in olive fruits is crucial to be able to understand the processes regulating the antioxidant composition of olive oil. Copyright © 2014 Elsevier GmbH. All rights reserved.

  12. Soil fluoride spiking effects on olive trees (Olea europaea L. cv. Chemlali).

    Science.gov (United States)

    Zouari, M; Ben Ahmed, C; Fourati, R; Delmail, D; Ben Rouina, B; Labrousse, P; Ben Abdallah, F

    2014-10-01

    A pot experiment under open air conditions was carried out to investigate the uptake, accumulation and toxicity effects of fluoride in olive trees (Olea europaea L.) grown in a soil spiked with inorganic sodium fluoride (NaF). Six different levels (0, 20, 40, 60, 80 and 100mM NaF) of soil spiking were applied through NaF to irrigation water. At the end of the experiment, total fluoride content in soil was 20 and 1770mgFkg(-1) soil in control and 100mM NaF treatments, respectively. The comparative distribution of fluoride partitioning among the different olive tree parts showed that the roots accumulated the most fluoride and olive fruits were minimally affected by soil NaF spiking as they had the lowest fluoride content. In fact, total fluoride concentration varied between 12 and 1070µgFg(-1) in roots, between 9 and 570µgFg(-1) in shoots, between 12 and 290µgFg(-1) in leaves, and between 10 and 29µgFg(-1) in fruits, respectively for control and 100mM NaF treatments. Indeed, the fluoride accumulation pattern showed the following distribution: roots>shoots>leaves>fruits. On the other hand, fluoride toxicity symptoms such as leaf necrosis and leaf drop appeared only in highly spiked soils (60, 80 and 100mM NaF). Copyright © 2014 Elsevier Inc. All rights reserved.

  13. Identification and Characterization of the Iridoid Synthase Involved in Oleuropein Biosynthesis in Olive (Olea europaea) Fruits.

    Science.gov (United States)

    Alagna, Fiammetta; Geu-Flores, Fernando; Kries, Hajo; Panara, Francesco; Baldoni, Luciana; O'Connor, Sarah E; Osbourn, Anne

    2016-03-11

    The secoiridoids are the main class of specialized metabolites present in olive (Olea europaea L.) fruit. In particular, the secoiridoid oleuropein strongly influences olive oil quality because of its bitterness, which is a desirable trait. In addition, oleuropein possesses a wide range of pharmacological properties, including antioxidant, anti-inflammatory, and anti-cancer activities. In accordance, obtaining high oleuropein varieties is a main goal of molecular breeding programs. Here we use a transcriptomic approach to identify candidate genes belonging to the secoiridoid pathway in olive. From these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive fruits. OeISY, the first pathway gene characterized for this type of secoiridoid, is a potential target for breeding programs in a high value secoiridoid-accumulating species. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. Genetic improvement of olive (Olea europaea L.) by conventional and in vitro biotechnology methods.

    Science.gov (United States)

    Rugini, E; Cristofori, V; Silvestri, C

    2016-01-01

    In olive (Olea europaea L.) traditional methods of genetic improvement have up to now produced limited results. Intensification of olive growing requires appropriate new cultivars for fully mechanized groves, but among the large number of the traditional varieties very few are suitable. High-density and super high-density hedge row orchards require genotypes with reduced size, reduced apical dominance, a semi-erect growth habit, easy to propagate, resistant to abiotic and biotic stresses, with reliably high productivity and quality of both fruits and oil. Innovative strategies supported by molecular and biotechnological techniques are required to speed up novel hybridisation methods. Among traditional approaches the Gene Pool Method seems a reasonable option, but it requires availability of widely diverse germplasm from both cultivated and wild genotypes, supported by a detailed knowledge of their genetic relationships. The practice of "gene therapy" for the most important existing cultivars, combined with conventional methods, could accelerate achievement of the main goals, but efforts to overcome some technical and ideological obstacles are needed. The present review describes the benefits that olive and its products may obtain from genetic improvement using state of the art of conventional and unconventional methods, and includes progress made in the field of in vitro techniques. The uses of both traditional and modern technologies are discussed with recommendations. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. Observation of eight ancient olive trees (Olea europaea L.) growing in the Garden of Gethsemane.

    Science.gov (United States)

    Petruccelli, Raffaella; Giordano, Cristiana; Salvatici, Maria Cristina; Capozzoli, Laura; Ciaccheri, Leonardo; Pazzini, Massimo; Lain, Orietta; Testolin, Raffaele; Cimato, Antonio

    2014-05-01

    For thousands of years, olive trees (Olea europaea L.) have been a significant presence and a symbol in the Garden of Gethsemane, a place located at the foot of the Mount of Olives, Jerusalem, remembered for the agony of Jesus Christ before his arrest. This investigation comprises the first morphological and genetic characterization of eight olive trees in the Garden of Gethsemane. Pomological traits, morphometric, and ultrastructural observations as well as SSR (Simple Sequence Repeat) analysis were performed to identify the olive trees. Statistical analyses were conducted to evaluate their morphological variability. The study revealed a low morphological variability and minimal dissimilarity among the olive trees. According to molecular analysis, these trees showed the same allelic profile at all microsatellite loci analyzed. Combining the results of the different analyses carried out in the frame of the present work, we could conclude that the eight olive trees of the Gethsemane Garden have been propagated from a single genotype. Copyright © 2014. Published by Elsevier SAS.

  16. The peculiar landscape of repetitive sequences in the olive (Olea europaea L.) genome.

    Science.gov (United States)

    Barghini, Elena; Natali, Lucia; Cossu, Rosa Maria; Giordani, Tommaso; Pindo, Massimo; Cattonaro, Federica; Scalabrin, Simone; Velasco, Riccardo; Morgante, Michele; Cavallini, Andrea

    2014-04-01

    Analyzing genome structure in different species allows to gain an insight into the evolution of plant genome size. Olive (Olea europaea L.) has a medium-sized haploid genome of 1.4 Gb, whose structure is largely uncharacterized, despite the growing importance of this tree as oil crop. Next-generation sequencing technologies and different computational procedures have been used to study the composition of the olive genome and its repetitive fraction. A total of 2.03 and 2.3 genome equivalents of Illumina and 454 reads from genomic DNA, respectively, were assembled following different procedures, which produced more than 200,000 differently redundant contigs, with mean length higher than 1,000 nt. Mapping Illumina reads onto the assembled sequences was used to estimate their redundancy. The genome data set was subdivided into highly and medium redundant and nonredundant contigs. By combining identification and mapping of repeated sequences, it was established that tandem repeats represent a very large portion of the olive genome (∼31% of the whole genome), consisting of six main families of different length, two of which were first discovered in these experiments. The other large redundant class in the olive genome is represented by transposable elements (especially long terminal repeat-retrotransposons). On the whole, the results of our analyses show the peculiar landscape of the olive genome, related to the massive amplification of tandem repeats, more than that reported for any other sequenced plant genome.

  17. Valuable nutrients and functional bioactives in different parts of olive (Olea europaea L.)-a review.

    Science.gov (United States)

    Ghanbari, Rahele; Anwar, Farooq; Alkharfy, Khalid M; Gilani, Anwarul-Hassan; Saari, Nazamid

    2012-01-01

    The Olive tree (Olea europaea L.), a native of the Mediterranean basin and parts of Asia, is now widely cultivated in many other parts of the world for production of olive oil and table olives. Olive is a rich source of valuable nutrients and bioactives of medicinal and therapeutic interest. Olive fruit contains appreciable concentration, 1-3% of fresh pulp weight, of hydrophilic (phenolic acids, phenolic alchohols, flavonoids and secoiridoids) and lipophilic (cresols) phenolic compounds that are known to possess multiple biological activities such as antioxidant, anticarcinogenic, antiinflammatory, antimicrobial, antihypertensive, antidyslipidemic, cardiotonic, laxative, and antiplatelet. Other important compounds present in olive fruit are pectin, organic acids, and pigments. Virgin olive oil (VOO), extracted mechanically from the fruit, is also very popular for its nutritive and health-promoting potential, especially against cardiovascular disorders due to the presence of high levels of monounsaturates and other valuable minor components such as phenolics, phytosterols, tocopherols, carotenoids, chlorophyll and squalene. The cultivar, area of production, harvest time, and the processing techniques employed are some of the factors shown to influence the composition of olive fruit and olive oil. This review focuses comprehensively on the nutrients and high-value bioactives profile as well as medicinal and functional aspects of different parts of olives and its byproducts. Various factors affecting the composition of this food commodity of medicinal value are also discussed.

  18. Meloidogyne lusitanica n. sp. (Nematoda: Meloidogynidae), a Root-knot Nematode Parasitizing Olive Tree (Olea europaea L.)

    OpenAIRE

    de O. Abrantes, Isabel M.; de A. Santos, M. Susana N.

    1991-01-01

    A root-knot nematode from Portugal, Meloidogyne lusitanica n. sp., is described and illustrated from specimens obtained from olive trees (Olea europaea L.). Females of the new species have a characteristic perineal pattern with medium to high trapezoidal dorsal arch with distinct punctuations in the tail terminus area. The excretory pore is located posterior to the stylet, about 1.5-2.5 stylet lengths from the anterior end. The stylet is 17.1 μm long with pear-shaped knobs. Males have a round...

  19. MeLiSSA third compartment: a kinetic and stoichiometric study for Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures

    Science.gov (United States)

    Creuly, Catherine; Poughon, Laurent; Dussap, Claude-Gilles; Farges, Berangere

    2012-07-01

    As a part of a natural biological N-cycle, nitrification is one of the steps included in the conception of artificial ecosystems designed for extraterrestrial life support systems (LSS). In MELiSSA loop, which is based on carbon and nitrogen recycling, the non-edible part of the higher plants and the waste produced by the crew are collected in the liquefying compartment that degrades the chemically complex wastes into simpler building blocks (organic acids and CO2). The organic acids are eliminated in the second photoheterotrophic compartment letting an organic free medium mostly containing minerals and N-NH+4 nitrogen. The third compartment is in charge to re-oxidize N-NH+4 in order to make nitrogen usable by the following compartments. In MELiSSA, the constraint is to perform axenic cultures in order to fully control the genetic status of the culture and a thorough modelling for developing a control strategy of the compartment and of the loop, knowing that the reliability of the production of oxidized forms of nitrogen NO3- directly impacts the behaviour of the following compartments. Nitrification in aerobic environments is carried out by two groups of bacteria in co-cultures in a two-step process. The ammonia-oxidizing bacteria (Nitrosomonas europaea) realize the oxidation of ammonia to nitrite and the nitrite-oxidizing bacteria (Nitrobacter winogradskyi) the oxidation of nitrite to nitrate. In both cases, the bacteria achieve the oxidations to obtain an energy and reductant source for their growth and maintenance. Both groups use CO2 predominantly as their carbon source. They are typically found together in ecosystems and, consequently, nitrite accumulation is rare. This study concerns kinetic and mass balances studies of axenic cultures of Ns. europaea and Nb. winogradskyi in autotrophic conditions. The daily follow-up of these cultures is done using a new protocol involving flow cytometry and ionic chromatography. Nitrogen substrates and products are

  20. Metabarcoding Analysis of Fungal Diversity in the Phyllosphere and Carposphere of Olive (Olea europaea).

    Science.gov (United States)

    Abdelfattah, Ahmed; Li Destri Nicosia, Maria Giulia; Cacciola, Santa Olga; Droby, Samir; Schena, Leonardo

    2015-01-01

    The fungal diversity associated with leaves, flowers and fruits of olive (Olea europaea) was investigated in different phenological stages (May, June, October and December) using an implemented metabarcoding approach. It consisted of the 454 pyrosequencing of the fungal ITS2 region and the subsequent phylogenetic analysis of relevant genera along with validated reference sequences. Most sequences were identified up to the species level or were associated with a restricted number of related taxa enabling supported speculations regarding their biological role. Analyses revealed a rich fungal community with 195 different OTUs. Ascomycota was the dominating phyla representing 93.6% of the total number of detected sequences followed by unidentified fungi (3.6%) and Basidiomycota (2.8%). A higher level of diversity was revealed for leaves compared to flowers and fruits. Among plant pathogens the genus Colletotrichum represented by three species (C. godetiae syn. C. clavatum, C. acutatum s.s and C. karstii) was the most abundant on ripe fruits but it was also detected in other organs. Pseudocercospora cladosporioides was detected with a high frequency in all leaf samples and to a less extent in ripe fruits. A much lower relative frequency was revealed for Spilocaea oleagina and for other putative pathogens including Fusarium spp., Neofusicoccum spp., and Alternaria spp. Among non-pathogen taxa, Aureobasidium pullulans, the species complex of Cladosporium cladosporioides and Devriesia spp. were the most represented. This study highlights the existence of a complex fungal consortium including both phytopathogenic and potentially antagonistic microorganisms that can have a significant impact on olive productions.

  1. Neurochemical and behavioral effects of Nigella sativa and Olea europaea oil in rats.

    Science.gov (United States)

    Cheema, M Atif Raza; Nawaz, Shazia; Gul, Sumera; Salman, Tabinda; Naqvi, Sabira; Dar, Ahsana; Haleem, Darakhshan J

    2018-04-01

    In the last few decades, therapeutic uses of medicinal compounds present in food as a normal constituent has risen substantially, largely because of their fewer side effects and adequate efficacy. This study is designed to investigate a role of brain serotonin (5-HT) and dopamine (DA) in the potential nootropic, anxiolytic, and other beneficial effects of Nigella sativa (NS) and Olea europaea (OE) oil in rat models. Animals were treated with NS and OE oil orally at doses of 0.1 ml/kg and 0.25 ml/kg for 5 weeks. Food intake and body weight change, anxiety-like effects in elevated plus maze and activity in a novel and familiar environment were monitored weekly. Effects on learning and memory after 5 weeks treatment were monitored using Morris water maze test. Neurochemical analysis was carried using HPLC-ECD method. NS and OE oil administration enhanced learning and memory in Morris water maze test and the effects were greater in NS than OE oil-treated animals. Low dose of OE oil increased exploration in an open field, higher dose of OE oil and both doses of NS oil produced no consistent effect on open field exploration. Effects of both oils on anxiety-like behavior, food and water intake, and activity in activity box were either not consistent or did not occur. The treatment increased homovanillic acid (HVA). 5-HT levels increased in high dose of NS oil and low dose of OE oil-treated groups. Low dose NS oil decreased 5-HT. The present study suggests that active components in NS and OE oil may prove useful in treating impaired cognition. OE oil may produce psychostimulant-like effect. Modulation of DA and serotonin neurotransmission seems important in the pharmacological effect of these oils.

  2. Identification and characterisation of Short Interspersed Nuclear Elements in the olive tree (Olea europaea L.) genome.

    Science.gov (United States)

    Barghini, Elena; Mascagni, Flavia; Natali, Lucia; Giordani, Tommaso; Cavallini, Andrea

    2017-02-01

    Short Interspersed Nuclear Elements (SINEs) are nonautonomous retrotransposons in the genome of most eukaryotic species. While SINEs have been intensively investigated in humans and other animal systems, SINE identification has been carried out only in a limited number of plant species. This lack of information is apparent especially in non-model plants whose genome has not been sequenced yet. The aim of this work was to produce a specific bioinformatics pipeline for analysing second generation sequence reads of a non-model species and identifying SINEs. We have identified, for the first time, 227 putative SINEs of the olive tree (Olea europaea), that constitute one of the few sets of such sequences in dicotyledonous species. The identified SINEs ranged from 140 to 362 bp in length and were characterised with regard to the occurrence of the tRNA domain in their sequence. The majority of identified elements resulted in single copy or very lowly repeated, often in association with genic sequences. Analysis of sequence similarity allowed us to identify two major groups of SINEs showing different abundances in the olive tree genome, the former with sequence similarity to SINEs of Scrophulariaceae and Solanaceae and the latter to SINEs of Salicaceae. A comparison of sequence conservation between olive SINEs and LTR retrotransposon families suggested that SINE expansion in the genome occurred especially in very ancient times, before LTR retrotransposon expansion, and presumably before the separation of the rosids (to which Oleaceae belong) from the Asterids. Besides providing data on olive SINEs, our results demonstrate the suitability of the pipeline employed for SINE identification. Applying this pipeline will favour further structural and functional analyses on these relatively unknown elements to be performed also in other plant species, even in the absence of a reference genome, and will allow establishing general evolutionary patterns for this kind of repeats in

  3. High-throughput sequencing of RNA silencing-associated small RNAs in olive (Olea europaea L..

    Directory of Open Access Journals (Sweden)

    Livia Donaire

    Full Text Available Small RNAs (sRNAs of 20 to 25 nucleotides (nt in length maintain genome integrity and control gene expression in a multitude of developmental and physiological processes. Despite RNA silencing has been primarily studied in model plants, the advent of high-throughput sequencing technologies has enabled profiling of the sRNA component of more than 40 plant species. Here, we used deep sequencing and molecular methods to report the first inventory of sRNAs in olive (Olea europaea L.. sRNA libraries prepared from juvenile and adult shoots revealed that the 24-nt class dominates the sRNA transcriptome and atypically accumulates to levels never seen in other plant species, suggesting an active role of heterochromatin silencing in the maintenance and integrity of its large genome. A total of 18 known miRNA families were identified in the libraries. Also, 5 other sRNAs derived from potential hairpin-like precursors remain as plausible miRNA candidates. RNA blots confirmed miRNA expression and suggested tissue- and/or developmental-specific expression patterns. Target mRNAs of conserved miRNAs were computationally predicted among the olive cDNA collection and experimentally validated through endonucleolytic cleavage assays. Finally, we use expression data to uncover genetic components of the miR156, miR172 and miR390/TAS3-derived trans-acting small interfering RNA (tasiRNA regulatory nodes, suggesting that these interactive networks controlling developmental transitions are fully operational in olive.

  4. The skeletal organic matrix from Mediterranean coral Balanophyllia europaea influences calcium carbonate precipitation.

    Directory of Open Access Journals (Sweden)

    Stefano Goffredo

    Full Text Available Scleractinian coral skeletons are made mainly of calcium carbonate in the form of aragonite. The mineral deposition occurs in a biological confined environment, but it is still a theme of discussion to what extent the calcification occurs under biological or environmental control. Hence, the shape, size and organization of skeletal crystals from the cellular level through the colony architecture, were attributed to factors as diverse as mineral supersaturation levels and organic mediation of crystal growth. The skeleton contains an intra-skeletal organic matrix (OM of which only the water soluble component was chemically and physically characterized. In this work that OM from the skeleton of the Balanophyllia europaea, a solitary scleractinian coral endemic to the Mediterranean Sea, is studied in vitro with the aim of understanding its role in the mineralization of calcium carbonate. Mineralization of calcium carbonate was conducted by overgrowth experiments on coral skeleton and in calcium chloride solutions containing different ratios of water soluble and/or insoluble OM and of magnesium ions. The precipitates were characterized by diffractometric, spectroscopic and microscopic techniques. The results showed that both soluble and insoluble OM components influence calcium carbonate precipitation and that the effect is enhanced by their co-presence. The role of magnesium ions is also affected by the presence of the OM components. Thus, in vitro, OM influences calcium carbonate crystal morphology, aggregation and polymorphism as a function of its composition and of the content of magnesium ions in the precipitation media. This research, although does not resolve the controversy between environmental or biological control on the deposition of calcium carbonate in corals, sheds a light on the role of OM, which appears mediated by the presence of magnesium ions.

  5. The skeletal organic matrix from Mediterranean coral Balanophyllia europaea influences calcium carbonate precipitation.

    Science.gov (United States)

    Goffredo, Stefano; Vergni, Patrizia; Reggi, Michela; Caroselli, Erik; Sparla, Francesca; Levy, Oren; Dubinsky, Zvy; Falini, Giuseppe

    2011-01-01

    Scleractinian coral skeletons are made mainly of calcium carbonate in the form of aragonite. The mineral deposition occurs in a biological confined environment, but it is still a theme of discussion to what extent the calcification occurs under biological or environmental control. Hence, the shape, size and organization of skeletal crystals from the cellular level through the colony architecture, were attributed to factors as diverse as mineral supersaturation levels and organic mediation of crystal growth. The skeleton contains an intra-skeletal organic matrix (OM) of which only the water soluble component was chemically and physically characterized. In this work that OM from the skeleton of the Balanophyllia europaea, a solitary scleractinian coral endemic to the Mediterranean Sea, is studied in vitro with the aim of understanding its role in the mineralization of calcium carbonate. Mineralization of calcium carbonate was conducted by overgrowth experiments on coral skeleton and in calcium chloride solutions containing different ratios of water soluble and/or insoluble OM and of magnesium ions. The precipitates were characterized by diffractometric, spectroscopic and microscopic techniques. The results showed that both soluble and insoluble OM components influence calcium carbonate precipitation and that the effect is enhanced by their co-presence. The role of magnesium ions is also affected by the presence of the OM components. Thus, in vitro, OM influences calcium carbonate crystal morphology, aggregation and polymorphism as a function of its composition and of the content of magnesium ions in the precipitation media. This research, although does not resolve the controversy between environmental or biological control on the deposition of calcium carbonate in corals, sheds a light on the role of OM, which appears mediated by the presence of magnesium ions.

  6. The Skeletal Organic Matrix from Mediterranean Coral Balanophyllia europaea Influences Calcium Carbonate Precipitation

    Science.gov (United States)

    Goffredo, Stefano; Vergni, Patrizia; Reggi, Michela; Caroselli, Erik; Sparla, Francesca; Levy, Oren; Dubinsky, Zvy; Falini, Giuseppe

    2011-01-01

    Scleractinian coral skeletons are made mainly of calcium carbonate in the form of aragonite. The mineral deposition occurs in a biological confined environment, but it is still a theme of discussion to what extent the calcification occurs under biological or environmental control. Hence, the shape, size and organization of skeletal crystals from the cellular level through the colony architecture, were attributed to factors as diverse as mineral supersaturation levels and organic mediation of crystal growth. The skeleton contains an intra-skeletal organic matrix (OM) of which only the water soluble component was chemically and physically characterized. In this work that OM from the skeleton of the Balanophyllia europaea, a solitary scleractinian coral endemic to the Mediterranean Sea, is studied in vitro with the aim of understanding its role in the mineralization of calcium carbonate. Mineralization of calcium carbonate was conducted by overgrowth experiments on coral skeleton and in calcium chloride solutions containing different ratios of water soluble and/or insoluble OM and of magnesium ions. The precipitates were characterized by diffractometric, spectroscopic and microscopic techniques. The results showed that both soluble and insoluble OM components influence calcium carbonate precipitation and that the effect is enhanced by their co-presence. The role of magnesium ions is also affected by the presence of the OM components. Thus, in vitro, OM influences calcium carbonate crystal morphology, aggregation and polymorphism as a function of its composition and of the content of magnesium ions in the precipitation media. This research, although does not resolve the controversy between environmental or biological control on the deposition of calcium carbonate in corals, sheds a light on the role of OM, which appears mediated by the presence of magnesium ions. PMID:21799830

  7. Metabarcoding Analysis of Fungal Diversity in the Phyllosphere and Carposphere of Olive (Olea europaea.

    Directory of Open Access Journals (Sweden)

    Ahmed Abdelfattah

    Full Text Available The fungal diversity associated with leaves, flowers and fruits of olive (Olea europaea was investigated in different phenological stages (May, June, October and December using an implemented metabarcoding approach. It consisted of the 454 pyrosequencing of the fungal ITS2 region and the subsequent phylogenetic analysis of relevant genera along with validated reference sequences. Most sequences were identified up to the species level or were associated with a restricted number of related taxa enabling supported speculations regarding their biological role. Analyses revealed a rich fungal community with 195 different OTUs. Ascomycota was the dominating phyla representing 93.6% of the total number of detected sequences followed by unidentified fungi (3.6% and Basidiomycota (2.8%. A higher level of diversity was revealed for leaves compared to flowers and fruits. Among plant pathogens the genus Colletotrichum represented by three species (C. godetiae syn. C. clavatum, C. acutatum s.s and C. karstii was the most abundant on ripe fruits but it was also detected in other organs. Pseudocercospora cladosporioides was detected with a high frequency in all leaf samples and to a less extent in ripe fruits. A much lower relative frequency was revealed for Spilocaea oleagina and for other putative pathogens including Fusarium spp., Neofusicoccum spp., and Alternaria spp. Among non-pathogen taxa, Aureobasidium pullulans, the species complex of Cladosporium cladosporioides and Devriesia spp. were the most represented. This study highlights the existence of a complex fungal consortium including both phytopathogenic and potentially antagonistic microorganisms that can have a significant impact on olive productions.

  8. High-Throughput Sequencing of RNA Silencing-Associated Small RNAs in Olive (Olea europaea L.)

    Science.gov (United States)

    Donaire, Livia; Pedrola, Laia; de la Rosa, Raúl; Llave, César

    2011-01-01

    Small RNAs (sRNAs) of 20 to 25 nucleotides (nt) in length maintain genome integrity and control gene expression in a multitude of developmental and physiological processes. Despite RNA silencing has been primarily studied in model plants, the advent of high-throughput sequencing technologies has enabled profiling of the sRNA component of more than 40 plant species. Here, we used deep sequencing and molecular methods to report the first inventory of sRNAs in olive (Olea europaea L.). sRNA libraries prepared from juvenile and adult shoots revealed that the 24-nt class dominates the sRNA transcriptome and atypically accumulates to levels never seen in other plant species, suggesting an active role of heterochromatin silencing in the maintenance and integrity of its large genome. A total of 18 known miRNA families were identified in the libraries. Also, 5 other sRNAs derived from potential hairpin-like precursors remain as plausible miRNA candidates. RNA blots confirmed miRNA expression and suggested tissue- and/or developmental-specific expression patterns. Target mRNAs of conserved miRNAs were computationally predicted among the olive cDNA collection and experimentally validated through endonucleolytic cleavage assays. Finally, we use expression data to uncover genetic components of the miR156, miR172 and miR390/TAS3-derived trans-acting small interfering RNA (tasiRNA) regulatory nodes, suggesting that these interactive networks controlling developmental transitions are fully operational in olive. PMID:22140484

  9. Metabarcoding Analysis of Fungal Diversity in the Phyllosphere and Carposphere of Olive (Olea europaea)

    Science.gov (United States)

    Abdelfattah, Ahmed; Li Destri Nicosia, Maria Giulia; Cacciola, Santa Olga; Droby, Samir; Schena, Leonardo

    2015-01-01

    The fungal diversity associated with leaves, flowers and fruits of olive (Olea europaea) was investigated in different phenological stages (May, June, October and December) using an implemented metabarcoding approach. It consisted of the 454 pyrosequencing of the fungal ITS2 region and the subsequent phylogenetic analysis of relevant genera along with validated reference sequences. Most sequences were identified up to the species level or were associated with a restricted number of related taxa enabling supported speculations regarding their biological role. Analyses revealed a rich fungal community with 195 different OTUs. Ascomycota was the dominating phyla representing 93.6% of the total number of detected sequences followed by unidentified fungi (3.6%) and Basidiomycota (2.8%). A higher level of diversity was revealed for leaves compared to flowers and fruits. Among plant pathogens the genus Colletotrichum represented by three species (C. godetiae syn. C. clavatum, C. acutatum s.s and C. karstii) was the most abundant on ripe fruits but it was also detected in other organs. Pseudocercospora cladosporioides was detected with a high frequency in all leaf samples and to a less extent in ripe fruits. A much lower relative frequency was revealed for Spilocaea oleagina and for other putative pathogens including Fusarium spp., Neofusicoccum spp., and Alternaria spp. Among non-pathogen taxa, Aureobasidium pullulans, the species complex of Cladosporium cladosporioides and Devriesia spp. were the most represented. This study highlights the existence of a complex fungal consortium including both phytopathogenic and potentially antagonistic microorganisms that can have a significant impact on olive productions. PMID:26132745

  10. Human absorption and metabolism of oleuropein and hydroxytyrosol ingested as olive (Olea europaea L.) leaf extract.

    Science.gov (United States)

    de Bock, Martin; Thorstensen, Eric B; Derraik, José G B; Henderson, Harold V; Hofman, Paul L; Cutfield, Wayne S

    2013-11-01

    Phenolic compounds derived from the olive plant (Olea europaea L.), particularly hydroxytyrosol and oleuropein, have many beneficial effects in vitro. Olive leaves are the richest source of olive phenolic compounds, and olive leaf extract (OLE) is now a popular nutraceutical taken either as liquid or capsules. To quantify the bioavailability and metabolism of oleuropein and hydroxytyrosol when taken as OLE, nine volunteers (five males) aged 42.8 ± 7.4 years were randomized to receive either capsulated or liquid OLE as a single lower (51.1 mg oleuropein, 9.7 mg hydroxytyrosol) or higher (76.6 mg oleuropein, 14.5 mg hydroxytyrosol) dose, and then the opposite strength (but same formulation) a week later. Plasma and urine samples were collected at fixed intervals for 24 h post-ingestion. Phenolic content was analyzed by LC-ESI-MS/MS. Conjugated metabolites of hydroxytyrosol were the primary metabolites recovered in plasma and urine after OLE ingestion. Peak oleuropein concentrations in plasma were greater following ingestion of liquid than capsule preparations (0.47 versus 2.74 ng/mL; p = 0.004), but no such effect was observed for peak concentrations of conjugated (sulfated and glucuronidated) hydroxytyrosol (p = 0.94). However, the latter peak was reached earlier with liquid preparation (93 versus 64 min; p = 0.031). There was a gender effect on the bioavailability of phenolic compounds, with males displaying greater plasma area under the curve for conjugated hydroxytyrosol (11,600 versus 2550 ng/mL; p = 0.048). All conjugated hydroxytyrosol metabolites were recovered in the urine within 8 h. There was wide inter-individual variation. OLE effectively delivers oleuropein and hydroxytrosol metabolites to plasma in humans. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Profiling and functional classification of esterases in olive (Olea europaea) pollen during germination.

    Science.gov (United States)

    Rejón, Juan D; Zienkiewicz, Agnieszka; Rodríguez-García, María Isabel; Castro, Antonio J

    2012-10-01

    A pollen grain contains a number of esterases, many of which are released upon contact with the stigma surface. However, the identity and function of most of these esterases remain unknown. In this work, esterases from olive pollen during its germination were identifided and functionally characterized. The esterolytic capacity of olive (Olea europaea) pollen was examined using in vitro and in-gel enzymatic assays with different enzyme substrates. The functional analysis of pollen esterases was achieved by inhibition assays by using specific inhibitors. The cellular localization of esterase activities was performed using histochemical methods. Olive pollen showed high levels of non-specific esterase activity, which remained steady after hydration and germination. Up to 20 esterolytic bands were identified on polyacrylamide gels. All the inhibitors decreased pollen germinability, but only diisopropyl fluorophosphate (DIFP) hampered pollen tube growth. Non-specific esterase activity is localized on the surface of oil bodies (OBs) and small vesicles, in the pollen intine and in the callose layer of the pollen tube wall. Acetylcholinesterase (AChE) activity was mostly observed in the apertures, exine and pollen coat, and attached to the pollen tube wall surface and to small cytoplasmic vesicles. In this work, for the first time a systematic functional characterization of esterase enzymes in pollen from a plant species with wet stigma has been carried out. Olive pollen esterases belong to four different functional groups: carboxylesterases, acetylesterases, AChEs and lipases. The cellular localization of esterase activity indicates that the intine is a putative storage site for esterolytic enzymes in olive pollen. Based on inhibition assays and cellular localization of enzymatic activities, it can be concluded that these enzymes are likely to be involved in pollen germination, and pollen tube growth and penetration of the stigma.

  12. Dental morphology of Talpa europaea and Talpa occidentalis (Mammalia: Insectivora) with a discussion of fossil Talpa in the Pleistocene of Europe

    NARCIS (Netherlands)

    Cleef-Roders, van J.T.; Hoek Ostende, van den L.W.

    2001-01-01

    A description is given of the last premolar and molars of T. europaea from The Netherlands and T. occidentalis of Spain. The metrical and morphological differences between the dentitions of the two species are small. A review is given of the literature of fossil Talpa in the Pleistocene of Europe.

  13. Isolation of antioxidative secoiridoids from olive wood (Olea europaea L.) guided by on-line HPLC-DAD-radical scavenging detection

    NARCIS (Netherlands)

    Pérez-Bonilla, M.; Salido, S.; Beek, van T.A.; Waard, de P.; Linares-Palomino, P.J.; Sánchez, A.; Altarejos, J.

    2011-01-01

    The woody portion of olive tree pruning is a source of natural antioxidants of potential interest for the food industry. This work deals with the isolation and identification of further antioxidants present in an ethyl acetate extract of olive (Olea europaea L.) wood. Thus, a new secoiridoid,

  14. Salt stress induces differential regulation of the phenylpropanoid pathway in Olea europaea cultivars Frantoio (salt-tolerant) and Leccino (salt-sensitive)

    NARCIS (Netherlands)

    Rossi, Lorenzo; Borghi, Monica; Francini, Alessandra; Lin, Xiuli; Xie, De Yu; Sebastiani, Luca

    2016-01-01

    Olive tree (Olea europaea L.) is an important crop in the Mediterranean Basin where drought and salinity are two of the main factors affecting plant productivity. Despite several studies have reported different responses of various olive tree cultivars to salt stress, the mechanisms that convey

  15. Simultaneous separation and purification of flavonoids and oleuropein from Olea europaea L. (olive) leaves using macroporous resin.

    Science.gov (United States)

    Li, Chen; Zheng, Yuanyuan; Wang, Xiaofei; Feng, Shilan; Di, Duolong

    2011-12-01

    This study developed a feasible process to simultaneously separate and purify polyphenols, including flavonoids and oleuropein, from the leaves of Olea europaea L. Macroporous resins were used as the separation and purification materials. The performance and separation capabilities of eight resins (D101, DM130, HPD450, LSA-21, LSA-40, 07C, LSD001 and HPD600) were systematically evaluated. The contents of target polyphenols in different extracts were determined using ultraviolet (for flavonoids) and high-performance liquid chromatographic (for oleuropein) methods. The static adsorption and desorption results showed that resin LSA-21 had better adsorption properties among the eight resins. Influential factors such as extraction method, pH value of feeding solution, desorption solution, adsorption kinetics and adsorption isotherm, etc. to the extraction and purification of these polyphenols were successively investigated on resin LSA-21. The target flavonoids and oleuropein were selectively purified using resin LSA-21. Compared with the contents in raw leaves, the contents of total flavonoids and oleuropein in the final purified products were increased 13.2-fold (from 16 to 211 g kg(-1) ) and 7.5-fold (from 120 to 902 g kg(-1) ) with recovery yields of 87.9% and 85.6%, respectively. This extraction and purification method could be used in the large-scale enrichment or purification of flavonoids, oleuropein and other polyphenols from O. europaea L. leaves or other herbal materials in industrial, food processing and medical manufacture. Copyright © 2011 Society of Chemical Industry.

  16. H(+) -pyrophosphatase from Salicornia europaea confers tolerance to simultaneously occurring salt stress and nitrogen deficiency in Arabidopsis and wheat.

    Science.gov (United States)

    Lv, Sulian; Jiang, Ping; Nie, Lingling; Chen, Xianyang; Tai, Fang; Wang, Duoliya; Fan, Pengxiang; Feng, Juanjuan; Bao, Hexigeduleng; Wang, Jinhui; Li, Yinxin

    2015-11-01

    High salinity and nitrogen (N) deficiency in soil are two key factors limiting crop productivity, and they usually occur simultaneously. Here we firstly found that H(+) -PPase is involved in salt-stimulated NO3 (-) uptake in the euhalophyte Salicornia europaea. Then, two genes (named SeVP1 and SeVP2) encoding H(+) -PPase from S. europaea were characterized. The expression of SeVP1 and SeVP2 was induced by salt stress and N starvation. Both SeVP1 or SeVP2 transgenic Arabidopsis and wheat plants outperformed the wild types (WTs) when high salt and low N occur simultaneously. The transgenic Arabidopsis plants maintained higher K(+) /Na(+) ratio in leaves and exhibited increased NO3 (-) uptake, inorganic pyrophosphate-dependent vacuolar nitrate efflux and assimilation capacity under this double stresses. Furthermore, they had more soluble sugars in shoots and roots and less starch accumulation in shoots than WT. These performances can be explained by the up-regulated expression of ion, nitrate and sugar transporter genes in transgenic plants. Taken together, our results suggest that up-regulation of H(+) -PPase favours the transport of photosynthates to root, which could promote root growth and integrate N and carbon metabolism in plant. This work provides potential strategies for improving crop yields challenged by increasing soil salinization and shrinking farmland. © 2015 John Wiley & Sons Ltd.

  17. Comparative and evaluation of anti-leech (Limnatis Nilotica effect of Olive (Olea Europaea L. with Levamisol and Tiabendazole

    Directory of Open Access Journals (Sweden)

    Majid Gholami-Ahangaran

    2012-05-01

    Full Text Available Objective: Until now, there is no registered drug for treatment of complications with leech in the world. According to the available scientific evidence, Olive is an effective anti-parasitic plant. Hence, in the present experiment we studied the inhibitory and killing effect of Olive methanolic extract on Limnatis nilotica. Methods: In this study, 100 leeches (Limnatis nilotica were collected from some wells in western area of Iran (south region in Ilam province and evaluated the antileech effects of Olive methanolic extract (Olea europaea L. in comparison with levamisole and tinidazole. Results: The results indicated no effect of tinidasole and distilled water on killing or mortality rate of the leeches but Olea europaea L. plant and levamisole have more effect on the L. nilotica. The mean death time of leech for levamisole and Olive determined 10依0.98 and 210依 24.1 minutes, respectively. Conclusions: The results showed that treatments of Olive methanolic extract and levamisole have the most effects on leeches and could be used as natural anti-L. nilotica. However it is necessary to achieve further studies for confirm of this subject.

  18. Antimicrobial activity of Olea europaea Linné extracts and their applicability as natural food preservative agents.

    Science.gov (United States)

    Thielmann, J; Kohnen, S; Hauser, C

    2017-06-19

    The antimicrobial activity of phenolic compounds from Olea (O.) europaea Linné (L.) is part of the scientific discussion regarding the use of natural plant extracts as alternative food preservative agents. Although, the basic knowledge on the antimicrobial potential of certain molecules such as oleuropein, hydroxytyrosol or elenolic acid derivatives is given, there is still little information regarding their applicability for food preservation. This might be primarily due to the lack of information regarding the full antimicrobial spectrum of the compounds, their synergisms in natural or artificial combinations and their interaction with food ingredients. The present review accumulates available literature from the past 40 years, investigating the antimicrobial activity of O. europaea L. derived extracts and compounds in vitro and in food matrices, in order to evaluate their food applicability. In summary, defined extracts from olive fruit or leaves, containing the strongest antimicrobial compounds hydroxytyrosol, oleacein or oleacanthal in considerable concentrations, appear to be suitable for food preservation. Nonetheless there is still need for consequent research on the compounds activity in food matrices, their effect on the natural microbiota of certain foods and their influence on the sensorial properties of the targeted products. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Oil, protein, antioxidants and free radical scavenging activity of stone from wild olive trees (Olea europaea L.).

    Science.gov (United States)

    Hannachi, Hédia; Elfalleh, Walid; Marzouk, Sizaiem

    2013-05-01

    The wild olive trees or oleaster (var. sylvestris) and the cultivated olive trees (var. europaea) constitute the two botanical varieties of Olea europaea L. from Mediterranean. In this study, a partial chemical profile was conducted including the total lipids, the fatty acid profiles, soluble proteins, polyphenols, flavanoids contents and antioxidants activities of stone from six oleaster trees. The comparison was made by two olive cultivars cultivated in the same region. The oleaster and cultivar stones were richer in oil content having an average of 8.99 and 7.38 % dry weight basis (DW), respectively. Qualitatively, all studied oils have the same fatty acids profile with the oleic acid C18:1n-9 as the major fatty acid. The oleaster stone oils were richer in monounsaturated fatty acids having an average of 64.87%. They, also, richer in protein content with an average of 198.86 mg/g DW.The globulin is the major fraction, followed by the albumin, the prolamin and the glutemin fractions. The oleaster stone extracts contain polyphenols, flavonoids with an average of 151.14 and 11.91 mg gallic acid equivalent/100g of DW, respectively. The studied extracts showed antioxidant activity using the free radical scavenging activity determined by DPPH and ABTS. The unexploited oleaster stone seems to be a source of oil with good fatty acids balance, in protein and antioxidants metabolites and would be useful for the formulation of supplements and/or pharmaceutical ingredients.

  20. Plant-parasitic nematodes associated with olive tree (Olea europaea L.) with a focus on the Mediterranean Basin: a review.

    Science.gov (United States)

    Ali, Nadine; Chapuis, Elodie; Tavoillot, Johannes; Mateille, Thierry

    2014-01-01

    The olive tree (Olea europaea ssp. europaea.) is one of the most ancient cultivated trees. It is an emblematic species owing to its ecological, economic and cultural importance, especially in the Mediterranean Basin. Plant-parasitic nematodes are major damaging pests on olive trees, mainly in nurseries. They significantly contribute to economic losses in the top-ten olive-producing countries in the world. However, the damages they induce in orchards and nurseries are specifically documented only in a few countries. This review aims to update knowledge about the olive-nematode pathosystem by: (1) updating the list of plant-parasitic nematodes associated with olive trees; (2) analysing their diversity (taxonomic level, trophic groups, dominance of taxa), which allowed us (i) to assess the richness observed in each country, and (ii) to exhibit and describe the most important taxa able to induce damages on olive trees such as: Meloidogyne, Pratylenchus, Helicotylenchus, Xiphinema, Tylenchulus, Rotylenchulus, Heterodera (distribution especially in the Mediterranean Basin, pathogenicity and reactions of olive trees); (3) describing some management strategies focusing on alternative control methods; (4) suggesting new approaches for controlling plant-parasitic nematodes based on the management of the diversity of their communities, which are structured by several environmental factors such as olive diversity (due to domestication of wild olive in the past, and to breeding now), cropping systems (from traditional to high-density orchards), irrigation, and terroirs. Copyright © 2014 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  1. [The scientific progress of the "Clinica del Lavoro Luigi Devoto" as seen through the contents of the journal "La Medicina del Lavoro". ].

    Science.gov (United States)

    Foà, V; Camerino, Donatella

    2003-01-01

    On occasion of the Centenary of the "Clinica del Lavoro Luigi Devoto", its researchers suggested that awareness of its historical identity and scientific development should constitute the basis for the future of the Institution. The directors of the Institute who have succeeded one to the other over the years have left a vivid report of the vast amount of work developed in several research fields and also of the original results achieved with significant impact on the scientific community and on society. Content analysis of "La Medicina del Lavoro" allowed us to shed light on strong bonds existing between manufacturing techniques, work organization and health, in the different political and social periods in which they developed. Many actions have been defined and several research subjects have been renewed (according to current demands and new methodological possibilities) between the past and the present, nevertheless many new approaches need to be taken in the fields of epidemiology, indoor air quality, ergophthalmology, muskuloskeletal disorders, environmental and molecular toxicology, and further research will be undertaken thanks to the potential of this discipline for the future. The aim of this report is also to express our thanks to all the medical and non-medical staff who have made their contribution over 100 years of engagement.

  2. UV-B radiation modulates physiology and lipophilic metabolite profile in Olea europaea.

    Science.gov (United States)

    Celeste Dias, Maria; Pinto, Diana C G A; Correia, Carlos; Moutinho-Pereira, José; Oliveira, Helena; Freitas, Helena; Silva, Artur M S; Santos, Conceição

    2018-03-01

    Ultraviolet-B (UV-B) radiation plays an important role in plant photomorphogenesis. Whilst the morpho-functional disorders induced by excessive UV irradiation are well-known, it remains unclear how this irradiation modulates the metabolome, and which metabolic shifts improve plants' tolerance to UV-B. In this study, we use an important Mediterranean crop, Olea europaea, to decipher the impacts of enhanced UV-B radiation on the physiological performance and lipophilic metabolite profile. Young olive plants (cv. 'Galega Vulgar') were exposed for five days to UV-B biologically effective doses of 6.5 kJ m -2  d -1 and 12.4 kJ m -2 d -1 . Cell cycle/ploidy, photosynthesis and oxidative stress, as well as GC-MS metabolites were assessed. Both UV-B treatments impaired net CO 2 assimilation rate, transpiration rate, photosynthetic pigments, and RuBisCO activity, but 12.4 kJ m -2  d -1 also decreased the photochemical quenching (qP) and the effective efficiency of PSII (Φ PSII ). UV-B treatments promoted mono/triperpene pathways, while only 12.4 kJ m -2  d -1 increased fatty acids and alkanes, and decreased geranylgeranyl-diphosphate. The interplay between physiology and metabolomics suggests some innate ability of these plants to tolerate moderate UV-B doses (6.5 kJ m -2  d -1 ). Also their tolerance to higher doses (12.4 kJ m -2  d -1 ) relies on plants' metabolic adjustments, where the accumulation of specific compounds such as long-chain alkanes, palmitic acid, oleic acid and particularly oleamide (which is described for the first time in olive leaves) play an important protective role. This is the first study demonstrating photosynthetic changes and lipophilic metabolite adjustments in olive leaves under moderate and high UV-B doses. Copyright © 2018 Elsevier GmbH. All rights reserved.

  3. Role of carbohydrate reserves in yield production of intensively cultivated oil olive (Olea europaea L.) trees.

    Science.gov (United States)

    Bustan, Amnon; Avni, Avishai; Lavee, Shimon; Zipori, Isaac; Yeselson, Yelena; Schaffer, Arthur A; Riov, Joseph; Dag, Arnon

    2011-05-01

    Olive (Olea europaea) has a very high tendency for year-to-year deviation in yield (alternate bearing), which has a negative economic impact on the olive oil industry. Among possible reasons for alternate bearing, depletion of stored carbohydrates (CHO) during the On-year (high yield) has often been mentioned. The objective of the present study was to verify the role of CHO reserves, as a cause or effect, in the alternate bearing of intensively cultivated olives. A monthly survey of soluble sugar and starch concentrations in the leaves, branches, bark and roots of On- and Off-trees (cv. Barnea) was carried out during a complete reproductive cycle from November 2005 to October 2006. Carbohydrate concentration in the sapwood was determined in January, as well as an estimate of whole-tree biomass. The trunk and limbs possess the largest portion of CHO reserves. The influence of reduced fruit load on CHO reserves was also investigated. Starch, mannitol and sucrose concentrations increased from December to March in all tissues, and then declined along with fruit development. Leaves, branches and bark have a significant role in CHO storage, whereas roots accumulated the lowest CHO concentrations. However, fluctuations in reserve content suggested considerable involvement of roots in the CHO budget. Nevertheless, there were no meaningful differences in the annual pattern of CHO concentration between On- and Off-trees. Even a 75-100% reduction in fruit number brought about only a minor, sluggish increase in CHO content, though this was more pronounced in the roots. Carbohydrate reserves were not depleted, even under maximum demands for fruit and oil production. It is concluded that in olives, the status of CHO reserves is not a yield determinant. However, they may play a significant role in the olive's survival strategy, ensuring tree recovery in the unpredictable semiarid Mediterranean environment. This suggests that CHO reserves in olive act like an active sink

  4. EFFET HYPOUPIDEMIANT DE L'HUILE D'OLIVIER SAIWAGEOLEA EUROPAEA OLÉASTRE OU OLEA SYLVESTRIS.

    OpenAIRE

    BENDIMERAD, SORAYA

    2014-01-01

    L'Olivier sauvage (Olea europaea oléastre/sylvestris) est une espèce végétale ancêtre de l'olivier cultivé bordant le pourtourméditerranéen. L'extraction par un procédé triphasique de fruit de cet arbre donne une huile sacrée par ses multiples usages. La détermination des indices physico- chimiques a révélé que l'huile est vierge, nonsiccative, constituée de chaines moyenne d'acides gras. La composition en acides gras montre une instauration prépondérante due à la teneur élevée...

  5. Phenol metabolism in the leaves of the olive tree (Olea europaea L.) cv. Picual, Verdial, Arbequina, and Frantoio during ripening.

    Science.gov (United States)

    Ortega-García, Francisca; Peragón, Juan

    2010-12-08

    The kinetic behavior and protein-expression level of phenylalanine ammonia-lyase (PAL) and polyphenol oxidase (PPO) have been determined in the leaves of the olive tree (Olea europaea L.) of cv. Picual, Verdial, Arbequina, and Frantoio during fruit ripening. Moreover, the concentration of total phenolic compounds, oleuropein, hydroxytyrosol, and tyrosol has been also determined. This study was carried out in 20-year-old olive trees grown in Jaén (Spain). The concentration of total and specific phenols showed a specific pattern in each cultivar. Frantoio showed the highest phenol concentration followed by Arbequina, Picual, and Verdial. A coordinated response between PAL, PPO, and the concentration of total phenols in the four cultivars was found. Also, specific changes were shown over the course of ripening, indicating a regulation of PAL, PPO, and phenol concentration in the olive-tree leaves during fruit ripening.

  6. Phylogenomics of the olive tree (Olea europaea) reveals the relative contribution of ancient allo- and autopolyploidization events.

    Science.gov (United States)

    Julca, Irene; Marcet-Houben, Marina; Vargas, Pablo; Gabaldón, Toni

    2018-01-25

    Polyploidization is one of the major evolutionary processes that shape eukaryotic genomes, being particularly common in plants. Polyploids can arise through direct genome doubling within a species (autopolyploidization) or through the merging of genomes from distinct species after hybridization (allopolyploidization). The relative contribution of both mechanisms in plant evolution is debated. Here we used phylogenomics to dissect the tempo and mode of duplications in the genome of the olive tree (Olea europaea), one of the first domesticated Mediterranean fruit trees. Our results depict a complex scenario involving at least three past polyploidization events, of which two-at the bases of the family Oleaceae and the tribe Oleeae, respectively-are likely to be the result of ancient allopolyploidization. A more recent polyploidization involves specifically the olive tree and relatives. Our results show the power of phylogenomics to distinguish between allo- and auto polyploidization events and clarify the contributions of duplications in the evolutionary history of the olive tree.

  7. Learning curve of sentinel lymph nodes in early breast cancer at the Teaching Hospital 'Hospital das Clinicas' in Belo Horizonte, MG

    International Nuclear Information System (INIS)

    Homma, L.A.H.; Campos, T.P.R.; Silva, S.Z.C.; Siqueira, C.F.; Lima, C.F.

    2007-01-01

    The research of the sentinel lymph node in early breast cancer, an already worldwide established method, was standardized at the teaching hospital 'Hospital das Clinicas' in Belo Horizonte (MG, Brazil). This standardization was carried out from December 2000 through December 2002, in which 39 patients were included in a learning curve and method validation. The applied methodology is based on the combination of a lymphoscintillography and the blue stain. A periareolar colloid 99m Tc injection was given 24 hours before the surgery. The blue dye was injected in the peritumoral region during the surgery. The sentinel lymph node was identified by the blue color pattern of the lymph node and by the use of a portable gamma probe detector. Radioactive contamination was evaluated before, during and after the surgery. The measurement of the radioactivity of the breast area was taken by using a GM detector and an ionization chamber on a humid piece of gauze (passed on the breast area), from which the radioactivity was recorded as well as the gloves used during the surgery, and the gauzes with contaminated blood. The sentinel lymph node identification rate was found to be 95%, there was a false negative rate of 4,8% and a predictive negative value (PNV) of 94%. The identification figures, the predictive negative value and the false negative rate were similar to the figures found in technical literature. The technique of the biopsy of the sentinel lymph node (BSL) is the method chosen for staging patients with invasive breast cancer and with clinically negative results for the armpit. The combined method using radio-colloid and the stain is the most indicated. There is a minimum radio isotopic contamination and there is scarcely any danger for the patient or the medical staff involved in the procedure. (author)

  8. Dynamique de la conductance hydraulique chez l'olivier de table (Olea europaea L., cv Meski

    Directory of Open Access Journals (Sweden)

    Hechmi, C.

    2007-01-01

    Full Text Available Hydraulic Conductance Dynamic in Olive Table Tree (Olea europaea L. cv Meski. Cette étude expose les effets de l'aménagement des pâturages par la digue filtrante sur la dynamique de la végétation. Dans les régions sahéliennes, de nombreuses techniques sont appliquées sur les sols pour la restauration des parcours dégradés. La digue filtrante s'intéresse particulièrement aux axes de drainage ou bas-fonds en dégradation. La méthode d'étude a consisté à évaluer l'impact des digues filtrantes par l'inventaire de la végétation, la mesure de la biomasse produite, et l'analyse chimique d'échantillons de fourrage et de sol. Ces observations ont été faites à la fois sur l'espace aménagé et sur un espace témoin représentatif en deux fois durant cinq ans. Les observations sur l'espace aménagé (stations d'observation d'un ha ont été faites en fonction du gradient par rapport à la digue filtrante tandis que sur le témoin (station d'observation d'un ha, les mesures ont été homogénéisées sur l'ensemble de la parcelle. Les résultats obtenus des inventaires de végétation montrent un effet positif de l'aménagement sur la dynamique de la végétation qui se maintient après cinq années. Les effets concernent la composition floristique pour laquelle certaines espèces connaissent une amélioration. Il s'agit de Panicum laetum (+ 5,9% en 1999 et + 1,9% en 2003, Setaria pallide fusca (+ 2,4 à + 8,6%, Cassia obtusifolia (+ 13,6% à + 9,3% et Zornia glochidiata (- 2,9% à + 1,7 %. Les espèces en régression sont surtout composées de Schoenefeldia gracilis (+ 1,7% à - 12% et Microchloa indica (- 28,9% à - 12,1% entre 1999 et 2003. L'écart de recouvrement du sol entre la parcelle aménagée et le témoin a été de -0,4% en 1999 contre + 14,6% en 2003. La biomasse produite et la capacité de charge ont connu une expansion allant de 3,14 à 4,5 fois par rapport à l'espace non aménagé. Cependant, des suivis doivent

  9. Composition, quality and oxidative stability of virgin olive oils from some selected wild olives (Olea europaea L. subsp. oleaster)

    OpenAIRE

    Zarrouk, Mokhtar; Daoud, Douja; Krichene, Douha; Nouairi, Issam; Guerfel, Mokhtar; Baccouri, Olfa; Zarrouk, Wissem; Baccouri, Bechir

    2008-01-01

    A study on the characterization of virgin olive oils from wild olives (Olea europaea L. subsp. oleaster) was conducted in order to define new cultivars which are welladapted to the Tunisian environment and yield high quality oils. The study was done during the crop years 2003/04, 2004/05 and 2005/06. The main analytical parameters of the oils were evaluated: fatty acid compositions, chlorophylls, carotenoids, tocopherols and phenolic compounds as well as their relationship with oxidative stab...

  10. Isolation of Endophytic Plant Growth-Promoting Bacteria Associated with the Halophyte Salicornia europaea and Evaluation of their Promoting Activity Under Salt Stress.

    Science.gov (United States)

    Zhao, Shuai; Zhou, Na; Zhao, Zheng-Yong; Zhang, Ke; Wu, Guo-Hua; Tian, Chang-Yan

    2016-10-01

    Several reports have highlighted that many plant growth-promoting endophytic bacteria (PGPE) can assist their host plants in coping with various biotic and abiotic stresses. However, information about the PGPE colonizing in the halophytes is still scarce. This study was designed to isolate and characterize PGPE from salt-accumulating halophyte Salicornia europaea grown under extreme salinity and to evaluate in vitro the bacterial mechanisms related to plant growth promotion. A total of 105 isolates were obtained from the surface-sterilized roots, stems, and assimilation twigs of S. europaea. Thirty-two isolates were initially selected for their ability to produce 1-aminocyclopropane-1-carboxylate deaminase as well as other properties such as production of indole-3-acetic acid and phosphate-solubilizing activities. The 16S rRNA gene-sequencing analysis revealed that these isolates belong to 13 different genera and 19 bacterial species. For these 32 strains, seed germination and seedling growth in axenically grown S. europaea seedlings at different NaCl concentrations (50-500 mM) were quantified. Five isolates possessing significant stimulation of the host plant growth were obtained. The five isolates were identified as Bacillus endophyticus, Bacillus tequilensis, Planococcus rifietoensis, Variovorax paradoxus, and Arthrobacter agilis. All the five strains could colonize and can be reisolated from the host plant interior tissues. These results demonstrate that habitat-adapted PGPE isolated from halophyte could enhance plant growth under saline stress conditions.

  11. Community structure variability of Uropodina mites (Acari: Mesostigmata) in nests of the common mole, Talpa europaea, in Central Europe.

    Science.gov (United States)

    Napierała, Agnieszka; Mądra, Anna; Leszczyńska-Deja, Kornelia; Gwiazdowicz, Dariusz J; Gołdyn, Bartłomiej; Błoszyk, Jerzy

    2016-04-01

    Underground nests of Talpa europaea, known as the common mole, are very specific microhabitats, which are also quite often inhabited by various groups of arthropods. Mites from the suborder Uropodina (Acari: Mesostigmata) are only one of them. One could expect that mole nests that are closely located are inhabited by communities of arthropods with similar species composition and structure. However, results of empirical studies clearly show that even nests which are close to each other can be different both in terms of the species composition and abundance of Uropodina communities. So far, little is known about the factors that can cause these differences. The major aim of this study was to identify factors determining species composition, abundance, and community structure of Uropodina communities in mole nests. The study is based on material collected during a long-term investigation conducted in western parts of Poland. The results indicate that the two most important factors influencing species composition and abundance of Uropodina communities in mole nests are nest-building material and depth at which nests are located. Composition of Uropodina communities in nests of moles was also compared with that of other microhabitats (e.g. rotten wood, forest litter, soil) based on data from 4421 samples collected in Poland. Communities of this habitat prove most similar to these of open areas, especially meadows, as well as some forest types.

  12. High-Throughput Sequencing Analysis of the Endophytic Bacterial Diversity and Dynamics in Roots of the Halophyte Salicornia europaea.

    Science.gov (United States)

    Zhao, Shuai; Zhou, Na; Zhao, Zheng-Yong; Zhang, Ke; Tian, Chang-Yan

    2016-05-01

    Endophytic bacterial communities of halophyte Salicornia europaea roots were analyzed by 16S rRNA gene pyrosequencing. A total of 20,151 partial 16S rRNA gene sequences were obtained. These sequences revealed huge amounts of operational taxonomic units (OTUs), that is, 747-1405 OTUs in a root sample, at 3 % cut-off level. Root endophytes mainly comprised four phyla, among which Proteobacteria was the most represented, followed by Bacteroidetes, Actinobacteria, and Firmicutes. Gammaproteobacteria was the most abundant class of Proteobacteria, followed by Betaproteobacteria and Alphaproteobacteria. Genera Pantoea, Halomonas, Azomonas, Serpens, and Pseudomonas were shared by all growth periods. A marked difference in endophytic bacterial communities was evident in roots from different host life-history stages. Gammaproteobacteria increased during the five periods, while Betaproteobacteria decreased. The richest endophytic bacteria diversity was detected in the seedling stage. Endophytic bacteria diversity was reduced during the flowering stage and fruiting stage. The five libraries contained 2321 different OTUs with 41 OTUs in common. As a whole, this study first surveys communities of endophytic bacteria by tracing crucial stages in the process of halophyte growth using high-throughput sequencing methods.

  13. Sustainability, Innovation, and Green Chemistry in the Production and Valorization of Phenolic Extracts from Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Annalisa Romani

    2016-10-01

    Full Text Available This paper describes a circular economy process based on environmentally and economically sustainable procedures which was applied to the sector of olive oil processing on an industrial scale. Olea europaea L. tissues and by-products represent a renewable and low-cost source of polyphenols, in particular hydroxytyrosol (HTyr, a naturally occurring compound well known for its biological properties. Specifically, green leaves (GL, dried leaves (DL, and pitted olive pulp were treated with water in a pneumatic extractor to obtain the corresponding polyphenolic extracts. Three standardized fractions, named Soft Extract Olea GL, Soft Extract Olea DL, and Soft Extract Olea HTyr resulted after the following two steps: a separation process carried out by membrane technology, and a concentration step performed under reduced pressure and low temperature. The polyphenolic fractions showed antiradical activity and have potential industrial applications in the food, nutraceutical, pharmaceutical, feed, and agronomic fields. Novel functionalized extracts containing hydroxytyrosol methyl carbonate (HTyr-MC were obtained from Soft Extract Olea HTyr through an innovative approach based on green chemistry procedures, which appear to be a promising tool to increase the applications of the polyphenolic extracts.

  14. Application of an integrated statistical design for optimization of culture condition for ammonium removal by Nitrosomonas europaea.

    Directory of Open Access Journals (Sweden)

    Yingling Bao

    Full Text Available Statistical methodology was applied to the optimization of the ammonium oxidation by Nitrosomonas europaea for biomass concentration (C(B, nitrite yield (Y(N and ammonium removal (R(A. Initial screening by Plackett-Burman design was performed to select major variables out of nineteen factors, among which NH4Cl concentration (C(N, trace element solution (TES, agitation speed (AS, and fermentation time (T were found to have significant effects. Path of steepest ascent and response surface methodology was applied to optimize the levels of the selected factors. Finally, multi-objective optimization was used to obtain optimal condition by compromise of the three desirable objectives through a combination of weighted coefficient method coupled with entropy measurement methodology. These models enabled us to identify the optimum operation conditions (C(N= 84.1 mM; TES = 0.74 ml; AS= 100 rpm and T = 78 h, under which C(B= 3.386×10(8 cells/ml; Y(N= 1.98 mg/mg and R(A = 97.76% were simultaneously obtained. The optimized conditions were shown to be feasible through verification tests.

  15. Characterization of polyphenol oxidase from the Manzanilla cultivar (Olea europaea pomiformis) and prevention of browning reactions in bruised olive fruits.

    Science.gov (United States)

    Segovia-Bravo, Kharla A; Jarén-Galan, Manuel; García-García, Pedro; Garrido-Fernandez, Antonio

    2007-08-08

    The crude extract of the polyphenol oxidase (PPO) enzyme from the Manzanilla cultivar (Olea europaea pomiformis) was obtained, and its properties were characterized. The browning reaction followed a zero-order kinetic model. Its maximum activity was at pH 6.0. This activity was completely inhibited at a pH below 3.0 regardless of temperature; however, in alkaline conditions, pH inhibition depended on temperature and was observed at values above 9.0 and 11.0 at 8 and 25 degrees C, respectively. The thermodynamic parameters of substrate oxidation depended on pH within the range in which activity was observed. The reaction occurred according to an isokinetic system because pH affected the enzymatic reaction rate but not the energy required to carry out the reaction. In the alkaline pH region, browning was due to a combination of enzymatic and nonenzymatic reactions that occurred in parallel. These results correlated well with the browning behavior observed in intentionally bruised fruits at different temperatures and in different storage solutions. The use of a low temperature ( approximately 8 degrees C) was very effective for preventing browning regardless of the cover solution used.

  16. Caracterización histoquimica de la etapa temprana del desarrollo del fruto del olivo (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Corrêa Maria José Pinheiro

    2002-01-01

    Full Text Available Se estudia el desarrollo a nivel histoquimico de la etapa temprana del fruto del olivo (Olea europaea L. variedad Picual, vigorosa y elevado rendimiento graso. Para ello, se utilizaron flores de olivo recién fecundadas y también com tres, siete y diez días tras la fecundación. Hemos utilizado tinción com "Sudan Black", para hacer un seguimiento de los lípidos en las diferentes etapas de desarrollo del fruto del olivo. Como resultado se puede decir que en la etapa temprana del desarrollo del fruto, el exocarpo se presenta rico en lípidos en todas las etapas de estudio. El mesocarpo y el embrión presentan tinción no homogénea, o sea, hay algunas regiones de ellos que presentan lipidos, mientras que la zona vascular del mesocarpo y el endocarpo se presentan libre de tinción y la zona vascular del embrión se mantiene rica en lipidos.

  17. Expression and purification of recombinant proteins in Escherichia coli tagged with a small metal-binding protein from Nitrosomonas europaea.

    Science.gov (United States)

    Vargas-Cortez, Teresa; Morones-Ramirez, Jose Ruben; Balderas-Renteria, Isaias; Zarate, Xristo

    2016-02-01

    Escherichia coli is still the preferred organism for large-scale production of recombinant proteins. The use of fusion proteins has helped considerably in enhancing the solubility of heterologous proteins and their purification with affinity chromatography. Here, the use of a small metal-binding protein (SmbP) from Nitrosomonas europaea is described as a new fusion protein for protein expression and purification in E. coli. Fluorescent proteins tagged at the N-terminal with SmbP showed high levels of solubility, compared with those of maltose-binding protein and glutathione S-transferase, and low formation of inclusion bodies. Using commercially available IMAC resins charged with Ni(II), highly pure recombinant proteins were obtained after just one chromatography step. Proteins may be purified from the periplasm of E. coli if SmbP contains the signal sequence at the N-terminal. After removal of the SmbP tag from the protein of interest, high-yields are obtained since SmbP is a protein of just 9.9 kDa. The results here obtained suggest that SmbP is a good alternative as a fusion protein/affinity tag for the production of soluble recombinant proteins in E. coli. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Effet du sucre sur l'embryogenèse somatique de l'olivier (Olea europaea L. cv. 'Picholine marocaine'

    Directory of Open Access Journals (Sweden)

    Abousalim A.

    2008-01-01

    Full Text Available Effect of sugar on somatic embryogenesis of olive tree (Olea europaea L. cv ' Moroccan Picholine '. The somatic embryogenesis of the olive tree cv ' Moroccan Picholine ' has been until now very little studied, in spite of its importance for Morocco.Thus, our work aimed to study the effects of type and concentrations of sugar on the induction and the development of somatic embryos of this variety. Regeneration of olive plants via somatic embryogenesis has been achieved from cotyledon fragments. Embryogenic, nodular and compact calli have been induced on media supplemented with 0.5 mg.l-1 zeatin and 2 mg.l-1 NAA and different types of sugar as mannitol, saccharose and sorbitol and different saccharose concentrations (20, 30, 60 and 90 g.l-1. The highest percentage of callus induction (P < 0.001 was observed with mannitol (90.6%. Up to 37% somatic embryogenesis was obtained in the case of saccharose (P < 0.001. The best callus induction was obtained in presence of 30 g.l-1 saccharose. This concentration was the best for olive plantlets regeneration. No morphogenesis was obtained with sorbitol. Somatic embryogenesis seems to be able to constitute an interesting source of micropropagation of olive tree in Morocco.

  19. An in vitro nutritive evaluation of olive tree (Olea europaea) pruning residues as affected by cutting regimen.

    Science.gov (United States)

    Al-Masri, M R

    2012-01-01

    Nutritive values of the branches from Olea europaea trees cut at 25, 50, 75 or 100 cm distance from the tip were evaluated by determination of the in vitro digestible organic matter (IVDOM), metabolizable energy (ME), net energy lactation (NEL), and presence nutritional and anti-nutritional components. The values of nutritive components, nitrogen forms, IVDOM, ME and NEL declined and concentrations of crude fiber and cell wall constituents increased with the increase in cutting length. Total phenols, hydrolysable tannins and condensed tannins amounted to 70, 17 and 0.6 g/kg DM, respectively. The addition of polyethylene glycol (PEG, 6000) to the plant samples incubated with rumen fluid at a ratio of (2:1 PEG:substrate) increased the values of IVDOM, ME and NEL by 40 g/kg DM, 0.59 MJ/kg DM and 0.42 MJ/kg DM, respectively. IVDOM, ME and NEL were negatively correlated with crude fiber and cell wall constituents but positively correlated with nitrogen forms and non-fiber carbohydrates. Olive pruning branches in diameter<3 mm could be used as sources of feeds for small ruminants. Copyright © 2011 Elsevier Ltd. All rights reserved.

  20. Histochemical location of key enzyme activities involved in receptivity and self-incompatibility in the olive tree (Olea europaea L.).

    Science.gov (United States)

    Serrano, Irene; Olmedilla, Adela

    2012-12-01

    Stigma-surface and style enzymes are important for pollen reception, selection and germination. This report deals with the histochemical location of the activity of four basic types of enzyme involved in these processes in the olive (Olea europaea L.). The detection of peroxidase, esterase and acid-phosphatase activities at the surface of the stigma provided evidence of early receptivity in olive pistils. The stigma maintained its receptivity until the arrival of pollen. Acid-phosphatase activity appeared in the style at the moment of anthesis and continued until the fertilization of the ovule. RNase activity was detected in the extracellular matrix of the styles of flowers just before pollination and became especially evident in pistils after self-pollination. This activity gradually decreased until it practically disappeared in more advanced stages. RNase activity was also detected in pollen tubes growing in pollinated pistils and appeared after in vitro germination in the presence of self-incompatible pistils. These findings suggest that RNases may well be involved in intraspecific pollen rejection in olive flowers. To the best of our knowledge this is the first time that evidence of enzyme activity in stigma receptivity and pollen selection has been described in this species. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  1. Nutrition metabolism plays an important role in the alternate bearing of the olive tree (Olea europaea L..

    Directory of Open Access Journals (Sweden)

    Mine Turktas

    Full Text Available The olive tree (Olea europaea L. is widely known for its strong tendency for alternate bearing, which severely affects the fruit yield from year to year. Microarray based gene expression analysis using RNA from olive samples (on-off years leaves and ripe-unripe fruits are particularly useful to understand the molecular mechanisms influencing the periodicity in the olive tree. Thus, we carried out genome wide transcriptome analyses involving different organs and temporal stages of the olive tree using the NimbleGen Array containing 136,628 oligonucleotide probe sets. Cluster analyses of the genes showed that cDNAs originated from different organs could be sorted into separate groups. The nutritional control had a particularly remarkable impact on the alternate bearing of olive, as shown by the differential expression of transcripts under different temporal phases and organs. Additionally, hormonal control and flowering processes also played important roles in this phenomenon. Our analyses provide further insights into the transcript changes between "on year" and "off year" leaves along with the changes from unrpipe to ripe fruits, which shed light on the molecular mechanisms underlying the olive tree alternate bearing. These findings have important implications for the breeding and agriculture of the olive tree and other crops showing periodicity. To our knowledge, this is the first study reporting the development and use of an olive array to document the gene expression profiling associated with the alternate bearing in olive tree.

  2. De Novo Transcriptome Sequencing of Olea europaea L. to Identify Genes Involved in the Development of the Pollen Tube

    Directory of Open Access Journals (Sweden)

    Domenico Iaria

    2016-01-01

    Full Text Available In olive (Olea europaea L., the processes controlling self-incompatibility are still unclear and the molecular basis underlying this process are still not fully characterized. In order to determine compatibility relationships, using next-generation sequencing techniques and a de novo transcriptome assembly strategy, we show that pollen tubes from different olive plants, grown in vitro in a medium containing its own pistil and in combination pollen/pistil from self-sterile and self-fertile cultivars, have a distinct gene expression profile and many of the differentially expressed sequences between the samples fall within gene families involved in the development of the pollen tube, such as lipase, carboxylesterase, pectinesterase, pectin methylesterase, and callose synthase. Moreover, different genes involved in signal transduction, transcription, and growth are overrepresented. The analysis also allowed us to identify members in actin and actin depolymerization factor and fibrin gene family and member of the Ca2+ binding gene family related to the development and polarization of pollen apical tip. The whole transcriptomic analysis, through the identification of the differentially expressed transcripts set and an extended functional annotation analysis, will lead to a better understanding of the mechanisms of pollen germination and pollen tube growth in the olive.

  3. Salicornia europaea L. Na⁺/H⁺ antiporter gene improves salt tolerance in transgenic alfalfa (Medicago sativa L.).

    Science.gov (United States)

    Zhang, L Q; Niu, Y D; Huridu, H; Hao, J F; Qi, Z; Hasi, A

    2014-07-24

    In order to obtain a salt-tolerant perennial alfalfa (Medicago sativa L.), we transferred the halophyte Salicornia europaea L. Na(+)/H(+) antiporter gene, SeNHX1, to alfalfa by using the Agrobacterium-mediated transformation method. The transformants were confirmed by both PCR and RT-PCR analyses. Of 197 plants that were obtained after transformation, 36 were positive by PCR analysis using 2 primer pairs for the CaMV35S-SeNHX1 and SeNHX1-Nos fragments; 6 plants survived in a greenhouse. RT-PCR analysis revealed that SeNHX1 was expressed in 5 plants. The resultant transgenic alfalfa had better salt tolerance. After stress treatment for 21 days with 0.6% NaCl, the chlorophyll and MDA contents in transgenic plants were lower, but proline content and SOD, POD, and CAT activities were higher than those in wild-type plants. These results suggest that the salt tolerance of transgenic alfalfa was improved by the overexpression of the SeNHX1 gene.

  4. Nutrition metabolism plays an important role in the alternate bearing of the olive tree (Olea europaea L.).

    Science.gov (United States)

    Turktas, Mine; Inal, Behcet; Okay, Sezer; Erkilic, Emine Gulden; Dundar, Ekrem; Hernandez, Pilar; Dorado, Gabriel; Unver, Turgay

    2013-01-01

    The olive tree (Olea europaea L.) is widely known for its strong tendency for alternate bearing, which severely affects the fruit yield from year to year. Microarray based gene expression analysis using RNA from olive samples (on-off years leaves and ripe-unripe fruits) are particularly useful to understand the molecular mechanisms influencing the periodicity in the olive tree. Thus, we carried out genome wide transcriptome analyses involving different organs and temporal stages of the olive tree using the NimbleGen Array containing 136,628 oligonucleotide probe sets. Cluster analyses of the genes showed that cDNAs originated from different organs could be sorted into separate groups. The nutritional control had a particularly remarkable impact on the alternate bearing of olive, as shown by the differential expression of transcripts under different temporal phases and organs. Additionally, hormonal control and flowering processes also played important roles in this phenomenon. Our analyses provide further insights into the transcript changes between "on year" and "off year" leaves along with the changes from unrpipe to ripe fruits, which shed light on the molecular mechanisms underlying the olive tree alternate bearing. These findings have important implications for the breeding and agriculture of the olive tree and other crops showing periodicity. To our knowledge, this is the first study reporting the development and use of an olive array to document the gene expression profiling associated with the alternate bearing in olive tree.

  5. Valuable Nutrients and Functional Bioactives in Different Parts of Olive (Olea europaea L.)—A Review

    Science.gov (United States)

    Ghanbari, Rahele; Anwar, Farooq; Alkharfy, Khalid M.; Gilani, Anwarul-Hassan; Saari, Nazamid

    2012-01-01

    The Olive tree (Olea europaea L.), a native of the Mediterranean basin and parts of Asia, is now widely cultivated in many other parts of the world for production of olive oil and table olives. Olive is a rich source of valuable nutrients and bioactives of medicinal and therapeutic interest. Olive fruit contains appreciable concentration, 1–3% of fresh pulp weight, of hydrophilic (phenolic acids, phenolic alchohols, flavonoids and secoiridoids) and lipophilic (cresols) phenolic compounds that are known to possess multiple biological activities such as antioxidant, anticarcinogenic, antiinflammatory, antimicrobial, antihypertensive, antidyslipidemic, cardiotonic, laxative, and antiplatelet. Other important compounds present in olive fruit are pectin, organic acids, and pigments. Virgin olive oil (VOO), extracted mechanically from the fruit, is also very popular for its nutritive and health-promoting potential, especially against cardiovascular disorders due to the presence of high levels of monounsaturates and other valuable minor components such as phenolics, phytosterols, tocopherols, carotenoids, chlorophyll and squalene. The cultivar, area of production, harvest time, and the processing techniques employed are some of the factors shown to influence the composition of olive fruit and olive oil. This review focuses comprehensively on the nutrients and high-value bioactives profile as well as medicinal and functional aspects of different parts of olives and its byproducts. Various factors affecting the composition of this food commodity of medicinal value are also discussed. PMID:22489153

  6. Influence of high concentrations of mineral salts on production process and NaCl accumulation by Salicornia europaea plants as a constituent of the LSS phototroph link

    Science.gov (United States)

    Tikhomirova, N. A.; Ushakova, S. A.; Kovaleva, N. P.; Gribovskaya, I. V.; Tikhomirov, A. A.

    Use of halophytes (salt-tolerant vegetation), in a particular vegetable Salicornia europaea plants which are capable of utilizing NaCl in rather high concentrations, is one of possible means of NaCl incorporation into mass exchange of bioregenerative life support systems. In preliminary experiments it was shown that S. europaea plants, basically, could grow on urine pretreated with physicochemical processing and urease-enzyme decomposing of urea with the subsequent ammonia distillation. But at the same time inhibition of the growth process of the plants was observed. The purpose of the given work was to find out the influence of excessive quantities of some mineral elements contained in products of physicochemical processing of urine on the production process and NaCl accumulation by S. europaea plants. As the content of mineral salts in the human liquid wastes (urine) changed within certain limits, two variants of experimental solutions were examined. In the first variant, the concentration of mineral salts was equivalent to the minimum salt content in the urine and was: K - 1.5 g/l, P - 0.5 g/l, S - 0.5 g/l, Mg - 0.07 g/l, Ca - 0.2 g/l. In the second experimental variant, the content of mineral salts corresponded to the maximum salt content in urine and was the following: K - 3.0 g/l, P - 0.7 g/l, S - 1.2 g/l, Mg - 0.2 g/l, Ca - 0.97 g/l. As the control, the Tokarev nutrient solution containing nitrogen in the form of a urea, and the Knop nutrient solution with nitrogen in the nitrate form were used. N quantity in all four variants made up 177 mg/l. Air temperature was 24 °C, illumination was continuous. Light intensity was 690 μmol/m 2s of photosynthetically active radiation. NaCl concentration in solutions was 1%. Our researches showed that the dry aboveground biomass of an average plant of the first variant practically did not differ from the control and totaled 11 g. In the second variant, S. europaea productivity decreased and the dry aboveground biomass

  7. [The preparation and characterization of fine dusts carried out in the Clinica del Lavoro di Milano in support of experimental studies].

    Science.gov (United States)

    Occella, E; Maddalon, G; Peruzzo, G F; Foà, V

    1999-01-01

    This paper aims to illustrate the conditions selected at the Clinica del Lavoro of the University of Milan to prepare and analyze a large number of fine dust samples produced over a period of about 50 years, that were initially used for studies within the Clinic performed in its own facilities, and since 1956 were sent to other Italian and overseas laboratories (Luxembourg, UK, Germany, Norway, Sweden, South Korea, USA). The total quantity of material distributed (with maximum size 7-10 microns) was about 2 kg and consisted of the following mineral and artificial compounds: quartz, HF-treated quartz, tridymite, HF-treated tridymite, cristobalite, chromite, anthracite, quartz sand for foundry moulds, sand from the Lybian desert, vitreous silica, pumice, cement, as well small quantities of metallic oxides, organic resins, chrysotile, crocidolite, fibres (vitreous, cotton and polyamidic). About half of the entire quantity of dusts produced consisted of partially HF-treated tridymite. Initially, research on the etiology of silicosis used quartz dust samples, simply sieved or ventilated (consisting of classes finer than 0.04 mm, containing a 15-20% respirable fraction). From 1956 to 1960 the dusts were produced by manual grinding in an agate mortar, below about 10 microns, starting from quartz from Quincinetto (near Ivrea, Province of Turin), containing about 99.5% quartz: particle size and composition were checked using an optical-petrographic technique, with identification of the free and total silica content. Subsequently, the dusts used for biological research were obtained by grinding coarse material with a cast iron pestle and planetary mills, agate and corundum jars. The grinding products were sized by means of centrifugal classification, using the selector developed by N. Zurlo, ensuring control of dust size both optically and by means of wet levigators and hydraulic classifiers (in cooperation with the Institute of Mines of Turin Polytechnic School). After 1990

  8. The first cytogenetic description of Euleptes europaea (Gené, 1839 from Northern Sardinia reveals the highest diploid chromosome number among sphaerodactylid geckos (Sphaerodactylidae, Squamata

    Directory of Open Access Journals (Sweden)

    Ekaterina Gornung

    2013-06-01

    Full Text Available The karyotype of a sphaerodactylid gecko Euleptes europaea (Gené, 1839 was assembled for the first time in this species. It is made of 2n = 42 gradually decreasing in size chromosomes, the highest chromosome number so far acknowledged in the family Sphaerodactylidae. The second chromosome pair of the karyotype appears slightly heteromorphic in the male individual. Accordingly, FISH with a telomeric probe revealed an uneven distribution of telomeric repeats on the two homologues of this pair, which may be indicative of an XY sex-determination system in the species, to be further investigated.

  9. Effect of NaCl Concentration on Productivity and Mineral Composition of Salicrnia europaea as a Plausible Representative of LSS Photosynthesizing Component

    Science.gov (United States)

    Ushakova, S.; Kovaleva, N.; Gribovskaya, I.; Dolgushev, V.; Tikhomirova, N.

    In man-made ecosystems the problem of deadlock wastes generated among other reasons by accumulation of NaCl-containing human liquid wastes has no efficient solution, yet. This retards development of man-made highly closed biological ecosystems where the deadlock wastes must be minimized. A possible solution of the problem is to select plant species capable of utilizing NaCl with sufficiently high concentrations, being edible by humans and featuring high productivity. So far the higher plants used in life support systems were either sensitive to salination (wheat, many bean species, carrots, potatoes, corn) or relatively salt-resistant (barley, beet roots, spinach). Salicornia europaea whose overground part is fully edible for humans is one of most acceptable for this purpose. By the literature evidence this plant is capable of accumulating up to 50% NaCl in terms of dry matter. In addition, excessive accumulation of sodium ions should bring forth increase of carry-out of potassium ions and other biogenous elements. The aim of this work is to study the feasibility of using S. europaea species in growth chambers to involve NaCl into matter turnover. Plants were grown in vegetation chambers under the irradiance of 100 W/m 2 PAR and the temperature of air 24?? by two methods. The first method was to cultivate on a substrate which was peat: without salination (1 version) and with addition of 3.5% (2 version) or 7% NaCl (3 version) in terms of dry peat mass. The second method was to cultivate on an aqueous solution with addition of a complete set of nutrients and, depending on the version, containing ? NaCl at the concentration of 0%, 1% or 2%. The study showed that addition of NaCl to the substrate or to the solution resulted in formation of more succulent plants which considerably increased their biomass. The amount of NaCl uptake was the highest in the plants grown in aqueous cultu e, its part in the dry matter was not less than 30%.r As the sodium uptake increased

  10. Effect of cognitive stimulation in patients with mild congenital deterioration, in the reduction of progression to dementia, in the Clinica de la Memoria, Hospital Nacional de Geriatria y Gerontologia, during the period from September 2008 to September 2013

    International Nuclear Information System (INIS)

    Giangiulio Lobo, Andrea

    2014-01-01

    The efficacy of cognitive stimulation in the progression to dementia is verified in patients with mild cognitive impairment, from the Clinica de Memoria of the Hospital Nacional de Geriatria y Gerontologia, between September 2008 and September 2013. A sample of 190 patients of the Metropolitan Area, the majority of female, complete primary, with self-care, aged 70 to 79 years are selected. The investigated group has had a history of hypertension, diabetes mellitus to a lesser extent and some degree of associated sensory deficit. The evolution time of memory loss presented is 2.6 years at the time of the medical evaluation. The most common cognitive impairment in the study has been the multiple dominion amnesia, followed by the non-amnesic dominion multiple. The etiology has leaded the degenerative, followed by vascular and thirdly the deficit of vitamin B12. Patients with mild cognitive impairment almost half of the cases have had neuro-behavioral disorder, being the depression most frequent, followed by anxiety and apathy. Patients have been partial independent in ABVD and dependent on AIVD. Absenteeism to dating has existed both in Clinica de Memoria; but mainly to the appointment with psychology. During the study it is determined that the deterioration was developed without progress to dementia, relatives have reported cognitive stability in more than half of the cases, only 18 patients have progressed to dementia. In the process only 29 patients have concluded and were reevaluated; without being able to demonstrate that the cognitive stimulation delays the cognitive deterioration to the dementia, but nevertheless; this result is given without unduly discrediting cognitive stimulation as a non-pharmacological measure for the prevention and delaying of dementia. (author) [es

  11. Genome-Scale, Constraint-Based Modeling of Nitrogen Oxide Fluxes during Coculture of Nitrosomonas europaea and Nitrobacter winogradskyi.

    Science.gov (United States)

    Mellbye, Brett L; Giguere, Andrew T; Murthy, Ganti S; Bottomley, Peter J; Sayavedra-Soto, Luis A; Chaplen, Frank W R

    2018-01-01

    Nitrification, the aerobic oxidation of ammonia to nitrate via nitrite, emits nitrogen (N) oxide gases (NO, NO 2 , and N 2 O), which are potentially hazardous compounds that contribute to global warming. To better understand the dynamics of nitrification-derived N oxide production, we conducted culturing experiments and used an integrative genome-scale, constraint-based approach to model N oxide gas sources and sinks during complete nitrification in an aerobic coculture of two model nitrifying bacteria, the ammonia-oxidizing bacterium Nitrosomonas europaea and the nitrite-oxidizing bacterium Nitrobacter winogradskyi . The model includes biotic genome-scale metabolic models (iFC578 and iFC579) for each nitrifier and abiotic N oxide reactions. Modeling suggested both biotic and abiotic reactions are important sources and sinks of N oxides, particularly under microaerobic conditions predicted to occur in coculture. In particular, integrative modeling suggested that previous models might have underestimated gross NO production during nitrification due to not taking into account its rapid oxidation in both aqueous and gas phases. The integrative model may be found at https://github.com/chaplenf/microBiome-v2.1. IMPORTANCE Modern agriculture is sustained by application of inorganic nitrogen (N) fertilizer in the form of ammonium (NH 4 + ). Up to 60% of NH 4 + -based fertilizer can be lost through leaching of nitrifier-derived nitrate (NO 3 - ), and through the emission of N oxide gases (i.e., nitric oxide [NO], N dioxide [NO 2 ], and nitrous oxide [N 2 O] gases), the latter being a potent greenhouse gas. Our approach to modeling of nitrification suggests that both biotic and abiotic mechanisms function as important sources and sinks of N oxides during microaerobic conditions and that previous models might have underestimated gross NO production during nitrification.

  12. Responses and recovery assessment of continuously cultured Nitrosomonas europaea under chronic ZnO nanoparticle stress: Effects of dissolved oxygen.

    Science.gov (United States)

    Wu, Junkang; Chang, Yan; Gao, Huan; Liang, Geyu; Yu, Ran; Ding, Zhen

    2018-03-01

    Although the antibacterial performances of emerging nanoparticles (NPs) have been extensively explored in the nitrifying systems, the impacts of dissolved oxygen (DO) levels on their bio-toxicities to the nitrifiers and the impaired cells' recovery potentials have seldom been addressed yet. In this study, the physiological and transcriptional responses of the typical ammonia oxidizers - Nitrosomonas europaea in a chemostat to the chronic ZnO NP exposure under different DO conditions were investigated. The results indicated that the cells in steady-growth state in the chemostat were more persevering than batch cultured ones to resist ZnO NP stress despite the dose-dependent NP inhibitory effects were observed. In addition, the occurred striking over-expressions of amoA and hao genes at the initial NP exposure stage suggested the cells' self-regulation potentials at the transcriptional level. The low DO (0.5 mg/L) cultured cells displayed higher sensitivity to NP stress than the high DO (2.0 mg/L) cultured ones, probably owning to the inefficient oxygen-dependent electron transfer from ammonia oxidation for energy conversion/production. The following 12-h NP-free batch recovery assays revealed that both high and low DO cultured cells possessed the physiological and metabolic activity recovery potentials, which were in negative correlation with the NP exposure time. The duration of NP stress and the resulting NP dissolution were critical for the cells' damage levels and their performance recoverability. The membrane preservation processes and the associated metabolism regulations were expected to actively participate in the cells' self-adaption to NP stress and thus be responsible for their metabolic activities recovery. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Hepatoprotective and antioxidant properties of the aqueous extract of Olea europaea leaves against Diclofenac-induced liver damages in mice.

    Science.gov (United States)

    Soussi, Rawya; Hfaiedh, Najla; Guesmi, Fatma; Sakly, Mohsen; Ben Rhouma, Khémais

    2018-04-20

    Historically, olive tree "Olea europaea" is one of the most important fruit trees in Mediterranean countries. Several studies suggest that olive leaf is a significant source of bioactive phenolic compounds compared to olive oil and fruits. This study was undertaken to investigate, the protective effect of the aqueous extract of « Chemlali » olive leaves against diclofenac-induced damages in liver and haematological alterations in swiss albinos mice. For this, twenty-eight mice were divided into four groups: a control group, a diclofenac-treated group (2.37 mg/kg) for 5 consecutive days, a group orally gavaged with aqueous extract of olive leaves, (3.3g/kg) during 28 days, and a group pre-treated with aqueous extract of olive leaves during 23 days then injected with diclofenac for 5 days. Results obtained from this study revealed that administration of diclofenac alone led to disturbance of some haematological parameters including red and white blood cells (RBC), (WBC) haemoglobin (Hb) and platelets content (PLT). However, diclofenac-treated mice group showed a increasing in the levels of cholesterol, triglyceride, glucose, creatinine, urea, aspartate aminotransferase (ASAT), and alanine aminotransferase (ALAT). Additionally we noted a state of oxidative stress in hepatic tissue indicated by the increasing of lipid peroxidation level (TBARS) and decreasing of superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPX). Interstingly, pre-treatment with olive leaves extract improved the haematological parameters and minimised the adverse effect on the hepatic function markers induced by diclofenac. The beneficial effect of olive leaves could be attributed to its antioxidant components as confirmed by phytochemical analysis.

  14. Identification of new polymorphic regions and differentiation of cultivated olives (Olea europaea L. through plastome sequence comparison

    Directory of Open Access Journals (Sweden)

    Baldoni Luciana

    2010-09-01

    Full Text Available Abstract Background The cultivated olive (Olea europaea L. is the most agriculturally important species of the Oleaceae family. Although many studies have been performed on plastid polymorphisms to evaluate taxonomy, phylogeny and phylogeography of Olea subspecies, only few polymorphic regions discriminating among the agronomically and economically important olive cultivars have been identified. The objective of this study was to sequence the entire plastome of olive and analyze many potential polymorphic regions to develop new inter-cultivar genetic markers. Results The complete plastid genome of the olive cultivar Frantoio was determined by direct sequence analysis using universal and novel PCR primers designed to amplify all overlapping regions. The chloroplast genome of the olive has an organisation and gene order that is conserved among numerous Angiosperm species and do not contain any of the inversions, gene duplications, insertions, inverted repeat expansions and gene/intron losses that have been found in the chloroplast genomes of the genera Jasminum and Menodora, from the same family as Olea. The annotated sequence was used to evaluate the content of coding genes, the extent, and distribution of repeated and long dispersed sequences and the nucleotide composition pattern. These analyses provided essential information for structural, functional and comparative genomic studies in olive plastids. Furthermore, the alignment of the olive plastome sequence to those of other varieties and species identified 30 new organellar polymorphisms within the cultivated olive. Conclusions In addition to identifying mutations that may play a functional role in modifying the metabolism and adaptation of olive cultivars, the new chloroplast markers represent a valuable tool to assess the level of olive intercultivar plastome variation for use in population genetic analysis, phylogenesis, cultivar characterisation and DNA food tracking.

  15. Thriving at the limit: Differential reproductive performance in range-edge populations of a Mediterranean sclerophyll (Olea europaea)

    Science.gov (United States)

    Granado-Yela, Carlos; Balaguer, Luis; García-Verdugo, Carlos; Carrillo, Katty; Méndez, Marcos

    2013-10-01

    Peripheral populations are often lumped together on the assumption of thriving in marginal habitats where reproductive performance is compromised. We have tested this hypothesis in peripheral populations of wild olive tree (Olea europaea L.) presumably limited by different factors at the westernmost limit of the species range. Additionally, we hypothesized that differences in reproductive outcome among populations are better explained by site-specific environmental conditions (PAR, soil water, soil nutrients, air humidity and air temperature) than by differences in phenotypic traits (tree size and leaf traits). To test these hypotheses, we assessed the number of flowering trees, the flowering intensity, fruit set and seed viability in eight populations for three consecutive years. Our findings provided sufficient evidence to reject the first hypothesis. Peripheral populations that occur under oceanic conditions, resembling the Tertiary subtropical climate, consistently presented higher values for all components of reproductive performance than those at the thermal and rainfall tolerance limits. In support of our second hypothesis, the variation in reproductive performance among populations was primarily accounted for by local environmental conditions. Leaf traits, however, also explained reproductive variation but to a lesser extent. Finally, we found that small changes in tree size may cause large differences in reproductive performance. This close relationship between tree size and reproductive performance suggests that any impact on population size structure would likely jeopardize persistence and expansion at the range edge. Our results suggest that reproductive performance of wild olive trees was not shaped by the population geographic position within the species range, but by the interaction between local environment, as the main driver, and individual phenotypic traits.

  16. Construction of Core Collections Suitable for Association Mapping to Optimize Use of Mediterranean Olive (Olea europaea L.) Genetic Resources

    Science.gov (United States)

    El Bakkali, Ahmed; Haouane, Hicham; Moukhli, Abdelmajid; Costes, Evelyne; Van Damme, Patrick; Khadari, Bouchaib

    2013-01-01

    Phenotypic characterisation of germplasm collections is a decisive step towards association mapping analyses, but it is particularly expensive and tedious for woody perennial plant species. Characterisation could be more efficient if focused on a reasonably sized subset of accessions, or so-called core collection (CC), reflecting the geographic origin and variability of the germplasm. The questions that arise concern the sample size to use and genetic parameters that should be optimized in a core collection to make it suitable for association mapping. Here we investigated these questions in olive (Olea europaea L.), a perennial fruit species. By testing different sampling methods and sizes in a worldwide olive germplasm bank (OWGB Marrakech, Morocco) containing 502 unique genotypes characterized by nuclear and plastid loci, a two-step sampling method was proposed. The Shannon-Weaver diversity index was found to be the best criterion to be maximized in the first step using the Core Hunter program. A primary core collection of 50 entries (CC50) was defined that captured more than 80% of the diversity. This latter was subsequently used as a kernel with the Mstrat program to capture the remaining diversity. 200 core collections of 94 entries (CC94) were thus built for flexibility in the choice of varieties to be studied. Most entries of both core collections (CC50 and CC94) were revealed to be unrelated due to the low kinship coefficient, whereas a genetic structure spanning the eastern and western/central Mediterranean regions was noted. Linkage disequilibrium was observed in CC94 which was mainly explained by a genetic structure effect as noted for OWGB Marrakech. Since they reflect the geographic origin and diversity of olive germplasm and are of reasonable size, both core collections will be of major interest to develop long-term association studies and thus enhance genomic selection in olive species. PMID:23667437

  17. Immunoproteomic tools are used to identify masked allergens: Ole e 12, an allergenic isoflavone reductase from olive (Olea europaea) pollen.

    Science.gov (United States)

    Castro, Lourdes; Crespo, Jesús F; Rodríguez, Julia; Rodríguez, Rosalía; Villalba, Mayte

    2015-12-01

    Proteins performing important biochemical activities in the olive tree (Olea europaea) pollen have been identified as allergens. One novel 37-kDa protein seems to be associated to the IgE-binding profile of a group of patients suffering allergy to peach and olive pollen. Three previously described olive pollen allergens exhibit very similar molecular mass. Our objective was to identify this allergen by using immunoproteomic approaches. After 2D-electrophoresis and mass spectrometry, peptide sequences from several IgE-binding spots, allowed identifying this new allergen, as well as cloning and DNA sequencing of the corresponding gene. The allergen, named Ole e 12, is a polymorphic isoflavone reductase-like protein of 308 amino acids showing 80% and 74% identity with birch and pear allergens, Bet v 6 and Pyr c 5, respectively. A prevalence of 33% in the selected population is in contrast to 4%-10% in groups of subjects suffering from pollinosis. Recombinant allergen was produced in Escherichia coli, and deeply characterised. Immunoblotting and ELISA detection as well as inhibition experiments were performed with polyclonal antisera and allergic patients' sera. The recombinant allergen retains the IgE reactivity of its natural counterpart. Close structural and immunological relationships between members of this protein family were supported by their IgG recognition in vegetable species. In summary, Ole e 12 is a minor olive pollen allergen, which gains relevance in patients allergic to peach with olive pollinosis. Proteomic approaches used to analyse this allergen provide useful tools to identify hidden allergens, relevant for several allergic populations and thus complete allergenic panels. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Comparing the historic olive trees (Olea europaea L.) of Santa Cruz with contemporaneous trees in the Santa Barbara, CA area: a case study of diversity and structure in an introduced agricultural species conserved in situ

    Science.gov (United States)

    Historic populations of crop species outside their centers of origin and diversity, like the domestic olive (Olea europaea L.) in North America, are genetic resources for contemporary agriculture, including genotypes that could be adapted to, local conditions. The primary goal of this study was to d...

  19. Partial Root-Zone Drying of Olive (Olea europaea var. 'Chetoui') Induces Reduced Yield under Field Conditions.

    Science.gov (United States)

    Dbara, Soumaya; Haworth, Matthew; Emiliani, Giovani; Ben Mimoun, Mehdi; Gómez-Cadenas, Aurelio; Centritto, Mauro

    2016-01-01

    The productivity of olive trees in arid and semi-arid environments is closely linked to irrigation. It is necessary to improve the efficiency of irrigation techniques to optimise the amount of olive fruit produced in relation to the volume of water used. Partial root-zone drying (PRD) is a water saving irrigation technique that theoretically allows the production of a root-to-shoot signal that modifies the physiology of the above-ground parts of the plant; specifically reducing stomatal conductance (gs) and improving water use efficiency (WUE). Partial root-zone drying has been successfully applied under field conditions to woody and non-woody crops; yet the few previous trials with olive trees have produced contrasting results. Thirty year-old olive trees (Olea europaea 'var. Chetoui') in a Tunisian grove were exposed to four treatments from May to October for three-years: 'control' plants received 100% of the potential evapotranspirative demand (ETc) applied to the whole root-zone; 'PRD100' were supplied with an identical volume of water to the control plants alternated between halves of the root-zone every ten-days; 'PRD50' were given 50% of ETc to half of the root-system, and; 'rain-fed' plants received no supplementary irrigation. Allowing part of the root-zone to dry resulted in reduced vegetative growth and lower yield: PRD100 decreased yield by ~47% during productive years. During the less productive years of the alternate bearing cycle, irrigation had no effect on yield; this suggests that withholding of water during 'off-years' may enhance the effectiveness of irrigation over a two-year cycle. The amount and quality of oil within the olive fruit was unaffected by the irrigation treatment. Photosynthesis declined in the PRD50 and rain-fed trees due to greater diffusive limitations and reduced biochemical uptake of CO2. Stomatal conductance and the foliar concentration of abscisic acid (ABA) were not altered by PRD100 irrigation, which may indicate the

  20. Partial Root-Zone Drying of Olive (Olea europaea var. 'Chetoui' Induces Reduced Yield under Field Conditions.

    Directory of Open Access Journals (Sweden)

    Soumaya Dbara

    Full Text Available The productivity of olive trees in arid and semi-arid environments is closely linked to irrigation. It is necessary to improve the efficiency of irrigation techniques to optimise the amount of olive fruit produced in relation to the volume of water used. Partial root-zone drying (PRD is a water saving irrigation technique that theoretically allows the production of a root-to-shoot signal that modifies the physiology of the above-ground parts of the plant; specifically reducing stomatal conductance (gs and improving water use efficiency (WUE. Partial root-zone drying has been successfully applied under field conditions to woody and non-woody crops; yet the few previous trials with olive trees have produced contrasting results. Thirty year-old olive trees (Olea europaea 'var. Chetoui' in a Tunisian grove were exposed to four treatments from May to October for three-years: 'control' plants received 100% of the potential evapotranspirative demand (ETc applied to the whole root-zone; 'PRD100' were supplied with an identical volume of water to the control plants alternated between halves of the root-zone every ten-days; 'PRD50' were given 50% of ETc to half of the root-system, and; 'rain-fed' plants received no supplementary irrigation. Allowing part of the root-zone to dry resulted in reduced vegetative growth and lower yield: PRD100 decreased yield by ~47% during productive years. During the less productive years of the alternate bearing cycle, irrigation had no effect on yield; this suggests that withholding of water during 'off-years' may enhance the effectiveness of irrigation over a two-year cycle. The amount and quality of oil within the olive fruit was unaffected by the irrigation treatment. Photosynthesis declined in the PRD50 and rain-fed trees due to greater diffusive limitations and reduced biochemical uptake of CO2. Stomatal conductance and the foliar concentration of abscisic acid (ABA were not altered by PRD100 irrigation, which may

  1. Genome-wide identification of alternate bearing-associated microRNAs (miRNAs in olive (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Yanik Huriye

    2013-01-01

    Full Text Available Abstract Background Alternate bearing is a widespread phenomenon among crop plants, defined as the tendency of certain fruit trees to produce a high-yield crop one year ("on-year", followed by a low-yield or even no crop the following year ("off-year". Several factors may affect the balance between such developmental phase-transition processes. Among them are the microRNA (miRNA, being gene-expression regulators that have been found to be involved as key determinants in several physiological processes. Results Six olive (Olea europaea L. cv. Ayvalik variety small RNA libraries were constructed from fruits (ripe and unripe and leaves (”on year” and ”off year” leaves in July and in November, respectively and sequenced by high-throughput Illumina sequencing. The RNA was retrotranscribed and sequenced using the high-throughput Illumina platform. Bioinformatics analyses of 93,526,915 reads identified 135 conserved miRNA, belonging to 22 miRNA families in the olive. In addition, 38 putative novel miRNAs were discovered in the datasets. Expression of olive tree miRNAs varied greatly among the six libraries, indicating the contribution of diverse miRNA in balancing between reproductive and vegetative phases. Predicted targets of miRNA were categorized into 108 process ontology groups with significance abundance. Among those, potential alternate bearing-associated processes were found, such as development, hormone-mediated signaling and organ morphogenesis. The KEGG analyses revealed that the miRNA-targeted genes are involved in seven main pathways, belonging to carbohydrate metabolism and hormone signal-transduction pathways. Conclusion A comprehensive study on olive miRNA related to alternate bearing was performed. Regulation of miRNA under different developmental phases and tissues indicated that control of nutrition and hormone, together with flowering processes had a noteworthy impact on the olive tree alternate bearing. Our results also

  2. Genome-wide identification of alternate bearing-associated microRNAs (miRNAs) in olive (Olea europaea L.).

    Science.gov (United States)

    Yanik, Huriye; Turktas, Mine; Dundar, Ekrem; Hernandez, Pilar; Dorado, Gabriel; Unver, Turgay

    2013-01-15

    Alternate bearing is a widespread phenomenon among crop plants, defined as the tendency of certain fruit trees to produce a high-yield crop one year ("on-year"), followed by a low-yield or even no crop the following year ("off-year"). Several factors may affect the balance between such developmental phase-transition processes. Among them are the microRNA (miRNA), being gene-expression regulators that have been found to be involved as key determinants in several physiological processes. Six olive (Olea europaea L. cv. Ayvalik variety) small RNA libraries were constructed from fruits (ripe and unripe) and leaves ("on year" and "off year" leaves in July and in November, respectively) and sequenced by high-throughput Illumina sequencing. The RNA was retrotranscribed and sequenced using the high-throughput Illumina platform. Bioinformatics analyses of 93,526,915 reads identified 135 conserved miRNA, belonging to 22 miRNA families in the olive. In addition, 38 putative novel miRNAs were discovered in the datasets. Expression of olive tree miRNAs varied greatly among the six libraries, indicating the contribution of diverse miRNA in balancing between reproductive and vegetative phases. Predicted targets of miRNA were categorized into 108 process ontology groups with significance abundance. Among those, potential alternate bearing-associated processes were found, such as development, hormone-mediated signaling and organ morphogenesis. The KEGG analyses revealed that the miRNA-targeted genes are involved in seven main pathways, belonging to carbohydrate metabolism and hormone signal-transduction pathways. A comprehensive study on olive miRNA related to alternate bearing was performed. Regulation of miRNA under different developmental phases and tissues indicated that control of nutrition and hormone, together with flowering processes had a noteworthy impact on the olive tree alternate bearing. Our results also provide significant data on the miRNA-fruit development

  3. Clinical manifestations of peripheral nervous system involvement in human chronic chagas disease Manifestaciones clinicas de compromiso del sistema nervioso periférico en el estádio crônico de la enfermedad de Chagas

    Directory of Open Access Journals (Sweden)

    Osvaldo Genovese

    1996-06-01

    Full Text Available We conducted a clinical and electromyographical study in patients with Chagas' disease in the indeterminate or chronic stages of the illness. Altogether 841 patients were examined. Only 511 were admitted within the protocol; the remainder patients were rejected because they showed other causes able to damage the nervous system. Fifty two (10.17% out of the 511 patients showed signs and symptoms of peripheral nervous system involvement in the form of sensory impairment and diminished tendon jerks suggesting the presence of neuropathy. Forty five of them were submitted to a conventional electromyographical examination. Fifteen of mem showed normal results, while the remainder 30 disclosed a reduced interference pattern, being most of the remaining motor unit potentials fragmented or poliphasic, reduced sensory and motor conduction velocities and diminished amplitude of the sensory action potential. The findings suggest that some chagasic patients in the indeterminate or chronic stages of the disease may develop a clinical mild sensory-motor peripheral neuropathy.El estúdio presente fue diseftado con ei objeto de pesquizar Ia existência de manifestaciones clinicas en pacientes afectados por enfermedad de Chagas, en estádio indeterminado o crônico, que tuviesen, ai menos, 2 reacciones serologicas positivas. En total fueron examinados 841 enfermos. De ellos solo 511 fueron admitidos en ei protocolo; los restantes fueron rechazados por mostrar Ia presencia de otras causas que hubiesen podido danar su sistema nervioso. Dentro de los 511 pacientes admitidos, 52 (10.17% evidenciaron alteraciones objetivas y subjetivas de Ia sensibilidad y disminucion de los reflejos osteotendinosos. Estos signos y sintomas, que sugieren la presencia de neuropatia, podian combinarse de diferente manera. Como complemento dei examen clinico, se efectuo estúdio electromiografico convencional en 45 de estos pacientes. En 15 los hallazgos fueron normales, en tanto que en

  4. De l’olivier à l’oléastre : origine et domestication de l’Olea europaea L. dans le Bassin méditerranéen

    OpenAIRE

    Breton, Catherine; Médail, Frédéric; Pinatel, Christian; Berville, Andre

    2006-01-01

    De l’olivier à l’oléastre : origine et domestication de l’Olea europaea L. dans le Bassin méditerranéen Keywords : VEGETAL PRODUCTIONS, NATURAL RESOURCES AND ENVIRONMENTRésumé : L’olivier occupe la 24 e place des 35 espèces les plus cultivées dans le monde. La diversité phénologique des cultivars est remarquable et l’intérêt économique de l’espèce est majeur. Pourtant peu d’études ont porté sur la domestication de l’olivier et sur les relations entre l’olivier et sa forme sauvage, l’oléastre....

  5. Effect of NaCl concentration on productivity and mineral composition of Salicornia europaea as a potential crop for utilization NaCl in LSS

    Science.gov (United States)

    Ushakova, S. A.; Kovaleva, N. P.; Gribovskaya, I. V.; Dolgushev, V. A.; Tikhomirova, N. A.

    The accumulation of solid and liquid wastes in manmade ecosystems presents a problem that has not been efficiently solved yet. Urine, containing NaCl, are part of these products. This is an obstacle to the creation of biological systems with a largely closed material cycling, because the amount of solid and liquid wastes in them must be reduced to a minimum. A possible solution to the problem is to select plant species capable of utilizing sufficiently high concentrations of NaCl, edible for humans, and featuring high productivity. Until recently, the life support systems have included the higher plants that were either sensitive to salinization (wheat, many of the legumes, carrot, potato, maize) or relatively salt-resistant (barley, sugar beet, spinach). Salicomia europaea, whose above-ground part is fully edible for humans, is one of the most promising candidates to be included in life support systems. It is reported in the literature that this plant is capable of accumulating up to 50% NaCl (dry basis). Besides, excessive accumulation of sodium ions should bring forth a decrease in the uptake of potassium ions and other biogenic elements. The aim of this work is to study the feasibility of using S. europaea plants in growth chambers to involve NaCl into material cycling. Plants were grown in vegetation chambers at the irradiance of 100 or 150 W/m 2 PAR (photosynthetically active radiation) and the air temperature 24 °C, by two methods. The first method was to grow the plants on substrate - peat. The peat was supplemented with either 3% NaCl (Variant 1) or 6% NaCl (Variant 2) of the oven-dry mass of the peat. The second method was to grow the plants in water culture, using the solution with a full complement of nutrients, which contained 0.0005% of NaCl, 1% or 2%. The study showed that the addition of NaCl to the substrate or to the solution resulted in the formation of more succulent plants, which considerably increased their biomass. The amount of NaCl uptake

  6. Transcriptional Analysis of Stearoyl-Acyl Carrier Protein Desaturase Genes from Olive (Olea europaea) in Relation to the Oleic Acid Content of the Virgin Olive Oil.

    Science.gov (United States)

    Parvini, Farshid; Sicardo, M Dolores; Hosseini-Mazinani, Mehdi; Martinez-Rivas, Jose M; Hernandez, M Luisa

    2016-10-02

    The specific contribution of different stearoyl-ACP desaturase (SAD) genes to the oleic acid content in olive (Olea europaea) fruit has been studied. Towards that end, we isolated three distinct cDNA clones encoding three SAD isoforms from olive (cv. Picual), as revealed by sequence analysis. The expression levels of olive SAD genes were determined in different tissues from Picual and Arbequina cultivars, including developing mesocarp and seed, together with the unsaturated fatty acid content. Lipid and gene expression analysis indicate that OeSAD2 seems to be the main gene contributing to the oleic acid content of the olive fruit and, therefore, of the virgin olive oil. This conclusion was confirmed when the study was extended to Hojiblanca, Picudo and Manzanilla cultivars. Furthermore, our data indicate that the olive microsomal oleate desaturase gene OeFAD2-2, but not OeSAD2, is responsible for the linoleic acid content in the virgin olive oil.

  7. The efficacy of kaolin particle film on oil quality indices of olive trees (Olea europaea L.) cv 'Zard' grown under warm and semi-arid region of Iran.

    Science.gov (United States)

    Khaleghi, Esmaeil; Arzani, Kazem; Moallemi, Norollah; Barzegar, Mohsen

    2015-01-01

    Kaolin particle film (0%, 3% and 6%; w/v), as an antitranspirant treatment, was applied to mature 'Zard' olive trees (Olea europaea L.). Olive oil was extracted from harvested fruit and fatty acid composition and other oil quality indices of the fruit assessed over crop seasons. Kaolin increased chlorophyll and carotenoid contents, but decreased peroxide and iodine values, and UV absorbance extinction coefficients, of the oil. The highest palmitic acid was observed in the oil obtained from untreated trees (17%). Kaolin increased oleic acid up to 65% and 64% in the first and second crop seasons, respectively, but decreased linoleic and linolenic acid contents. Monounsaturated acids (65%) and oleic acid/linoleic acid ratios (4) were higher in oil obtained from kaolin treated than untreated trees. Therefore it can be expected that extracted olive oil from kaolin treated trees has a higher oxidative stability and shelf life than untreated trees. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Olive tree (Olea europaea L.) leaf as a waste by-product of table olive and olive oil industry: a review.

    Science.gov (United States)

    Şahin, Selin; Bilgin, Mehmet

    2018-03-01

    Research into finding new uses for by-products of table olive and olive oil industry are of great value not only to the economy but also to the environment where olives are grown and to the human health. Since leaves represent around 10% of the total weight of olives arriving at the mill, it is worth obtaining high added-value compounds from those materials for the preparation of dietary supplements, nutraceuticals, functional food ingredients or cosmeceuticals. In this review article, olive tree (Olea europaea L.) leaf is reviewed as being a potential inexpensive, renewable and abundant source of biophenols. The importance of this agricultural and industrial waste is emphasised by means of describing its availability, nutritional and therapeutic effects and studies conducted on this field. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  9. Short-term effects of TiO2, CeO2, and ZnO nanoparticles on metabolic activities and gene expression of Nitrosomonas europaea.

    Science.gov (United States)

    Yu, Ran; Fang, Xiaohua; Somasundaran, Ponisseril; Chandran, Kartik

    2015-06-01

    Nanosized TiO2 (n-TiO2), CeO2 (n-CeO2), and ZnO (n-ZnO) and bulk ZnO were chosen for a 4-h exposure study on a model ammonia oxidizing bacterium, Nitrosomonas europaea. n-ZnO displayed the most serious cytotoxicity while n-TiO2 was the least toxic one. The change of cell morphologies, the retardance of specific oxygen uptake rates and ammonia oxidation rates, and the depression of amoA gene expressions under NP stresses were generally observed when the cell densities and membrane integrities were not significantly impaired yet. The TEM imaging and the synchrotron X-ray fluorescence microscopy of the NPs impacted cells revealed the increase of the corresponding intracellular Ti, Ce or Zn contents and suggested the intracellular NP accumulation. The elevation of intracellular S contents accompanied with higher K contents implied the possible activation of thiol-containing glutathione and thioredoxin production for NP stress alleviation. The NP cytotoxicity was not always a function of NP concentration. The 200 mg L(-1) n-TiO2 or n-CeO2 impacted cells displayed the similar ammonia oxidation activities but higher amoA gene expression levels than the 20 mg L(-1) NPs impacted ones. Such phenomenon further indicated the possible establishment of an anti-toxicity mechanism in N. europaea at the genetic level to redeem the weakened AMO activities along with the NP aggregation effects. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Composition, quality and oxidative stability of virgin olive oils from some selected wild olives (Olea europaea L. subsp. oleaster

    Directory of Open Access Journals (Sweden)

    Zarrouk, Mokhtar

    2008-12-01

    Full Text Available A study on the characterization of virgin olive oils from wild olives (Olea europaea L. subsp. oleaster was conducted in order to define new cultivars which are welladapted to the Tunisian environment and yield high quality oils. The study was done during the crop years 2003/04, 2004/05 and 2005/06. The main analytical parameters of the oils were evaluated: fatty acid compositions, chlorophylls, carotenoids, tocopherols and phenolic compounds as well as their relationship with oxidative stability. The fatty acid composition of all the wild olive trees tested produced virgin olive oil which complies with commercial standards, as well as for their appreciable amounts of tocopherols and phenolic compounds. Tocopherol analysis by HPLC revealed the presence of α, β, γ and δ tocopherols in all the studied olive oils. Total tocopherol content was significantly influenced by the varietal factor. It ranged from 310 (SB12 to 780 mg/kg (H3. As for total tocopherols, the amount of each tocopherol varied according to genotype. α tocopherol is the most prominent, whereas β, γ and δ tocopherols are less represented. Results showed a clear influence of total phenols and o-diphenols on virgin olive oil stability (R = 0.905, 0.963 P En este trabajo se han caracterizado los aceites obtenidos a partir de siete acebuches previamente seleccionados entre varias poblaciones de Olea europea L. Subsp. oleaster. El estudio se llevó a cabo durante las campañas de producción 2003/04, 2004/05 y 2005/06.Varios parámetros analíticos fueron evaluados: composiciones en ácidos grasos, pigmentos, tocoferoles, fenoles; así mismo, se investigó la relación de estos parámetros con la estabilidad de los aceites. Los resultados obtenidos mostraron que todas las muestras de frutos de acebuche produjeron aceites cuya composición de ácidos grasos, tocoferoles y compuestos fenólicos cumplió las normas comerciales para aceite de oliva virgen del Comit

  11. Polen atmosférico de Olea europaea L. en Madrid (Ciudad Universitaria y Aranjuez durante los años 1994-1997

    Directory of Open Access Journals (Sweden)

    Sáenz Laín, Concepción

    1999-12-01

    Full Text Available The results of four years of study (1994-1997 of the atmospheric levéis of pollen from Olea europaea L. in Madrid and Aranjuez are presented. The principal pollination period (PPP for each year and each season were calculated, using the mean daily concentrations, and fell between weeks 16 and 26, with maximum daily valúes registered between 3rd May and 7th June. The presence of olive pollen was greater in Aranjuez than in Madrid (mean 3,307 grains of pollen/year and 2,123 grains/year, respectively. The pollen season was similar in each locality. A preliminary comparison of pollen data with temperature and precipitation seems to indicates that accumulated pre-season temperatures, but not rainfall, can have decisive influence on the initiation of pollination. His nuclear what influence rainfall has on the account of pollen collected.Presentamos los resultados obtenidos durante cuatro años de estudio (1994-1997 del contenido atmosférico de polen de Olea europaea L. en Madrid (Ciudad Universitaria y en Aranjuez. A partir de las concentraciones medias diarias, hemos calculado el Período de Polinización Principal (PPP para cada año y cada estación, que se ha producido siempre entre las semanas 16 y 26, con valores máximos diarios registrados entre el 3 de mayo y el 7 de junio. La presencia del polen de olivo ha sido mayor en Aranjuez que en Madrid (media del período, 3.307 granos de polen/año y 2.123, respectivamente. Las estación polínica transcurre de forma similar en ambas localidades. De una primera comparación de los datos polínicos con los datos de temperatura y precipitación, parece deducirse que las temperaturas acumuladas durante el período preestacional pueden tener una influencia decisiva en el inicio de la polinización, no así las precipitaciones. Tampoco parece clara su influencia sobre el total anual de polen recogido.

  12. Influence of inorganic and organic amendments in the soil properties and the growth and survival of Olea Europaea var. Sylvestris in the semiarid Mediterranean area

    Science.gov (United States)

    Ortega, Raúl; Miralles, Isabel; Anguita-Maeso, Manuel; Domene, Miguel; Soriano, Miguel

    2017-04-01

    Selecting the most appropriate types of plants adapted to the harsh climatic conditions of restoring drylands is essential to success in landscape restoration. Besides improving soil quality is a key factor to consider when designing the restoration procedures. The use of organic and inorganic amendments can help with this task. On this study, we evaluated the influence of different mineral (clays) and organic (compost and poultry) amendments on the properties of a bare soil and how this influenced on the growth and survival of the Olea europaea var. sylvestrys, a perennial bush plant adapted to the Mediterranean semi-arid zone. Tests were designed and carried out in a greenhouse at the "Experimental Station of Cajamar foundation "Las Palmerillas" in El Ejido (Almería, Spain). Plants were grown in 250L pots and their substrate was bare soil and mineral and/or organic amendments. The experimental design consisted of three replicas for five treatments: 1. compost, 2. "ZeoPro", a cliptonolite commercial clay, 3. mordenite clay from local quarries plus compost, 4. cliptonolite clay from Turkey plus compost, 5. cliptonolite from Turquey plus poultry; with four levels each one: 5%, 10%, 20%, 30% volume of amendment. Including three control samples without amendment total plants accounted for 63. Climatic sensors inside and outside the greenhouse permitted to establish the same meteorological conditions for the plants and only emergency watering was supplied when necessary for the survival of the plants when arid conditions were extreme. The physico-chemical soil properties of each treatment and level were analyzed before planting and the biovolume and the survival rates of the plants were measured regularly along eleven months. Statistically the best treatment for the growing of the plants was number 3 (mordenite and compost) with no deaths recorded. According to the growing rates the best level was soil with 20% of amendment. Besides we analyzed the evolution of the

  13. Variability of virgin olive oil phenolic compounds in a segregating progeny from a single cross in Olea europaea L. and sensory and nutritional quality implications.

    Directory of Open Access Journals (Sweden)

    Ana G Pérez

    Full Text Available Virgin olive oil phenolic compounds are responsible for its nutritional and sensory quality. The synthesis of phenolic compounds occurs when enzymes and substrates meet as olive fruit is crushed during the industrial process to obtain the oil. The genetic variability of the major phenolic compounds of virgin olive oil was studied in a progeny of the cross of Picual x Arbequina olive cultivars (Olea europaea L.. They belong to four different groups: compounds that included tyrosol or hydroxytyrosol in their molecules, lignans, flavonoids, and phenolic acids. Data of phenolics in the oils showed that the progeny displayed a large degree of variability, widely transgressing the genitor levels. This high variability can be of interest on breeding programs. Thus, multivariate analysis allowed to identify genotypes within the progeny particularly interesting in terms of phenolic composition and deduced organoleptic and nutritional quality. The present study has demonstrated that it is possible to obtain enough degree of variability with a single cross of olive cultivars for compounds related to the nutritional and organoleptic properties of virgin olive oil.

  14. The 1.3-A resolution structure of Nitrosomonas europaea Rh50 and mechanistic implications for NH3 transport by Rhesus family proteins.

    Science.gov (United States)

    Lupo, Domenico; Li, Xiao-Dan; Durand, Anne; Tomizaki, Takashi; Cherif-Zahar, Baya; Matassi, Giorgio; Merrick, Mike; Winkler, Fritz K

    2007-12-04

    The Rhesus (Rh) proteins are a family of integral membrane proteins found throughout the animal kingdom that also occur in a number of lower eukaryotes. The significance of Rh proteins derives from their presence in the human red blood cell membrane, where they constitute the second most important group of antigens used in transfusion medicine after the ABO group. Rh proteins are related to the ammonium transport (Amt) protein family and there is considerable evidence that, like Amt proteins, they function as ammonia channels. We have now solved the structure of a rare bacterial homologue (from Nitrosomonas europaea) of human Rh50 proteins at a resolution of 1.3 A. The protein is a trimer, and analysis of its subunit interface strongly argues that all Rh proteins are likely to be homotrimers and that the human erythrocyte proteins RhAG and RhCE/D are unlikely to form heterooligomers as previously proposed. When compared with structures of bacterial Amt proteins, NeRh50 shows several distinctive features of the substrate conduction pathway that support the concept that Rh proteins have much lower ammonium affinities than Amt proteins and might potentially function bidirectionally.

  15. The influence of field margins on the presence and spatial distribution of the European mole Talpa europaea L. within the agricultural landscape of northern Poland

    Directory of Open Access Journals (Sweden)

    Zurawska-Seta Ewa

    2012-01-01

    Full Text Available European moles are widespread in both cultivated and uncultivated areas in Poland. Their occurrence and distribution in relation to the physical and chemical characteristics of soil has been already studied in previous research. However, there is still an open question about the impact of the structure of anthropogenic habitats produced by agriculture on moles. The main aim of this study is to assess the influence of different kinds of field margins on the presence and spatial distribution of the European mole Talpa europaea L. in farmlands. Methods included the monitoring of six investigative sites in northern Poland. Observations were made during three six-month periods in 2005-2008 of the presence or absence of moles as recognized by recent molehills and surface tunnels. There was a very clear tendency by moles to occupy areas within arable fields close to field boundaries with wide verges containing ruderal and woodland communities with a spacious zone of ecotones. Narrow boundary strips were avoided by moles. In conclusion, the conducted research confirms that field margins have an impact on the presence and spatial distribution of moles within ploughed lands. Our results may be helpful in improving the relation between agricultural development and biodiversity conservation, and the rational use of nature by humankind.

  16. Spatial genetic structure in the Laperrine's olive (Olea europaea subsp. laperrinei), a long-living tree from the central Saharan mountains.

    Science.gov (United States)

    Besnard, G; Christin, P A; Baali-Cherif, D; Bouguedoura, N; Anthelme, F

    2007-12-01

    The Laperrine's olive (Olea europaea subsp. laperrinei) is an emblematic species of the Sahelo-Saharan Mountains. Populations of this tree are locally threatened by extinction due to climatic vicissitudes and human activities, particularly in Niger and Algeria. In order to study the spatial genetic structure and the dynamics of O. e. laperrinei populations, we sampled trees in four isolated mountain ranges (Tassili n'Ajjer and Hoggar (Algeria), Tamgak and Bagzane (Niger)). A total of 237 genets were identified using nuclear microsatellites. Phylogenetic reconstruction based on plastid DNA data supported a maternal origin of O. e. laperrinei populations in South Algeria, where a higher allelic richness was observed. Based on nuclear microsatellite data, two levels of structure were revealed: first, individuals from Niger and Algeria were separated in two distinct groups; second, four less differentiated clusters corresponded to the four studied mountain ranges. These results give support to the fact that desert barriers have greatly limited long distance gene flow. Within populations, pairwise kinship coefficients were significantly correlated to geographical distance for Niger populations but not for Algerian mountains. Historical factors and habitat heterogeneity may explain the differences observed. We conclude that the Hoggar acts as an important genetic reservoir that has to be taken into account in future conservation programmes. Moreover, very isolated endangered populations (for example, Bagzane) displaying evident genetic particularities have to be urgently considered for their endemism.

  17. Effect of Low-Density Static Magnetic Field on the Oxidation of Ammonium by Nitrosomonas europaea and by Activated Sludge in Municipal Wastewater

    Science.gov (United States)

    Filipič, Jasmina; Kraigher, Barbara; Tepuš, Brigita; Kokol, Vanja

    2015-01-01

    Summary Ammonium removal is a key step in biological wastewater treatment and novel approaches that improve this process are in great demand. The aim of this study is to test the hypothesis that ammonium removal from wastewater can be stimulated by static magnetic fields. This was achieved by analysis of the effects of static magnetic field (SMF) on the growth and activity of Nitrosomonas europaea, a key ammonia-oxidising bacterium, where increased growth and increased ammonia oxidation rate were detected when bacteria were exposed to SMF at 17 mT. Additionally, the effect of SMF on mixed cultures of ammonia oxidisers in activated sludge, incubated in sequencing batch bioreactors simulating wastewater treatment process, was assessed. SMFs of 30 and 50 mT, but not of 10 mT, increased ammonium oxidation rate in municipal wastewater by up to 77% and stimulated ammonia oxidiser growth. The results demonstrate the potential for use of static magnetic fields in increasing ammonium removal rates in biological wastewater treatment plants. PMID:27904349

  18. Identification of leaf volatiles from olive (Olea europaea) and their possible role in the ovipositional preferences of olive fly, Bactrocera oleae (Rossi) (Diptera: Tephritidae).

    Science.gov (United States)

    Malheiro, Ricardo; Casal, Susana; Cunha, Sara C; Baptista, Paula; Pereira, José Alberto

    2016-01-01

    The olive fly, Bactrocera oleae (Rossi), is a monophagous pest that displays an oviposition preference among cultivars of olive (Olea europaea L.). To clarify the oviposition preference, the olive leaf volatiles of three olive cultivars (Cobrançosa, Madural and Verdeal Transmontana) were assessed by headspace solid-phase microextraction gas chromatography-mass spectrometry (HS-SPME-GC/MS) at six different periods of olive fruit maturation and degrees of infestation. A total of 39 volatiles were identified, mainly esters and alcohols, with a minor percentage of aldehydes, ketones and terpenic compounds, including sesquiterpenes. At sampling dates with higher degrees of infestation, cv. Cobrançosa had, simultaneously, significantly lower infestation degrees and higher volatile amounts than the other two cultivars, with a probable deterrent effect for oviposition. The green leaf volatiles (GLVs) (Z)-3-hexen-1-ol and (Z)-3-hexen-1-ol acetate) were the main compounds identified in all cultivars, together with toluene. The abundance of GLVs decreased significantly throughout maturation, without significant differences among cultivars, while toluene showed a general increase and positive correlation with olive fly infestation levels. The results obtained could broaden our understanding of the roles of various types and amounts of olive volatiles in the environment, especially in olive fly host selection and cultivar preference. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Changes in olive oil volatile organic compounds induced by water status and light environment in canopies of Olea europaea L. trees.

    Science.gov (United States)

    Benelli, Giovanni; Caruso, Giovanni; Giunti, Giulia; Cuzzola, Angela; Saba, Alessandro; Raffaelli, Andrea; Gucci, Riccardo

    2015-09-01

    Light and water are major factors in fruit development and quality. In this study, the effect of water and light in Olea europaea trees on volatile organic compounds (VOCs) in olive oil was studied over 2 years. Mature fruits were harvested from three zones of the canopy with different light exposure (64%, 42% and 30% of incident light) of trees subjected to full, deficit or complementary irrigation. VOCs were determined by SPME GC-MS and analysed by principal component analysis followed by discriminant analysis to partition treatment effects. Fruit fresh weight and mesocarp oil content decreased in zones where intercepted light was less. Low light levels significantly slowed down fruit maturation, whereas conditions of water deficit accelerated the maturation process. The presence of cyclosativene and α-muurulene was associated with water deficit, nonanal, valencene with full irrigation; α-muurulene, (E)-2-hexanal were related to low light conditions, while trans-β-ocimene, α-copaene, (Z)-2-penten-1-ol, hexanal and nonanal to well exposed zones. The year strongly affected the VOC profile of olive oil. This is the first report on qualitative changes in VOCs induced by light environment and/or water status. This information is valuable to better understand the role of environmental factors on the sensory quality of virgin olive oil. © 2014 Society of Chemical Industry.

  20. Colonization of olive trees (Olea europaea L.) with the arbuscular mycorrhizal fungus Glomus sp. modified the glycolipids biosynthesis and resulted in accumulation of unsaturated fatty acids.

    Science.gov (United States)

    Mechri, Beligh; Attia, Faouzi; Tekaya, Meriem; Cheheb, Hechmi; Hammami, Mohamed

    2014-09-01

    The influence of arbuscular mycorrhizal (AM) fungi colonization on photosynthesis, mineral nutrition, the amount of phospholipids and glycolipids in the leaves of olive (Olea europaea L.) trees was investigated. After six months of growth, the rate of photosynthesis, carboxylation efficiency, transpiration and stomatal conductance in mycorrhizal (M) plants was significantly higher than that of non-mycorrhizal (NM) plants. The inoculation treatment increased the foliar P and Mg but not N. The amount of glycolipids in the leaves of M plants was significantly higher than that of NM plants. However, the amount of phospholipids in the leaves of M plants was not significantly different to that in the leaves of NM plants. Also, we observed a significant increase in the level of α-linolenic acid (C18:3ω3) in glycolipids of M plants. This work supports the view that increased glycolipids level in the leaves of M plants could be involved, at least in part, in the beneficial effects of mycorrhizal colonization on photosynthesis performance of olive trees. To our knowledge, this is the first report on the effect of AM fungi on the amount of glycolipids in the leaves of mycorrhizal plants. Copyright © 2014 Elsevier GmbH. All rights reserved.

  1. Variability of virgin olive oil phenolic compounds in a segregating progeny from a single cross in Olea europaea L. and sensory and nutritional quality implications.

    Science.gov (United States)

    Pérez, Ana G; León, Lorenzo; Pascual, Mar; Romero-Segura, Carmen; Sánchez-Ortiz, Araceli; de la Rosa, Raúl; Sanz, Carlos

    2014-01-01

    Virgin olive oil phenolic compounds are responsible for its nutritional and sensory quality. The synthesis of phenolic compounds occurs when enzymes and substrates meet as olive fruit is crushed during the industrial process to obtain the oil. The genetic variability of the major phenolic compounds of virgin olive oil was studied in a progeny of the cross of Picual x Arbequina olive cultivars (Olea europaea L.). They belong to four different groups: compounds that included tyrosol or hydroxytyrosol in their molecules, lignans, flavonoids, and phenolic acids. Data of phenolics in the oils showed that the progeny displayed a large degree of variability, widely transgressing the genitor levels. This high variability can be of interest on breeding programs. Thus, multivariate analysis allowed to identify genotypes within the progeny particularly interesting in terms of phenolic composition and deduced organoleptic and nutritional quality. The present study has demonstrated that it is possible to obtain enough degree of variability with a single cross of olive cultivars for compounds related to the nutritional and organoleptic properties of virgin olive oil.

  2. Thermal stability of oils added with avocado (Persea americana cv. Hass) or olive (Olea europaea cv. Arbequina) leaf extracts during the French potatoes frying.

    Science.gov (United States)

    Jiménez, Paula; García, Paula; Bustamante, Andrés; Barriga, Andrés; Robert, Paz

    2017-04-15

    Effect of the addition of avocado (Persea americana cv. Hass) or olive (Olea europaea cv. Arbequina) hydroalcoholic leaf extracts (AHE and OHE, respectively) on thermal stability of canola oil (CO) and high oleic sunflower oil (HOSO) during French potatoes frying at 180°C was studied. The extracts were characterized by the total phenolic content, phenol chromatographic profiles and antioxidant activity. B-type trimer procyanidins were the major phenolic compounds identified in AHE. OHE showed higher phenol content, antioxidant activity regarding AHE. CO+OHE and HOSO+OHE decreased the formation of polar compounds and showed an anti-polymeric effect with respect to oils without extracts, whereas AHE extract showed a prooxidant effect on HOSO. Therefore, OHE showed an antioxidant effect on HOSO and CO under the studied conditions. In addition, all systems (CO+AHE, HOSO+AHE, CO+OHE and HOSO+OHE) increased the retention of tocopherols. These results demonstrate the potential utility of OHE as natural antioxidant for oils. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. A possible role for flowering locus T-encoding genes in interpreting environmental and internal cues affecting olive (Olea europaea L.) flower induction.

    Science.gov (United States)

    Haberman, Amnon; Bakhshian, Ortal; Cerezo-Medina, Sergio; Paltiel, Judith; Adler, Chen; Ben-Ari, Giora; Mercado, Jose Angel; Pliego-Alfaro, Fernando; Lavee, Shimon; Samach, Alon

    2017-08-01

    Olive (Olea europaea L.) inflorescences, formed in lateral buds, flower in spring. However, there is some debate regarding time of flower induction and inflorescence initiation. Olive juvenility and seasonality of flowering were altered by overexpressing genes encoding flowering locus T (FT). OeFT1 and OeFT2 caused early flowering under short days when expressed in Arabidopsis. Expression of OeFT1/2 in olive leaves and OeFT2 in buds increased in winter, while initiation of inflorescences occurred i n late winter. Trees exposed to an artificial warm winter expressed low levels of OeFT1/2 in leaves and did not flower. Olive flower induction thus seems to be mediated by an increase in FT levels in response to cold winters. Olive flowering is dependent on additional internal factors. It was severely reduced in trees that carried a heavy fruit load the previous season (harvested in November) and in trees without fruit to which cold temperatures were artificially applied in summer. Expression analysis suggested that these internal factors work either by reducing the increase in OeFT1/2 expression or through putative flowering repressors such as TFL1. With expected warmer winters, future consumption of olive oil, as part of a healthy Mediterranean diet, should benefit from better understanding these factors. © 2017 John Wiley & Sons Ltd.

  4. Endophytic colonization and biocontrol performance of Pseudomonas fluorescens PICF7 in olive (Olea europaea L.) are determined neither by pyoverdine production nor swimming motility.

    Science.gov (United States)

    Maldonado-González, M Mercedes; Schilirò, Elisabetta; Prieto, Pilar; Mercado-Blanco, Jesús

    2015-09-01

    Pseudomonas fluorescens PICF7 is an indigenous inhabitant of olive (Olea europaea L.) rhizosphere, able to display endophytic lifestyle in roots, to induce a wide range of defence responses upon colonization of this organ and to exert effective biological control against Verticillium wilt of olive (VWO) (Verticillium dahliae). We aimed to evaluate the involvement of specific PICF7 phenotypes in olive root colonization and VWO biocontrol effectiveness by generating mutants impaired in swimming motility (fliI) or siderophore pyoverdine production (pvdI). Besides, the performance of mutants with diminished in vitro growth in potato dextrose agar medium (gltA) and cysteine (Cys) auxotrophy was also assessed. Results showed that olive root colonization and VWO biocontrol ability of the fliI, pvdI and gltA mutants did not significantly differ from that displayed by the parental strain PICF7. Consequently, altered in vitro growth, swimming motility and pyoverdine production contribute neither to PICF7 VWO suppressive effect nor to its colonization ability. In contrast, the Cys auxotroph mutant showed reduced olive root colonization capacity and lost full biocontrol efficacy. Moreover, confocal laser scanning microscopy revealed that all mutants tested were able to endophytically colonize root tissue to the same extent as wild-type PICF7, discarding these traits as relevant for its endophytic lifestyle. © 2014 Society for Applied Microbiology and John Wiley & Sons Ltd.

  5. Subclinical atherosclerosis and history of cardiovascular events in Italian patients with rheumatoid arthritis: Results from a cross-sectional, multicenter GIRRCS (Gruppo Italiano di Ricerca in Reumatologia Clinica e Sperimentale) study.

    Science.gov (United States)

    Ruscitti, Piero; Margiotta, Domenico Paolo Emanuele; Macaluso, Federica; Iacono, Daniela; D'Onofrio, Francesca; Emmi, Giacomo; Atzeni, Fabiola; Prete, Marcella; Perosa, Federico; Sarzi-Puttini, Piercarlo; Emmi, Lorenzo; Cantatore, Francesco Paolo; Triolo, Giovanni; Afeltra, Antonella; Giacomelli, Roberto; Valentini, Gabriele

    2017-10-01

    Several studies have pointed out a significant association between rheumatoid arthritis (RA) and accelerated atherosclerosis. At the best of our knowledge, no such study has been carried out in a large Italian series and, in this study, we aimed to investigate the prevalence of both subclinical atherosclerosis and history of cardiovascular events (CVEs), in patients consecutively admitted from January 1, 2015 to December 31, 2015 to Rheumatology Units throughout the whole Italy.Centers members of GIRRCS (Gruppo Italiano di Ricerca in Reumatologia Clinica e Sperimentale) were invited to enrol patients consecutively admitted from January 1, 2015 to December 31, 2015 and satisfying American College of Rheumatology/ European League Against Rheumatism criteria for RA and to investigate each of them for: traditional cardiovascular risk factors: sex, age, smoking habit, total cholesterol, triglycerides, glycaemia, high blood pressure, metabolic syndrome (MS), type 2 diabetes (T2D); RA features: disease duration as assessed from the first symptom, disease activity as evaluated by DAS28, radiographic damage as assessed by hands and feet x-ray, and previous joint surgery; prevalence of both subclinical atherosclerosis and history of CVEs.Eight centers participated to the study. From January 1, 2015 to December 31, 2015, the 1176 patients, who had been investigated for all the items, were enrolled in the study. They were mostly women (80.52%), with a median age of 60 years (range, 18-91 years), a median disease duration of 12 years (range, 0.8-25 years), seropositive in 69.21%. Nineteen percent were in remission; 17.51% presented low disease activity; 39.45% moderate disease activity; 22.61% high disease activity.Eighty-two patients (6.9%) had a history for CVEs (58 myocardial infarction, 38 heart failure, 10 ischemic transitory attack, and 7 stroke). This figure appears to be lower than that reported worldwide (8.5%). After excluding the 82 patients with a history of CV

  6. A de novo transcriptomic approach to identify flavonoids and anthocyanins switch-off in olive (Olea europaea L. drupes at different stages of maturation

    Directory of Open Access Journals (Sweden)

    Domenico eIaria

    2016-01-01

    Full Text Available During ripening, the fruits of the olive tree (Olea europaea L. undergo a progressive chromatic change characterized by the formation of a red-brown spot which gradually extends on the epidermis and in the innermost part of the mesocarp. This event finds an exception in the Leucocarpa cultivar, in which we observe a destabilized equilibrium between the metabolisms of chlorophyll and other pigments, particularly the anthocyanins whose switch-off during maturation promotes the white coloration of fruits. Despite its importance, genomic information on the olive tree is still lacking. Different RNA-seq libraries were generated from drupes of ‘Leucocarpa’ and ‘Cassanese’ olive genotypes, sampled at 100 and 130 days after flowering (DAF, and were used in order to identify transcripts involved in the main phenotypic changes of fruits during maturation and their corresponding expression patterns. A total of 103,359 transcripts were obtained and 3792 and 3064 were differentially expressed in ‘Leucocarpa’ and ‘Cassanese’ genotypes, respectively, during 100-130 DAF transition. Among them flavonoid and anthocyanin related transcripts such as phenylalanine ammonia lyase (PAL, cinnamate 4-hydroxylase (C4H, 4-coumarate-CoA ligase (4CL, chalcone synthase (CHS, chalcone isomerase (CHI, flavanone 3-hydroxylase (F3H, flavonol 3’-hydrogenase (F3'H, flavonol 3’5’-hydrogenase (F3'5'H, flavonol synthase (FLS, dihydroflavonol 4-reductase (DFR, anthocyanidin synthase (ANS, UDP-glucose:anthocianidin:flavonoid glucosyltransferase (UFGT were identified.These results contribute to reducing the current gap in information regarding metabolic processes, including those linked to fruit pigmentation in the olive.

  7. Biogenic synthesis of copper oxide nanoparticles using olea europaea leaf extract and evaluation of their toxicity activities: An in vivo and in vitro study.

    Science.gov (United States)

    Sulaiman, Ghassan M; Tawfeeq, Amer T; Jaaffer, Marwa D

    2018-01-01

    Copper oxide nanoparticles (CUNPs) were synthesized using Olea europaea leaf extract as reducing and protecting agent. The formation of nanoparticles was observed through a color change from yellowish to brownish black. The CUNPs were confirmed with UV-Vis spectrophotometer, which revealed a peak absorbance at 289 nm. The synthesized CUNPs were characterized by XRD, FTIR, SEM, and TEM. The XRD pattern revealed that CUNPs were crystalline in nature with a diameter around 20 nm. FTIR spectral analysis showed that CUNPs were capped with plant constituents. From SEM and TEM analyses, the CUNPs were generally found to be spherical in shape, and the size range was 20-50 nm. Free radical scavenging potential of CUNPs against DPPH was confirmed by its stable antioxidant effects. In addition, the toxicity of CUNPs in mice was also assessed by body weight and weights of liver, kidneys, spleen, and thymus. The immune response in mice was signaled through an obvious change in spleen and thymus index, with a decrease of ADA enzyme activity in serum, spleen, and thymus after CUNPs treatment. The CUNPs were found to exert cell growth arrest against AMJ-13 and SKOV-3 cancer cells in a dose-dependent manner and induce cell death by apoptosis. Less significant cytotoxic effect was observed in normal dermal fibroblast cells. These findings suggest that CUNPs may have the potential to be anticancer agents. © 2017 American Institute of Chemical Engineers Biotechnol. Prog., 34:218-230, 2018. © 2017 American Institute of Chemical Engineers.

  8. Olive (Olea europaea) leaf methanolic extract prevents HCl/ethanol-induced gastritis in rats by attenuating inflammation and augmenting antioxidant enzyme activities.

    Science.gov (United States)

    Al-Quraishy, Saleh; Othman, Mohamed S; Dkhil, Mohamed A; Abdel Moneim, Ahmed Esmat

    2017-07-01

    Gastritis is preponderantly characterized by inflammation of the lining epithelial layer and the chronic gastritis is considered as a pre-cancer lesion. For many centuries olive (Olea europaea) leaf has been used for its putative health potential, nonetheless, to date, the gastroprotective effects of olive leaves have not been studied yet. Hence, in this study we investigated whether olive leaf extract (OLE) could protect gastric mucosa against HCl/ethanol-induced gastric mucosal damage in rats. Hcl/ethanol administration caused significant damage to the gastric mucosa, as confirmed by gastric ulcer index and histological evaluation. However, this damage was largely prevented by pre-administering 20mg/kg omeprazole or 100mg/kg OLE. Interestingly, the damage was completely prevented by pre-administering 200 and 300mg/kg OLE. Moreover, OLE attenuated the inflammatory response by decreasing nuclear factor-κB (NF-κB), cycloxygenase-2 (COX-2) and tumor necrosis factor-α (TNF-α) expressions, and down-regulating inducible nitric oxide synthase (iNOS) and interleukin-1β (IL-1β) in gastric mucosa. The gastroprotective mechanism of OLE involved the promotion of enzymatic and nonenzymatic molecules (superoxide dismutase, catalase, glutathione peroxidase, glutathione reductase and glutathione reduced form), promoting nuclear factor erythroid 2-related factor 2 (Nrf2) mRNA expression, halting lipid peroxidation and preventing the overproduction of nitric oxide. Together, our findings clearly demonstrated that OLE could prevent HCl/ethanol-induced gastritis by attenuating inflammation and oxidant/antioxidant imbalance. Indeed, OLE could potentially be useful as a natural therapy for gastritis. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  9. Spatiotemporal variation of arbuscular mycorrhizal fungal colonization in olive (Olea europaea L.) roots across a broad mesic-xeric climatic gradient in North Africa.

    Science.gov (United States)

    Meddad-Hamza, Amel; Hamza, Nabila; Neffar, Souad; Beddiar, Arifa; Gianinazzi, Silvio; Chenchouni, Haroun

    2017-04-01

    This study aims to determine the spatiotemporal dynamics of root colonization and spore density of arbuscular mycorrhizal fungi (AMF) in the rhizosphere of olive trees (Olea europaea) with different plantation ages and under different climatic areas in Algeria. Soil and root samples were seasonally collected from three olive plantations of different ages. Other samples were carried out in productive olive orchards cultivated under a climatic gradient (desertic, semi-arid, subhumid, and humid). The olive varieties analysed in this study were Blanquette, Rougette, Chemlel and the wild-olive. Spore density, mycorrhization intensity (M%), spore diversity and the most probable number (MPN) were determined. Both the intensity of mycorrhizal colonization and spore density increased with the increase of seasonal precipitation and decreased with the increase of air temperature regardless of the climatic region or olive variety. The variety Rougette had the highest mycorrhizal levels in all plantation ages and climates. Spore community was composed of the genera Rhizophagus, Funneliformis, Glomus, Septoglomus, Gigaspora, Scutellospora and Entrophospora. The genus Glomus, with four species, predominated in all climate regions. Spores of Gigaspora sp. and Scutellospora sp. were the most abundant in desertic plantations. Statistical models indicated a positive relationship between spore density and M% during spring and winter in young seedlings and old plantations. A significant positive relationship was found between MPN and spore density under different climates. For a mycotrophic species, the rhizosphere of olive trees proved to be poor in mycorrhiza in terms of mycorrhizal colonization and numbers of the infective AMF propagules. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. RP-HPLC-DAD-ESI-QTOF-MS based metabolic profiling of the potential Olea europaea by-product "wood" and its comparison with leaf counterpart.

    Science.gov (United States)

    Ammar, Sonda; Contreras, Maria Del Mar; Gargouri, Boutheina; Segura-Carretero, Antonio; Bouaziz, Mohamed

    2017-05-01

    Olea europaea L. organs such as leaves, stems and roots have been associated with numerous in vivo and in vitro biological activities and used for traditional medicinal purposes. However, tree wood is an untapped resource with little information about their chemical composition. That is why, the objective of this study is to increase the knowledge about phytochemicals from 'Chemlali' olive wood by means of mass spectrometry-based analyses. Its comparison with by-products derived from leaves was also studied. Hydromethanol extracts from wood and leaves with stems of 'Chemlali' olive cultivar were analysed using reversed-phase (RP) high-performance liquid chromatography (HPLC) coupled to two detection systems: diode-array detection (DAD) and quadrupole time-of-flight (QTOF) mass spectrometry (MS) in negative ion mode. Tandem MS experiments were performed to establish the chemical structure of olive phytochemicals. A total of 85 compounds were characterised in the studied olive parts and classified as: sugars (3), organic acids (5), one phenolic aldehyde, simple phenolic acids (6), simple phenylethanoids (5), flavonoids (14), coumarins (3), caffeoyl phenylethanoid derivatives (6), iridoids (5), secoiridoids (32), and lignans (5). To our knowledge, the major part of these metabolites was not previously reported in olive tree wood, and 10 olive chemical constituents were identified for the first time in the Oleaceae family. The results presented here demonstrated the usefulness of the methodology proposed, based on RP-HPLC-DAD-ESI-QTOF-MS and MS/MS, to develop an exhaustive metabolic profiling and to recover new biologically active compounds in olive wood with pharmacologic and cosmetic potential. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  11. On the use of leaf spectral indices to assess water status and photosynthetic limitations in Olea europaea L. during water-stress and recovery.

    Directory of Open Access Journals (Sweden)

    Pengsen Sun

    Full Text Available Diffusional limitations to photosynthesis, relative water content (RWC, pigment concentrations and their association with reflectance indices were studied in olive (Olea europaea saplings subjected to water-stress and re-watering. RWC decreased sharply as drought progressed. Following rewatering, RWC gradually increased to pre-stress values. Photosynthesis (A, stomatal conductance (gs, mesophyll conductance (gm, total conductance (gt, photochemical reflectance index (PRI, water index (WI and relative depth index (RDI closely followed RWC. In contrast, carotenoid concentration, the carotenoid to chlorophyll ratio, water content reflectance index (WCRI and structural independent pigment index (SIPI showed an opposite trend to that of RWC. Photosynthesis scaled linearly with leaf conductance to CO2; however, A measured under non-photorespiratory conditions (A1%O2 was approximately two times greater than A measured at 21% [O2], indicating that photorespiration likely increased in response to drought. A1%O2 also significantly correlated with leaf conductance parameters. These relationships were apparent in saturation type curves, indicating that under non-photorespiratory conditions, CO2 conductance was not the major limitations to A. PRI was significant correlated with RWC. PRI was also very sensitive to pigment concentrations and photosynthesis, and significantly tracked all CO2 conductance parameters. WI, RDI and WCRI were all significantly correlated with RWC, and most notably to leaf transpiration. Overall, PRI correlated more closely with carotenoid concentration than SIPI; whereas WI tracked leaf transpiration more effectively than RDI and WCRI. This study clearly demonstrates that PRI and WI can be used for the fast detection of physiological traits of olive trees subjected to water-stress.

  12. Assessing Animal Welfare Impacts in the Management of European Rabbits (Oryctolagus cuniculus), European Moles (Talpa europaea) and Carrion Crows (Corvus corone)

    Science.gov (United States)

    Baker, Sandra E.; Sharp, Trudy M.; Macdonald, David W.

    2016-01-01

    Human-wildlife conflict is a global issue. Attempts to manage this conflict impact upon wild animal welfare, an issue receiving little attention until relatively recently. Where human activities harm animal welfare these effects should be minimised where possible. However, little is known about the welfare impacts of different wildlife management interventions, and opinions on impacts vary widely. Welfare impacts therefore need to be assessed objectively. Our objectives were to: 1) establish whether an existing welfare assessment model could differentiate and rank the impacts of different wildlife management interventions (for decision-making purposes); 2) identify and evaluate any additional benefits of making formal welfare assessments; and 3) illustrate issues raised by application of the model. We applied the welfare assessment model to interventions commonly used with rabbits (Oryctolagus cuniculus), moles (Talpa europaea) and crows (Corvus corone) in the UK. The model ranked interventions for rabbits (least impact first: fencing, head shot, chest shot) and crows (shooting, scaring, live trapping with cervical dislocation). For moles, managing molehills and tunnels scored least impact. Both spring trapping, and live trapping followed by translocation, scored greater impacts, but these could not be compared directly as they scored on different axes of the model. Some rankings appeared counter-intuitive, highlighting the need for objective formal welfare assessments. As well as ranking the humaneness of interventions, the model highlighted future research needs and how Standard Operating Procedures might be improved. The model is a milestone in assessing wildlife management welfare impacts, but our research revealed some limitations of the model and we discuss likely challenges in resolving these. In future, the model might be developed to improve its utility, e.g. by refining the time-scales. It might also be used to reach consensus among stakeholders about

  13. Assessing Animal Welfare Impacts in the Management of European Rabbits (Oryctolagus cuniculus, European Moles (Talpa europaea and Carrion Crows (Corvus corone.

    Directory of Open Access Journals (Sweden)

    Sandra E Baker

    Full Text Available Human-wildlife conflict is a global issue. Attempts to manage this conflict impact upon wild animal welfare, an issue receiving little attention until relatively recently. Where human activities harm animal welfare these effects should be minimised where possible. However, little is known about the welfare impacts of different wildlife management interventions, and opinions on impacts vary widely. Welfare impacts therefore need to be assessed objectively. Our objectives were to: 1 establish whether an existing welfare assessment model could differentiate and rank the impacts of different wildlife management interventions (for decision-making purposes; 2 identify and evaluate any additional benefits of making formal welfare assessments; and 3 illustrate issues raised by application of the model. We applied the welfare assessment model to interventions commonly used with rabbits (Oryctolagus cuniculus, moles (Talpa europaea and crows (Corvus corone in the UK. The model ranked interventions for rabbits (least impact first: fencing, head shot, chest shot and crows (shooting, scaring, live trapping with cervical dislocation. For moles, managing molehills and tunnels scored least impact. Both spring trapping, and live trapping followed by translocation, scored greater impacts, but these could not be compared directly as they scored on different axes of the model. Some rankings appeared counter-intuitive, highlighting the need for objective formal welfare assessments. As well as ranking the humaneness of interventions, the model highlighted future research needs and how Standard Operating Procedures might be improved. The model is a milestone in assessing wildlife management welfare impacts, but our research revealed some limitations of the model and we discuss likely challenges in resolving these. In future, the model might be developed to improve its utility, e.g. by refining the time-scales. It might also be used to reach consensus among

  14. Neuroprotection by Combined Administration with Maslinic Acid, a Natural Product from Olea europaea, and MK-801 in the Cerebral Ischemia Model

    Directory of Open Access Journals (Sweden)

    Yisong Qian

    2016-08-01

    Full Text Available Glutamate-mediated excitotoxicity is a major cause of ischemic brain damage. MK-801 confers neuroprotection by attenuating the activation of the N-methyl-d-aspartate (NMDA receptor, but it failed in clinical use due to the short therapeutic window. Here we aim to investigate the effects of maslinic acid, a natural product from Olea europaea, on the therapeutic time window and dose range for the neuroprotection of MK-801. Rats were administered with maslinic acid intracerebroventricularly and cerebral ischemia was induced by middle cerebral artery occlusion (MCAO followed by reperfusion. MK-801 was administered at 1 h, 2 h, 3 h and 4 h after ischemia, respectively. The cerebral infarct volume was determined by 2,3,5-Triphenyltetrazolium chloride (TTC staining, neuronal damage was assessed by Haematoxylin Eosin (H&E staining, and the expression of glial glutamate transporters and glial fibrillary acidic protein (GFAP was evaluated by immunohistochemistry and Western blot post-ischemia. Results showed that the presence of maslinic acid extended the therapeutic time window for MK-801 from 1 h to 3 h. Co-treatment of maslinic acid and MK-801 at a subthreshold dosage obviously induced neuroprotection after ischemia. The combination of these two compounds improved the outcome in ischemic rats. Moreover, maslinic acid treatment promoted the expression of GLT-1 and GFAP post-ischemia. These data suggest that the synergistic effect of maslinic acid on neurological protection might be associated with the improvement of glial function, especially with the increased expression of GLT-1. The combination therapy of maslinic acid and MK-801 may prove to be a potential strategy for treating acute ischemic stroke.

  15. Differential Contribution of Endoplasmic Reticulum and Chloroplast ω-3 Fatty Acid Desaturase Genes to the Linolenic Acid Content of Olive (Olea europaea) Fruit.

    Science.gov (United States)

    Hernández, M Luisa; Sicardo, M Dolores; Martínez-Rivas, José M

    2016-01-01

    Linolenic acid is a polyunsaturated fatty acid present in plant lipids, which plays key roles in plant metabolism as a structural component of storage and membrane lipids, and as a precursor of signaling molecules. The synthesis of linolenic acid is catalyzed by two different ω-3 fatty acid desaturases, which correspond to microsomal- (FAD3) and chloroplast- (FAD7 and FAD8) localized enzymes. We have investigated the specific contribution of each enzyme to the linolenic acid content in olive fruit. With that aim, we isolated two different cDNA clones encoding two ω-3 fatty acid desaturases from olive (Olea europaea cv. Picual). Sequence analysis indicates that they code for microsomal (OepFAD3B) and chloroplast (OepFAD7-2) ω-3 fatty acid desaturase enzymes, different from the previously characterized OekFAD3A and OekFAD7-1 genes. Functional expression in yeast of the corresponding OepFAD3A and OepFAD3B cDNAs confirmed that they encode microsomal ω-3 fatty acid desaturases. The linolenic acid content and transcript levels of olive FAD3 and FAD7 genes were measured in different tissues of Picual and Arbequina cultivars, including mesocarp and seed during development and ripening of olive fruit. Gene expression and lipid analysis indicate that FAD3A is the gene mainly responsible for the linolenic acid present in the seed, while FAD7-1 and FAD7-2 contribute mostly to the linolenic acid present in the mesocarp and, therefore, in the olive oil. These results also indicate the relevance of lipid trafficking between the endoplasmic reticulum and chloroplast in determining the linolenic acid content of membrane and storage lipids in oil-accumulating photosynthetic tissues. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  16. The influence of light, temperature and feeding on the growth of the Coras cladocora caespitosa and Balanophyllia europaea; L'influenza di luce, temperatura e alimentazione sulla crescita dei coralli mediterranei Cladocora caespitosa e Balanophyllia europaea. Risultati preliminari di una sperimentazione in ambiente controllato

    Energy Technology Data Exchange (ETDEWEB)

    Rodolfo-Metalpa, R.; Abbate, M.; Peirano, A. [ENEA, Divisione Ambiente Globale e Mediterraneo, Centro Ricerche S. Teresa, La Spezia (Italy)

    2001-07-01

    In the course of the environmental studies, carried out by ENEA-CRAM Center of S. Teresa near La Spezia, research has been performed about bioconstructional organisms in the Mediterranean Sea. To understand how these organisms respond to environmental parameters an experiment has been carried out in aquaria. Specimens of the Mediterranean coral Cladocora caespitosa and Balanophyllia europaea has been maintained in 80 independent aquaria for four months. Growth rates, pigments concentration and asexual reproduction of the corals were compared in experimental procedures with controlled conditions of light, temperature and food. Environmental parameters have been set out to simulate natural (winter and summer) ambient in the Ligurian Sea. Heterotrophic and autotrophic abilities of the corals have been compared. Results show different growth rates between the two species but similar heterotrophic growth patterns. Summer temperature largely influences growth rates and asexual reproduction of the species while light influence is small. [Italian] Nell'ambito delle ricerche svolte dall'ENEA sullo studio degli organismi biocostruttori nell'ambiente marino, e' stata svolta una sperimentazione al fine di valutare l'influenza di alcuni parametri ambientali (luce, temperatura e alimentazione), impostati in modo da simulare la naturale stagionalita' (inverno ed estate), sulla crescita e sulla riproduzione asessuale dei coralli mediterranei Cladocora caespitosa e Balanophyllia europaea. Queste sperimentazioni sono state condotte, per un periodo di circa quattro mesi, in ottanta acquari indipendenti caratterizzati da differenti livelli di luce, temperatura e alimentazione. Le valutazioni degli incrementi di peso e della crescita lineare sono state eseguite utilizzando differenti metodiche note in letteratura. Soprattutto la tecnica del Peso Galleggiante (Buoyant Weight) si e' dimostrata molto sensibile ed efficace. La capacita' (eterotrofia

  17. Physiological Response of Common Glasswort (Salicornia europaea L. to Potassium Nano-Particles Grown in Saline Soils around the Lake Urmia

    Directory of Open Access Journals (Sweden)

    Alireza Pirzad

    2016-06-01

    Full Text Available To evaluate the effects of spraying potassium nano-particles on the osmolytes, photosynthetic pigments, total carotenoids and nutrients of aerial parts of common glasswort (Salicornia europaea L., a factorial experiment based on randomized complete block design with three replications was conducted at the marginal lands of Lake Urmia in 2012. The treatments consisted of application of potassium nano-particle concentrations at five levels (0, 1, 2, 3 and 4 g/l of K nano-particles applied, once, twice and three times. Results of analysis of variance (ANOVA showed that there were significant interaction between the levels and concentrations of potassium nano-particles sprayings on aerial parts with respect to their contents proline, total soluble carbohydrates, total chlorophyll, chlorophyll a and b, total carotenoids (xanthophyll and carotene and nutrients (nitrogen, phosphorus, potassium, calcium and sodium. The highest levels of proline (1.84 mg/g dry weight at one time spraying 4 g/l of K, total soluble carbohydrates (66.9 mg/g dry weight at three times spraying 4 g/l, total chlorophyll (26.23 mg/g fresh weight and chlorophyll b (22.85 mg/g fresh weight at two times of water spraying, and chlorophyll a (9.93 mg/g fresh weight at three times of 4g/l of potassium nano-particles sprayings were obtained. The highest nitrogen (0.95 % of aerial parts and phosphorus (2.99 g/kg dry weight of aerial parts contents were obtained from three times water spraying. However, the highest amounts of aerial plant part of potassium (65.08 g/kg dry weight and sodium (403 g/kg dry weight belonged to the two times, and calcium (29.23 g/kg dry weight to the three times spraying of 4 g/l nano-potassium. Despite of the high concentration of osmolytes by potassium spraying, the nutrient accumulations levels were not significantly different from each other.

  18. Validation of reference genes for gene expression analysis in olive (Olea europaea) mesocarp tissue by quantitative real-time RT-PCR.

    Science.gov (United States)

    Ray, Debashree L; Johnson, Joshua C

    2014-05-18

    Gene expression analysis using quantitative reverse transcription PCR (qRT-PCR) is a robust method wherein the expression levels of target genes are normalised using internal control genes, known as reference genes, to derive changes in gene expression levels. Although reference genes have recently been suggested for olive tissues, combined/independent analysis on different cultivars has not yet been tested. Therefore, an assessment of reference genes was required to validate the recent findings and select stably expressed genes across different olive cultivars. A total of eight candidate reference genes [glyceraldehyde 3-phosphate dehydrogenase (GAPDH), serine/threonine-protein phosphatase catalytic subunit (PP2A), elongation factor 1 alpha (EF1-alpha), polyubiquitin (OUB2), aquaporin tonoplast intrinsic protein (TIP2), tubulin alpha (TUBA), 60S ribosomal protein L18-3 (60S RBP L18-3) and polypyrimidine tract-binding protein homolog 3 (PTB)] were chosen based on their stability in olive tissues as well as in other plants. Expression stability was examined by qRT-PCR across 12 biological samples, representing mesocarp tissues at various developmental stages in three different olive cultivars, Barnea, Frantoio and Picual, independently and together during the 2009 season with two software programs, GeNorm and BestKeeper. Both software packages identified GAPDH, EF1-alpha and PP2A as the three most stable reference genes across the three cultivars and in the cultivar, Barnea. GAPDH, EF1-alpha and 60S RBP L18-3 were found to be most stable reference genes in the cultivar Frantoio while 60S RBP L18-3, OUB2 and PP2A were found to be most stable reference genes in the cultivar Picual. The analyses of expression stability of reference genes using qRT-PCR revealed that GAPDH, EF1-alpha, PP2A, 60S RBP L18-3 and OUB2 are suitable reference genes for expression analysis in developing Olea europaea mesocarp tissues, displaying the highest level of expression stability across

  19. Quantificação dos níveis endógenos de auxinas e da actividade enzimática das polifenoloxidases em oliveira (Olea europaea L. Quantification of endogenous auxin levels and polyphenoloxidase enzymatic activity in olive (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    C. Serra

    2007-01-01

    Full Text Available A actividade enzimática de polifenoloxidases foi avaliada em folhas e na zona apical, média e basal de ramos de duas cultivares de oliveira (Olea europaea L., comuns no Alentejo (‘Galega vulgar’ e ‘Cobrançosa’, mostrando que a actividade enzimática nas folhas foi muito superior à encontrada em tecidos de ramos do ano. Maior actividade enzimática foi também detectada na variedade ‘Cobrançosa’ versus ‘Galega vulgar’. As condições óptimas para a determinação da actividade enzimática foram: pH= 5.5 e T= 40 ºC, com 20 mM de 4-metilcatecol em tampão acetato. Nestas condições o KM determinado foi: 2,60 e 3,48 mM com o método de Michaelis-Menten e Lineweaver-Burk, respectivamente. A melhor recuperação das auxinas AIA (ácido indol-3-acético e AIB (ácido indolbutírico em material vegetal foi conseguida através da extracção das amostras com acetona. A separação, identificação e quantificação do AIA e AIB em padrões, material vegetal dopado (tecidos de oliveira dopados com uma concentração conhecida de padrão e não dopado, foi efectuada por técnicas cromatográficas (HPLC-DAD e LCMS, mostrando os resultados taxas de recuperação superiores a 40% para o AIA e 60% para o AIB.The poliphenoloxidase enzymatic activity was evaluated in two olive cultivars (Olea europaea L. widespread in Alentejo (‘Galega vulgar and ‘Cobrançosa. Leaves and apical, medium and basal regions of the year stems were used as sample material. When compared with the different regions of the year stem, the results have shown that enzymatic activity was significantly higher in the leaves of both cultivars. Between cultivars, it was observed that ‘Cobrançosa’ presented higher enzymatic activity than ‘Galega vulgar’. The pH at 5.5 and 40 ºC temperature, using 20 mM of 4methylcatecol in acetate buffer were the optimized conditions for the enzymatic analysis. Under these conditions, the measured KM was 2,60 and 3,48 m

  20. Preliminary Evaluation of 29 Olive (Olea europaea L. Cultivars for Production and Alternate Bearing, in the Huasco Valley, Northern Chile Evaluación Preliminar de la Produción y Añerismo en 29 Variedades de Olivo (Olea europaea L. en el Valle del Huasco, Norte de Chile

    Directory of Open Access Journals (Sweden)

    Francisco Tapia C

    2009-09-01

    Full Text Available There is increasing interest in the development of intensively managed olive orchards (Olea europaea L. in northern Chile. The selection of specific varieties that perform well on a particular site is considered crucial to maximizing productivity. The present study was undertaken to evaluate the productive performance of 29 varieties of olive in the Huasco Valley (28°34' S, 70°47' W, Northern Chile.The traits evaluated were: mean olive production per tree considering a longitudinal (PML analysis over a period of five years, 2003 to 2007, total olive production in the same period (PA03-07 and alternate bearing index (ABI. The effect of variety was highly significant (p En el norte de Chile existe un creciente interés en el desarrollo de huertos de olivo (Olea europaea L. manejados intensivamente. La selección de variedades específicas que han respondido bien en un sitio en particular es considerada clave para la maximización de la productividad. El presente estudio fue realizado para evaluar el desempeño de algunas características agronómicas en 29 variedades de olivo, en el Valle del Huasco (28°34' S, 70°47' O, norte de Chile. Las características analizadas correspondieron a producción de frutos promedio por árbol (PML en un análisis longitudinal durante un período de 5 años, 2003 a 2007, producción acumulada del mismo período (PA03-07 y el índice de alternancia de producción (ABI. El efecto debido a la variedad fue altamente significativo (p < 0,01 para las tres características. El ABI fue moderado (0,52, con una PML de 37,37 kg árbol-1 y PA03-07 de 186 kg árbol-1. Correlaciones de Spearman entre los ranking de cada característica fueron positivas y significativamente diferentes de cero (p < 0,05. ‘Leccino’ tuvo la mejor respuesta considerando únicamente la producción de frutos. ‘Arbequina’, ‘Picholine’, ‘Manzanilla Racimo’, ‘Picual’, ‘Manzanilla de Sevilla’, ‘Frantoio’ y

  1. Influência do número de nós em estacas semilenhosas de oliveira (Olea europaea L. no enraizamento sob câmara de nebulização Influence the number of nodes on semi-woody cuttings of olive tree (Olea europaea L. on the rooting in misty room

    Directory of Open Access Journals (Sweden)

    Adelson Francisco de Oliveira

    2003-04-01

    Full Text Available Com o objetivo de avaliar o enraizamento de estacas semilenhosas de oliveira (Olea europaea L. com diferentes números de nós, foi conduzido no Centro de Investigación y Formación Agraria - CIFA "Alameda del Obispo" de Córdoba - Espanha, experimento sob condições de câmara de nebulização intermitente. As estacas foram tratadas com ácido indolbutítico (AIB na concentração de 3.000 mg.L-1, antes da instalação do ensaio, submergindo durante cinco segundos as suas bases, aproximadamente 2,5 centímetros, em solução contendo o produto. Utilizaram-se estacas medianas, que foram coletadas de plantas em desenvolvimento vegetativo contínuo. O delineamento experimental utilizado foi o de blocos casualizados em fatorial 2 x 5, sendo respectivamente duas variedades, Picual e Arbequina, e cinco tamanhos de estacas: dois nós com duas folhas, três nós com duas folhas, três nós com quatro folhas, quatro nós com quatro folhas e cinco nós com quatro folhas. Utilizaram-se quatro repetições com parcelas experimentais constituídas por trinta estacas plantadas em substrato de perlita, em mesas suspensas, com aquecimento controlado. Avaliaram-se aos 75 dias porcentagem de estacas enraizadas, mortas e número e comprimento médio de raízes. Observou-se que, entre estacas de quatro nós e cinco nós, com quatro folhas, não houve diferença nos parâmetros considerados; estacas com três nós, com duas e quatro folhas também não diferenciaram. Estacas com dois nós e duas folhas, de ambas as variedades, apresentaram maior mortalidade.With the objective of assessing the rooting efficiency of semi-woody cuttings of olive tree (Olea europaea L., with different nodes, an experiment under intermittent misty room conditions and with the use of IBA at the concentration of 3000 mg L-1 was run at the Centro de Investigación y Formación Agraria 'Alameda del Obispo' in Cordoba, Spain. The cuttings were treated before the establishment of the trial

  2. Separation and identification of phenolic compounds of extra virgin olive oil from Olea europaea L. by HPLC-DAD-SPE-NMR/MS. Identification of a new diastereoisomer of the aldehydic form of oleuropein aglycone.

    Science.gov (United States)

    Pérez-Trujillo, Míriam; Gómez-Caravaca, Ana María; Segura-Carretero, Antonio; Fernández-Gutiérrez, Alberto; Parella, Teodor

    2010-08-25

    The phenolic fraction of a monovarietal extra virgin olive oil (EVOO) from Olea europaea L. var. Cornezuelo was studied by the hyphenated HPLC-DAD-SPE-NMR/MS techniques. This survey led to the identification of 25 main compounds. One was identified as a new diastereoisomer of the aldehydic form of oleuropein aglycone (AOA) and characterized by 1D and 2D NMR techniques. The relative configuration of this new AOA was determined as 5R*,8S*,9S* on the basis of the results obtained from the combination of NOE experiments and Monte Carlo conformational search calculations. Assuming, as for the described diastereoisomers, that the new AOA comes from the natural oleuropein aglycone (OA), the absolute configuration was proposed as 5S,8R,9R.

  3. Fauna Europaea: Mollusca – Bivalvia

    Directory of Open Access Journals (Sweden)

    Rafael Araujo

    2015-07-01

    European freshwater bivalves belong to the Orders Unionoida and Cardiida. All the European unionoids are included in the superfamily Unionoidea, the freshwater mussels or naiads. The European cardiids belong to the following three superfamilies: Cardioidea, Cyrenoidea and Dreissenoidea. Among the Unionoidea there are the most imperilled animal groups on the planet while the Cardioidea includes the cosmopolitan genus Pisidium, the Cyrenoidea the Asiatic clam (Corbicula fluminea and the Dreissenoidea the famous invasive zebra mussel (Dreissena polymorpha. Basic information is summarized on their taxonomy and biology. Tabulations include a complete list of the current estimated families, genera and species.

  4. Workshop Euratom Directive 97/43. New trends in radiation protection in clinical practice, in research and in regulation; Giornata di studio La Direttiva Europea 97/43: nuovi orientamenti per la radioprotezione nella pratica clinica, nella ricerca e nel quadro normativo

    Energy Technology Data Exchange (ETDEWEB)

    Mazzei, F. [ed.] [Istituto Superiore di Sanita' , Rome (Italy). Lab. di Fisica

    1999-07-01

    The Euratom Directive 97/43 on health protection of individuals against the dangers of ionizing radiation in relation to medical exposure is presented. In particular the following topics are focused, with a multidisciplinary approach, on: diagnostic reference levels in radiodiagnostics and nuclear medicine; radiation protection in paediatrics, in interventional radiology and in computer tomography; radiation protection radiotherapy, radiation protection in medical research; radiation protection in prenatal and neonatal exposure; radiation protection in medical-legal exposures. [Italian] Il rapporto raccoglie una presentazione della Direttiva Euratom 97/43 riguardante la protezione sanitaria delle persone contro i pericoli delle radiazioni ionizzanti connessi a esposizioni mediche. In particolare sono affrontati in modo interdisciplinare i seguenti argomenti: livelli diagnostici di riferimento in radiodiagnostica e in medicina nucleare; radioprotezione nelle esposizioni in eta' pediatrica, in radiologica interventistica e in tomografia computerizzata; radioprotezione in radioterapia; radioprotezione nella ricerca scientifica clinica; radioprotezione nell'esposizione in eta' prenatale e neonatale; esposizioni potenziali e radioprotezione nelle esposizioni medico-legali.

  5. Efecto vasodilatador e inhibidor de vasoconstricción del extracto hidroalcohólico de hojas de Olea europaea (olivo sobre anillos aórticos de ratas

    Directory of Open Access Journals (Sweden)

    Job Nexar-QH

    2013-10-01

    Full Text Available Objetivos: Evaluar el efecto vasodilatador, la inhibición de la vasoconstricción, así como el mecanismo responsable, del extracto hidroalcohólico de hojas de Olea europaea (olivo, sobre anillos aórticos en ratas. Diseño: Experimental. Lugar: Centro de Investigación y Desarrollo Científico, Facultad de Medicina, Universidad Nacional de San Agustín, Arequipa, Perú. Material biológico: Hojas de Olea europea y anillos aórticos de Rattus norvegicus, variedad albina swiss. Intervenciones: Se obtuvo un extracto hidroalcohólico de las hojas de Olea europaea. Se usó anillos aórticos de rata en cámara de órganos aislados y se registró la actividad vasomotora con un transductor de tensión isométrica. Se produjo contracción basal máxima con CaCl2 6 mM y se determinó el efecto vasodilatador con dosis de 25, 50 y 100 mg/mL de extracto hidroalcohólico de las hojas de Olea europaea. Se usó 1H-[1,2,4] oxadiazolo [4,3 alquinoxalin-1-one] (ODQ y nifedipino para determinar el mecanismo de acción. Se comparó la inhibición de la vasoconstricción tras la incubación durante 30 minutos con extracto 100 mg/mL y con captopril 10 µM. Principales medidas de resultados: Porcentaje de vasodilatación y de vasoconstricción. Resultados: Se obtuvo una vasodilatación de 7,20 ± 1,49%, 9,84 ± 1,42% y 12,31 ± 1,16% para las dosis de 25, 50 y 100 mg/mL, respectivamente, siendo significativa con la dosis de 100 mg/mL. La vasodilatación se incrementó tras la administración de ODQ 100 mM. La vasodilatación se inhibió tras la incubación con ODQ 100 mM más nifedipino 5 µM. No se encontró diferencia significativa entre la inhibición de la vasoconstricción con captopril 10µM y extracto a 100 mg/mL. Conclusiones: El extracto hidroalcohólico de hojas de Olea europea, a una dosis de 100 mg/mL, tiene efecto vasodilatador sobre anillos aórticos de ratas, mediado por el bloqueo de canales de calcio; además, posee efecto inhibidor de la

  6. Essais de prolifération et d'enracinement de matériel issu de rajeunissement par bouturage d'oliviers adultes (Olea europaea L. et de germination in vitro : effets de cytokinine et d'auxines

    Directory of Open Access Journals (Sweden)

    Walali Loudiyi D

    2005-01-01

    Full Text Available Proliferation and rooting of juvenile and adult olive explants (Olea europaea L.: effects of cytokinin and auxins. The micropropagation trials conducted concerned juvenile and adult material from the ‘Moroccan Picholine’ olive cultivar. Zeatin, added to the proliferation medium, was tested at 0, 1, 5, 10 et 20 mg/l. Root induction was performed on media contaning IAA, IBA or NAA tested at 0, 0.5, 1, 2 et 4 mg/l. A significant (P<0.001 interaction exists between the explant type and the cytokinine concentration on one hand and the type and concentration of auxin on the other hand. The highest bud sprouting and shoot development were obtained on medium supplemented with 5 mg/l zeatin. For economical reasons, satisfying results can be obtained with only 1 mg/l. Rooting of microcuttings reached 100% when NAA, which proved to be the best auxin for root induction, was used at 1 mg/l. No rooting was observed in the case of adult plant material. Further investigations are being undertaken to improve the reactivity of this recalcitrant type of material.

  7. Twelve-month consumption of a polyphenol extract from olive (Olea europaea) in a double blind, randomized trial increases serum total osteocalcin levels and improves serum lipid profiles in postmenopausal women with osteopenia.

    Science.gov (United States)

    Filip, R; Possemiers, S; Heyerick, A; Pinheiro, I; Raszewski, G; Davicco, M-J; Coxam, V

    2015-01-01

    Osteoporosis is a skeletal disorder characterized by impaired bone turnover and compromised bone strength, thereby predisposing to increased risk of fracture. Preclinical research has shown that compounds produced by the olive tree (Olea europaea), may protect from bone loss, by increasing osteoblast activity at the expense of adipocyte formation. The aim of this exploratory study was to obtain a first insight on the effect of intake of an olive extract on bone turnover in postmenopausal women with decreased bone mass (osteopenia). For that, a double blind, placebo-controlled study was performed in which participants were randomly allocated to either treatment or placebo groups. 64 osteopenic patients, with a mean bone mineral density (BMD) T-score between -1.5 and -2.5 in the lumbar spine (L2-L4) were included in the study. PARTICIPANTS received for 12 months daily either 250 mg/day of olive extract and 1000 mg Ca (treatment) or 1000 mg Ca alone (placebo). Primary endpoints consisted of evaluation of bone turnover markers. Secondary endpoints included BMD measurements and blood lipid profiles. After 12 months, the levels of the pro-osteoblastic marker osteocalcin were found to significantly increase in the treatment group as compared to placebo. Simultaneously, BMD decreased in the placebo group, while remaining stable in the treatment group. In addition, improved lipid profiles were observed, with significant decrease in total- and LDL-cholesterol in the treatment group. This exploratory study supports preclinical observations and warrants further research by showing that a specific olive polyphenol extract (Bonolive®) affects serum osteocalcin levels and may stabilize lumbar spine BMD. Moreover, the improved blood lipid profiles suggest additional health benefits associated to the intake of the olive polyphenol extract.

  8. Isolation of Pseudomonas aeruginosa strains from dental office environments and units in Barretos, state of São Paulo, Brazil, and analysis of their susceptibility to antimicrobial drugs Isolamento de cepas de Pseudomonas aeruginosa provenientes do meio ambiente e de equipos dentarios em clinicas dentarias em Barretos, São Paulo, Brasil; analises da susceptibilidade das cepas a drogas antimicrobianas

    Directory of Open Access Journals (Sweden)

    Ana Claudia de Oliveira

    2008-09-01

    Full Text Available A wide variety of opportunistic pathogens has been detected in the tubing supplying water to odontological equipment, in special in the biofilm lining of these tubes. Among these pathogens, Pseudomonas aeruginosa, one of the leading causes of nosocomial infections, is frequently found in water lines supplying dental units. In the present work, 160 samples of water, and 200 fomite samples from forty dental units were collected in the city of Barretos, State of São Paulo, Brazil and evaluated between January and July, 2005. Seventy-six P. aeruginosa strains, isolated from the dental environment (5 strains and water system (71 strains, were tested for susceptibility to six antimicrobial drugs most frequently used against P. aeruginosa infections. Susceptibility to ciprofloxacin, followed by meropenem was the predominant profile. The need for effective means of reducing the microbial burden within dental unit water lines is emphasized, and the risk of exposure and cross-infection in dental practice, in special when caused by opportunistic pathogens like P. aeruginosa, are highlighted.Uma ampla variedade de patógenos oportunistas tem sido detectadas nos tubos de alimentação de água dos equipos odontológicos, particularmente no biofilme formado na superfície do tubo. Entre os patógenos oportunistas encontrados nos tubos de água, Pseudomonas aeruginosa é reconhecida como uma das principais causadoras de infecções nosocomiais. Foram coletadas 160 amostras de água e 200 amostras de fomites em quarenta clinicas odontológicas na cidade de Barretos, São Paulo, Brasil, durante o período de Janeiro a Julho de 2005. Setenta e seis cepas de P. aeruginosa, isoladas a partir dos fomites (5 cepas e das amostras de água (71 cepas, foram analisadas quanto à susceptibilidade à seis drogas antimicrobianas freqüentemente utilizadas para o tratamento de infecções provocadas por P. aeruginosa. As principais suscetibilidades observadas foram para a

  9. Come pesci nell’acqua. Elementi di etnopsicologia clinica

    Directory of Open Access Journals (Sweden)

    Wanda Ielasi

    2007-03-01

    Full Text Available Starting from her clinical experience with migrant people, the author summarizes the theoretical and operational instruments in ethno-psychological field with a critical review of some key concepts: psyche and body, health and suffering, culture, ethnic group and race, diagnosis and treatment, individual and collective dimension. Especially, culture becomes most relevant when psychological competences are involved in cultural contexts which are different from our own: both when we work with foreign people in our country and when we are involved in mental health projects abroad. Transcultural clinic, ethnopsychiatry, critical medical anthropology and anthropology of contemporaneousness constitute the disciplinary horizon of therapeutic communications capable of managing caregiver’s and client’s cultural aspects.

  10. Enterite da Campylobacter upsaliensis: un paradigma della microbiologia clinica

    Directory of Open Access Journals (Sweden)

    Maria Letizia D’Annibale

    2006-12-01

    Full Text Available The Authors describe a case of acute enteritis in a adult woman with severe hepatitis C infection caused by a strain of Campylobacter upsaliensis.The clinical isolate was obtained only on blood agar because filter membrane technique was performed. In fact for this strain it was no growth on selective Campy agar, which include cephalotin too; C. upsaliensis is sensitive to this antibiotic molecule. So, the use of filter membrane on blood agar or charcoal agar at 37°C in microaerophilic atmosphere is recommended for isolation of all campylobacters responsible of human enteritis.

  11. Ruolo ed organizzazione della microbiologia clinica di domani

    Directory of Open Access Journals (Sweden)

    Giorgio Mucignat

    2006-12-01

    Full Text Available Infectious diseases continue to represent an important preventive and clinical problem especially in the light of the emergence of new pathogens, of the return of infrequent pathogens and of the increased risk of infective pathologies associated with migratory flow. Another critical point is represented by the possible insurgence of infections due to agents used in bioterrorism. More than ever it is indispensable for our country to define a network of structures able to give an organized response to these relevant problems both in terms of prevention and assistance. It is therefore important to define a protocol for clinical microbiology on a national basis that responds to different levels of activity. Keeping in mind that the fundamental objectives of microbiology are: - diagnosis of infective diseases - determination of resistance to antimicrobic drugs as a valid instrument to allow the clinician to proceed with specific treatment - control of infection spreading in the sanitary structures (hospital infections - to develop front line defence in new infections and bioterrorism, in collaboration with the department of prevention - to be a reference centre for specific training The principals on which one must base the reorganization are essentially three: 1. to configurate the microbiology service on the basis of real needs of the local population 2. to give qualitatively optimal results in real time 3. supporting “good clinical practice” to assure adequate patient results and acceptable costs for the regionale sanitary system (SSR The organization of microbiology should therefore foresee a microbiology department, structured on a provincial basis or a vast area including a structured centralized complex with peripheral structures (even simplified. This must integrate actively with the department of prevention in regard to the dynamics of infectious diseases in the territory and with the Division of Infectious Diseases (where this exists. In parallel an active interaction with research structures (IRCCS and University present in the territory to enable the coordinated implementation of the guidelines of research and its relapse on diagnostic exams. Keeping in mind that the quality of diagnostic performance is closely linked to the professional experience of the operators it is good practice centralizing some diagnostic procedures by identifying a reference centre. In a regional network organized in this way it is important to include a coordinating structure, since it is necessary to activate a complete level of communication, information exchange, activity planning, and complete problem solving.

  12. Construcao de subconjuntos terminologicos: contribuicoes a pratica clinica do enfermeiro

    Directory of Open Access Journals (Sweden)

    Jorge Wilker Bezerra Clares

    2013-08-01

    Full Text Available A Classificação Internacional para a Prática de Enfermagem (CIPE® é um sistema de classificação unificador dos elementos da prática de enfermagem (diagnósticos, resultados e intervenções, que possibilita elucidar elementos da linguagem própria da Enfermagem por meio da construção de subconjuntos terminológicos. Neste ensaio reflexivo, destacam-se aspectos relevantes para a construção de subconjuntos terminológicos CIPE®, bem como suas contribuições para a prática clínica do enfermeiro. Discute-se a elaboração de subconjuntos como ferramenta que contribui para a universalização da linguagem da Enfermagem, facilita o processo comunicativo, bem como o avanço científico e tecnológico da profissão. Portanto, incentiva-se seu uso por enfermeiros de todo o mundo.

  13. Legionnaires' disease in the renal transplant unit of "Hospital das Clinicas, FMUSP": during a five year period (1988-1993 Doença dos legionários na Unidade de Transplante Renal (UTR do Hospital das Clínicas FMUSP, no período de 1988 a 1993

    Directory of Open Access Journals (Sweden)

    Neusa Augusta de Oliveira Mazieri

    1994-06-01

    Full Text Available Several reports have related Legionella pneumophila with pneumonia in renal transplant patients, however this association has not been systematically documented in Brazil. Therefore this paper reports the incidence, by serologycal assays, of Legionella pneumophila serogroup 1 in these patients during a five year period. For this purpose sera from blood samples of 70 hospitalized patients with pneumonia from the Renal Transplant Unit of Hospital das Clinicas, FMUSP collected at the acute and convalescent phase of infection were submitted to indirect immunofluorescence assay (IFA to demonstrate anti-Legionella pneumophila serogroup 1 antibodies. Of these 70 patients studied during the period of 1988 to 1993,18 (25.71 % had significant rises in specific antibody titers for Legionella pneumophila serogroup 1. Incidence was interrupted following Hospital water decontamination procedures, with recurrence of infections after treatment interruption. In this study, the high susceptibility (25.71% of immunodepressed renal transplant patients to Legionella pneumophila serogroup 1 nosocomial infections is documented. The importance of the implementation and maintenance of water decontamination measures for prophylaxis of the infection is also clearly evident.Embora vários trabalhos tem mostrado a presença de Legionella pneumophila associado a pneumopatias infecciosas em transplantados renais, tal associação não fora antes realizado de maneira sistemática no Brasil. Os autores julgaram oportuno a determinação da incidência por comprovação sorológica da Legionella pneumophila sorogrupo 1 em transplantados renais num período de 5 anos. Para tanto amostras de soros de 70 pacientes com pneumopatia infecciosa internados na UTR do HC-FMUSP, colhidos na fase aguda e convalescente da infecção, foram submetidas à reação de imunofluo-rescência indireta para pesquisa de anticorpos anti-Legionella pneumophila sorogrupo 1. Dos 70 pacientes

  14. Olea europaea Linn (Oleaceae) Fruit Pulp Exhibits ...

    African Journals Online (AJOL)

    of 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 1 %. Triton X-100, 0.5 % sodium deoxycholate, 0.1 % sodium dodecyl sulfate (SDS), 1 mM EDTA. (Sigma), 1% protease inhibitor cocktail, and 1 % phosphatase inhibitor cocktail (Roche). After centrifugation, the protein concentration of the supernatant was assayed using a Bio-Rad ...

  15. Proteome Regulation during Olea europaea Fruit Development

    DEFF Research Database (Denmark)

    Bianco, Linda; Alagna, Fiammetta; Baldoni, Luciana

    2013-01-01

    occurring during these complex physiological processes. Methodology/Principal Findings: In this work, we started monitoring the proteome variations associated with olive fruit development by using comparative proteomics coupled to mass spectrometry. Proteins extracted from drupes at three different...... if changes observed at the protein level were consistent with changes of mRNAs, proteomic data produced in the present work were compared with transcriptomic data elaborated during previous studies. Conclusions/Significance: This study identifies a number of proteins responsible for quality traits of cv...

  16. Olea europaea Linn (Oleaceae) Fruit Pulp Exhibits ...

    African Journals Online (AJOL)

    as hydroxymethylglutaryl-CoA reductase (HMGR), acyl-CoA:cholesterol acyltransferase (ACAT), cytochrome P450 7A1 (CYP7A1) and peroxisome proliferation-activated receptor alpha (PPAR-á) in rat livers were evaluated using Western blotting. Results: OFP-EA-extract markedly altered the increased plasma TC, TG, LDL ...

  17. Correlacion clinica-patologica de corioamnionitis en pacientes que ingresan al servicio ginecologia en el año 2009 en el Hospital Universitario Clinica San Rafael

    OpenAIRE

    Hernandez Navarrete, Willy

    2011-01-01

    Este trabajo tuvo como utilidad básica determinar cuál es la correlación del diagnóstico clínico con los criterios de Gibss y con el Gold estándar que es la patología en las paciente con corioamnionitis para así poder establecer si el diagnostico se realizó en forma adecuada y cuáles son los criterios más relevantes para su diagnóstico. Dicha investigación se realizó de la siguiente manera: 1. Se Identificaron las pacientes que ingresaron al servicio de urgencias...

  18. Lesões desportivas no atletismo: comparação entre informações obtidas em prontuários e inquéritos de morbidade referida Lesiones deportivas en el atletismo: comparacion entre las informaciones obtenidas en historias clinicas y consultas de la morbilidad referida Sports injuries in track and field: comparison between information obtained in medical records and reported morbidity inquires

    Directory of Open Access Journals (Sweden)

    Carlos Marcelo Pastre

    2004-02-01

    ões desportivas para a população investigada.Para comprender las lesiones deportivas (LD es necesario cuantificarlas, asociandolas a factores causales particulares al esporte. Aún así, faltan registros sobre estas patologías en las instituciones deportivas, sobretodo en el atletismo brasileño, donde pocos son los clubes que poseen servicios de asistencia de la salud. La ausencia de tales registros, estudios en el área de Salud Pública, se utilizan otros recursos epidemiológicos para colectas, tales como las consultas de morbilidad referida. A partir de esta escasez de información y de la facilidad de obtención de datos junto a los propios atletas, se objetivó, para esta pesquisa, levantar informaciones sobre las LD referidas por los atletas de alto rendimento, retrocediendo ocho meses, y comparándolas con los registros de historias clínicas. Por lo tanto, fueron tomados veinticinco atletas de elite, dieciseis de género masculino y nueve del femenino, con edades de 25,7 ± 4,4 años, altura de 1,74 ± 0,10 m, peso 70,4 ± 13,15 kg e tiempo médio de entrenamiento de 8,38 ± 4,06 años. Dos fisioterapeutas fueron entrenados separadamente para recolectar información sobre LD. Uno de ellos en historias clinicas y el otro de los propios atletas a través de entrevistas (Interrogatorio de Morbidade Referida - IMR. El estudio de concordancia de respuestas para las dos formas de colecta fué realizado por el test de proporción binomial, estabeleciendose límites de 95% de confianza para la concordancia. Los resultados mostraron que en todas las variables estudiadas los valores estaban dentro de los límites de confianza estabelecidos para los tests estadísticos, siendo: 88,33% para las variables tipo de lesión o agravio y mecanismo de lesión o aumento de los síntomas, 90% para la variable calidad del reintegro a las actividades deportivas el 91,67% para las variables local anatómico y período de entrenamiento. Se concluye por lo tanto, que ha habido una elevada

  19. Genetic variation within the olive ( Olea europaea L. ) cultivar Oblica ...

    African Journals Online (AJOL)

    Oblica is the predominant olive cultivar in Croatia, spread widely in all the olive growing regions. Morphological variability within the cultivar is well documented but often it has been attributed to environmental factors rather than to genetic ones. In order to investigate intracultivar variability on the molecular level, olive ...

  20. Heavy metal accumulation in under crown Olea europaea L forest ...

    African Journals Online (AJOL)

    Heavy metal concentration in plants increased in site irrigation with wastewater. Zn, Pb and Ni exceeded their permitted limits in soils and Pb, Cr and Ni exceeded their permitted limits in roots of plants irrigated with wastewater. It was concluded that the use of wastewater in urban forest enriched the soils with heavy metals ...

  1. Genetic variation within the olive (Olea europaea L.) cultivar Oblica ...

    African Journals Online (AJOL)

    USER

    2010-05-17

    May 17, 2010 ... 1Institute for Adriatic Crops and Karst Reclamation Split, Put Duilova 11, 21000 Split, Croatia. 2Science and Research Centre of Koper, University of Primorska, Garibaldijeva 18, 6000 Koper, Slovenia. 3University of Zagreb, Faculty of Agriculture, Svetosimunska 25, 10000 Zagreb, Croatia. 4University of ...

  2. Flowering in the wild olive ( Olea europaea L.) tree (oleaster ...

    African Journals Online (AJOL)

    flowers with absence or reduced stamens and flowers with absence of pistil) are frequently observed and may reduce fruit set. This study investigates the phenology evolution and the male and female abortion of the oleaster tree (or the wild olive ...

  3. Mycorrhizal status of Olea europaea spp. oleaster in Morocco

    African Journals Online (AJOL)

    SARAH

    2013-01-31

    Jan 31, 2013 ... Physico-chemical analyzes of soil: The main physicochemical soils characteristics (pH, electrical conductivity, organic matter, carbon, nitrate, Nitrogen, ammoniacal nitrogen, mineral nitrogen, phosphore and potassium) were determined by conventional analyzes performed by the soil analysis laboratory of ' ...

  4. Comparative molecular analysis of old olive ( Olea europaea L ...

    African Journals Online (AJOL)

    We compared the genetic profiles of six old olive cultivars from an Eastern Mediterranean Region of Turkey to 15 modern Turkish olive cultivars from different geographical origins. The RAPD profiles successfully clarified the molecular relationships among the genotypes tested. Seventeen RAPD primers generated 153 ...

  5. Factors influencing phenolic compounds in table olives (Olea europaea).

    Science.gov (United States)

    Charoenprasert, Suthawan; Mitchell, Alyson

    2012-07-25

    The Mediterranean diet appears to be associated with a reduced risk of several chronic diseases including cancer and cardiovascular and Alzheimer's diseases. Olive products (mainly olive oil and table olives) are important components of the Mediterranean diet. Olives contain a range of phenolic compounds; these natural antioxidants may contribute to the prevention of these chronic conditions. Consequently, the consumption of table olives and olive oil continues to increase worldwide by health-conscious consumers. There are numerous factors that can affect the phenolics in table olives including the cultivar, degree of ripening, and, importantly, the methods used for curing and processing table olives. The predominant phenolic compound found in fresh olive is the bitter secoiridoid oleuropein. Table olive processing decreases levels of oleuropein with concomitant increases in the hydrolysis products hydroxytyrosol and tyrosol. Many of the health benefits reported for olives are thought to be associated with the levels of hydroxytyrosol. Herein the pre- and post-harvest factors influencing the phenolics in olives, debittering methods, and health benefits of phenolics in table olives are reviewed.

  6. Olea europaea Linn (Oleaceae) Fruit Pulp Extract Suppresses Sterol ...

    African Journals Online (AJOL)

    regarded as an energy sensor in most tissues. AMPK regulates cellular lipid metabolism by increasing ... cells relative to that of control vehicle-treated cells. Nile red stain test. Human HepG2 hepatocytes .... assay and expressed as percentage of the vehicle controls. Data expressed are means ± SD of three independent ...

  7. Hydrophilic C terminus of Salicornia europaea vacuolar Na/H ...

    Indian Academy of Sciences (India)

    Plant vacuolar Na+/H+ antiporters play important roles in cellular ion homeostasis,vacuolar pH regulation and sequestration of Na+ ions into the vacuole. Previous research showed that hydrophilic C-terminal region of Arabidopsis AtNHX1 negatively regulates the Na+/H+ transporting activity. In this study, we truncated the ...

  8. Olea europaea Linn (Oleaceae) Fruit Pulp Extract Exhibits Potent ...

    African Journals Online (AJOL)

    HP

    expression and tumor necrosis factor-alpha (TNF-α) production were measured using enzyme-linked immunosorbent assay (ELISA) and Western blot analysis. Results: OFP-EA extract significantly (p<0.001 at 20-200 µg/ml, respectively) scavenged the free radicals in a dose-dependent fashion. The increased levels of No ...

  9. Experimental measurement of the biomass of Olea europaea L ...

    African Journals Online (AJOL)

    The C stock evaluation methodology made in this research and the calculation of biomass expansion factor can be considered as the first scientific contribution in estimating productivity, CO2 sequestration, carbon stocks and yield of olive groves. Key words: Biomass, biomass expansion factor, Intergovernmental Panel on ...

  10. Multiplicação in vitro de oliveira (Olea europaea L. Olive (Olea europaea L. in vitro multiplication

    Directory of Open Access Journals (Sweden)

    Leonardo Ferreira Dutra

    2004-02-01

    Full Text Available Com o objetivo de induzir a multiplicação em explantes de oliveira, segmentos nodais oriundos de plântulas mantidas in vitro foram excisados e inoculados em tubos de ensaio contendo meio de cultura MS suplementado com 2 g L-1 de carvão ativado, BAP (0, 1, 2 e 4 mg L-1 e ANA (0; 0,01; 0,1 e 1 mg L-1, solidificado com 6 g L-1 de ágar e pH ajustado para 5,8. Durante 100 dias, os explantes foram mantidos em sala de crescimento a 25±1ºC, intensidade luminosa de 32 µmoles.m-2.s-1 e fotoperíodo de 16 horas. Não houve indução de brotações nos segmentos nodais. O maior comprimento da parte aérea foi obtido com 0,1 mg L-1 de ANA na ausência de BAP. O meio de cultura sem BAP proporcionou maior peso de matéria fresca da parte aérea.This work had the objective to induce olive multiplication. Nodal segments from in vitro plantlets were excised and inoculated in test tubes containing MS culture medium supplemented with activated charcoal (2 g L-1, BAP (0, 1, 2 and 4 mg L-1, NAA (0; 0.01; 0.1 and 1 mg L-1, agar (6 g L-1 and pH adjusted to 5.8. The explant were maintained in growth room to 25±1°C, 32 µmoles.m-2.s-1 light intensity and 16 hours photoperiod for 100 days. There was not shoots induction in the nodal segments. Larger length of aerial part were obtained with ANA 0.1 mg L-1 in the BAP absence. Culture medium without BAP provides larger weight of fresh matter of the aerial part.

  11. CONSENTIMIENTO INFORMADO EN LA PRÁCTICA CLINICA: RETOS DEL PERSONAL DE SALUD

    Directory of Open Access Journals (Sweden)

    Francisco Javier Bonilla Escobar

    2013-08-01

    Full Text Available El consentimiento informado es una herramienta cotidiana en la práctica clínica; para comprenderlo se requiere de un proceso formativo y académico que genere las actitudes para proponer consentimientos informados éticamente aceptables y que estos abarquen la perspectiva del paciente. El consentimiento requiere de un uso adecuado y de su entendimiento por parte del paciente como del profesional de salud que lo administra, siendo de utilidad ética y legal, motivo por el cual no debe ser subestimado. Es importante que dicho conocimiento implique en forma clara el reconocimiento tanto del médico como del paciente de la(s intervención(es, de las posibles consecuencias y situaciones a las que pudiera estar expuesto. Este artículo es una revisión al respecto del consentimiento informado, partiendo de su historia, evolución e implicaciones para el personal de la salud en general, con el objetivo de orientar e informar sobre su uso y evolución en la práctica clínica. El área bioética y los temas concernientes al consentimiento informado son necesidades de difusión e investigación en Latinoamérica para la protección del paciente y la buena práctica del personal de salud.

  12. Radio sterilized human ligaments and their clinical application;Ligamentos humanos radioesterilizados y su aplicacion clinica

    Energy Technology Data Exchange (ETDEWEB)

    Luna Z, D.; Reyes F, M. L. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Diaz M, I.; Hernandez R, G., E-mail: daniel.luna@inin.gob.m [Centro Estatal de Trasplantes del Estado de Mexico, Pablo Sidar No. 602, Col. Universidad, 50130 Toluca, Estado de Mexico (Mexico)

    2009-10-15

    The ligaments are human tissues that are used in the transplantation area. A ligament is an anatomical structure in band form, composed by resistant fibers that connect the tissues that unite the bones with the articulations. In an articulation, the ligaments allow and facilitate the movement inside the natural anatomical directions, while it restricts those movements that are anatomically abnormal, impeding lesions that could arise of this type of movements. The kneecap ligament is a very important tissue in the knee mobility and of walking in the human beings. This ligament can injure it because of automobile accidents, for sport lesions or illnesses, and in many cases the only form of recovering the knee movement is carried out a transplant with the purpose of replacing the damage ligament by allo gen kneecap ligament processed in specialized Tissue Banks where the tissue is sterilized with gamma radiation of {sup 60}Co at very low temperatures, obtaining high quality ligaments for clinical application in injured patients. The kneecap ligaments are processed in the Tissue Banks with a segment of kneecap bone, a segment of tibial bone, the contained ligament between both bones and in some cases a fraction of the quadriceps tendon. In this work is given a description of the selection method of the tissue that includes the donor's serologic control, the kneecap ligament processing in the Radio Sterilized Tissues Bank, its sterilization with gamma radiation of {sup 60}Co, also it is indicated like the clinical application of the allo gen ligament was realized in a hasty patient and whose previous crossed ligament was injured. Finally the results are presented from the tissue obtaining until the clinical application of it is, and in this case is observed a favorable initial evolution of the transplantation patient. (Author)

  13. Guías clinicas de RCP y SRI enfermería

    OpenAIRE

    Donis Mulero, Elena

    2015-01-01

    La reanimación cardiopulmonar (RCP) es un procedimiento de emergencia para salvar vidas que se lleva a cabo cuando una persona se encuentra en parada cardiorrespiratoria (PCR). Tanto la técnica de RCP como la de intubación, son aspectos olvidados por los profesionales de la salud. Recopilar las últimas recomendaciones sobre RCP para poder elaborar un programa sencillo enfocado a la enfermería. Elaborar una guía sencilla de secuencia rápida de intubación (SRI). Revisión bibliográfica en la que...

  14. Etiologic agents of surface mycoses isolated at Laboratorio de Micologia Clinica from Universidad del Cauca

    Directory of Open Access Journals (Sweden)

    Emilse Folleco

    2014-04-01

    Full Text Available Introduction: Superficial fungal infections affect 20 % to 25 % of the world’s population with an increase on its incidence. They are caused by endogenous and exogenous fungi in presence of an alteration of the protective mechanisms of the skin. Objectives: To determine the most common etiologic agents, characterize the patients, describe the type of injury and determine the risk factors associated with superficial mycoses. Methods: Prospective cross-sectional study conducted between January 2008 and December 2010; samples were taken from 136 patients who met the inclusion criteria defined samples of skin lesions and nail for KOH and fungal culture were collected and a structured survey for clinical and associated risk factors was applied. Results: Cultures and KOH were positive in 41.9% of samples; the most frequently isolated fungi were Trichophyton interdigitale 12.5%, Trichophyton rubrum (8.8% and Candida albicans (7.4%. Regarding patients, 61% of patients were female and 39 % male, the largest percentage were aged between 21 to 30 years (20.6%, with varied occupations as students (35.3%, housewives (16.9%, traders (14.7%, being affected the feet (35.2 % and hallux toenail (22.7 %. Risk factors were statistically significant prior use of antifungal, corticosteroid use and share objects like slippers. Conclusion: This study found that superficial mycoses are mainly due to fungi of the normal flora of the skin. Sharing personal care items facilitates dispersion of the infective forms of this group fungus as interpersonal. A high percentage of patients used empirical treatments without mycological diagnosis, which may facilitate fungal resistance to commonly used antifungal. Knowledge of risk factors is important for the prevention of fungal infections and mycological studies are essential for effective treatment.

  15. Avaliação clinica comparativa entre duas tecnicas de tratamento radicular na terapia periodontal

    OpenAIRE

    Lucio Flavio Teixeira Damis

    2000-01-01

    Resumo: Este estudo clínico teve como proposição comparar dois tipos de terapia para o tratamento da doença periodontal. A terapia tradicional que utiliza a raspagem e alisamento radicular com curetas manuais ­ grupo controle - e a terapia alternativa que propõe apenas destacar os cálculos usando curetas manuais e escovar a superficie radicular com solução iodada a 2% - grupo teste. Foram selecionados para cada grupo 40 faces de dentes unirradiculares com bolsas periodontais supra­ ósseas, co...

  16. Triage e regole di supporto della decisione clinica nel paziente politraumatizzato veterinario

    OpenAIRE

    Foglia, Armando

    2017-01-01

    Il trauma è spesso causa di lesioni anche mortali nel cane e nel gatto. Numerosi sono i fattori in grado di influenzare la sopravvivenza e in medicina umana, diversamente dalla medicina veterinaria, sono disponibili numerosi sistemi di valutazione del paziente politraumatizzato. Questi permettono di determinare la necessità di trattamenti specialistici ed identificare i pazienti ad alto rischio di complicazioni o morte. Tali informazioni potrebbero essere utili anche per il paziente veterinar...

  17. Possibilities of radiographic digitalisation in dental clinics; Possibilidades de digitalizacao radiografica na clinica odontologica

    Energy Technology Data Exchange (ETDEWEB)

    Zenobio, Madelon A.F. [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), Belo Horizonte, MG (Brazil); Zenobio, Elton Goncalves [Pontificia Univ. Catolica de Minas Gerais, Belo Horizonte, MG (Brazil)

    2002-07-01

    In the evolution diagnostic processes by image, the improvement of the intrabucal radiographic sensibility generated and digitalized is today, of great expressiveness in the evolution and effectiveness in the odontological area. This methodology applicability as a possibility of a more precise and accurate diagnostic formulation among other advantages, justifies this technique use. This paper intends to, thorough the literature magazine and clinic case presentations to show its applicability in the daily odontological clinic, and specially, in the periodonty area. (author)

  18. Evaluation of the adhesion to the vaccunation scheme regime mass immunization plan in Clinica Infantil Colsubsidio

    Directory of Open Access Journals (Sweden)

    Angélica María Montañéz Mancera

    2007-06-01

    Full Text Available Background. The human being has tried tofind solid protection against infectious diseases,hence, vaccination was sought as the most important milestone public health intervention forcommunicable diseases. In this context, and injoint action with world nations, the MassImmmunization Plan was created in order toreach the control and eradication of the abovementioned diseases.Materials and Methods. A descriptive, retrospectivestudy was conducted. Primary datawas drawn from children under 6-year-old ofage as users of the program of Promotion, Educationand Prevention (PEP at the Clínica InfantilColsubsidio in Bogotá, Colombia, and those attendedat the vaccination center of the abovementioned institution between January 1 andDecember 31, 2005.Results. 7.686 children under 6-year-oldwere registered in the information data base atthe Vaccination Center of Clínica InfantilColsubsidio. 65,75 % complied with the vaccinationscheme regimen according to age,whereas 34,23 % had still an incomplete schemeregimen. Children between 6 months and 2 yearsof age represent the most affected group withincomplete scheme regimen (19,87 %. 30.984was the total amount of vaccines applied duringthis specific period.Conclusions. This preliminary study showfigures which raise concern dealing vaccinationcoverage. However, shows existing failure tofulfill comprehensive vaccination scheme regime,besides the need of forther strengtheningthe program of promotion, education and preventionPEP that is realized at the health networkof Colsubsidio.

  19. Non-Transfusional Hemocomponents: From Biology to the Clinic-A Literature Review.

    Science.gov (United States)

    Gasparro, Roberta; Qorri, Erda; Valletta, Alessandra; Masucci, Michele; Sammartino, Pasquale; Amato, Alessandra; Marenzi, Gaetano

    2018-03-31

    Non-transfusional hemocomponents for surgical use are autogenous products prepared through the centrifugation of a blood sample from a patient. Their potential beneficial outcomes include hard and soft tissue regeneration, local hemostasis, and the acceleration of wound healing. Therefore, they are suitable for application in different medical fields as therapeutic options and in surgical practices that require tissue regeneration.

  20. Miastenia grave: avaliação clinica e terapêutica de 55 casos

    Directory of Open Access Journals (Sweden)

    Lineu Cesar Werneck

    1987-12-01

    Full Text Available Foram estudados 55 casos de miastenia grave, avaliando os sinais e sintomas clínicos que ocorreram no início e na evolução dos pacientes, bem como os procedimentos diagnósticos e avaliação das medidas terapêuticas utilizadas. No manejo dos pacientes foram utilizados anticolinesterásicos, corticoesteróides, azathioprina, plasmaferese e timectomia, sem que fosse possível encontrar relação estatística significante entre os diferentes procedimentos com respeito à resolução da doença. Dos 55 casos, 9 (16,6% obtiveram remissão total, 41 (74,5% permaneceram com a doença ativa necessitando de tratamento sintomático e 5 (9.09% faleceram. Houve relação estatística significante entre os sinais de insuficiência respiratória, crises miastênicas e timoma somente no grupo de pacientes que faleceram (um por insuficiência respiratória restritiva secundária a cifoescoliose severa, três com timoma e um caso durante a timectomia.

  1. MR cholangio pancreatography: clinical applications; Colangiopancreatografia por ressonancia magnetica: aplicacoes clinicas

    Energy Technology Data Exchange (ETDEWEB)

    D`Ippolito, Giuseppe; Galvao Filho, Mario; Jesus, Paulo Eduardo Marinho de; Wolosker, Angela; Borri, Maria Lucia [Hospital Sao Luiz, Sao Paulo, SP (Brazil). Centro Diagnostico

    1998-05-01

    MR cholangio-pancreatography (MRCP) has been replacing diagnostic conventional cholangio-pancreatography. MRCP is a new, noninvasive and rapidly evolving technique for imaging diseases of the biliary tree and pancreatic ducts. Images are obtained without administration of oral or intravenous contrast. Our objective is to demonstrate the main clinical applications of MPCP, its limits and advantages over other methods. In our series of 60 patients we have detected choledocholithiasis, sclerosing cholecystitis, chronic pancreatitis, pancreatic and ampullary tumors. (author) 16 refs., 14 figs.

  2. Fracture liaison service in a non-regional orthopaedic clinic--a cost-effective service.

    LENUS (Irish Health Repository)

    Ahmed, M

    2012-01-01

    Fracture liaison services (FLS) aim to provide cost-effective targeting of secondary fracture prevention. It is proposed that a dedicated FLS be available in any hospital to which a patient presents with a fracture. An existing orthopaedic clinic nurse was retrained to deliver a FLS. Proformas were used so that different nurses could assume the fracture liaison nurse (FLN) role, as required. Screening consisted of fracture risk estimation, phlebotomy and DXA scanning. 124 (11%) of all patients attending the orthopaedic fracture clinic were reviewed in the FLS. Upper limb fractures accounted for the majority of fragility fractures screened n=69 (55.6%). Two-thirds of patients (n=69) had reduced bone mineral density (BMD). An evidence based approach to both non-pharmacological and pharmacotherapy was used and most patients (76.6%) receiving pharmacotherapy received an oral bisphosphonate (n=46). The FLS has proven to be an effective way of delivering secondary prevention for osteoporotic fracture in a non-regional fracture clinic, without increasing staff costs.

  3. Campylobacteriosi nel perugino nel primo biennio del nuovo secolo: alcuni aspetti e considerazioni di microbiologia clinica

    Directory of Open Access Journals (Sweden)

    Daniele Crotti

    2004-03-01

    Full Text Available 794 faecal specimens of outpatients with enteritis during 2001-02 were examined for pathogens. Campylobacter jejuni/coli (14.2% and Salmonella spp (15.1% prevailed among bacteria. 3 strains of Arcobacter butzleri were isolated too (0.4%. C. jejuni prevailed (85.7% in respect of C. coli (11.8% and A. butzleri (2.5%, as in children as in adults. C. jejuni biotype 1 was prevalent (68.6% in respect of C. jejuni b. 2 (29.4% or C. jejuni b. 3 (2.0%; also C. coli b. 1 prevailed (78.6%.The average of infected people was 4 years for children (0-14 years old and 48 for adults, with a range between 3 moths and 84 years. Regarding patterns of resistance to antibiotics, were observed 6.7% of resistance (R to erytromycin, 49.5% to norfloxacin (and similar quinolones, 37.8% to tetracycline, 31.1% to minocycline, 1.7% to amoxicyllin + clavulanate, 0.8% to gentamycin and chloramphenicole. No particular correlations were observed between age, sex, clinical findings and species or biotype of isolated Campylobacter. Concluding, the filter membrane technique is preferable for isolating these spirilla, the identification of genus and species could be rational, macrolides are always the first choice molecules for therapy when mandatory.

  4. Two patients walk into a clinic...a genomics perspective on the future of schizophrenia

    LENUS (Irish Health Repository)

    Corvin, Aiden P

    2011-11-11

    Abstract Progress is being made in schizophrenia genomics, suggesting that this complex brain disorder involves rare, moderate to high-risk mutations and the cumulative impact of small genetic effects, coupled with environmental factors. The genetic heterogeneity underlying schizophrenia and the overlap with other neurodevelopmental disorders suggest that it will not continue to be viewed as a single disease. This has radical implications for clinical practice, as diagnosis and treatment will be guided by molecular etiology rather than clinical diagnostic criteria.

  5. SOPORTE SOCIAL Y FAMILIAR: EXPERIENCIAS CON FAMILIAS DE PACIENTES ATENDIDOS EN UNA CLINICA UNIVERSITARIA

    Directory of Open Access Journals (Sweden)

    María Eugenia Agudelo Bedoya

    2016-08-01

    Full Text Available Este artículo está basado en una investigación realizada sobre problemáticas familiares de 133 pacientes interconsultados y atendidos por Trabajo Social en los servicios de internación de la Clínica Universitaria Bolivariana (CUB entre febrero-julio de 2013.1 Se utilizó un diseño mixto, integrando aspectos cuantitativos y cualitativos para describir las familias, variables de la atención ofrecida por trabajo social y la manera como se organizaban las familias para el cuidado del paciente en su hospitalización. Se encontraron varias configuraciones familiares, un porcentaje alto atravesando ciclo vital de adulto o anciano. El mayor número de remisiones corrieron por cuenta del médico internista y correspondieron a situaciones catalogadas por trabajo social como “problemas relacionados con otros hechos estresantes que afectan la familia”. El tipo de intervención en el que fueron atendidas fue el acompañamiento. Algunas de las familias, encontraron soporte entre sus miembros, amigos, vecinos, cuidadores formales e informales y en instituciones que por su competencia deben brindarlo. La ausencia de estos apoyos se constituye el principal motivo de remisión a trabajo social.

  6. Two patients walk into a clinic...a genomics perspective on the future of schizophrenia

    Directory of Open Access Journals (Sweden)

    Corvin Aiden P

    2011-11-01

    Full Text Available Abstract Progress is being made in schizophrenia genomics, suggesting that this complex brain disorder involves rare, moderate to high-risk mutations and the cumulative impact of small genetic effects, coupled with environmental factors. The genetic heterogeneity underlying schizophrenia and the overlap with other neurodevelopmental disorders suggest that it will not continue to be viewed as a single disease. This has radical implications for clinical practice, as diagnosis and treatment will be guided by molecular etiology rather than clinical diagnostic criteria.

  7. A clinica como pratica arborifica e rizomorfica do trabalho em enfermagem cirurgica

    Directory of Open Access Journals (Sweden)

    Lenice Dutra de Sousa

    2013-12-01

    Full Text Available Foi realizada uma pesquisa qualitativa e exploratória, na forma de um estudo de caso, em uma unidade de internação cirúrgica de um hospital universitário, que objetivou analisar o trabalho do enfermeiro sob a ótica da produção de cuidados em saúde e do exercício da clínica. Os sujeitos do estudo foram seis enfermeiros e foram realizadas observações não participantes, pesquisa documental e entrevistas em profundidade com posterior análise textual discursiva. Verificou-se que o trabalho da enfermagem é organizado segundo duas perspectivas interconectadas e interdependentes: a do modelo clínico, que compõe a estrutura-mestre de sua prática, e uma estrutura composta por elementos múltiplos e heterogêneos. O modelo clínico de assistência organiza-se como uma estrutura centrada que possibilita a resolutividade das necessidades biológicas e atua como base para a conexão de outros saberes e práticas que expandem o fazer do enfermeiro por meio de interligações com o ambiente.

  8. Miastenia grave: avaliação clinica e terapêutica de 55 casos

    OpenAIRE

    Werneck, Lineu Cesar; Teive, Hélio A. Ghizoni

    1987-01-01

    Foram estudados 55 casos de miastenia grave, avaliando os sinais e sintomas clínicos que ocorreram no início e na evolução dos pacientes, bem como os procedimentos diagnósticos e avaliação das medidas terapêuticas utilizadas. No manejo dos pacientes foram utilizados anticolinesterásicos, corticoesteróides, azathioprina, plasmaferese e timectomia, sem que fosse possível encontrar relação estatística significante entre os diferentes procedimentos com respeito à resolução da doença. Dos 55 casos...

  9. Corrimentos vaginais em gestantes: comparacao da abordagem sindromica com exames da pratica clinica da enfermagem

    Directory of Open Access Journals (Sweden)

    Thais Marques Lima

    2013-12-01

    Full Text Available Estudo avaliativo de abordagem quantitativa, com amostra de 104 gestantes, com o objetivo de comparar os achados de infecções vaginais em gestantes obtidos por meio do fluxograma de corrimento vaginal com exames presentes na prática clínica da Enfermagem. Os dados foram coletados por meio de entrevista e exame ginecológico realizados de janeiro a julho de 2011. O fluxograma não se mostrou eficaz na identificação de candidíase e tricomoníase, apresentou baixa sensibilidade (0,0%; 50% e valor preditivo positivo (0,0%; 3,6% para as duas infecções e baixa especificidade para tricomoníase (46%. Mostrou-se satisfatório para vaginose bacteriana, com alta sensibilidade (100%, valor preditivo negativo (100% e acurácia (74%. Conclui-se que o emprego do fluxograma precisa ser reavaliado, visto que não foi eficaz em identificar infecções importantes em gestantes. Os esforços para o desenvolvimento de testes eficazes devem ser contínuos, com intuito de prevenir a disseminação de infecções e reduzir tratamentos desnecessários.

  10. Coronary CT: clinical indications and future directions; Tomografia de coronarias: indicacoes clinicas e perspectivas futuras

    Energy Technology Data Exchange (ETDEWEB)

    Nomura, Cesar H.; Serpa, Bruna S.; Kay, Fernando U.; Szarf, Gilberto; Passos, Rodrigo B.; Neto, Roberto S.; Chate, Rodigo C.; Funar, Marcelo B., E-mail: cesarnomura@gmail.com [Hospital Israelita Albert Einstein, Sao Paulo, SP (Brazil); Cury, Roberto C. [Hospital Samaritano, Sao Paulo, SP (Brazil)

    2011-01-15

    Multidetector computed tomography (MDCT) has started its implementation in cardiology with calcium quantification of coronary plaques in the study without contrast, using the calcium score, demonstrating an important independent predictor of future cardiac events. The examination with intravenous contrast, coronary angiography, appeared later as a noninvasive method for evaluation of anatomy and obstructive coronary disease, characterizing the degree of stenosis and the presence of non calcified atherosclerotic plaques, assessing not only the lumen, but also the vessel wall. With the advent of new machines with more detectors and higher temporal resolution has been a reduction in radiation dose and the possibility of new applications. (author)

  11. Savoirs paysans autour des huiles d’olive, (zaytun, Olea europaea var. europaea) et d’oléastre, (əl-bərri, Olea europaea var. sylvestris) Rif, nord du Maroc

    OpenAIRE

    Aumeeruddy-Thomas, Yildiz; Caubet, Dominique

    2017-01-01

    Dans cet article, nous nous intéressons centralement aux produits de l’olivier et de l’oléastre du Nord du Maroc, aux modalités techniques d’obtention de différents types d’huile et ce que ces produits représentent pour les habitants. Il s’agit de comprendre si le Rif détient une particularité sur ce sujet. Nous suggérons que ces techniques et les savoirs et savoir-faire sur les huiles ont pu influencer des processus pré-domesticatoire et de création variétale dans le nord du Maroc. Nous cher...

  12. [The ECCIS study: the epidemiology and clinical picture of silent ischemic cardiopathy. Epidemiologia e Clinica della Cardiopatia Ischemica Silente].

    Science.gov (United States)

    Fazzini, P F; Prati, P L; Rovelli, F; Antoniucci, D; Menghini, F; Seccareccia, F; Menotti, A

    1994-12-01

    The ECCIS project (Epidemiology and Clinic of Silent Ischemic Heart Disease) is an italian epidemiological study based on a population sample of 4,842 totally asymptomatic men aged 40-59 whose primary aim is the evaluation of the prevalence of totally silent myocardial ischemia and silent myocardial infarction. The systemic search for markers of silent ischemia and infarction was pursued along 3 screening stages: the 1st stage included resting electrocardiogram, hyperventilation test, exercise electrocardiogram and 24-hour Holter electrocardiogram; the 2nd stage included echocardiogram, thallium-201 scintigraphy in conjunction with exercise test or dypiridamole test, exercise radionuclide ventriculography and ergometrine test; the 3rd stage included coronary angiography. After the completion of the 1st stage procedures 439 men (9.1%) with abnormal results and low probability of disease were invited to the 2nd stage and 387 accepted to undergo the diagnostic procedures. After the completion of the 2nd stage, 104 men with moderate or high suspicion of silent myocardial ischemia or infarction were invited to perform coronary angiography but only 62 men accepted to undergo the 3rd stage procedures (participation rate 59.6%). The final diagnosis of totally silent myocardial ischemia or infarction on the basis of predefined criteria was established in 25 patients. The prevalence of silent ischemic heart disease on the overall original 4,842 men was 0.52% (95% CL, 0.32 and 0.72%), while the final estimate after adjusting for participation rates at 2nd and 3rd stages was 0.89% (95% CL, 0.6 and 1.1%). The results of the ECCIS study show that the prevalence of silent myocardial ischemia is definitely lower than that revealed by prior epidemiological studies in Norway and in USA.

  13. Actinomicose cerebral: observação anatomo-clinica e revisão da literatura brasileira

    Directory of Open Access Journals (Sweden)

    Luciano de Souza Queiroz

    1975-12-01

    Full Text Available Os autores relatam a observação anátomo-clínica de um paciente de 33 anos, com síndrome de hipertensão intracraniana e hemiparesia à direita. O líquido cefalorraqueano revelava discreta hipercitose linfomonocitária. A autópsia mostrou três abscessos cerebrais, com edema difuso mais intenso no hemisfério cerebral esquerdo, sem leptomeningite purulenta. O exame histopatológico demonstrou grãos actinomicóticos nos abscessos cerebrais e pulmonares. A literatura brasileira sobre neuroactinomicose é analisada, com encontro de seis casos, publicados entre 1934 e 1946. São discutidos aspectos clínicos e anátomo-patológicos relevantes dos casos nacionais.

  14. Leitura rapida do KDIGO 2012: Diretrizes para avaliacao e manuseio da doenca renal cronica na pratica clinica

    Directory of Open Access Journals (Sweden)

    Gianna Mastroianni Kirsztajn

    2014-03-01

    Full Text Available Os autores desta "leitura rápida" apresentam os dados que consideraram mais relevantes na versão 2012 do KDIGO referente à avaliação e manuseio da doença renal crônica. Não se trata da opinião dos autores, mas sim de uma apresentação mais concisa das diretrizes, que podem ser úteis na prática clínica.

  15. Positron Emission Tomography (PET) in the oncologic clinical practice; Tomografia por Emision de Positrones (PET) en la practica clinica oncologica

    Energy Technology Data Exchange (ETDEWEB)

    Serna M, J.A.; Luviano, C.; Martinez V, D. [Hospital Angeles del Pedregal Mexico DF (Mexico); Maldonado S, A. [Centro PET Complutense, Madrid (Spain)

    2005-07-01

    We intended to determine the frequency with that the computer axial tomography (TAC), it was able to visualize the lesions extra neoplasia detected by the PET tomography in patients with fully identified primary malignant neoplasia. (Author)

  16. Frecuencia y tiempo promedio para la rehabilitación postendodontica en una Clinica Dental Docente Peruana

    OpenAIRE

    Oliveira-Ruiz, Gaby; Machicao-Chacon, Norka Giuliana; Hernández-Añaños, Juan Felipe

    2016-01-01

    Objetivo: Determinar la frecuencia del tipo de rehabilitación y tiempo promedio que pasa desde la obturación de los conductos radiculares y la rehabilitación postendodóntica en la clínica dental docente de la Facultad de Estomatologia de la Universidad Peruana Cayetano Heredia en el año 2012. Materiales y Métodos: Se revisaron historias clínicas de pacientes atendidos en el Pregrado y en el Postgrado en el año 2012. Muchas historias clínicas fueron excluidas, debido a que no especifi caba dat...

  17. Phyllodes tumor: clinical, radiological and pathological correlation in 50 cases; Tumor filodes: correlacion clinica, radiologica y anatomopatologica en 50 casos

    Energy Technology Data Exchange (ETDEWEB)

    Higueras, A.; Alvarez, M.; Jimenez, A.; Garcia Revillo, J.; Cano, A. [Hospital Universitario Reina Sofia. Cordoba (Spain)

    2000-07-01

    To review the radiological features of the phyllodes tumor, correlating them with the clinical presentation, histological type and response to treatment. Fifty phyllodes tumors in 29 patients aged 16 to 59 years (mean: 41 years) were analyzed retrospectively. The series included 12 cases of recurrence, 1 of bilateral tumor and 6 of multiple tumor. Forty-five lesions were studied by mammography and 36 by ultrasound. Clinically guided fine-needle aspiration cytology was performed in 8 cases. The pathological diagnosis was obtained by means of surgical biopsy in every case (31 benign and 19 malignant). Twenty-four patients underwent postoperative clinical and radiological follow-up for a mean period of 32 months. Mammography revealed the presence of a nodule or mass in 42 cases, asymmetrical density in two and a generalized increase in density in one: Multifocal lesions were detected in six cases. The size varied widely, with masses measuring >5 cm showing a greater probability of malignancy (p<0.01). Calcifications were observed in 13% of the cases. Ultrasound revealed the presence of heterogeneous, hypoechoic nodules, with cystic areas in five tumors, all of which were malignant (p<0.01). Local recurrence was detected in 31% of the cases and bone metastases in one. The phyllodes tumor is an uncommon fibroepithelial tumor that has a potential for recurrence and distant metastasis. Mammographic and ultrasound features are similar to those of the fibroadenoma, a lesion with which it is occasionally associated. Multiple lesions are not infrequent and it can present with calcifications. The presence of cystic areas and a tumor size of >5 cm are the only radiological findings that are statistically associated with malignancy. The recurrence rate is greater in malignant tumors than in benign lesions, especially in patients treated by tumor resection. (Author) 28 refs.

  18. Caracteristicas clinicas, laboratoriais e ultra-sonograficas de pacientes com trombose de veia porta na faixa etaria pediatrica

    OpenAIRE

    Roberto Massao Yamada

    2005-01-01

    Resumo: A trombose de veia porta (TVP) é uma condição rara que acomete crianças e adultos consistindo de uma obstrução extra-hepática da veia porta que, na maior parte das vezes, evolui com hipertensão portal (HP). Os conhecimentos a respeito da apresentação clínica e da investigação diagnóstica ainda não estão incorporados na rotina do conhecimento do pediatra geral, do gastroenterologista pediátrico e do ultra-sonografista. Dessa forma, o objetivo desse estudo foi analisar as característica...

  19. Análise clinica da espasticidade em indivíduos com lesão medular

    OpenAIRE

    Tancredo,Janaina Roland; Maria,Renata Manzano; Azevedo,Eliza Regina Ferreira Braga Machado de; Alonso,Karina Cristina; Varoto,Renato; Cliquet Junior,Alberto

    2013-01-01

    OBJETIVO: Avaliar o efeito da estimulação elétrica neuromuscular na espasticidade nos pacientes com lesão medular. MÉTODOS: Participaram do estudo onze sujeitos lesados medulares (C4 a T5). Foram utilizados para esta avaliação a escala modificada de Ashworth e o teste pendular, que foi realizado através do Dispositivo de Teste Pendular - DTP (o equipamento possui um acelerômetro de transdutores de cristais de quartzo e eletrogoniômetro de fibra óptica flexível que mede as tensões e os desloca...

  20. Vivencias emocionais de mulheres submetidas a cirurgia bariatrica no Hospital de Clinicas da Unicamp : um estudo clinico-qualitativo

    OpenAIRE

    Ronis Magdaleno Junior

    2009-01-01

    Resumo: Este estudo teve por objetivo compreender as vivências emocionais de mulheres obesas mórbidas submetidas à cirurgia bariátrica. A obesidade tornou-se, globalmente, um grave problema de saúde pública e, em função disto, tem crescido de modo expressivo o número de cirurgias bariátricas como opção de tratamento para a obesidade mórbida. Contudo, é um procedimento que implica em importantes modificações físicas e psicossociais para o paciente. Metodologia: Aplicamos o Método Clínico Quali...

  1. APRENDIZAJE COOPERATIVO SOBRE LA PRÁCTICA CLINICA EN ENFERMERÍA: EVALUACIÓN DE DOCENTES

    Directory of Open Access Journals (Sweden)

    María-Aurora Rodríguez Borrego

    2011-01-01

    Full Text Available El proyecto se desarrolló entre las Universidades de Córdoba y A Coruña en España y consistió en una experiencia de aprendizaje cooperativo intercultural e Interuniversitario con alumnos/as del primer curso de la Diplomatura de Enfermería que estaban realizando sus prácticas clínicas, con los objetivos de encontrar puntos de encuentro a la habitual distorsión entre teoría y práctica que detecta el alumnado cuando realiza sus primeras prácticas clínicas, trabajar en grupo cooperativo y ganar habilidad para la crítica y la autocrítica. Se presenta la evaluación de la experiencia por los docentes participantes con el modelo DAFO (Dificultades, Amenazas, Fortalezas y Oportunidades. Para los alumnos, el encuentro de la igualdad en la diferencia se constituyo en una gran oportunidad de aprendizaje, si bien contrastó con la dificultad de trabajar en grupo cooperativo. Como conclusión se puede decir que el método docente empleado mostró su efectividad y su dificultad.

  2. Recuperación Clinica Pero No Cognitiva En Esquizofrenia A Traves De La Experiencia Del Cine De Ficcion

    Directory of Open Access Journals (Sweden)

    J. Peña

    2015-12-01

    Discusión: Una intervención breve basada en actividades de la vida diaria puede ser transformada en herramienta eficaz de rehabilitación psiquiátrica. Sin embargo, con las características actuales y en la muestra de este estudio, la misma intervención no aportó beneficios en parámetros de cognición.

  3. Design and construction of ophthalmic simulators for clinical applications; Projeto e confeccao de simuladores oftalmicos para aplicacoes clinicas

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, Andrea

    2006-07-01

    This work presents a calculational methodology for dose determination in human eye structures, such as: sclera, choroid, retina, lens, vitreous body, optic nerve and disc, and cornea, as well as tumor due to treatment to the eye plaques. A human eye model was constructed taking into consideration its main structural and dimension characteristics. Beyond that a mathematical model for the Co-60 and 1-125 plaques with all geometric details were built employing the MCNP-4C code. This model is able to calculate the axial and radial doses in any point of the eye and for each of its structures. An acrylic eye simulator was also built with the aim to obtain experimental results for the both model validations. This simulator is made of an acrylic sphere split into foils of 1 mm thickness which allow the introduction of a radiographic film to measure the axial and radial doses. The experimental data were used to validate the MCNP-4C results. The data from the mathematical model will serve as the basis to build a data bank for all the eye structures allowing different position and sizes of tumor as well as the replacement of all ophthalmic plaques used in the treatment. This data bank will be the principal part for the construction of a national software for the dose calculation and can be of great help for a reliable treatment system planning in radiotherapy/brachytherapy. (author)

  4. Las experiencias clinicas de los estudiantes de enfermeria: Estudio de caso hacia la integracion de la mentoria

    Science.gov (United States)

    Rivera Rodriguez, Ivelisse

    Clinical experiences are an essential part of the training of future nursing professionals. The period of clinical experience aims to develop in the student the necessary skills to practice as a nursing professional, when the academic program ends. This case study aimed to understand the opinion and explore the perception of faculty, clinical instructors, and nursing students on the meaning, contributions and challenges presented during clinical experiences. Among the themes explored in the focus groups were the meaning and importance to learning about the profession of clinical experiences, teaching strategies used during the practice scenarios, didactic relationships developed among students, clinical instructors, and teachers. The goal was to learn from all participants about what they do, their expectations, and the challenges presented during the clinical experiences. A qualitative, descriptive and contextual research design was followed, which required conducting six focus groups to collect the information from the perspective of all the participants. Faculty, clinical instructors, and nursing students participated each in two focus groups. Collected data were transcribed, coded and analyzed in order to organize it under themes related to the research framework. The qualitative analysis of the focus groups revealed that nursing faculty and clinical instructors perceived clinical experiences as a very important element in the training of nursing students, but that coordination between the academy and practice scenarios is disconnected and needs improvement. They also expressed that they use various learning strategies during the clinical experiences, however, they recognize it needs more structure and suggested mentoring as a strategy to consider. They affirmed that mentoring could contribute positively to enhance the teaching-learning process. Clinical instructors understand they perform mentoring roles, but they would like to have a more defined role and structured process. Nursing students, also, recognized the importance of clinical experiences in their professional training. They expressed the need to improve the communication between the academy and the practice scenarios in order to reduce the levels of anxiety they experience when entering the clinical experiences. Nursing students also expressed the need to consider the use of different teaching strategies, such as mentoring, to improve clinical experiences.

  5. Selection, processing and clinical application of muscle-skeletal tissue; Seleccion, Procesamiento y Aplicacion Clinica de Tejido Musculo-Esqueletico

    Energy Technology Data Exchange (ETDEWEB)

    Luna Z, D.; Reyes F, M.L.; Lavalley E, C.; Castaneda J, G. [ININ, Carretera Mexico-Toluca s/n, 52750 La Marquesa, Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: dlz@nuclear.inin. mx

    2007-07-01

    Due to the increase in the average of the world population's life, people die each time to more age, this makes that the tissues of support of the human body, as those muscle-skeletal tissues, when increasing the individual's age go weakening, this in turn leads to the increment of the illnesses like the osteoporosis and the arthritis, that undoubtedly gives as a result more injure of the muscle-skeletal tissues joined a greater number of traffic accidents where particularly these tissues are affected, for that the demand of tissues muscle-skeletal for transplant every day will be bigger. The production of these tissues in the Bank of Radio sterilized Tissues, besides helping people to improve its quality of life saved foreign currencies because most of the muscle-skeletal tissues transplanted in Mexico are of import. The use of the irradiation to sterilize tissues for transplant has shown to be one of the best techniques with that purpose for what the International Atomic Energy Agency believes a Technical cooperation program to establish banks of tissues using the nuclear energy, helping mainly to countries in development. In this work the stages that follows the bank of radio sterilized tissues of the National Institute of Nuclear Research for the cadaverous donor's of muscle-skeletal tissue selection are described, as well as the processing and the clinical application of these tissues. (Author)

  6. L’emergenza della resistenza batterica agli antibiotici e il suo impatto sul laboratorio di microbiologia clinica*

    Directory of Open Access Journals (Sweden)

    Pietro E. Varaldo

    2003-03-01

    Full Text Available Le riflessioni qui riportate sono state elaborate, in parte, in occasione di riunioni dell’AMCLI Marche (Jesi, 19.10.2001 e del Comitato AMCLI per lo Studio degli Antibiotici (CoSA (Milano, 11.12.2001 e Firenze, 11.4.2002 e, in parte, in un Leading Article su Journal of Antimicrobial Chemotherapy (Varaldo PE.Antimicrobial resistance and susceptibility testing: an evergreen topic. J.Antimicrob. Chemother. 2002; 50: 1-4.

  7. La day surgery centralizzata: l’appropriatezza clinica e organizzativa come leva di creazione di valore sanitario

    Directory of Open Access Journals (Sweden)

    Bruno Vogliolo

    2001-12-01

    Full Text Available In the last years Public Health Service has been trying to find out solutions in order to improve its health value added creation capacity. The implementation of the Day-surgery division mainly aims to follow that direction, since it enables the improvement of the ratio between efficacy, quality and healthcare suitability and on the other hand efficiency, costs and modality of better resources utilization. The centralization of Day-surgery activities proposes some innovative characteristics, concerning that it introduces an organizational model focused on needs and it performs the separation of the clinic and therapeutic activities from the ones involving the assistance. Both economic and qualitative advantages deriving from the changes stand out in term of: - high possibility of activities’ scheduling; - improved customer satisfaction; - rationalisation of day-hospital recovery, with positive effects on the inpatients; - improved hospital economic stability. This study was carried out with the support of the multiple-skill group composed of doctors, nurses, administrative staff as well as experts in the field of organisation with an aim to provide the full outline of the necessary competences. The proposed discussion reflects the multidisciplinary view of the problem and different perspectives. Each of them regards particular aspects and implications indicated as following: - clinical perspective, related to the possibility of day-surgery interventions both from the medical and the anaesthetic point of view; - organisational perspective, which refers to the possible day-surgery models in conjunction with the organisational model and their peculiarities; - operative perspective, which consist of the analysis of the ideal structural dimension, flows of activities among all services involved and the analysis of the productive capability; (number of necessary beds, staff dimension and a relapse of the operation activities needs; - economic perspective, focused mainly to provide the final valuation on the capacity of the project to contribute to the improvement of the hospital.

  8. Clinical, radiographic and scintigraphic aspects of the trapeziometacarpal osteoarthritis; Caracterizacao clinica, radiografica e cintilografica da osteoartrose trapeziometacarpiana

    Energy Technology Data Exchange (ETDEWEB)

    Kaziyama, Helena Hideko Seguchi

    1996-12-31

    Trapeziometacarpal osteoarthritis occurs mainly in women during the menopausal period. It is related to manual activities and is usually bilateral. The onset is insidious and the evolution is slow and progressive. It is characterized by of strength and pain in the basis of the thumb resulting in limitation of the use and function of the hand. The diagnosis of this condition is based on the physical examination. The manouver of compression axial-rotation of the trapezimetacarpal joint is a common positive finding. Typical findings of osteoarthritis are present in the radiological studies. Scintigraphic images have a predictive value. The early diagnosis is important to avoid the risk factors and to prevent disabilities of the hand. (author) 102 refs., 18 figs., 10 tabs.

  9. IMPORTANCIA DE LA CLINICA DE ENFERMEDADES DE PLANTAS EN LA IMPLEMENTACIÓN DE UNA AGRICULTURA SOSTENIBLE

    Directory of Open Access Journals (Sweden)

    Amanda Emy Gonçalves

    2010-07-01

    Full Text Available Así como ocurre en otras regiones, enfermedades de plantas también son responsables por grandes pérdidas en la agricultura del estado. De este modo, en función de la intensa demanda por diagnósticos, fue creado en el ano de 2002 la “Clínica de Enfermedades de Plantas”, localizada en  el Laboratorio de Fitopatología (CCA/UFSC. Su creación estrecho los lazos entre productores rurales, técnicos e la UFSC, auxiliando en el diagnostico para los problemas fitopatológicos, siendo este su objetivo principal. A lo largo de estos ocho años de existencia, a Clínica recibió un total de 252 muestras, provenientes en su mayoría de Santa Catarina, pero también de Paraná y Río Grande del Sur, presentando principalmente enfermedades causadas por hongos. Además, el trabajo realizado por la Clínica contribuyo para capacitar profesionales en el área de fitopatología, siendo una fuente de aprendizaje significativamente positiva para profesores y alumnos, pues trae para el ambiente académico la problemática real enfrentada por los agricultores en el campo.

  10. Utilidad clinica de biomarcadores en el diagnóstico y tratamiento de la enfermedad glomerular del adulto

    OpenAIRE

    Jatem Escalante, Elias

    2015-01-01

    Con el presente proyecto de tesis, mediante el desarrollo de estudios observacionales con inclusión de grupos de pacientes afectos de formas primarias y secundarias de glomerulopatías causantes de síndrome nefrótico, específicamente gloméruloesclerósis focal y segmentaria,(GFS), y la nefropatía membranosa (NM), donde se practican mediciones séricas y urinarias de determinadas moléculas (receptor soluble de la urokinasa y anticuerpos contra el receptor tipo M de la fosfolipasa A2), para determ...

  11. Comparative study on fatty acid composition of olive (Olea europaea L.), with emphasis on phytosterol contents.

    Science.gov (United States)

    Ozkan, Ali; Aboul-Enein, Hassan Y; Kulak, Muhittin; Bindak, Recep

    2017-08-01

    The present study was designed to determine the fatty acid composition and phytosterol contents of Turkish native olive cultivars, namely Kilis Yağlık and Nizip Yağlık cv. In this context, olive fruits from 34 locations were sampled and then screened for their components in comparison. Fifteen different fatty acids were found in both olive oils. In the order of abundance, the most important ones were oleic acid (18:1) > palmitic acid (16:0) > linoleic acid (18:2) > stearic acid (18:0). Significant differences were observed in the contents of oleic acid (18:1), palmitic acid (16:0), linoleic acid (18:2) but not for stearic acid content in comparison both oils (p phytosterols - cholesterol, campesterol, stigmasterol, β-sitosterol, Δ-5-avenasterol, Δ-7-stigmastenol and Δ-7-avenasterol - were studied in both oil sources. The predominant sterols were β-sitosterol, Δ5-avenasterol and campesterol in the samples analysed. However, no significant differences were found in the levels of the phytosterols between the two olive cultivars. Copyright © 2017 John Wiley & Sons, Ltd.

  12. Copa y concierto: variabilidad de caracteres funcionales foliares en "Olea europaea"

    OpenAIRE

    Escribano Rocafort, Adrián Gaspar

    2015-01-01

    Una de las premisas adoptadas en la teoría ecológica implica que la variabilidad en la expresión de caracteres funcionales es despreciable entre individuos conespecíficos comparada con la variabilidad existente entre especies. Sin embargo, la evidencia acumulada destaca la variabilidad intraespecífica en el funcionamiento de los ecosistemas y en los procesos de ensamblaje y dinámica de comunidades, especialmente en aquellas dominadas por una o pocas especies. La variabilidad funcional intraes...

  13. Flowers and olive fruits (Olea Europaea l. growth under tropic conditions.

    Directory of Open Access Journals (Sweden)

    José Francisco García Molano

    2012-11-01

    Full Text Available It was relatively easy the olive adaptation in tropical area for its evergreen and rustic condition where there were found trees with a very good development and production according to different studies that show the existence of some varieties of ancient trees located in villa de Leyva, Sáchica and Sutamarchán; however these varieties did not prosper as farming and they were abandoned. In the last ten years the olive farming has taken interest again and now there has been planted new crops through the existent material in the region, the production started three years later, for that reason it was taken the cultural, environmental, economic and scientific interest. This study aimed to know the performance of the development and trees growth planted take into account some edaphoclimatic conditions of the ‘Alto Ricaurte’. There were chosen thirty nine trees which the treatment one corresponded to olives of thirty years in production and the treatment two corresponded to three years plants which they had started their production. This plant material had been identified genetically by means of molecular analysis with a classification from one to ten considering that it did not correspond to the denomination that these varieties had in this region. The study shows that genotype four has trees at both ages, which the analysis of results was made take into account the age of this one, observing different behavior in flowering that it seems to be influenced because of climate conditions meanwhile that the planted development and growth did not show any difference in genotypes neither ages.

  14. Characterization of a caleosin expressed during olive (Olea europaea L. pollen ontogeny

    Directory of Open Access Journals (Sweden)

    Rodríguez-García María

    2011-08-01

    Full Text Available Abstract Background The olive tree is an oil-storing species, with pollen being the second most active site in storage lipid biosynthesis. Caleosins are proteins involved in storage lipid mobilization during seed germination. Despite the existence of different lipidic structures in the anther, there are no data regarding the presence of caleosins in this organ to date. The purpose of the present work was to characterize a caleosin expressed in the olive anther over different key stages of pollen ontogeny, as a first approach to unravel its biological function in reproduction. Results A 30 kDa caleosin was identified in the anther tissues by Western blot analysis. Using fluorescence and transmission electron microscopic immunolocalization methods, the protein was first localized in the tapetal cells at the free microspore stage. Caleosins were released to the anther locule and further deposited onto the sculptures of the pollen exine. As anthers developed, tapetal cells showed the presence of structures constituted by caleosin-containing lipid droplets closely packed and enclosed by ER-derived cisternae and vesicles. After tapetal cells lost their integrity, the caleosin-containing remnants of the tapetum filled the cavities of the mature pollen exine, forming the pollen coat. In developing microspores, this caleosin was initially detected on the exine sculptures. During pollen maturation, caleosin levels progressively increased in the vegetative cell, concurrently with the number of oil bodies. The olive pollen caleosin was able to bind calcium in vitro. Moreover, PEGylation experiments supported the structural conformation model suggested for caleosins from seed oil bodies. Conclusions In the olive anther, a caleosin is expressed in both the tapetal and germ line cells, with its synthesis independently regulated. The pollen oil body-associated caleosin is synthesized by the vegetative cell, whereas the protein located on the pollen exine and its coating has a sporophytic origin. The biological significance of the caleosin in the reproductive process in species possessing lipid-storing pollen might depend on its subcellular emplacement. The pollen inner caleosin may be involved in OB biogenesis during pollen maturation. The protein located on the outside might rather play a function in pollen-stigma interaction during pollen hydration and germination.

  15. The Major Qualitative Characteristics of Olive (Olea europaea L.) Cultivated in Southwest China.

    Science.gov (United States)

    Cheng, Zizhang; Zhan, Mingming; Yang, Zeshen; Zumstein, Kristina; Chen, Huaping; Huang, Qianming

    2017-01-01

    Olive trees, originated from Mediterranean, have been cultivated in China for decades and show great adaption to local environment. However, research on this topic is limited. In this study, the major qualitative characteristics and changes of olive grown in southwest China were investigated. The results showed that oil accumulated during fruit development and reached its maximum value when fruit had fully ripened. Phenolic and flavonoid contents increase rapidly in the early growth stage (0-90 DAFB) and then begin to decrease as fruit ripens. Compared with olive from the Mediterranean, olive from China has special characteristics: higher moisture content in the fruit combined with lower percentages of unsaturated fatty acids and oil content. This is due to southwest China's climate which is wetter and cooler compared to the Mediterranean. Our study suggests that southwest China's higher annual rainfall might contribute to higher fruit moisture content while its low temperatures would be conducive to higher unsaturated fatty acid levels in the fruit.

  16. Over-expressing Salicornia europaea (SeNHX1) gene in tobacco ...

    African Journals Online (AJOL)

    An increase of salt tolerance in transgenics was observed both in vitro and in pot culture. When exposed to either 138 mM or 172 mM NaCl in vitro, the transgenic apical meristem and stem segments with buds exhibited stronger salt-tolerance than their wild-type counterparts. In pot soil with 10.2 mg g-1 DW Na+ stress, ...

  17. Modelling of the carbon and water balances of olive (Olea europaea, L.)

    International Nuclear Information System (INIS)

    Villalobos, F.J.

    1999-01-01

    Olive orchards are the main component of numerous agricultural systems in the Mediterranean region. In this work we present the development of a simulation model of olive orchards, which is used here to illustrate some specific features of the water and carbon balances of olives. The fraction of daily Photosynthetically-Active Radiation (PAR) intercepted by the trees (Qd) changes substantially with solar declination. For a given LAI Qd increases as tree size is smaller. Canopy volume has a much larger effect on Qd than Leaf Area Density (LAD), implying that a submodel for canopy volume will be required. Estimates of Radiation-Use Efficiency for yield are 0.35 g dry matter/(MJ PAR) and 0.16 g oil/(MJ PAR) which are around 80% of those for sunflower under the same environment. Crop evaporation in olive orchards is characterized by a high proportion of evaporation from the soil surface (Es) and by the response of stomata to air humidity. Results from a evapotranspiration corresponds to Es, and that Water-Use Efficiency relative to transpiration is 0.9 kg fruit dry matter m-3, which is equal to that of sunflower. Important gaps in our knowledge of olive ecophysiology (dry matter partitioning and growth) require further research

  18. Over-expressing Salicornia europaea (SeNHX1) gene in tobacco ...

    African Journals Online (AJOL)

    use

    2011-11-21

    Nov 21, 2011 ... These results suggested that the impor- tance of vacuolar Na+/H+ antiporters to improve plants salinity tolerance is regulating ion homeostasis. This capacity of vacuolar compartmentalization can be taken as an adaptation mechanism to high salt environment of halophytes and glycophytes (Blumwald et al.

  19. Phenological changes in olive (Ola europaea L. reproductive cycle in southern Spain due to climate change

    Directory of Open Access Journals (Sweden)

    Herminia Garcia-Mozo

    2015-09-01

    LMMs was revealed as an appropriate technique for phenology behaviour analysis displaying both fixed and random interactions. Cultivars grown in the study province are adapted to climate with a synchronized response, although climate change is affecting theolive reproductive cycle in southern Spain; therefore, the timing of pollen release, with subsequent consequences on allergic population as phenological changes, could have impacts on flowering period and pollen production. Further investigation is required of the implications for crop production in Mediterranean ecosystems.

  20. Radical-scavenging compounds from olive tree (Olea europaea L.) wood.

    Science.gov (United States)

    Pérez-Bonilla, Mercedes; Salido, Sofía; van Beek, Teris A; Altarejos, Joaquín

    2014-01-08

    The purpose of this study was to complete knowledge on the chemical composition and radical-scavenging activity of olive tree wood. Two new monoterpene glycosides, (-)-oleuropeic acid 6'-O-α-D-glucopyranosyl ester (6a) and (-)-perillic acid 1'-O-β-D-primeverosyl ester (8), together with the known compounds (-)-oleuropeic acid (1), (-)-olivil (2), the aldehydic form of oleuropein aglycone (3), (+)-1-hydroxypinoresinol 1-O-β-D-glucopyranoside (4), (-)-oleuropeic acid 1'-O-β-D-glucopyranosyl ester (5), (-)-oleuropeic acid 6'-O-β-D-glucopyranosyl ester (6b), and (-)-olivil 4-O-β-D-glucopyranoside (7) were isolated from an ethyl acetate extract. The radical scavengers found (2-4 and 7) were detected and isolated with the help of the online HPLC-DAD-DPPH/ABTS technique. Compounds 2-4 and 7 displayed a higher antioxidative effect against the free radical DPPH than the reference BHT and lower than hydroxytyrosol, whereas compounds 1, 5, 6a, 6b, and 8 showed no activity.

  1. Olive tree, Olea europaea L., leaves as a bioindicator of atmospheric PCB contamination.

    Science.gov (United States)

    Sofuoglu, Sait C; Yayla, Burak; Kavcar, Pınar; Ates, Duygu; Turgut, Cafer; Sofuoglu, Aysun

    2013-09-01

    Olive tree leaf samples were collected to investigate their possible use for biomonitoring of lipophilic toxic substances. The samples were analyzed for 28 polychlorinated biphenyls (PCB) congeners. Twelve congeners were detected in the samples. PCB-60, 77, 81, 89, 105, 114, and 153 were the most frequently detected congeners ranging from 32 % for PCB-52 to 97 % for PCB-81. Σ12PCBs concentration varied from below detection limit to 248 ng/g wet weight in the sampling area, while the mean congener concentrations ranged from 0.06 ng/g (PCB-128 + 167) to 64.2 ng/g wet weight (PCB-60). Constructed concentration maps showed that olive tree leaves can be employed for the estimation of spatial distrubution of these congeners.

  2. Radical-Scavenging Compounds from Olive Tree (Olea europaea L.) wood

    NARCIS (Netherlands)

    Pérez-Bonilla, M.; Salido, S.; Beek, van T.A.; Altarejos, J.

    2014-01-01

    The purpose of this study was to complete knowledge on the chemical composition and radical-scavenging activity of olive tree wood. Two new monoterpene glycosides, (-)-oleuropeic acid 6'-O-a-d-glucopyranosyl ester (6a) and (-)-perillic acid 1'-O-ß-d-primeverosyl ester (8), together with the known

  3. Metabolomics reveals variation and correlation among different tissues of olive (Olea europaea L.).

    Science.gov (United States)

    Guodong, Rao; Xiaoxia, Liu; Weiwei, Zha; Wenjun, Wu; Jianguo, Zhang

    2017-09-15

    Metabolites in olives are associated with nutritional value and physiological properties. However, comprehensive information regarding the olive metabolome is limited. In this study, we identified 226 metabolites from three different tissues of olive using a non-targeted metabolomic profiling approach, of which 76 named metabolites were confirmed. Further statistical analysis revealed that these 76 metabolites covered different types of primary metabolism and some of the secondary metabolism pathways. One-way analysis of variance (ANOVA) statistical assay was performed to calculate the variations within the detected metabolites, and levels of 65 metabolites were differentially expressed in different samples. Hierarchical cluster analysis (HCA) dendrograms showed variations among different tissues that were similar to the metabolite profiles observed in new leaves and fruit. Additionally, 5776 metabolite-metabolite correlations were detected by a Pearson correlation coefficient approach. Screening of the calculated correlations revealed 3136, 3025, and 5184 were determined to metabolites and had significant correlations in three different combinations, respectively. This work provides the first comprehensive metabolomic of olive, which will provide new insights into understanding the olive metabolism, and potentially help advance studies in olive metabolic engineering. © 2017. Published by The Company of Biologists Ltd.

  4. Estabilidade de azeite de oliva extra virgem (Olea europaea) em diferentes sistemas de embalagem

    OpenAIRE

    Simone Faria Silva

    2011-01-01

    Resumo: O consumo de azeite de oliva no Brasil apresentou um crescimento de 70% na última década. As gôndolas dos supermercados foram tomadas por uma diversidade de azeites de oliva acondicionados em vários tipos de embalagens. Esses produtos são todos importados, sendo que uma parte é fracionada e envasada no Brasil, visto que não existe produção em escala comercial no país. O objetivo deste trabalho foi avaliar a estabilidade do azeite de oliva extra virgem em diferentes sistemas de embalag...

  5. Identification and characterization of the iridoid synthase involved in oleuropein biosynthesis in olive (Olea europaea) fruits

    DEFF Research Database (Denmark)

    Alagna, Fiammetta; Geu-Flores, Fernando; Kries, Hajo

    2016-01-01

    these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive...

  6. Transcript Analysis and Regulative Events during Flower Development in Olive (Olea europaea L..

    Directory of Open Access Journals (Sweden)

    Fiammetta Alagna

    Full Text Available The identification and characterization of transcripts involved in flower organ development, plant reproduction and metabolism represent key steps in plant phenotypic and physiological pathways, and may generate high-quality transcript variants useful for the development of functional markers. This study was aimed at obtaining an extensive characterization of the olive flower transcripts, by providing sound information on the candidate MADS-box genes related to the ABC model of flower development and on the putative genetic and molecular determinants of ovary abortion and pollen-pistil interaction. The overall sequence data, obtained by pyrosequencing of four cDNA libraries from flowers at different developmental stages of three olive varieties with distinct reproductive features (Leccino, Frantoio and Dolce Agogia, included approximately 465,000 ESTs, which gave rise to more than 14,600 contigs and approximately 92,000 singletons. As many as 56,700 unigenes were successfully annotated and provided gene ontology insights into the structural organization and putative molecular function of sequenced transcripts and deduced proteins in the context of their corresponding biological processes. Differentially expressed genes with potential regulatory roles in biosynthetic pathways and metabolic networks during flower development were identified. The gene expression studies allowed us to select the candidate genes that play well-known molecular functions in a number of biosynthetic pathways and specific biological processes that affect olive reproduction. A sound understanding of gene functions and regulatory networks that characterize the olive flower is provided.

  7. The Major Qualitative Characteristics of Olive (Olea europaea L. Cultivated in Southwest China

    Directory of Open Access Journals (Sweden)

    Zizhang Cheng

    2017-05-01

    Full Text Available Olive trees, originated from Mediterranean, have been cultivated in China for decades and show great adaption to local environment. However, research on this topic is limited. In this study, the major qualitative characteristics and changes of olive grown in southwest China were investigated. The results showed that oil accumulated during fruit development and reached its maximum value when fruit had fully ripened. Phenolic and flavonoid contents increase rapidly in the early growth stage (0–90 DAFB and then begin to decrease as fruit ripens. Compared with olive from the Mediterranean, olive from China has special characteristics: higher moisture content in the fruit combined with lower percentages of unsaturated fatty acids and oil content. This is due to southwest China's climate which is wetter and cooler compared to the Mediterranean. Our study suggests that southwest China's higher annual rainfall might contribute to higher fruit moisture content while its low temperatures would be conducive to higher unsaturated fatty acid levels in the fruit.

  8. Metabolomics reveals variation and correlation among different tissues of olive (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Rao Guodong

    2017-09-01

    Full Text Available Metabolites in olives are associated with nutritional value and physiological properties. However, comprehensive information regarding the olive metabolome is limited. In this study, we identified 226 metabolites from three different tissues of olive using a non-targeted metabolomic profiling approach, of which 76 named metabolites were confirmed. Further statistical analysis revealed that these 76 metabolites covered different types of primary metabolism and some of the secondary metabolism pathways. One-way analysis of variance (ANOVA statistical assay was performed to calculate the variations within the detected metabolites, and levels of 65 metabolites were differentially expressed in different samples. Hierarchical cluster analysis (HCA dendrograms showed variations among different tissues that were similar to the metabolite profiles observed in new leaves and fruit. Additionally, 5776 metabolite-metabolite correlations were detected by a Pearson correlation coefficient approach. Screening of the calculated correlations revealed 3136, 3025, and 5184 were determined to metabolites and had significant correlations in three different combinations, respectively. This work provides the first comprehensive metabolomic of olive, which will provide new insights into understanding the olive metabolism, and potentially help advance studies in olive metabolic engineering.

  9. A dynamic model of potential growth of olive (Olea europaea L.) orchards

    NARCIS (Netherlands)

    Morales Sierra, Alejandro; Leffelaar, Peter A.; Testi, Luca; Orgaz, Francisco; Villalobos, Francisco J.

    2016-01-01

    A model of potential olive oil production is presented, based on a three-dimensional model of canopy photosynthesis and respiration and dynamic distribution of assimilates among organs. The model is used to analyse the effects of planting density (high and super-high density orchards with 408 and

  10. Phenological changes in olive (Ola europaea L.) reproductive cycle in southern Spain due to climate change.

    Science.gov (United States)

    Garcia-Mozo, Herminia; Oteros, Jose; Galan, Carmen

    2015-01-01

    Modifications of crop species phenology due to a changing environment are of interest because of their impact on fruit set and final harvest. Pre-flowering and flowering phenophases in olive groves at different sites of southern Spain were examined, in order to chart potential trends and determine major correlations with weather-related parameters, especially temperature and water availability. The high prevalence of olive pollen allergy in the Mediterranean population makes this study highly relevant. Ten sites in Cordoba province (Spain) during a 17-year period (1996-2012). BBCH phenology scale. Meteorological data from 1960 were analyzed; data from 1996 included on modeling analysis. Linear Mixed Models (LMMs) were developed, combining phenological and meteorological data. Since 1960, local spring temperatures have increased 1.5ºC, the number of spring rainfall days has fallen 11 days, total rainfall has declined 150 mm. Despite phenological differences between sites, attributable to altitude, phenological development during the season followed a similar pattern. Flowering dates advanced 2 days, while inflorescence emergence was delayed 24 days. Trend slopes revealed differences, an earlier period (1996-2002) with a sharp flowering advance of 15 days, and a later period (2003-2012) characterized by a gradual advance and a high bud emergence delay of 22 days. LMMs was revealed as an appropriate technique for phenology behaviour analysis displaying both fixed and random interactions. Cultivars grown in the study province are adapted to climate with a synchronized response, although climate change is affecting theolive reproductive cycle in southern Spain; therefore, the timing of pollen release, with subsequent consequences on allergic population as phenological changes, could have impacts on flowering period and pollen production. Further investigation is required of the implications for crop production in Mediterranean ecosystems.

  11. Phenological changes in olive (Ola europaea L. reproductive cycle in southern Spain due to climate change

    Directory of Open Access Journals (Sweden)

    Herminia Garcia-Mozo

    2015-09-01

    Full Text Available Introduction. Modifications of crop species phenology due to a changing environment are of interest because of their impact on fruit set and final harvest. Pre-flowering and flowering phenophases in olive groves at different sites of southern Spain were examined, in order to chart potential trends and determine major correlations with weather-related parameters, especially temperature and water availability. The high prevalence of olive pollen allergy in the Mediterranean population makes this study highly relevant. Materials and methods. Ten sites in Cordoba province (Spain during a 17-year period (1996–2012. BBCH phenology scale. Meteorological data from 1960 were analyzed; data from 1996 included on modeling analysis. Linear Mixed Models (LMMs were developed, combining phenological and meteorological data. Results. Since 1960, local spring temperatures have increased 1.5ºC, the number of spring rainfall days has fallen 11 days, total rainfall has declined 150 mm. Despite phenological differences between sites, attributable to altitude, phenological development during the season followed a similar pattern. Flowering dates advanced 2 days, while inflorescence emergence was delayed 24 days. Trend slopes revealed differences, an earlier period (1996–2002 with a sharp flowering advance of 15 days, and a later period (2003–2012 characterized by a gradual advance and a high bud emergence delay of 22 days. Conclusions. LMMs was revealed as an appropriate technique for phenology behaviour analysis displaying both fixed and random interactions. Cultivars grown in the study province are adapted to climate with a synchronized response, although climate change is affecting theolive reproductive cycle in southern Spain; therefore, the timing of pollen release, with subsequent consequences on allergic population as phenological changes, could have impacts on flowering period and pollen production. Further investigation is required of the implications for crop production in Mediterranean ecosystems.

  12. The Major Qualitative Characteristics of Olive (Olea europaea L.) Cultivated in Southwest China

    Science.gov (United States)

    Cheng, Zizhang; Zhan, Mingming; Yang, Zeshen; Zumstein, Kristina; Chen, Huaping; Huang, Qianming

    2017-01-01

    Olive trees, originated from Mediterranean, have been cultivated in China for decades and show great adaption to local environment. However, research on this topic is limited. In this study, the major qualitative characteristics and changes of olive grown in southwest China were investigated. The results showed that oil accumulated during fruit development and reached its maximum value when fruit had fully ripened. Phenolic and flavonoid contents increase rapidly in the early growth stage (0–90 DAFB) and then begin to decrease as fruit ripens. Compared with olive from the Mediterranean, olive from China has special characteristics: higher moisture content in the fruit combined with lower percentages of unsaturated fatty acids and oil content. This is due to southwest China's climate which is wetter and cooler compared to the Mediterranean. Our study suggests that southwest China's higher annual rainfall might contribute to higher fruit moisture content while its low temperatures would be conducive to higher unsaturated fatty acid levels in the fruit. PMID:28579990

  13. LTR retrotransposon dynamics in the evolution of the olive (Olea europaea) genome

    Czech Academy of Sciences Publication Activity Database

    Barghini, E.; Natali, L.; Giordani, T.; Cossu, R.M.; Scalabrin, S.; Cattonaro, F.; Šimková, Hana; Vrána, Jan; Doležel, Jaroslav; Morgante, M.; Cavallini, A.

    2015-01-01

    Roč. 22, č. 1 (2015), s. 91-100 ISSN 1340-2838 R&D Projects: GA ČR GBP501/12/G090; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : LTR retrotransposons * next-generation sequencing * olive Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.267, year: 2015

  14. Analytical approaches for the characterization and identification of olive (Olea europaea) oil proteins.

    Science.gov (United States)

    Esteve, Clara; D'Amato, Alfonsina; Marina, María Luisa; García, María Concepción; Righetti, Pier Giorgio

    2013-10-30

    Proteins in olive oil have been scarcely investigated probably due to the difficulty of working with such a lipidic matrix and the dramatically low abundance of proteins in this biological material. Additionally, this scarce information has generated contradictory results, thus requiring further investigations. This work treats this subject from a comprehensive point of view and proposes the use of different analytical approaches to delve into the characterization and identification of proteins in olive oil. Different extraction methodologies, including capture via combinational hexapeptide ligand libraries (CPLLs), were tried. A sequence of methodologies, starting with off-gel isoelectric focusing (IEF) followed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) or high-performance liquid chromatography (HPLC) using an ultraperformance liquid chromatography (UPLC) column, was applied to profile proteins from olive seed, pulp, and oil. Besides this, and for the first time, a tentative identification of oil proteins by mass spectrometry has been attempted.

  15. Olive (Olea europaea L.) tree nitrogen status is a key factor for olive oil quality.

    Science.gov (United States)

    Erel, Ran; Kerem, Zohar; Ben-Gal, Alon; Dag, Arnon; Schwartz, Amnon; Zipori, Isaac; Basheer, Loai; Yermiyahu, Uri

    2013-11-27

    The influence of macronutrient status on olive oil properties was studied for three years. Data were analyzed by a multivariate model considering N, P, K, and fruiting year as explanatory factors. Oil quality parameters were primarily associated with N concentration in leaves and fruits which increased with N in irrigation solution. The effect of P on oil quality was mainly indirect since increased P availability increased N accumulation. The potassium level had negligible effects. The oil phenolic content decreased linearly as a function of increased leaf N, indicating protein-phenol competition in leaves. The overall saturation level of the fatty acids decreased with fruit N, resulting in increased polyunsaturated fatty acids. Free fatty acids increased with increased levels of fruit N. High fruit load tended to reduce fruit N and subsequently improve oil quality. The effect of N on oil properties depended solely on its concentration in leaves or fruits, regardless of the cause.

  16. Model for forecasting Olea europaea L. airborne pollen in South-West Andalusia, Spain

    Science.gov (United States)

    Galán, C.; Cariñanos, Paloma; García-Mozo, Herminia; Alcázar, Purificación; Domínguez-Vilches, Eugenio

    Data on predicted average and maximum airborne pollen concentrations and the dates on which these maximum values are expected are of undoubted value to allergists and allergy sufferers, as well as to agronomists. This paper reports on the development of predictive models for calculating total annual pollen output, on the basis of pollen and weather data compiled over the last 19 years (1982-2000) for Córdoba (Spain). Models were tested in order to predict the 2000 pollen season; in addition, and in view of the heavy rainfall recorded in spring 2000, the 1982-1998 data set was used to test the model for 1999. The results of the multiple regression analysis show that the variables exerting the greatest influence on the pollen index were rainfall in March and temperatures over the months prior to the flowering period. For prediction of maximum values and dates on which these values might be expected, the start of the pollen season was used as an additional independent variable. Temperature proved the best variable for this prediction. Results improved when the 5-day moving average was taken into account. Testing of the predictive model for 1999 and 2000 yielded fairly similar results. In both cases, the difference between expected and observed pollen data was no greater than 10%. However, significant differences were recorded between forecast and expected maximum and minimum values, owing to the influence of rainfall during the flowering period.

  17. Effect of gamma irradiation on quality of olive fruits (Olea Europaea L. ), and its oil

    International Nuclear Information System (INIS)

    Al-Bashir, M.

    2000-12-01

    A study was conducted to investigate the effect of gamma radiation on accelerating the debittering steps of olive fruits, oil extractability and the quality of extracted oil. Olive fruits (Olea Europea. var. Surrany) were treated with 0, 1, 2, and 3 kGy of gamma irradiation at a dose rate of 669 Gy/hr., a part of these fruits was debittered in distilled water, the second was processed with NaOH (3.6% concentration) for 3 or 6 hr. Both treated fruits with a control part were kept in brine (5.6% sodium chloride) and stored for 12 months at room temperature. Portions of all these treated fruits were subjected to oil extraction by mechanical means immediately after treatment. During the debittering period (8 days) the total dissolved and inorganic dissolved solids, Na, K, Ca, electric conductivity (EC) and ph values were determined in wastewater (daily), whereas the peroxide value, iodine number and the total acidity were measured in the extracted oil. The results showed that gamma irradiation increased the total and inorganic dissolved solids, a and K in wastewater. The most significant effect was noticed when irradiated fruits were processed with NaOH for 3 hrs. as indicated by the values of total and inorganic dissolved solids, Na and K concentration in wastewater. All used doses of gamma radiation, increased the extractability of the oil from the treated fruits, the total acidity and the peroxide value of that oil. (Author)

  18. Pedologic Factors Affecting Virgin Olive Oil Quality of "Chemlali" Olive Trees (Olea europaea L.).

    Science.gov (United States)

    Rached, Mouna Ben; Galaverna, Gianni; Cirlini, Martina; Boujneh, Dalenda; Zarrouk, Mokhtar; Guerfel, Mokhtar

    2017-08-01

    The aim of this study examined the characterization of extra virgin olive oil samples from the main cultivar Chemlali, grown in five olive orchards with different soil type (Sandy, Clay, Stony, Brown, Limestone and Gypsum). Volatile compounds were studied using headspace-solid phase micro-extraction (HS-SPME) and gas chromatography-mass spectrometry (GC-MS) technics. Moreover, the sterol profile was established using gas chromatography-mass spectrometry. 35 different volatile compounds were identified: alcohols, esters, aldehydes, ketones and hydrocarbons. The chemical composition of the volatile fraction was characterized by the preeminence of 2-hexenal (32.75%) and 1-hexanol (31.88%). Three sterols were identified and characterized. For all olive oil samples, ß-sitosterol (302.25 mg/kg) was the most abundant sterol. Interestingly, our results showed significant qualitative and quantitative differences in the levels of the volatile compounds and sterols from oils obtained from olive trees grown in different soil type.

  19. Biogenesis of protein bodies during legumin accumulation in developing olive (Olea europaea L.) seed.

    Science.gov (United States)

    Jimenez-Lopez, Jose C; Zienkiewicz, Agnieszka; Zienkiewicz, Krzysztof; Alché, Juan D; Rodríguez-García, Maria I

    2016-03-01

    Much of our current knowledge about seed development and differentiation regarding reserves synthesis and accumulation come from monocot (cereals) plants. Studies in dicotyledonous seeds differentiation are limited to a few species and in oleaginous species are even scarcer despite their agronomic and economic importance. We examined the changes accompanying the differentiation of olive endosperm and cotyledon with a focus on protein bodies (PBs) biogenesis during legumin protein synthesis and accumulation, with the aim of getting insights and a better understanding of the PBs' formation process. Cotyledon and endosperm undergo differentiation during seed development, where an asynchronous time-course of protein synthesis, accumulation, and differential PB formation patterns was found in both tissues. At the end of seed maturation, a broad population of PBs, particularly in cotyledon cells, was distinguishable in terms of number per cell and morphometric and cytochemical features. Olive seed development is a tissue-dependent process characterized by differential rates of legumin accumulation and PB formation in the main tissues integrating seed. One of the main features of the impressive differentiation process is the specific formation of a broad group of PBs, particularly in cotyledon cells, which might depend on selective accumulation and packaging of proteins and specific polypeptides into PBs. The nature and availability of the major components detected in the PBs of olive seed are key parameters in order to consider the potential use of this material as a suitable source of carbon and nitrogen for animal or even human use.

  20. Novel qPCR systems for olive (Olea europaea L.) authentication in oils and food.

    Science.gov (United States)

    Ramos-Gómez, Sonia; Busto, María D; Albillos, Silvia M; Ortega, Natividad

    2016-03-01

    The traceability of olive oil is an unresolved issue that remains a challenge. In this field, DNA-based techniques are very powerful tools for discrimination that are less negatively influenced by environmental conditions than other techniques. More specifically, quantitative real time PCR (qPCR) achieves a high degree of sensitivity, although the DNA that it can directly isolate from these oils presents drawbacks. Our study reports the analysis of eight systems, in order to determine their suitability for olive detection in oil and oil-derived foodstuffs. The eight systems were analyzed on the basis of their sensitivity and specificity in the qPCR assay, their relative sensitivity to olive DNA detection and DNA mixtures, their sensitivity and specificity to olive in vegetable oils and the detection of olive in commercial products. The results show that the PetN-PsbM system, designed in this study, is a suitable and reliable technique in relation to olive oil and olive ingredients in both food authentication and food safety processes. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Transcript Analysis and Regulative Events during Flower Development in Olive (Olea europaea L.).

    Science.gov (United States)

    Alagna, Fiammetta; Cirilli, Marco; Galla, Giulio; Carbone, Fabrizio; Daddiego, Loretta; Facella, Paolo; Lopez, Loredana; Colao, Chiara; Mariotti, Roberto; Cultrera, Nicolò; Rossi, Martina; Barcaccia, Gianni; Baldoni, Luciana; Muleo, Rosario; Perrotta, Gaetano

    2016-01-01

    The identification and characterization of transcripts involved in flower organ development, plant reproduction and metabolism represent key steps in plant phenotypic and physiological pathways, and may generate high-quality transcript variants useful for the development of functional markers. This study was aimed at obtaining an extensive characterization of the olive flower transcripts, by providing sound information on the candidate MADS-box genes related to the ABC model of flower development and on the putative genetic and molecular determinants of ovary abortion and pollen-pistil interaction. The overall sequence data, obtained by pyrosequencing of four cDNA libraries from flowers at different developmental stages of three olive varieties with distinct reproductive features (Leccino, Frantoio and Dolce Agogia), included approximately 465,000 ESTs, which gave rise to more than 14,600 contigs and approximately 92,000 singletons. As many as 56,700 unigenes were successfully annotated and provided gene ontology insights into the structural organization and putative molecular function of sequenced transcripts and deduced proteins in the context of their corresponding biological processes. Differentially expressed genes with potential regulatory roles in biosynthetic pathways and metabolic networks during flower development were identified. The gene expression studies allowed us to select the candidate genes that play well-known molecular functions in a number of biosynthetic pathways and specific biological processes that affect olive reproduction. A sound understanding of gene functions and regulatory networks that characterize the olive flower is provided.

  2. Contribuição ao estudo do lupus eritematoso sistemico na infancia : manifestações clinicas e laboratoriais de 59 pacientes

    OpenAIRE

    Roberto Marini

    1997-01-01

    Resumo: o intuito deste trabalho foi avaliar as manifestações clínicas, laboratoriais e as causas de óbito de 59 pacientes (48F/11M) com LES que iniciaram os sintomas até os 16 anos de idade. Para tal realizou-se um estudo retrospectivo com revisão dos prontuários de pacientes matriculados nos ambulatórios de Pediatria e Reumatologia do Hospital das Clínicas da UNICAMP durante o período de 1979 a 1995. Os pacientes com LED, o induzido por drogas e o Lupus neonatal não foram estudados. Analisa...

  3. Normal behaviour of circulatory parameters during exercise. Reference values for heart rate and systemic blood pressure. The ECCIS Project data. Epidemiologia e Clinica della Cardiopatia Ischemica Silente.

    Science.gov (United States)

    Menghini, F; Dally, L; Fazzini, P F; Menotti, A; Prati, P L; Rovelli, F; Antoniucci, D; Seccareccia, F

    1995-08-01

    The study of simultaneous variations in heart rate (HR) and systemic blood pressure is of great interest in ergometric practice complementing the analysis of the ST segment by ECG. This paper examines data proceeding from 500 consecutive, normal, exercise stress tests with the aim of offering reference values on the step-by-step behaviour of HR, systolic and diastolic blood pressure (SBP, DBP) during exercise in a normal population. The sample comes from a large epidemiological study (ECCIS Project) conducted on 4842 healthy, working men, aged 40-59, which proposes to identify, by a 3 stage procedure, subjects with totally asymptomatic coronary artery disease (type I silent ischemia). A further aim of our paper is to examine the influence of some physiological variables (age, height, weight, body mass index, resting HR, SBP and DBP) on the response to effort of HR, SBP and DBP; reciprocal HR/SBP adjustment during exercise; maximal attained workload and recovery time. Due to a preliminary observation that the rate of step-by-step increase in HR and SBP is inversely related to total duration, the population was split into 4 groups according to exercise tolerance (defined by maximal attained workload) to elaborate reference values. Furthermore our data demonstrate that: 1) SBP increases more rapidly with respect to HR for older and heavier subjects; 2) Exercise tolerance is inversely related to age, baseline HR and SBP, and directly related to weight and height; 3) return to baseline conditions, during recovery, is quicker for subjects with better exercise tolerance and lower baseline HR, SBP and weight.

  4. Discussão genetico-clinica sobre a Síndrome de Apert: a propósito de um caso

    Directory of Open Access Journals (Sweden)

    Aguinaldo Gonçalves

    1976-09-01

    Full Text Available Após breve introdução sobre a síndrome de Apert, é relatado um caso clínico, sendo destacada a conduta genético-clínica. A discussão revela como os aspectos genéticos envolvidos orientam o raciocínio clínico.

  5. Avaliação clinica do valor terapeutico do barbexaclone incluindo determinação de niveis plasmaticos do barbiturico

    Directory of Open Access Journals (Sweden)

    Telmo Tonetto Reis

    1980-03-01

    Full Text Available São apresentados os resultados de um ensaio clínico usando barbexaclone (ciclo-hexil-aminopropano associado com fenil-etil-barbitúrico, como único anti-convulsivante. Foram selecionados 70 pacientes dos quais 36 eram do sexo feminino e 34 do sexo masculino, sendo 52 crianças e 18 adultos. Todos apresentavam crises de epilepsia tipo grande-mal e tiveram duas ou mais crises antes de serem incluídos na pesquisa. Cinqüenta e três pacientes foram observados durante 18 meses, dos quais 96% ficaram livres de crises neste período. Os níveis plasmáticos dos barbitúricos foram determinados em 20 pacientes. Nestes pacientes o controle completo das crises atingiu 89%. A mensuração dos níveis plasmáticos dos anticonvulsivantes tem demonstrado ser um guia terapêutico útil e seguro no tratamento de epilepsia.

  6. Actinomicose cerebral: observação anatomo-clinica e revisão da literatura brasileira Cerebral actinomycosis: case report and review of the Brazilian literature

    Directory of Open Access Journals (Sweden)

    Luciano de Souza Queiroz

    1975-12-01

    Full Text Available Os autores relatam a observação anátomo-clínica de um paciente de 33 anos, com síndrome de hipertensão intracraniana e hemiparesia à direita. O líquido cefalorraqueano revelava discreta hipercitose linfomonocitária. A autópsia mostrou três abscessos cerebrais, com edema difuso mais intenso no hemisfério cerebral esquerdo, sem leptomeningite purulenta. O exame histopatológico demonstrou grãos actinomicóticos nos abscessos cerebrais e pulmonares. A literatura brasileira sobre neuroactinomicose é analisada, com encontro de seis casos, publicados entre 1934 e 1946. São discutidos aspectos clínicos e anátomo-patológicos relevantes dos casos nacionais.A case of central nervous system actinomycosis is reported. A 33-year-old male complained of headache, vomiting and blurred vision lasting for eight days prior to admission. On examination, a right hemiparesis, as well an intracranial hypertension were detected. The cerebrospinal fluid showed mild lymphomononuclear hypercytosis. Necropsy disclosed three abscess in the cerebral hemispheres, in addition to moderate cerebral edema on the left side but without purulent leptomeningitis. Actinomyces filaments and granules were demonstrated in the cerebral and lung abscesses. The Brazilian literature on actinomycosis is reviewed and six published cases with nervous system involvement were found. Relevant clinical and anatomical aspects of the cases and of the present one are discussed.

  7. Analysis of imaging findings and clinical abnormalities in patients with lymphoma; Analise de achados de imagem e alteracoes clinicas em pacientes com linfoma

    Energy Technology Data Exchange (ETDEWEB)

    Caldas, Flavio Augusto Ataliba; Montomiya, Carolina Tsumori [Faculdade de Medicina de Marilia, SP (Brazil)]. E-mail: flavio_caldas@hotmail.com; Silva, Helena Cristina da [Faculdade de Medicina de Marilia, SP (Brazil). Hospital de Clinicas

    2002-04-01

    Computed tomography is currently the method of choice for the diagnostic and staging of lymphomas. Computed tomography enables accurate measurements of both tumor extent and volume and provides information that can be used to plan an appropriate strategy for the treatment. The purpose of the present article is to describe and analyze the chest and abdomen computed tomography and ultrasound findings in HIV-negative patients with lymphoma. Clinical abnormalities, such as the reason the patient sought medical assistance already showing evidence of lymphocytic disease (not yet diagnosed at this point) and the physical examination abnormalities seen on the first consultation were also studied. This study comprised 30 patients: 40% with non-Hodgkin lymphoma, 46,6% with Hodgkin lymphoma, 10% with Burkitt's lymphoma and 3,3% with lymphoblastic lymphoma. (author)

  8. Hepatic hemangio-endothelioma: radiological findings and clinical evolution of a case; Hemangioendotelioma hepatico: aspectos radiologicos e evolucao clinica de um caso

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho Neto, Arnolfo de; Souza, Carolina Althoff; Yanaga, Ricardo Hideki [Parana Univ., Curitiba, PR (Brazil). Hospital de Clinicas. Servico de Radiologia; Albonei, Mara [Parana Univ., Curitiba, PR (Brazil). Hospital de Clinicas. Dept. de Pediatria]. E-mail: carolina_althoff@hotmail.com

    2003-02-01

    Vascular tumors encompass a spectrum of lesions, which may vary from benign hemangiomas to malignant angio sarcomas. Hemangio-endotheliomas can be considered intermediary between these two types of lesions. We report a case of hepatic hemangio endothelioma in a newborn female and review the most important aspects of this disease. (author)

  9. Laser diagnostic and therapy of dental caries: the clinic point of view; Laser diagnostico e tratamento da carie dental: uma visao clinica

    Energy Technology Data Exchange (ETDEWEB)

    Paiva, Priscila Faria

    2001-07-01

    Dental caries's diagnosis is a major dentistry problem from the clinic point of view. The laser beam on the region of 655 nm induces the fluorescence of the compounds present in the hard tissue, quantifying differences between sound and carious enamel and dentine. Diagnodent (Kavo, Germany), showed to be effective regarding dental caries's diagnosis in the present research sampling. The Er:YAG laser (Kavo Key Laser 2, Germany) performed efficient cavity preparations in caries lesions of I and V class type, using up energies that ranged from 300 mJ to 350 mJ with 4 Hz repetition rate for the enamel; and from 250 mJ to 300 mJ with 4 Hz repetition rate for the dentine, and with 80 mJ with 6 Hz of repetition rate for laser conditioning. In the Er:YAG laser preparations no patient was anesthetized even when there were deeper cavities, and the maximum degree of pain ( which ranged from 0 to 10) was 4. In the control group with conventional high-speed drill two patients were anesthetized and the maximum degree of pain was 7. Restorations performed by conventional method of composite were equally satisfying both in caries groups of I and V class type and in the control group. The laser application in the operative dentistry office as a new method of diagnosis and dental preparations should be a good alternative to the use of the conventional dental drill. Nevertheless, dentistry practice has a lot to improve from technology progress, as well as new researches on laser dentistry are necessary in a long term. New types of lasers will come about and will increasingly improve the dental practice assistance and procedures quality. (author)

  10. Avaliação clinica do valor terapeutico do barbexaclone incluindo determinação de niveis plasmaticos do barbiturico

    OpenAIRE

    Reis,Telmo Tonetto; Maia Filho,Manoel Soares; Cechini,Pedro Celso

    1980-01-01

    São apresentados os resultados de um ensaio clínico usando barbexaclone (ciclo-hexil-aminopropano) associado com fenil-etil-barbitúrico, como único anti-convulsivante. Foram selecionados 70 pacientes dos quais 36 eram do sexo feminino e 34 do sexo masculino, sendo 52 crianças e 18 adultos. Todos apresentavam crises de epilepsia tipo grande-mal e tiveram duas ou mais crises antes de serem incluídos na pesquisa. Cinqüenta e três pacientes foram observados durante 18 meses, dos quais 96% ficaram...

  11. The role of the medical physic on radiologic, hemodynamic and surgery unit at Hospital das Clinicas de Porto Alegre, Rio Grande do Sul State, Brazil

    International Nuclear Information System (INIS)

    Bacelar, A.; Furtado, A.P.A.; Krebs, E.M.; Oliveira, S.S.; Lima, A.A.; Jacques, L.C.; Silveira, C.S.

    1996-01-01

    The activities executed by the medical physic in the radiologic, hemodynamic and surgery unit are presented. Topics such as organization of a radiologic protection project and a quality assurance program, monthly information of the individual doses, sanitary inspection and training of the professionals involved are emphasized. The methodology and results are briefly presented

  12. Transcutaneous electrical neural stimulation for the treatment of urinary urgency or urge-incontinence in children and adolescents: a Phase II clinica.

    Science.gov (United States)

    Alcantara, Amanda Carolina Almeida de; Mello, Maria Júlia Gonçalves de; Costa e Silva, Eduardo Just da; Silva, Bárbara Bernardo Rinaldo da; Ribeiro Neto, José Pacheco Martins

    2015-01-01

    To determine the effectiveness of 20 twice-weekly sessions of parasacral transcutaneous electrical neural stimulation (TENS) for treatment of urinary urgency and urge-incontinence in children and adolescents. A Phase II clinical trial was carried out with patients with urinary urgency or urge-incontinence aged between 5 and 14 years. Twenty TENS sessions were conducted, twice weekly, using a Quark® Dualpex 961 apparatus. The variables analyzed were daily micturition, dynamics ultrasonography of the lower urinary tract pre-and post-treatment and responses to a questionnaire on urinary leakage applied during each session. The mean age of the 25 children participating in the study was 7.80 ± 2.22 years, most were female (92%) and had urge-incontinence (92%). The difference in urinary leakage pre- and post-treatment was statistically significant ( p = 0.04); a decline in the symptom of urinary leakage was reported by all caregivers in children who completed the 20th session; the ultrasound parameters, although not statistically significant, showed a reduction in the percentage of children with detrusor contractions (from 62.5% to 43.5%); and a more adequate pre-micturition bladder volume of 4.2% post-treatment compared with 19.0% prior to treatment. The electro-stimulation carried out during the twice weekly sessions appeared to be effective and urinary incontinence declined in half of the patients from the 12th session onwards. However, there is a need for a study involving a larger number of patients to confirm the results obtained.

  13. VALORACION DEL TRATAMIENTO CON ACUPUNTURA Y MOXIBUSTION EN PACIENTES CON BURSITIS DE HOMBRO DE LA CLINICA DE ACUPUNTURA DE LA ESCUELA NACIONAL DE MEDICINA Y HOMEOPATIA.

    OpenAIRE

    DE LEON POLANCO, ALEJANDRO PACIANO

    2009-01-01

    LA BURSITIS ES LA INFLAMACION DE LAS BURSAS, QUE SON PEQUENAS BOLSAS LLENAS DE LIQUIDO SEROSO QUE SE ENCUENTRAN ENTRE LOS TENDONES Y EL PLANO OSEO. LA CINTURA ESCAPULAR TIENE 11 BURSAS LAS CUALES SE PUEDEN AFECTAR UNA O MAS EN FORMA SIMULTANEA CONDICIONANDO DOLOR, INFLAMACION Y LIMITACION FUNCIONAL QUE TRAE COMO CONSECUENCIA TRASTORNOS EN LA VIDA COTIDIANA DEL INDIVIDUO. LA BURSITIS SE CLASIFICA EN AGUDAS Y CRONICAS. LAS POSIBLES ETIOLOGIAS DE LA BURSITIS PUEDEN SER TRAUMATISMOS AGUDOS, PROC...

  14. Alienacion de la Madre, Psicopatoligia y la Practica Clinica en Mexico. (Alienation of the Mother, Psychopathology, and the Practice Clinic in Mexico).

    Science.gov (United States)

    Diaz-Guerrero, Rogelio; And Others

    1979-01-01

    The study related the role of the maternal figure to the affective behavior of the Mexican. Two hundred adolescents judged the concept of "Insult to the Mother" in relation to other similarly charged affective concepts, e.g., "death", "suicide", "drunkenness", etc. Results showed that "Insult to the…

  15. Breast cancer only detected at US. Incidental finding or clinical evidence?; Le neoplasie mammarie visualizzabili solo con esame ecografico. Reperti incidentali o realta' clinica?

    Energy Technology Data Exchange (ETDEWEB)

    Nori, J.; Masi, A.; Boeri, C.; Vivian, A.; Nori Bufalini, F. [Azienda Ospedaliera Careggi, Florence (Italy). Unita' Operativa di Radiodiagnostica 2; Cariti, G. [Florence Univ., Florence (Italy). Dipt. di Ginecologia e Ostetricia

    2000-06-01

    Mammography is the only technique of proven efficacy in the early diagnosis of breast cancer, even though its sensitivity is much lower in breasts that are dense or with a high parenchymal-stroma component. In the past malignant breast nodules detected at US in patients with negative mammographic and physical findings were considered incidental findings, but more recent papers report increasing numbers of breast cancers detected only at US. It was investigated the yield of US performed as a diagnostic complement in asymptomatic women with mammographic findings that were either negative or poorly readable because of dense breast. 13 women were examined: 37 to 55 years old (mean 47): 9 of them were asymptomatic and 4 had poorly specific physical findings. The patients underwent physical examination, mammography, US, micro histologic biopsy with 14G needles under US guidance and surgery. Fourteen breast lesions 7.0-15 mm in diameter were detected only by US. Mammography (2 or 3 standard views) was negative in all cases. The lesions detected only by US (10% of all carcinomas) were typified with US-guided needle biopsy and finally confirmed surgically. Though obtained in a small series, the results seem to suggest that US should be included in the diagnostic work-up, especially of women with dense breast. Also, any hypoechoic lesion detected at breast US in clinically asymptomatic women with negative mammographic findings should be further investigated with US, needle aspiration or core biopsy to make the final diagnosis. [Italian] Si intende con questo lavoro valutare l'utilita' dell'esame ecografico, eseguito come completamento diagnostico in donne clinicamente negative e con mammografia negativa o comunque scarsamente leggibile in relazione alla elevata densita' del parenchima mammario (mammelle dense). Tredici donne con eta' compresa tra 37 e 55 anni (eta' media 47 anni) asintomatiche o con quadri clinici vaghi o comunque non orientativi per patologia neoplastica della mammella hanno eseguito esame clinico, mammografia, ecografia mammaria, prelievo microistologico ecoguidato e intervento operatorio. Quattordici neoplasie mammarie, con dimensioni comprese tra 7 e 15 mm sono state evidenziate solo ecograficamente. La mammografia eseguita nelle 2 o 3 incidenze abituali, e' risultata sempre negativa. Le lesioni neoplastiche evidenziate solamente con l'esame ecografico (10% di tutti i carcinomi) sono state caratterizzate con biopsia istologica con ago da 14G e definitivamente confermate con intervento chirurgico. I risultati ottenuti permettono di suggerire che l'esame ecografico debba essere metodica da includere nell'iter diagnostico nelle donne con mammelle scarsamente leggibili. Le lesioni nodulari ipoecogene sospette rilevate all'esame ecografico in una donna con visita e mammografia negative meritano di essere ulteriormente approfondite (controllo con ecografia, agoaspirazione per citologia o biopsia istologica con ago) al fine di ottenere la definitiva caratterizzazione.

  16. Use of a registry-generated audit, feedback, and patient reminder intervention in an internal medicine resident clinic--a randomized trial.

    Science.gov (United States)

    Thomas, Kris G; Thomas, Matthew R; Stroebel, Robert J; McDonald, Furman S; Hanson, Gregory J; Naessens, James M; Huschka, Todd R; Kolars, Joseph C

    2007-12-01

    Disease registries, audit and feedback, and clinical reminders have been reported to improve care processes. To assess the effects of a registry-generated audit, feedback, and patient reminder intervention on diabetes care. Randomized controlled trial conducted in a resident continuity clinic during the 2003-2004 academic year. Seventy-eight categorical Internal Medicine residents caring for 483 diabetic patients participated. Residents randomized to the intervention (n = 39) received instruction on diabetes registry use; quarterly performance audit, feedback, and written reports identifying patients needing care; and had letters sent quarterly to patients needing hemoglobin A1c or cholesterol testing. Residents randomized to the control group (n = 39) received usual clinic education. Hemoglobin A1c and lipid monitoring, and the achievement of intermediate clinical outcomes (hemoglobin A1c audit, feedback, and patient reminder intervention in a resident continuity clinic modestly improved diabetes care processes, but did not influence intermediate clinical outcomes.

  17. Radiological protection in the interventional techniques: experience in the Pain Clinic of the CIMEQ; Proteccion radiologica en las tecnicas intervencionistas: experiencia en la Clinica del Dolor del CIMEQ

    Energy Technology Data Exchange (ETDEWEB)

    Guerrero C, M. C.; Benitez N, P. P.; Gonzalez G, Y. [Centro de Investigaciones Medico Quirurgicas, Av. 216 Esq. 11B, Playa Siboney, 6096 La Habana (Cuba); Martinez G, A.; Gonzalez R, N. [Centro de Proteccion e Higiene de las Radiaciones, Carretera de la Cantera, Victoria II, Km. 21.5 Guanabacoa, La Habana (Cuba); Sanchez Z, L. R., E-mail: mayka@infomed.sld.cu [Hospital C. Q. Hermanos Ameijeiras, San Lazaro 701, Centro Habana, La Habana (Cuba)

    2014-08-15

    The Pain Clinic of the CIMEQ offers treatment to patients with different pathologies, using interventional techniques as the radiology like visual guide to reach the target structure and to apply the election technique. The personnel that carry out these procedures are inserted in the program of radiological surveillance of the institution, reason for which a radiological event could be detected where the main physician responsible of the service was implied. In this work the results of an investigation are presented realized with the objective of to know the causes of the event and to determine the necessary measures to avoid that this repeats again. The investigation was oriented to three fundamental aspects: medical exam of the affected worker; evaluation of the operational procedures from the radiological protection view point; and dosimetric measurements simulating the real conditions of work for which were used ionization chamber, radiometer and PMMA mannequin. As a result of the medical exam was detected that the main physician of the service did not use during the execution of all the procedures the extremities dosimetry and that he presented a radio induced erythema in the right hand, reason for which he was separated of the activity with ionizing radiations, until the conclusion of the investigation. With relationship to the evaluation of the operational procedures from the radiological protection view point, was verified that the medical physician not carried out any collimation of the beam and he was located in the positions where the dose rate reached the maximum values, frequently introducing the hands in the direct beam; that which implied an overexposure of the superior extremities and a not optimized exposure for whole body. This result was proven with the realized experimental measurements, which gave dose estimated values in extremities of the order of the deterministic effects. The investigation facilitated to introduce modifications in the operational procedures from the radiological protection view point that allowed optimizing the occupational exposure and to avoid the appearance of deterministic effects on the workers of this practice. Parallel was carried out the completion of the protection individual media and working media that allowed the proper application of the mentioned procedures were substituted. On the other hand, this investigation pointed to that the personnel training in radiological protection matter and the control of the occupational exposure in the interventional techniques are indispensable for the safe performance of the medical practice. (author)

  18. Correlação clinica entre a mielopatia cervical e o índice de Torg Correlation between the clinic and the index of cervical myelopathy Torg

    Directory of Open Access Journals (Sweden)

    Agnaldo Rogério Lozorio

    2012-01-01

    Full Text Available OBJETIVO: A mielopatia cervical é uma disfunção da medula espinhal relacionada a degeneração típica do envelhecimento, cuja patologia se relaciona com a isquemia e compressão da medula. Muitos são os problemas clínicos apresentados por portadores de mielopatia, nos casos mais graves este acometimento pode levar a para ou tetraplegia quando não tratado. Devido a patologia primária desta doença ser causada por compressão gerando isquemia medular, julgamos poder existir uma correlação entre o grau de compressão e clínica dos pacientes portadores de mielopatia cervical, porém não encontramos nenhum estudo na literatura que realizou esta correlação, por existir esta dúvida na literatura é que objetivamos em nosso estudo analisar a correlação entre o grau do comprometimento clínico dos pacientes com mielopatia cervical e o índice de Torg. MÉTODOS: Estudo prospectivo, de caráter descritivo, avaliados 46 pacientes, realizado mensuração radiográfica do índice de Torg e análise clínica através da escala de JOA e Nurick. RESULTADOS: Dos 46 pacientes, 100% apresentaram Torg OBJECTIVE: Cervical myelopathy is a spinal cord dysfunction related to degeneration typical of aging. Its primary pathology is related to ischemia and spinal cord compression. Patients with myelopathy present many clinical problems; more severe cases may lead to quadriplegia if not treated in a timely manner. Because the primary pathology of this disease is caused by compression, thus generating spinal cord ischemia, we believed there must be a correlation between the degree of compression and the clinical assessment of patients with cervical myelopathy, but we did not find any study in the literature that made this correlation. Because there is doubt the literature we aimed, in our study, to analyze the correlation between the degree of clinical impairment of patients with cervical myelopathy and the Torg index. METHODS: A prospective, descriptive study, evaluating 46 patients, in which radiographic measurements of the Torg index were performed, with clinical analysis through the Nurick and JOA scale. RESULTS: Of the 46 study patients included in the study, 100% presented a Torg score <0.8. The decrease in Torg values was directly proportional to clinical worsening on the Nurick and JOA scale. CONCLUSIONS: The degree of clinical impairment in patients with cervical myelopathy is directly related to the degree of spinal canal stenosis. Level of Evidence I, Prognostic Studies - Investigating the effect of the characteristics of a patient on the outcome of the disease.

  19. Clinical manifestations in patients with computerized tomography diagnosis of neurocysticercosis; Manifestacoes clinicas de pacientes com diagnostico de neurocisticercose por tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Pfuetzenreiter, Marcia Regina [Universidade do Estado de Santa Catarina (UDESC), Florianopolis, SC (Brazil). Dept. de Medicina Veterinaria Preventiva e Tecnologia]. E-mail: a2mrp@cav.udesc.br; Avila-Pires, Fernando Dias de [Santa Catarina Univ., Florianopolis, SC (Brazil). Dept. de Saude Publica

    1999-09-01

    A survey was conducted in the urban area of Lages using patients who had been submitted to a computed tomography of the skull in the period of March-December, 1996, for different reasons. Forty-two patients with a provisional diagnosis of neurocysticercosis, and 57 negatives were personally interviewed by one of the authors (Pfuetzenreiter), using a semi-structured procedure. More individuals with a provisional diagnostic of neurocysticercosis reported clinical manifestations related to this infection than those found negative. this difference is more marked among women, except in relation to convulsions, more frequently reported by men (19.05%) than by women (7.14%). The greater percentage of inactive forms (83.33%0 and a longer history of perceived symptoms among those positives suggest that the condition is not new. (author)

  20. Evolution of sensitivity to fosfomycin in bacteria isolated in 1973, 1974 and 1975 in the Servicio de Microbiologia y Epidemiologia of the 'Clinica Puerta de Hierro', Madrid.

    Science.gov (United States)

    Dámaso, D; Moreno-López, M; Martínez-Beltrán, J

    1977-01-01

    The bacteriostatic activity of fosfomycin was studied in vitro against 1,243 clinical isolations of gram-positive cocci and 4,086 isolations of gram-negative bacilli that were obtained in 1973, 1974 and in the period from January to May of 1975. MIC was determined by the agar diffusion method, quantifying it by means of the standard curve that was worked out with the strain of E. coli NCTC 10,418. A slight increase in resistance was observed in the gram-positive cocci: 64 mug/ml were inhibitory for 63% of the 249 isolations obtained in 1973, 59.1% of the 716 isolations obtained in 1974, and 57.5% of the 278 isolations from 1975. A slight loss of sensitivity was also observed in the gram-negative bacilli: the aforementioned concentration of fosfomycin inhibited 36% of the 742 isolations from 1973, 33.6% of the 2,387 isolations from 1974 and 32.6% of the 957 isolations from 1975. 933 g of this antibiotic were consumed in our hospital in 1973, 4,203 g in 1974 and 957 g in 1975. The consumption rate per patient per year was 0.15, 0.72 and 0.20 g, respectively. In conclusion, although no change was observed in the sensitivity of some bacterial strains to fosfomycin, the overall study indicates a slight decrease in the sensitivity, although it does not apparently have any relationship to the consumption of fosfomycin in our hospital.

  1. ISO 9001 certification in the clinical dosimetry process in physics medical service; Certificacion ISO9001 en el proceso de dosimetria clinica en un servicio de fisica medica

    Energy Technology Data Exchange (ETDEWEB)

    Font Gomez, J. A.; Andres Redondo, M. M.; Gandia Martinez, A.; Jimenez Albericio, F. J.; Mengual Gil, M. A.

    2013-07-01

    The objective of this work is to simply name a series of procedures that are part of the certification and technical instructions (manuals about how to perform specific tasks) without going into details. (Author)

  2. [Congenital toxoplasmosis: clinical manifestation, treatment and follow-up] [Article in Italian] • Il neonato con toxoplasmosi congenita: clinica, terapia e follow-up

    Directory of Open Access Journals (Sweden)

    Lina Bollani

    2014-01-01

    Full Text Available Toxoplamosis is a parasitic zoonosis which occurs worldwide, but is prevalent in Europe, South America and Africa. When infection occurs for the first time during pregnancy, mother to child transmission of the parasite can cause congenital toxoplasmosis. Rate of congenital infection ranges from less than 0.1 to approximately 1 per 1,000 live births. The risk of transmission depends on the gestational age at the time of maternal infection. A diagnosis of congenital toxoplasmosis is usually considered in infants who present: hydrocephalus, chorioretinitis, and intracranial calcifications, but this triade is very rare. Approximately 85% of the infants with congenital toxoplasmosis are clinically normal at birth; however, sequelae of infection may become apparent only months or even years later. Chorioretinitis is the main complication of congenital toxoplasmosis, late onset retinal lesions and relapse can appear many years after birth, but the overall ocular prognosis is satisfactory when infection is identified and treated accordingly. Fortunately, serious neonatal forms and severe neurological impairment have become rare, but prompt treatment of children with convulsions, abnormal muscle tone, hydrocephalus, may improve the prognosis and result in almost normal outcome. For infants who have congenital toxoplasmosis, treatment soon after birth for 1 year with pyrimetamine, sulfadiazine and leukoverin led to remarkable resolution of serious, active disease. A long follow-up is necessary to assess the long-term outcome of children and young adults with congenital toxoplasmosis, that is favourable for the majority of cases. Epidemiological surveillance needs to be improved in order to determine the effectiveness of prevention programs.Articoli Selezionati del “3° Convegno Pediatrico del Medio Campidano” · Guspini · 25 Maggio 2013Guest Editor: Roberto Antonucci

  3. Frecuencia de anticuerpos anti Trypanozoma cruzi en pacientes portadores de marcapasos de la Clinica San Pedro Claver de Bogotá

    Directory of Open Access Journals (Sweden)

    Guillermo Mora

    2007-12-01

    Conclusiones. La prevalencia de anticuerpos anti-T. cruzi en pacientes portadores de marcapaso es alta. La implantación de marcapasos se presentó más tempranamente en el grupo seropositivo. No hay adecuada sospecha clínica ni información al paciente sobre el diagnóstico de la enfermedad de Chagas.

  4. Development of software for management of radioactive waste in biological research and clinical assistance; Desenvolvimento do software para gerenciamento de rejeitos radioativos em pesquisa biologica e assistencia clinica

    Energy Technology Data Exchange (ETDEWEB)

    Maciel, Bianca; Mattos, Maria Fernanda S.S.; Medeiros, Regina B. [Universidade Federal de Sao Paulo (UNIFESP/EPM), Sao Paulo, SP (Brazil). Dept. de Diagnostico por Imagem. Nucleo de Protecao Radiologica; Franca Junior, Jose Antonio de, E-mail: fernanda@cfhr.epm.b, E-mail: rbitelli@cfhr.epm.b, E-mail: jafjunior@unifesp.b [Universidade Federal de Sao Paulo (UNIFESP/EPM), Sao Paulo, SP (Brazil). Dept. de Tecnologia da Informacao. Div. de Sistema de Informacao

    2011-10-26

    This paper describes the development of software which facilitates the automation of this process by mean of the Safety Analysis Report generating a data base allowing the statistic analysis and elaboration of radioactive wastes inventory. The software was developed in PHP language and the information is stored in a data base generated in Oracle and organized in different tables which allows to calculate the storage time of waste and to register the specificities of radioisotopes, cadastral data of the professionals which handle that radioisotope and also the characteristics of handling laboratories. That tool collaborates for a effective control on the use of radioisotopes in research laboratories and assistance areas as well

  5. Management units radio physics hospital clinic: New management model; Unidades de gestion clinica de radiofisica hospitalaria, ¿nuevo modelo de gestion?

    Energy Technology Data Exchange (ETDEWEB)

    Iborra Oquendo, M.; Angulo Pain, E.; Castro Ramirez, I.; Quinones Rodriguez, L. A.; Urena Llinares, A.; Richarter Reina, J. M.; Lupiani Castellanos, J.; Ramos Caballero, L. I.

    2011-07-01

    Clinical management in the Andalusian Health Service is a process of organizational design that allows professionals to incorporate the management of resources used in their own clinical practice. In the Clinical Management Units activity develops according to different objectives, among them: encourage the involvement of health professionals in managing the centers, enhance continuity of care between the two levels of care, improve work organization and raise patient satisfaction.

  6. Picture archiving and communication systems (PACS) in clinical practice. Implantacion de un sistema de archivo y comunicacion de imagen (PACS) en la practica clinica

    Energy Technology Data Exchange (ETDEWEB)

    Carreo Pedemonte, J.C.; Piqueras Pardellans, J.; Lucaya Layret, J.

    1994-01-01

    Picture archiving and communication systems (PACS) were developed as a technological response to the complex management of the growing amount of information generated by the different diagnostic imaging methods. This article documents the process of the progressive implementation, starting in January 1991, of the first complete PACS installed in our country. The system installed in our center is composed of acquisition modules for all the imaging methods (computed radiography, ultrasound, computed tomography, digital fluoroscopy and magnetic resonance), a central processing unit, an automatic optical disk for storage and a network of image viewing and diagnostic stations. The preliminary results obtained with its implementation demonstrate that PACS provide a series of functional advantages, especially at the image storage and display levels. In spite of these conveniences, the present high costs of acquisition and maintenance, together with certain technical problems as a result of its complexity, will signify that its generalized application for all imaging methods will not become a reality at most centers in the near future. (Author)

  7. Existe diferença no estadiamento entre doentes operados de câncer colorretal no sistema previdenciário e na clinica privada?

    Directory of Open Access Journals (Sweden)

    Rodrigo Cuiabano Paes Leme

    Full Text Available OBJETIVO: Avaliar se existe diferença no estadiamento de doentes submetidos à ressecção intestinal por câncer colorretal no sistema previdenciário e na clínica privada. MÉTODO: Foram estudados de forma retrospectiva 41 doentes (16 homens e 25 mulheres com idade média de 59,4 anos operados no sistema previdenciário (SP e 33 doentes (18 homens e 15 mulheres com idade média de 60,8 anos operados na clínica privada (CP. Foram avaliados o estadiamento TNM, a frequência de operações de urgência, de operações paliativas e do uso de colostomia. RESULTADOS: Não se observou diferença entre o estadiamento dos dois grupos. A frequência de operações de urgência foi 26,8% no SP e 12,1% na CP (p=0,100. As operações paliativas ( 19,5% SP x 6,1% CP e o uso de colostomia ( 26,8 SP X 15,2 CP foram maiores no sistema previdenciário porém os valores não foram estatisticamente significantes, valores de p=0,087 e p=0,352 respectivamente. CONCLUSÃO: Não há diferença significante entre o estadiamento TNM de doentes operados no sistema previdenciário e privado.

  8. Porous bone radio sterilized chips and their clinical application in vertebral arthrodesis; Chips de hueso esponjoso radioesterilizados y su aplicacion clinica en arthrodesis vertebral

    Energy Technology Data Exchange (ETDEWEB)

    Luna Z, D. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Ortega E, J.; Zayas M, L. A. [Instituto de Salud del Estado de Mexico, Centro Medico Lic. Adolfo Lopez Mateos, Av. Nicolas San Juan s/n, Ex-Hacienda La Magdalena, 50170 Toluca, Estado de Mexico (MX); Diaz M, I., E-mail: daniel.luna@inin.gob.mx [Centro Estatal de Trasplantes del Estado de Mexico, Pablo Sidar No. 602, Col. Universidad, 50130 Toluca, Estado de Mexico (MX)

    2011-11-15

    The diseases of the muscle-skeletal tissue are the main cause of physical disability which affects in the entire world to millions of people. The bone is part of the muscle-skeletal tissue and the spine is a group of bones that are located in the dorsal part of the human body. At present the spine lesions are varied as those that people suffer when they have automobile accidents of for fallen, mainly in the major adults, if the spine lesions are not treated appropriately they can have consequences to short or long term. A procedure that has been useful for the spine lesions is the vertebral arthrodesis. The tissue banks are places where is obtained bone of distinct origin for clinical use, the chips of porous bone are obtained in banks of specialized tissues which are sterilized with gamma radiation of cobalt-60, the use of this bone type has been demonstrated that these help in the recovery of patients that suffer spine fracture. In this work the process of procurement of human bone is presented, just as the process of its transformation in chips form and its sterilization method. At the end a case of a young patient is presented who suffers an automobile accident and was treated by the vertebral arthrodesis technique of spine, using chips of porous bone for his recovery. (Author)

  9. Oxicenus maxwelli (Keifer (Acari: Eriophyidae danificando a cultura da oliveira, Olea europaea L., no Estado do Rio Grande do Sul Oxicenus maxwelli (Keifer (Acari: Eriophyidae damaging olive tree, Olea europaea L., in Rio Grande do Sul State

    Directory of Open Access Journals (Sweden)

    Marcelo Perrone Ricalde

    2012-05-01

    Full Text Available O micro ácaro da oliveira Oxicenus maxwelli (Keifer, 1939 foi identificado em pomares de oliveira nos municípios de Santana do Livramento, Bagé, Candiota, Pelotas e Rio Grande, RS, nos meses de novembro de 2010 a fevereiro de 2011. A espécie foi encontrada nas faces superior e inferior de folhas jovens, em flores e brotos, onde causa deformações, queda de folhas e flores, diminuição da fotossíntese e superbrotação, prejudicando a produção da planta e a comercialização dos frutos deformados. Este é o primeiro registro da espécie atacando a oliveira no Estado do Rio Grande do Sul.The olive bud mite Oxicenus maxwelli (Keifer, 1939 was identified in olive groves in the municipalities of Santana do Livramento, Bagé, Candiota, Pelotas and Rio Grande, RS in November 2010 to February 2011. The specie was found on the upper surface and under surface of young leaves, flowers and buds where it causes deformities, loss of leaves and flowers, decreased photosynthesis and budding, damaging the plant's production and marketing of deformed fruits. This is the first record of the species attacking the olive tree in the state of Rio Grande do Sul.

  10. Transcriptomic analysis of the Olea europaea L. roots during the Verticillium dahliae early infection process

    DEFF Research Database (Denmark)

    Jiménez-Ruiz, Jaime; Pérez, Maria De la O Leyva; Schilirò, Elisabetta

    2017-01-01

    Olive cultivation is affected by a wide range of biotic constraints. Verticillium wilt of olive is one of the most devastating diseases affecting this woody crop, inflicting major economic losses in many areas, particularly within the Mediterranean Basin. Little is known about gene-expression cha...

  11. Trocas gasosas influenciam na morfogênese in vitro de duas cultivares de oliveira (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Marcos Vinícius Marques Pinheiro

    2013-02-01

    Full Text Available Os objetivos deste trabalho foram estabelecer in vitro as cultivares de oliveira 'Arbequina' e 'Maria da Fé' e avaliar a influência das tampas com membranas permeáveis a gases na morfogênese in vitro dessas cultivares. Inocularam-se segmentos nodais com gemas previamente descontaminadas pelo protocolo aqui desenvolvido. Utilizaram-se o delineamento inteiramente casualizado (DIC em esquema fatorial 2³, duas cultivares; dois meios de cultura OM (Olive medium (OM + 20 µM de zeatina [1]; e OM + 20 µM de zeatina + 10 µM de GA3 [2]; dois tipos de vedação (tampa rígida sem orifício e com membrana porosa com cinco repetições/ tratamento; e a unidade experimental constituída por quatro tubos de ensaio. Avaliaram-se: a porcentagem de contaminação total; a porcentagem de contaminação fúngica e bacteriana; o número de gemas intumescidas; o número de brotos; e a porcentagem de oxidação. Aos 30 dias de cultivo, constatou-se a contaminação de 15% e 8,8% dos explantes de 'Arbequina' e 'Maria da Fé', respectivamente. Em 'Arbequina', 33,3% e 66,7% ocorreram por contaminação fúngica e bacteriana, respectivamente. Em 'Maria da Fé', 28,6% e 71,4% decorreram de contaminação fúngica e bacteriana, respectivamente. O número de gemas foi superior (p<0,05 em 'Arbequina', comparativamente à 'Maria da Fé', quando se utilizou tampa com membrana porosa para vedar os frascos. Em tampa rígida não houve diferença entre cultivares. O número de brotos no meio 1 foi superior estatisticamente (p<0,05 ao no meio 2. Não houve diferença estatística em porcentagem de oxidação. Sugere-se a utilização do protocolo de desinfestação aqui desenvolvido, como também do meio 1 e tampas com membranas porosas, pois isso favorecerá o desenvolvimento das gemas e a posterior formação de plantas.

  12. Water relation response to soil chilling of six olive (Olea europaea L.) cultivars with different frost resistance

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Lopez, D.; Gijon, M. C.; Marino, J.; Moriana, A.

    2010-07-01

    The relationship between the water relations of six olive cultivars exposed to different soil temperatures (14 0.1, 9.9 0.1 and 5.8 0.2 degree centigrade) and their inherent frost resistance (as determined by two different methods) was investigated. Soil chilling was achieved by introducing pots of olive plants into water baths. The water relations of these plants were compared to those of plants kept under conditions of room temperature. The cultivars Frantoio, Picual and Changlot Real began to show significant dehydration below 14 degree centigrade, while Cornicabra, Arbequina and Ascolana Tenera showed this below 10 degree centigrade. This response is probably due to delayed stomatal closure. Only Cornicabra and Picual showed a significant reduction in leaf conductance (below 10 degree centigrade and 6 degree centigrade respectively). This absence of stomatal control led to a significantly greater dehydration in Ascolana Tenera. These variations in response to the soil chilling temperature suggest that different mechanisms may be at work, and indicate that would be necessary to study the influence of rootstock in the frost resistance of olive plants. The variations recorded grouped the cultivars as either resistant (Cornicabra), tolerant (Picual, Ascolana Tenera and Arbequina), or sensitive (Frantoio and Changlot Real). This classification is in line with the frost resistance reported for these cultivars in the literature, and with the results obtained in the present work using the stomatal density and ion leakage methods of determining such resistance. (Author) 40 refs.

  13. Effects of the planting density on virgin olive oil quality of "Chemlali" olive trees (Olea europaea L.).

    Science.gov (United States)

    Guerfel, Mokhtar; Zaghdoud, Chokri; Jebahi, Khaled; Boujnah, Dalenda; Zarrouk, Mokhtar

    2010-12-08

    Here, we report the characterization of virgin olive oil samples obtained from fruits of the main Tunisian olive cultivar (Chemlali) grown in four planting densities (156, 100, 69, and 51 trees ha(-1)). Olive oil samples obtained from fruits of trees grown at 100 trees ha(-1) had a higher content of oleic acid (65.5%), a higher content of chlorophyll and carotenoids, and a higher content in total phenols (1059.08 mg/kg). Interestingly, olives grown at the two highest planting densities yielded more stable oils than olives grown at the two lowest ones. Thus planting density is found to be a key factor for the quality of olive oils in arid regions.

  14. Acetylene and oxygen as inhibitors of nitrous oxide production in Nitrosomonas europaea and Nitrosospira briensis: a cautionary tale

    NARCIS (Netherlands)

    Wrage, N.; Velthof, G.L.; Oenema, O.; Laanbroek, H.J.

    2004-01-01

    Autotrophic ammonia-oxidizing bacteria produce nitrous oxide (N2O) as a by-product of nitrification or as an intermediate of nitrifier denitrification. In soil incubations, acetylene (C2H2) and large partial pressures of oxygen (O-2) are used to distinguish between these sources. C2H2 inhibits

  15. Acetylene and oxygen as inhibitors of nitrous oxide production in Nitrosomonas europaea and Nitrosospira briensis: a cautionary tale

    NARCIS (Netherlands)

    Wrage, N.; Velthof, G.L.; Oenema, O.; Laanbroek, H.J.

    2004-01-01

    Autotrophic ammonia-oxidizing bacteria produce nitrous oxide (N2O) as a by-product of nitrification or as an intermediate of nitrifier denitrification. In soil incubations, acetylene (C2H2) and large partial pressures of oxygen (O2) are used to distinguish between these sources. C2H2 inhibits

  16. Responses of Commercial Olive Cultivars (Olea europaea L. to Cold Stress Using Electrolyte Leakage Method and Measuring Total Soluble Carbohydrate

    Directory of Open Access Journals (Sweden)

    S. Mousavi

    2015-09-01

    Full Text Available Identification and characterization of tolerant and susceptible cultivars of crop plants to cold stress is important. In this regard, in present research electrolyte leakage and Total Soluble Sugar (TSS contents in the leaf and bark tissues in ten olive cultivars, namely, Zard, Mari, Fadak87-1, Fadak87-5, Fadak86, Fadak77, Arbequina, Mission, Blady and Coratina were measured to assess their response to cold stress during two consecutive years. Two years-old shoots from five year-old olive trees were collected in summer and winter from a commercial orchard in Qom, Central Iran and exposed to cold treatments of 0, -4, -8, -12, -16 and -20°C for 24 hours. Then LT50 was measured by electrolyte leakage. A considerable increase in cold-hardiness was observed with decreasing temperature. Leaf and bark tissues exhibited more tolerance in winter than summer and bark tissue had more tolerance than leaf in both seasons. Also TSS contents in leaf and bark tissues were greater in winter than summer and in all studied cultivars bark tissue had greater TSS content than the leaf. Results showed that cold-hardy cultivars, Zard, Arbequina and Fadak87-5 (with tolerance thresholds of -17.34°C, -17.5°C and -17.99°C, respectively had greater TSS contents in tissues in summer and winter compared to susceptible cultivars, Coratina and Mari (with tolerance thresholds of -7.18°C and -9.13°C respectively. Although the precise mechanism in response to cold stress has not been characterized in olive tree, it can be concluded from this experiment, that the tissue TSS content is closely associated with resistance to cold stress in this tree species.

  17. Pomology observations, morphometric analysis, ultrastructural study and allelic profiles of "olivastra Seggianese" endocarps from ancient olive trees (Olea europaea L.).

    Science.gov (United States)

    Milanesi, Claudio; Sorbi, Andrea; Paolucci, Elisa; Antonucci, Francesca; Menesatti, Paolo; Costa, Corrado; Pallottino, Federico; Vignani, Rita; Cimato, Antonio; Ciacci, Andrea; Cresti, Mauro

    2011-01-01

    Preliminary studies of historical sources and remote sensing were used to identify ancient olive trees near archaeological sites and heritage buildings in the Orcia Valley (Siena, Italy). Distinctive characters were assessed by traditional pomological observation. Trees with similar characters were selected on the basis of the features of endocarps, the only structure that survives aerobic deterioration and conserves useful botanical information for centuries. Non-invasive morphometric analysis of endocarp size and shape established morphological variations in individuals of different populations. Plastid organization in the endocarp and location of DNA in the endocarp tegument were detected by morphological and ultrastructural observations using light and electron microscopy. Cytoplasmic markers with high polymorphism were used to test similarity of endocarp and leaf DNA within individuals and to confirm low variability and minimal divergence between individuals. The ancient trees studied showed the same allelic profiles and therefore belonged to a distinct cultivar. The traditional pomological descriptions of the trees, leaves and fruits, morphometric analysis of size, and shape elliptic Fourier analysis of endocarp outline, ultrastructural observations and allelic profiles of endocarp tegument delineated the general species-specific qualities of the cultivar "olivastra Seggianese" of the Orcia Valley. Copyright © 2010 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  18. Identification and Assessment of the Potential Allergenicity of 7S Vicilins in Olive (Olea europaea L. Seeds

    Directory of Open Access Journals (Sweden)

    Jose C. Jimenez-Lopez

    2016-01-01

    Full Text Available Olive seeds, which are a raw material of interest, have been reported to contain 11S seed storage proteins (SSPs. However, the presence of SSPs such as 7S vicilins has not been studied. In this study, following a search in the olive seed transcriptome, 58 sequences corresponding to 7S vicilins were retrieved. A partial sequence was amplified by PCR from olive seed cDNA and subjected to phylogenetic analysis with other sequences. Structural analysis showed that olive 7S vicilin contains 9 α-helixes and 22 β-sheets. Additionally, 3D structural analysis displayed good superimposition with vicilin models generated from Pistacia and Sesamum. In order to assess potential allergenicity, T and B epitopes present in these proteins were identified by bioinformatic approaches. Different motifs were observed among the species, as well as some species-specific motifs. Finally, expression analysis of vicilins was carried out in protein extracts obtained from seeds of different species, including the olive. Noticeable bands were observed for all species in the 15–75 kDa MW interval, which were compatible with vicilins. The reactivity of the extracts to sera from patients allergic to nuts was also analysed. The findings with regard to the potential use of olive seed as food are discussed.

  19. Molecular characterization of three common olive (Olea europaea L.) cultivars in Palestine, using simple sequence repeat (SSR) markers

    Science.gov (United States)

    Obaid, Ramiz; Abu-Qaoud, Hassan; Arafeh, Rami

    2014-01-01

    Eight accessions of olive trees from three common varieties in Palestine, Nabali Baladi, Nabali Mohassan and Surri, were genetically evaluated using five simple sequence repeat (SSR) markers. A total of 17 alleles from 5 loci were observed in which 15 (88.2%) were polymorphic and 2 (11.8%) were monomorphic. An average of 3.4 alleles per locus was found ranging from 2.0 alleles with the primers GAPU-103 and DCA-9 to 5.0 alleles with U9932 and DCA-16. The smallest amplicon size observed was 50 bp with the primer DCA-16, whereas the largest one (450 bp) with the primer U9932. Cluster analysis with the unweighted pair group method with arithmetic average (UPGMA) showed three clusters: a cluster with four accessions from the ‘Nabali Baladi’ cultivar, another cluster with three accessions that represents the ‘Nabali Mohassen’ cultivar and finally the ‘Surri’ cultivar. The similarity coefficient for the eight olive tree samples ranged from a maximum of 100% between two accessions from Nabali Baladi and also in two other samples from Nabali Mohassan, to a minimum similarity coefficient (0.315) between the Surri and two Nabali Baladi accessions. The results in this investigation clearly highlight the genetic dissimilarity between the three main olive cultivars that have been misidentified and mixed up in the past, based on conventional morphological characters. PMID:26019564

  20. Influence of process parameters and biomass characteristics on the durability of pellets from the pruning residues of Olea europaea L.

    Energy Technology Data Exchange (ETDEWEB)

    Carone, Maria Teresa; Pantaleo, Antonio; Pellerano, Achille [Department of Engineering and Management of the Agricultural, Livestock and Forest Systems, Faculty of Agriculture, University of Bari, Via Amendola, 165/A, 70126 Bari (Italy)

    2011-01-15

    The present work aims to investigate the influence of the main process parameters (pressure and temperature) and biomass characteristics (moisture content and particle size) on some mechanical properties (density and durability) of olive tree pruning residues pellets. By means of a lab scale pellet press, able to control process parameters, the biomass, ground with three different hammer mill screen sizes (1, 2 and 4 mm) and conditioned at different moisture contents (5, 10, 15 and 20% w.b.), was pelletized at various process temperatures (60, 90, 120 and 150 C) and pressures (71, 106, 141 and 176 MPa). Compressed sample dimensions and mass were measured in order to calculate pellet density, while compressive strength tests were carried out to estimate the durability of the final biofuel. The relationships between the factor settings and the responses (density, compression strength and modulus of elasticity) were examined by univariate and multivariate statistical analysis. Temperature resulted the most important variable influencing pellet mechanical properties, followed by the initial moisture content and the particle size of the raw material. In particular, high process temperature, low moisture contents and reduced particle sizes allowed obtaining good quality pellets. The effect of compression force resulted scarcely relevant. (author)

  1. Effect of Tea (Camellia sinensis and Olive (Olea europaea L. Leaves Extracts on Male Mice Exposed to Diazinon

    Directory of Open Access Journals (Sweden)

    Atef M. Al-Attar

    2013-01-01

    Full Text Available The present study was aimed to evaluate the effects of tea and olive leaves extracts and their combination in male mice intoxicated with a sublethal concentration of diazinon. Exposure of mice to 6.5 mg/kg body weight of diazinon for seven weeks resulted in statistical increases of serum alanine aminotransferase, aspartate aminotransferase, gamma glutamyl transferase, alkaline phosphatase, creatine kinase, creatinine, glucose, triglycerides, and cholesterol, while the value of serum total protein was declined. Treating diazinon-intoxicated mice with tea and olive leaves extracts or their combination significantly attenuated the severe alterations in these hematobiochemical parameters. Moreover, the results indicated that the supplementation with combination of tea and olive leaves extracts led to more attenuation effect against diazinon toxicity. Additionally, these new findings suggest that the effect of tea and olive leaves extracts and their combination against toxicity of diazinon may be due to antioxidant properties of their chemical constituents. Finally, the present study indicated that the extracts of tea and olive leaves and their combination can be considered as promising therapeutic agents against hepatotoxicity, cardiotoxicity, nephrotoxicity, and metabolic disorders induced by diazinon and maybe by other toxicants and pathogenic factors.

  2. OXIDATION OF METHYL FLUORIDE AND DIMETHYL ETHER BY AMMONIA MONOOXYGENASE IN NITROSOMONAS EUROPAEA. (R825689C009)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  3. Olive (Olea europaea L. Biophenols: A Nutriceutical against Oxidative Stress in SH-SY5Y Cells

    Directory of Open Access Journals (Sweden)

    Syed Haris Omar

    2017-10-01

    Full Text Available Plant biophenols have been shown to be effective in the modulation of Alzheimer’s disease (AD pathology resulting from free radical-induced oxidative stress and imbalance of the redox chemistry of transition metal ions (e.g., iron and copper. On the basis of earlier reported pharmacological activities, olive biophenols would also be expected to have anti-Alzheimer’s activity. In the present study, the antioxidant activity of individual olive biophenols (viz. caffeic acid, hydroxytyrosol, oleuropein, verbascoside, quercetin, rutin and luteolin were evaluated using superoxide radical scavenging activity (SOR, hydrogen peroxide (H2O2 scavenging activity, and ferric reducing ability of plasma (FRAP assays. The identification and antioxidant activities in four commercial olive extracts—Olive leaf extractTM (OLE, Olive fruit extractTM (OFE, Hydroxytyrosol ExtremeTM (HTE, and Olivenol plusTM (OLP—were evaluated using an on-line HPLC-ABTS•+ assay, and HPLC-DAD-MS analysis. Oleuropein and hydroxytyrosol were the predominant biophenols in all the extracts. Among the single compounds examined, quercetin (EC50: 93.97 μM and verbascoside (EC50: 0.66 mM were the most potent SOR and H2O2 scavengers respectively. However, OLE and HTE were the highest SOR (EC50: 1.89 μg/mL and H2O2 (EC50: 115.8 μg/mL scavengers among the biophenol extracts. The neuroprotection of the biophenols was evaluated against H2O2-induced oxidative stress and copper (Cu-induced toxicity in neuroblastoma (SH-SY5Y cells. The highest neuroprotection values (98% and 92% against H2O2-induced and Cu-induced toxicities were shown by the commercial extract HTETM. These were followed by the individual biophenols, caffeic acid (77% and 64% and verbascoside (71% and 72%. Our results suggest that olive biophenols potentially serve as agents for the prevention of neurodegenerative diseases such as AD, and other neurodegenerative ailments that are caused by oxidative stress.

  4. Phenolic Compounds and Antimicrobial Activity of Olive (Olea europaea L. Cv. Cobrançosa Leaves

    Directory of Open Access Journals (Sweden)

    José Alberto Pereira

    2007-05-01

    Full Text Available We report the determination of phenolic compounds in olive leaves by reversed-phase HPLC/DAD, and the evaluation of their in vitro activity against several microorganisms that may be causal agents of human intestinal and respiratory tract infections, namely Gram positive (Bacillus cereus, B. subtilis and Staphylococcus aureus, Gram negative bacteria (Pseudomonas aeruginosa, Escherichia coli and Klebsiella pneumoniae and fungi (Candida albicans and Cryptococcus neoformans. Seven phenolic compounds were identified and quantified: caffeic acid, verbascoside, oleuropein, luteolin 7-O-glucoside, rutin, apigenin 7-O-glucoside and luteolin 4’-O-glucoside. At low concentrations olive leafs extracts showed an unusual combined antibacterial and antifungal action, which suggest their great potential as nutraceuticals, particulalry as a source of phenolic compounds.

  5. Antithrombotic effect of repeated doses of the ethanolic extract of local olive (Olea europaea L. leaves in rabbits

    Directory of Open Access Journals (Sweden)

    Abdallah M. Dub

    2013-05-01

    Full Text Available The incidence of thromboembolic diseases is increasing, and they are a major cause of mortality and morbidity worldwide. Mediterranean diet is known for its high content of olive products, especially olive oil, which has known cardiovascular health benefits, including those on blood pressure, cholesterol level, and thrombogenesis. All previous animal and clinical studies investigating the beneficial antithrombotic effects of olives have focused on olive oil and a few on olive leaves (OLEs. In this study, the ethanolic extract of OLE was evaluated for its antithrombotic activity in the rabbit model of thrombosis induced by ligature of the vena cava and intravenous administration of tissue thromboplastin. Pre-treatment with 100 or 200 mg/kg per day of the ethanolic extract for 8 weeks significantly prolonged the prothrombin time (PT in comparison to the control group (12.10±0.35 sec and 14.38±0.29 sec vs. 10.8±0.32 sec, p<0.05 and 0.001, respectively. In comparison to the control group, the same doses had no statistically significant effect on thrombus weight (16.85±0.67 mg, 16.32±0.35 mg, and 17.81±0.75 mg; p=0.18 and 0.06 or on activated partial thromboplastin time (APTT (19.17±0.33 sec, 19.12±0.73 sec, and 18.97±0.41 sec; p=0.36 and 0.43, respectively. One important finding in this study concerns thrombus morphology. In the extract treatment groups, the thrombus was filament-like and did not adhere to blood vessel walls, whereas in the control group the thrombus was thick and almost completely occluded the vein. Therefore, these results suggest that OLE ethanolic extract can modify the extrinsic coagulation pathway as evidenced by the prolongation of PT and changes in thrombus morphology, enough to justify further research to evaluate its possible antithrombotic effects.

  6. Antithrombotic effect of repeated doses of the ethanolic extract of local olive (Olea europaea L.) leaves in rabbits.

    Science.gov (United States)

    Dub, Abdallah M; Dugani, Aisha M

    2013-05-22

    The incidence of thromboembolic diseases is increasing, and they are a major cause of mortality and morbidity worldwide. Mediterranean diet is known for its high content of olive products, especially olive oil, which has known cardiovascular health benefits, including those on blood pressure, cholesterol level, and thrombogenesis. All previous animal and clinical studies investigating the beneficial antithrombotic effects of olives have focused on olive oil and a few on olive leaves (OLEs). In this study, the ethanolic extract of OLE was evaluated for its antithrombotic activity in the rabbit model of thrombosis induced by ligature of the vena cava and intravenous administration of tissue thromboplastin. Pre-treatment with 100 or 200 mg/kg per day of the ethanolic extract for 8 weeks significantly prolonged the prothrombin time (PT) in comparison to the control group (12.10 ± 0.35 sec and 14.38 ± 0.29 sec vs. 10.8 ± 0.32 sec, p < 0.05 and 0.001, respectively). In comparison to the control group, the same doses had no statistically significant effect on thrombus weight (16.85 ± 0.67 mg, 16.32 ± 0.35 mg, and 17.81 ± 0.75 mg; p = 0.18 and 0.06) or on activated partial thromboplastin time (APTT) (19.17 ± 0.33 sec, 19.12 ± 0.73 sec, and 18.97 ± 0.41 sec; p = 0.36 and 0.43, respectively). One important finding in this study concerns thrombus morphology. In the extract treatment groups, the thrombus was filament-like and did not adhere to blood vessel walls, whereas in the control group the thrombus was thick and almost completely occluded the vein. Therefore, these results suggest that OLE ethanolic extract can modify the extrinsic coagulation pathway as evidenced by the prolongation of PT and changes in thrombus morphology, enough to justify further research to evaluate its possible antithrombotic effects.

  7. Identification of olive (Olea europaea) seed and pulp proteins by nLC-MS/MS via combinatorial peptide ligand libraries.

    Science.gov (United States)

    Esteve, Clara; D'Amato, Alfonsina; Marina, María Luisa; García, María Concepción; Citterio, Attilio; Righetti, Pier Giorgio

    2012-04-18

    Different types of extraction protocols are described for identifying proteins in seed and pulp of olive (Olea europea), by employing both conventional extraction methods and capture with ProteoMiner as well as with in house-made combinatorial peptide ligand libraries (HM-CPLLs) at pH 7.4 and at pH 2.2. Thanks to the use of CPLLs, able to dramatically amplify the signal of low-abundance species, a quite large number of compounds has been indeed identified: 61 in the seed (vs. only four reported in current literature) and 231 in the pulp (vs. 56 described so far), the deepest investigation up to the present of the olive proteome. In the seed, it highlights the presence of seed storage proteins, oleosins and histones. In the pulp, the allergenic thaumatin-like protein (Ole e 13) was confirmed, among the other 231, as the most abundant protein in the olive pulp. The present research has also been undertaken with the aim of identifying proteins in olive oil and ascertaining the relative contribution of seed and pulp proteins in their presence, if any, in oils. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. Ecophysiological responses of olive (Olea europaea L.) to restricted water availability: limitations, damages and drought resistance mechanisms.

    OpenAIRE

    Bacelar, Eunice Luís Vieira Areal

    2006-01-01

    Tese de Doutoramento em Engenharia Biológica O stresse hídrico é o factor que mais limita a produção vegetal à escala mundial, reduzindo significativamente os lucros da actividade agrícola. Do ponto de vista ecofisiológico, designa-se por stresse hídrico qualquer limitação ao funcionamento óptimo das plantas imposta por uma insuficiente disponibilidade de água. As respostas das plantas à falta de água são complexas, envolvendo uma série de adaptações/aclimatações e efeitos nefastos, ou amb...

  9. The eastern part of the Fertile Crescent concealed an unexpected route of olive (Olea europaea L.) differentiation.

    Science.gov (United States)

    Mousavi, Soraya; Mariotti, Roberto; Bagnoli, Francesca; Costantini, Lorenzo; Cultrera, Nicolò G M; Arzani, Kazem; Pandolfi, Saverio; Vendramin, Giovanni Giuseppe; Torkzaban, Bahareh; Hosseini-Mazinani, Mehdi; Baldoni, Luciana

    2017-06-01

    Olive is considered a native plant of the eastern side of the Mediterranean basin, from where it should have spread westward along the Mediterranean shores, while little is known about its diffusion in the eastern direction. Genetic diversity levels and population genetic structure of a wide set of olive ecotypes and varieties collected from several provinces of Iran, representing a high percentage of the entire olive resources present in the area, was screened with 49 chloroplast and ten nuclear simple sequence repeat markers, and coupled with archaeo-botanical and historical data on Mediterranean olive varieties. Approximate Bayesian Computation was applied to define the demographic history of olives including Iranian germplasm, and species distribution modelling was performed to understand the impact of the Late Quaternary on olive distribution. The results of the present study demonstrated that: (1) the climatic conditions of the last glacial maximum had an important role on the actual olive distribution, (2) all Iranian olive samples had the same maternal inheritance as Mediterranean cultivars, and (3) the nuclear gene flow from the Mediterranean basin to the Iranian plateau was almost absent, as well as the contribution of subspecies cuspidata to the diversity of Iranian olives. Based on this evidence, a new scenario for the origin and distribution of this important fruit crop has been traced. The evaluation of olive trees growing in the eastern part of the Levant highlighted a new perspective on the spread and distribution of olive, suggesting two routes of olive differentiation, one westward, spreading along the Mediterranean basin, and another moving towards the east and reaching the Iranian plateau before its domestication. © The Author 2017. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com

  10. Bioactive properties of the main triterpenes found in olives, virgin olive oil, and leaves of Olea europaea.

    Science.gov (United States)

    Sánchez-Quesada, Cristina; López-Biedma, Alicia; Warleta, Fernando; Campos, María; Beltrán, Gabriel; Gaforio, José J

    2013-12-18

    Oleanolic acid, maslinic acid, uvaol, and erythrodiol are the main triterpenes present in olives, olive tree leaves, and virgin olive oil. Their concentration in virgin olive oil depends on the quality of the olive oil and the variety of the olive tree. These triterpenes are described to present different properties, such as antitumoral activity, cardioprotective activity, anti-inflammatory activity, and antioxidant protection. Olive oil triterpenes are a natural source of antioxidants that could be useful compounds for the prevention of multiple diseases related to cell oxidative damage. However, special attention has to be paid to the concentrations used, because higher concentration may lead to cytotoxic or biphasic effects. This work explores all of the bioactive properties so far described for the main triterpenes present in virgin olive oil.

  11. Identification and Assessment of the Potential Allergenicity of 7S Vicilins in Olive (Olea europaea L.) Seeds.

    Science.gov (United States)

    Jimenez-Lopez, Jose C; Zafra, Adoración; Palanco, Lucía; Florido, José Fernando; Alché, Juan de Dios

    2016-01-01

    Olive seeds, which are a raw material of interest, have been reported to contain 11S seed storage proteins (SSPs). However, the presence of SSPs such as 7S vicilins has not been studied. In this study, following a search in the olive seed transcriptome, 58 sequences corresponding to 7S vicilins were retrieved. A partial sequence was amplified by PCR from olive seed cDNA and subjected to phylogenetic analysis with other sequences. Structural analysis showed that olive 7S vicilin contains 9 α-helixes and 22 β-sheets. Additionally, 3D structural analysis displayed good superimposition with vicilin models generated from Pistacia and Sesamum. In order to assess potential allergenicity, T and B epitopes present in these proteins were identified by bioinformatic approaches. Different motifs were observed among the species, as well as some species-specific motifs. Finally, expression analysis of vicilins was carried out in protein extracts obtained from seeds of different species, including the olive. Noticeable bands were observed for all species in the 15-75 kDa MW interval, which were compatible with vicilins. The reactivity of the extracts to sera from patients allergic to nuts was also analysed. The findings with regard to the potential use of olive seed as food are discussed.

  12. Effect of agronomical practices on carpology, fruit and oil composition, and oil sensory properties, in olive (Olea europaea L.).

    Science.gov (United States)

    Rosati, Adolfo; Cafiero, Caterina; Paoletti, Andrea; Alfei, Barbara; Caporali, Silvia; Casciani, Lorena; Valentini, Massimiliano

    2014-09-15

    We examined whether some agronomical practices (i.e. organic vs. conventional) affect olive fruit and oil composition, and oil sensory properties. Fruit characteristics (i.e. fresh and dry weight of pulp and pit, oil content on a fresh and dry weight basis) did not differ. Oil chemical traits did not differ except for increased content of polyphenols in the organic treatments, and some changes in the acidic composition. Sensory analysis revealed increased bitterness (both cultivars) and pungency (Frantoio) and decreased sweetness (Frantoio) in the organic treatment. Fruit metabolomic analysis with HRMAS-NMR indicated significant changes in some compounds including glycocholate, fatty acids, NADPH, NADP+, some amino acids, thymidine, trigonelline, nicotinic acid, 5,6-dihydrouracil, hesanal, cis-olefin, β-D-glucose, propanal and some unassigned species. The results suggest that agronomical practices may have effects on fruit composition that may be difficult to detect unless a broad-spectrum analysis is used. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Comparison of some chemical parameters of a naturally debittered olive (Olea europaea L.) type with regular olive varieties.

    Science.gov (United States)

    Aktas, Ayse Burcu; Ozen, Banu; Tokatli, Figen; Sen, Ilknur

    2014-10-15

    Some olives grown in Karaburun peninsula in the west part of Turkey and mostly coming from Erkence variety lose their bitterness while still on the tree and are called Hurma among locals. This olive type does not require further processing to remove the bitter compounds. In this study, sugar, organic acid and fatty acid profiles of Hurma, Erkence (not naturally debittered) and Gemlik (commonly consumed as table olive) olives were determined throughout 8weeks of maturation period for two consecutive harvest seasons, and the results were analysed by principal component analysis (PCA). PCA of sugar and organic acid data revealed a differentiation in terms of harvest year but not on variety. Hurma olive is separated from others due to its fatty acid profile, and it has higher linoleic acid content compared to others. This might be an indication of increased desaturase enzyme activity for Hurma olives during natural debittering phase. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Differences in the Neuroprotective Effect of Orally Administered Virgin Olive Oil (Olea europaea) Polyphenols Tyrosol and Hydroxytyrosol in Rats.

    Science.gov (United States)

    De La Cruz, José Pedro; Ruiz-Moreno, Maria Isabel; Guerrero, Ana; Reyes, José Julio; Benitez-Guerrero, Adela; Espartero, José Luis; González-Correa, José Antonio

    2015-07-01

    The neuroprotective effect of virgin olive oil (VOO) polyphenols has been related to their antioxidant effect. The main objective was to analyze how tyrosol and hydroxytyrosol contribute to the antioxidant and neuroprotective effects of VOO in a model of hypoxia-reoxygenation in rat brain slices. Rats were treated per os (po) (10 or 20 mg/kg/day) with hydroxytyrosol ethyl ether (HTEE), tyrosol ethyl ether (TEE), or 3,4-di-o-methylidene-hydroxytyrosol ethyl ether (MHTEE), used as a negative control for antioxidant effects. Lipid peroxidation was inhibited with HTEE, TEE, and MHTEE (from 5.0 ± 1.5 to 2.6 ± 1.5, 4.5 ± 1.5, and 4.8 ± 1.5 nmol/mg protein, respectively). However, all three compounds had similar neuroprotective effects: from 2.8 ± 0.07 to 1.8 ± 0.02 arbitrary units for HTEE, 1.4 ± 0.09 arbitrary units for TEE, and 1.3 ± 0.2 arbitrary units for MHTEE. All three compounds inhibited 3-nitrotyrosine production (from 3.7 ± 0.3 to 1.2 ± 0.03 nmol/0.1 g tissue for HTEE, 1.0 ± 0.2 nmol/0.1 g tissue for TEE, and 1.3 ± 0.1 nmol/0.1 g tissue for MHTEE), prostaglandin E2 production (from 55.7 ± 2.2 to 46.4 ± 1.9 pg/0.1 g tissue for HTEE, 24.7 ± 1.3 pg/0.1 g tissue for TEE, and 27.6 ± 2.6 pg/0.1 g tissue for MHTEE), whereas only HTEE inhibited IL1β production (from 35.7 ± 1.5 to 21.6 ± 0.8 pg/0.1 g tissue). Pearson correlation coefficients related neuroprotective effect with an antioxidant effect for HTEE (R = 0.72, p < 0.001), and inhibition of nitrosative stress (R = 0.78, 0.67, and 0.66 for HTEE, TEE, and MHTEE, respectively, p < 0.001) and inflammatory mediators (R = 0.72, 0.79, and 0.64 for HTEE, TEE, and MHTEE, respectively, p < 0.001) with all three compounds.

  15. Effect of Olive Leaf (Olea europaea) Powder on Laying Hens Performance, Egg Quality and Egg Yolk Cholesterol Levels.

    Science.gov (United States)

    Cayan, H; Erener, G

    2015-04-01

    This experiment was conducted to measure the effects of olive leaf powder on performance, egg yield, egg quality and yolk cholesterol level of laying hens. A total of 120 Lohmann Brown laying hens of 22 weeks old were used in this experiment. The birds were fed on standard layer diets containing 0, 1%, 2%, or 3% olive leaf powder for 8 weeks. Egg weight and yield were recorded daily; feed intake weekly; egg quality and cholesterol content at the end of the trial. Olive leaf powder had no effect on feed intake, egg weight, egg yield and feed conversion ratio (p>0.05) while olive leaf powder increased final body weight of hens (pcholesterol content was tended to decrease about 10% (p>0.05). To conclude, olive leaf powder can be used for reducing egg yolk cholesterol content and egg yolk coloring agent in layer diets.

  16. Effect of Olive Leaf (Olea europaea) Powder on Laying Hens Performance, Egg Quality and Egg Yolk Cholesterol Levels

    OpenAIRE

    Cayan, H.; Erener, G.

    2015-01-01

    This experiment was conducted to measure the effects of olive leaf powder on performance, egg yield, egg quality and yolk cholesterol level of laying hens. A total of 120 Lohmann Brown laying hens of 22 weeks old were used in this experiment. The birds were fed on standard layer diets containing 0, 1%, 2%, or 3% olive leaf powder for 8 weeks. Egg weight and yield were recorded daily; feed intake weekly; egg quality and cholesterol content at the end of the trial. Olive leaf powder had no effe...

  17. Clinical characterization of OSL dosimeters for use in dosimetry of teletherapy beams in conventional fractionation; Caracterizacion clinica de dosimetros OSL para su uso en dosimetria de haces de teleterapia en fraccionamiento convencional

    Energy Technology Data Exchange (ETDEWEB)

    Lopez V, A.; Gutierrez M, J. G.; Rivera M, T. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria No. 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Velazquez T, J. J., E-mail: jggm25@yahoo.com.mx [Centro Medico Nacional Siglo XXI, Hospital de Oncologia, Departamento de Fisica Medica, Av. Cuauhtemoc No. 330, Col. Doctores, 06720 Mexico D. F. (Mexico)

    2015-10-15

    Optically stimulated materials are increasingly used for dosimetry in clinical settings; to be sure of the obtained reading their proper clinical characterization is necessary. Is important to know the homogeneity of a batch, reproducibility, be exposed to the same conditions of irradiation repeatedly and other dependences that could present such as energy, angular, the type of radiation which are exposed and the dose deposited in them. For characterization they were designed and implemented tests for each of the factors of interest, taking into account the need for them (calculations, manufacture of mannequins, conditions, practicality, etc.) It was shown that we can apply this dosimetry in clinical practice within a radiotherapy center, relying on the readings and practicality. (Author)

  18. Discussão genetico-clinica sobre a Síndrome de Apert: a propósito de um caso Apert's syndrome: clinical-genetic discussion and a case report

    Directory of Open Access Journals (Sweden)

    Aguinaldo Gonçalves

    1976-09-01

    Full Text Available Após breve introdução sobre a síndrome de Apert, é relatado um caso clínico, sendo destacada a conduta genético-clínica. A discussão revela como os aspectos genéticos envolvidos orientam o raciocínio clínico.After a short introduction about the so-called Apert's syndrome, a clinical suggestive case is reported. Discussion shows how a clinic-genetical procedure may help the clinicians.

  19. Pineal metastasis as first clinical manifestation of colorectal adenocarcinoma: case report Metástase pineal como primeira manifestação clinica de adenocarcinoma colorretal: relato de caso

    Directory of Open Access Journals (Sweden)

    RICARDO RAMINA

    1999-03-01

    Full Text Available Cerebral metastases from colorectal adenocarcinomas occur in 8% of the cases. Diagnosis is usually made when primary disease and widespread metastases are already known. We report the case of a patient with single metastases in the pineal region as the first clinical manifestation of a colorectal adenocarcinoma. A 48-year-old female with Parinaud's syndrome for 15 days prior her admission was evaluated in our clinic. She had no symptoms or signs of colorectal disease. MRI examination revealed an heterogeneous lesion with peritumoral gadolinium enhancement, located in the pineal region. The tumor was radically resected through an infratentorial/supracerebellar approach. Histology showed metastatic carcinoma and immunohistochemical examination showed gastrointestinal tract adenocarcinoma. Metastases to the pineal region are extremely rare and should be considered in the differential diagnosis of tumors of this region.Metástases cerebrais derivadas de adenocarcinomas colorretais ocorrem em 8% dos casos. Geralmente a doença primária e as metástases em outros órgãos já são conhecidas quando do momento das manifestações neurológicas. Descrevemos um caso de metástase única na região pineal que promoveu a primeira manifestação clínica de adenocarcinoma colorretal. Uma mulher de 48 anos de idade apresentava há quinze dias de sua admissão ao nosso serviço diplopia e síndrome de Parinaud . O exame de ressonância magnética revelou lesão heterogênea localizada na região pineal. O tumor foi completamente retirado por acesso infratentorial/supracerebelar. O exame histológico revelou tumor metastático indiferenciado e o exame imuno-histoquímico demostrou adenocarcinoma do trato gastrointestinal moderadamente diferenciado. Metástases para a região pineal são extremamente raras e devem ser consideradas no diagnóstico diferencial de tumores nesta região.

  20. Gingival healing after gingivectomy procedure and low intensity laser irradiation. A clinical and biometrical study in anima nobile; Reparacao gengival apos a tecnica de gengivectomia e aplicacao de laser em baixa intensidade. Avaliacao clinica e biometrica em humanos

    Energy Technology Data Exchange (ETDEWEB)

    Amorim, Jose Claudio Faria

    2001-07-01

    For the present study seven patients presenting periodontal disease were selected in a way that they required the performance of gingivectomy procedure in the region of premolars in both sides, being this in the upper or lower region. After the surgical procedure one side was submitted to low intensity laser radiation, wavelength 685 nm, power 50 mW and fluency of 4J/cm{sup 2}, contact mode. The other side was used as a control, not receiving any laser irradiation. Healing process for both sides, was clinically and biometrically evaluated and compared using photographs for the periods: pre-operative, immediate post-operative, 3, 7,14,21, 28 and 35 days. The analysis was performed by 3 specialists in Periodontology considering aspects of healing. Results were submitted to statistical analysis. Biometrical evaluation showed improvement of healing for the period of 21 and 28 days in the lased group. Clinical evaluation showed better reparation mainly after the third day for the active group. Laser group was considered to present an improved healing when compared to the control group. (author)

  1. Influence of the curve density relative electron in dosimetry clinic in treatments stereo tactics; Influencia de la curva de densidad electronica relativa en la dosimetria clinica en tratamientos estereotaxicos

    Energy Technology Data Exchange (ETDEWEB)

    Moreno Saiz, C.; Benitez Villegas, E. M.; Casado Villalon, F. J.; Parra Osorio, V.; Bodineau Gil, C.; Garcia Pareja, S.

    2013-07-01

    The objective of this study is to analyze the difference between clinical dosimetry in the treatments with radiosurgery and stereotactic radiotherapy fractional obtained from the relative Electron density curve (Schneider 1996) tabulated and provided with the scanner's radiation therapy. (Author)

  2. Temporal evolution of the environmental dose remaining in a clinical irradiation bunker after the cessation of irradiation; Evolucion temporal de la Dosis ambiental remanente en un bunker de irradiacion clinica tras el cese de la irradiacion

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Egea, E.; Sanchez Carrascal, M.; Torres Pozas, S.; Monja Ray, P. de la; Perez Molina, J. L.; Madan Rodriguez, C.; Luque Japon, L.; Morera Molina, A.; Hernandez Perez, A.; Barquero Bravo, Y.; Morengo Pedagna, I.; Oliva Gordillo, M. C.; Martin Olivar, R.

    2011-07-01

    In this paper we try to quantify the dose emitted by different radioactive processes that occur in the head of a clinical linear accelerator and the patient is irradiated, or walls of the bunker, converted into tertiary sources of radiation trying to establish the origin of the came in different parts of the bunker.

  3. PET/MRI: a novel hybrid imaging technique: major clinical indications and preliminary experience in Brazil; PET/RM: um novo metodo de imagem hibrida: principais indicacoes clinicas e experiencia preliminar no Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Vitor, Taise; Martins, Karine Minaif; Ionescu, Tudor Mihai and others, E-mail: taisevitor@gmail.com [Hospital Israelita Albert Einstein, Sao Paulo, SP (Brazil)

    2017-04-01

    In recent years, medical imaging with hybrid techniques has widely accepted and employed in clinical routine. PET/MRI offers significant advantages, including excellent contrast and resolution and reduced ionizing radiation, as compared to well-established PET/ CT. Therefore, PET/MRI is a promising modality for oncologic imaging of some regions, such as brain, head and neck, liver and pelvis. This article set out to analyze clinical conditions that could benefit from PET/MRI imaging based on our caseload. The potential of PET/MRI to become the imaging modality of choice for assessment of neurologic and oncologic conditions associated with soft tissues is highlighted. Clinical aspects of PET/MRI and its application to clinical cases are illustrated with examples extracted from the authors' preliminary experience. (author)

  4. Estudio retrospectivo de las afecciones obstructivas de las vias aereas superiores en equinos adultos presentados a la clinica para grandes animales de la universidad nacional de colombia entre 1993 y 2007

    OpenAIRE

    Martínez, D. A.; Oliver, O. J.

    2012-01-01

    Un total de 44 historias de animales admitidos en la Clínica para Grandes Animales de la Universidad Nacional de Colombia fueron analizadas, para determinar cuales fueron las entidades más prevalentes en el tracto respiratorio superior (cavidad nasal, faringe y laringe) de estos equinos. Se determinó que el desplazamiento dorsal del paladar blando, la hemiplejia laríngea, la hiperplasia faríngea linfoide y las neoplasias fueron las mas prevalentes con 38.64%, 34.09%, 18.18% y 9.09% respectiva...

  5. Nd:YAG laser in caries prevention: a clinical study; Avaliacao clinica da eficiencia do laser de Nd:YAG associado ao fluor fosfato acidulado na prevencao de caries de sulcos e fissuras de criancas e adolescentes

    Energy Technology Data Exchange (ETDEWEB)

    Boari, Heloisa Gomes Dimiranda

    2000-07-01

    The caries prevention by using laser irradiation has been investigated during the last 30 years. The Nd: YAG laser associated with acidulated phosphate fluoride has been shown as a very promising technique for enamel caries prevention. The aim of this work was to clinically evaluate the efficiency of Nd: YAG laser associated with acidulated phosphate fluoride in pit and fissure caries prevention of children and adolescents. In this work it was determined the dye that enhance the effect of Nd: YAG laser in enamel. It was selected 242 pre-molar and molar teeth from 33 children and adolescents, aged from 7 to 15 years old. The selected teeth were free from caries or decalcification marks (active white marks) to the clinical and radiographic exams. The teeth were divided into two groups: the first group was laser irradiated and their homologous remained as a control. The right side teeth were dye-assisted Nd:YAG laser irradiated. The dye solution was a moisture of dust coal and equal parts of water and alcohol. The irradiation conditions were 60 mJ/10 Hz, optical fiber in contact mode, with diameter of 300 {mu}m, resulting in an energy density of 84,9 J/cm{sup 2}. The oclusal surface of the teeth was completely irradiated, specially on the slopes and in the deepest part of the pits and fissures. This procedure was repeated three times. In the sequence it was applied the acidulated phosphate fluoride for 4 minutes. On the left side teeth - control group- only acidulated phosphate fluoride was applied for the same time. The final examination considered the presence of caries and active white marks after a period of one year. There were statistical significant differences (p < 0.01) between the lased + fluoride group and the non irradiated group. The present study concluded that the technique used in this work can be an alternative clinical method for caries prevention. (author)

  6. Specialized consultant in radiological safety to the Reforma peripheral clinic, PEMEX. - III. - September and October of 2002; Asesoria especializada en seguridad radiologica a la clinica periferica Reforma, PEMEX.- III.- Septiembre y Octubre de 2002

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Rodriguez A, F.; Garcia A, J

    2003-02-15

    The Reforma peripheral clinic, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the clinic can conserve its respective sanitary license.(Author)

  7. Specialized consultant in radiological safety to the Reforma peripheral clinic, PEMEX. - IV. - November and December of 2002; Asesoria especializada en seguridad radiologica a la clinica periferica Reforma, PEMEX.- IV.- Noviembre y Diciembre de 2002

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Hernandez C, J. E.; Rodriguez A, F.; Garcia A, J

    2003-02-15

    The Reforma peripheral clinic, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray quipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the clinic can conserve its respective sanitary license.(Author)

  8. Advantages and Limitations of BiRads''tm System Application in Clinical Practice; Ventajas y limitaciones de la aplicacion del sistema BI-RADS''TM en la practica clinica

    Energy Technology Data Exchange (ETDEWEB)

    Torres Tabanera, M. [Hospital de la Rioja. Logrono (Spain); Acebal Blanco, M. M. [Hospital Costa del Sol. Marbella (Spain)

    2004-07-01

    The BiRads''Tm system (Breast-Imaging Report and Database System) was created by the American College of Radiology in 1992 with the participation of other American scientific societies. It is a quality assurance tool designed to standardize mammographic reports, reduce confusion in the interpretation of breast images and facilitate the monitoring of results. It consists of five sections: breast Imaging Lexicon, Reporting System, Follow-up and Outcome Monitoring, National Mammography Database and Appendices. It was designed in order to create a common lexicon, universally accepted by breast pathology specialists, which would standardize both content and format of mammographic reports, as well as constitute a tool for continuing quality improvement. However, these promising objectives give rise to some serious controversies when sufficient experience is gained in a daily clinical use of the system. In this study, the advantages and contributions of Bi-Rads''TM system use is reviewed. Drawbacks are also cited, based on then years experience, with regard to lexicon, categories and recommendations. (Author)

  9. Octavius 4D: Initial state of reference and clinical implementation of a new equipment for checks VMAT; Octavius 4D: Estado de referencia inicial e implementacion clinica de un nuevo equipamiento para verificaciones VMAT

    Energy Technology Data Exchange (ETDEWEB)

    Eno Olmos, J.; Carmona Mesequer, V.; Lliso Vlaverde, F.; Garcia Martinez, M. t.; Pujades Claumarchiran, M. C.; Palomo Llinares, R.; Ballester Pallares, F.; Perez-Calatayud, J.

    2013-07-01

    The objective of this work is the establishment of the State of initial reference of a new system of measurement with the above capabilities, as well as the evaluation of its use in clinical routine. (Author)

  10. ERI and initial clinical experience with dosimetry check, a commercial software for dosimetry in vivo volumetric; ERI y experiencia clinica inicial con dosimetry check, un software comercial para dosimetria in vivo volumetrica

    Energy Technology Data Exchange (ETDEWEB)

    Pujades Claumarchirant, M. C.; Gimeno Olmos, J.; Garcia Martinez, T.; Carmona Meseguer, V.; Lliso Valverde, F.; Palomo Llinares, R.; Ballester Pallares, F.; Perez Calatayud, J.

    2013-07-01

    The objective of this work is to study the differences in dose at a point of reference between the result of calculation of dose and the planning system to establish a level of uncertainty of the system. In addition, evaluates its use in clinical routine and presents results obtained with the first patients. (Author)

  11. OCTAVIUS 4D: Commissioning and routine clinical use of a device for VMAT verifications; OCTAVIUS 4D: establecimiento del estado de referencia inicial y uso en rutina clinica de un dispositivo para verifiicaciones VMAT

    Energy Technology Data Exchange (ETDEWEB)

    Gimeno Olmos, J.; Candela Juan, C.; Palomo Linares, R.; Carmona Meseguer, V.; Lliso Valverde, F.; Ballester Pallares, F.; Perez Calatayud, J.

    2015-07-01

    Purpose: To commission OCTAVIUS 4D and its arrays 729 and 1000 SRS for VMAT patient-specific QA verifications, and to provide clinical results obtained with this device. Methods: The performance of both arrays was analysed by evaluating: homogeneity, linearity, reproducibility and leakage current. The accuracy of the dose reconstruction of OCTAVIUS 4D with array 729 was evaluated through ion chamber measurements at several points of interest. The performance of both arrays was compared for the same clinical plans. Finally, results of the 3D gamma analysis performed in our hospital for more than 900 patient plans are provided. Results: Both arrays present good homogeneity, linearity, reproducibility, and negligible leakage current. Dose differences between OCTAVIUS-calculated doses and ion chamber measurements or TPS-calculated doses were within 2% for single field plans, and within 4% for clinical plans. The mean value of the local gamma passing rate (3%/3 mm) of clinical plans verified with array 729 is 89.7%, whereas for 1000 SRS it is 97.8%. Conclusions: OCTAVIUS 4D provides accurate 3D dose reconstructions from 2D dose measurements. Clinical results here presented may be used to establish reference levels for VMAT verifications with this device. (Author)

  12. Dosimetry characterization and clinical application of Exa skin: Bolus of high of high density for use with photons; Caracterizacion dosimetrica y aplicacion clinica de Exaskin: bolus de alta densidad para uso con fotones

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz Seidel, M.; Velazquez Miranda, S.

    2013-07-01

    Bolus of high density eXaSkin of density 1.6 g/cm{sub 3} is calculated correctly in the planning systems, is easy to use and generates optimum coupling with the radiation area, at the same time which is easily reproducible in their placement, avoiding the use of electron beams. On the other hand its behavior varies very slightly with the presence of air gaps. (Author)

  13. Development and clinical implementation of a global software use and analysis of radiochromic s films; Desarrollo e implementacion clinica de un software global de uso y analisis de peliculas radiocromicas

    Energy Technology Data Exchange (ETDEWEB)

    Gimeno Olmos, J.; Martinez Fernandez, J. M.; Pastor Sanchis, V.; Gonzalez Perez, V.; Guardino de la Flor, C.; Dolores Alemany, V. de los; Crispin Contreras, V.

    2011-07-01

    The aim of this study was to gather information in one solution the different processes that occur with the use of radiochromic films: calibration, reading, corrections, step-absorbed dose, dose distribution analysis and comparison with reference distributions.

  14. Method for calibration of asymmetric jaws in hemi fields techniques and effects in clinical practice; Metodo para la calibracion de las mandibulas asimetricas en tecnicas de hemicampos y efectos en la practica clinica

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez Masgrau, V.; Sempau Roma, J.; Abella Cereigido, R.; Lopez Sanchez, M.; Perez Fernandez, M.; Gonzalez Leyba, M.; Artigues Pedrola, M.

    2013-07-01

    This paper presents a method improved very significantly the accuracy of calibration, providing a good homogeneity of the dose distribution in the area of union of fields. Also evaluates the effect that has this new calibration in clinical practice. (Author)

  15. Accounting of costs in a service of physical health. Relative units of value in dosimetry clinic in teletherapy; Contabilidad de costes en un servicio de fisica medica. Unidades relativas de valor en dosimetria clinica en teleterapia

    Energy Technology Data Exchange (ETDEWEB)

    Font Gomez, J. A.; Gandia Martinez, A.; Jimenez Albericio, F. J.; Andres Redondon, M. M.; Mengual Gil, M. A.

    2013-07-01

    A single - although laborious - start in the economic and clinical management of our units can be come to the knowledge of the time invested in the tasks functional, having to differentiate them, name them and even encrypt them. The time spent in performing the tasks multiplied by the annual number of these will indicate the resources necessary to achieve our objectives. In addition, pooling the values of times that members of the Unit provide analysed inter-workers dispersal, their causes and possible solutions. The establishment of relative units of value in any process benefits all workers involved in the process since it allows to know the dispersion of the times that each person employed in the development of the tasks. (Author)

  16. Specialized consultant in radiological safety to the south central hospital of high speciality, PEMEX. IV. - October of 2001; Asesoria especializada en seguridad radiologica a la clinica al hospital central sur de alta especialidad, PEMEX. IV.- Octubre de 2001

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Vizuet G, J.; Benitez S, J. A.; Garcia A, J.; Rodriguez A, F

    2002-01-15

    The south central hospital of high speciality, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the hospital can conserve its respective sanitary license.(Author)

  17. Specialized consultant in radiological safety to the clinical north central hospital of high speciality, PEMEX. IV. - December of 2001; Asesoria especializada en seguridad radiologica a la clinica hospital central norte de alta especialidad, PEMEX. IV.- Diciembre de 2001

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Vizuet G, J.; Benitez S, J. A.; Garcia A, J.; Rodriguez A, F

    2002-01-15

    The clinical north central hospital of high speciality, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the hospital can conserve its respective sanitary license.(Author)

  18. Contributions to the problems of generalization in the phonological intervention: a clinical approach Contribuições para os problemas de generalização em intervenção fonológica: uma abordagem clinica

    Directory of Open Access Journals (Sweden)

    Víctor M. Acosta Rodríguez

    2007-03-01

    Full Text Available PURPOSE: to describe the procedure which could be useful for teachers and speech therapists engaged within a school context, in the treatment of the phonological mistakes exhibited by children during their primary-school education. It is an attempt to present an intra-subject study and to observe the generalization suffered by the untrained phonemes and processes during the training of a phoneme. METHODS: two children with phonological impairment participated in this research. A Test of Phonology Acosta et al. (1998 was used for the analysis of the simplifications and, later on, an intervention program by minimal pairs was applied. RESULTS: the results seem to indicate that the treatment should start with the process affecting more phonemes and that the most difficult; for example, the phoneme where the process is compulsory applied, should be chosen as the one to be trained. CONCLUSION: the results showed that treatment must begin with the process that affects a major number of phonemes which have more difficulty in their production.OBJETIVO: descrever procedimento de intervenção fonológica. MÉTODOS: duas crianças com transtorno fonológico participaram do estudo. Foi aplicada a prova de Fonologia de Acosta et al. (1998 para o levantamento das simplificações e, posteriormente, aplicado o programa de intervenção por pares mínimos. RESULTADOS: observou-se generalização dos fonemas e processos fonológicos não treinados durante o tratamento. CONCLUSÃO: os resultados indicam que o tratamento deve começar por aqueles processos que afetam um maior número de fonemas e que apresentam maior dificuldade em sua produção.

  19. Elements determination of clinical relevance in biological tissues Dmd{sup mdx}/J dystrophic mice strains investigated by NAA; Determinacao de elementos de relevancia clinica em tecidos biologicos de camundongos distroficos Dmd{sup mdx}/J por AAN

    Energy Technology Data Exchange (ETDEWEB)

    Metairon, Sabrina

    2012-07-01

    In this work the determination of chemistry elements in biological tissues (whole blood, bones and organs) of dystrophic mice, used as animal model of Duchenne Muscular Dystrophy (DMD), was performed using analytical nuclear technique. The aim of this work was to determine reference values of elements of clinical (Ca, Cl, K, Mg, Na) and nutritional (Br and S) relevance in whole blood, tibia, quadriceps and hearts from Dmdmdx/J (10 males and 10 females) dystrophic mice and C57BL/6J (10 males) control group mice, using Neutron Activation Analysis technique (NAA). To show in more details the alterations that this disease may cause in these biological tissues, correlations matrixes of the DMD{sup mdx}/J mouse strain were generated and compared with C57BL/6J control group. For this study 119 samples of biological tissue were irradiated in the IEA-R1 nuclear reactor at IPEN (Sao Paulo, Brazil). The concentrations of these elements in biological tissues of Dmd{sup mdx}/J and C57B/6J mice are the first indicative interval for reference values. Moreover, the alteration in some correlation coefficients data among the elements in the health status and in the diseased status indicates a connection between these elements in whole blood, tibia, quadriceps and heart. These results may help the researchers to evaluate the efficiency of new treatments and to compare the advantages of different treatment approaches before performing tests in patients with muscular dystrophy. (author)

  20. Avaliaçao clinica e eletromiografica de musculos da mastigação, em policiais militares com DTM, antes e apos o uso de dispositivos inter-oclusais

    OpenAIRE

    Reinaldo José Antonio de Faria

    2006-01-01

    Resumo: Introdução: A Disfunção Têmporo-Mandibular é uma alteração articular de origem multifatorial que acomete grande parte da população mundial, em especial aqueles expostos a altos índices de stress, como os Policiais Militares. O presente estudo teve como objetivo investigar, através de exame clínico (RDC) e eletromiográfico, o comportamento dos músculos temporal, masseter e suprahioideos, em Policias Militares do 18º Batalhão da Polícia Militar do Estado de São Paulo, portadores de DTM ...

  1. EFECTO IN VITRO DE LA UNCARIA TOMENTOSA, DEL MTA Y DEL HIDROXIDO DE CALCIO EN LA VIABILIDAD CELULAR, MORFOLOGIA NUCLEAR Y INTEGRIDAD DEL ADN EN PULPA DENTAL DE PIEZAS DENTARIAS EXTRAIDAS, CLINICA ODONTOLOGICA PARTICULAR. AREQUIPA, 2011

    OpenAIRE

    LÓPEZ HUAMÁN, GIOVANNI

    2013-01-01

    UNCARIA TOMENTOSA ANTECEDENTES HISTÓRICOS CLASIFICACIÓN BOTÁNICA COMPOSICIÓN QUÍMICA PROPIEDADES FARMACOLÓGICAS TOXICIDAD Y CONTRAINDICACIONES EFECTOS MTA HIDRÓXIDO DE CALCIO COMPLEJO DENTINO PULPAR RECUBRIMIENTO PULPAR DIRECTO VIABILIDAD CELULAR MORFOLOGÍA NUCLEAR ESTRUCTURA DEL ADN

  2. Avaliação clínica da vertebroplastia percutânea transpedicular Evaluación clinica de la vertebroplastia transpedicular percutánea Clinic evaluation of transpedicular percutaneous vertebroplasty

    Directory of Open Access Journals (Sweden)

    André Rafael Hubner

    2011-01-01

    Full Text Available OBJETIVO: Avaliar a eficácia do efeito analgésico da vertebroplastia com polimetilmetacrilato (PMMA e da estabilização vertebral obtida nos pacientes com fraturas vertebrais patológicas e realizar uma revisão detalhada da técnica da vertebroplastia percutânea, analisando suas indicações. MÉTODOS: Análise retrospectiva de 64 procedimentos de vertebroplastia percutânea em 46 pacientes. Foram realizadas avaliações dos prontuários e das radiografias pré e pós-operatórias e em nova consulta de rotina, na qual foi aplicado o questionário de dor (escala analógica visual da dor. RESULTADOS: Entre os 46 pacientes analisados, 37 (80,4% eram do sexo feminino e 9 (19,6% do sexo masculino, com média de idade de 71 anos (desvio-padrão +/- 9,2, variando de 50 a 90 anos. Foram operados 64 níveis, com predomínio do segmento toracolombar, sendo realizadas 17 (26,6% vertebroplastias a maioria em pedículos de T12. Trinta e um pacientes (67,4% apresentaram apenas um nível fraturado, 12 (26,1% apresentaram 02 níveis operados e três pacientes (6,5% apresentaram 03 ou mais níveis operados. O diagnóstico de osteoporose foi o mais comum (33 casos, 71,7%. Quanto ao alívio da dor no pós-operatório, houve um alto índice de satisfação de 90 a 100% em 37 (80% pacientes. CONCLUSÃO: A vertebroplastia demonstra ser um procedimento eficaz no tratamento da dor por fratura patológica de coluna, sendo tamb��m utilizada em investigação diagnóstica (biópsia óssea. É um procedimento seguro com baixas taxas de complicações.OBJETIVO: Evaluar la eficacia del efecto analgésico y estabilización vertebral de la vertebroplastia con polimetilmetacrilato (PMMA en pacientes con fracturas patológicas de la columna vertebral, y realizar una revisión detallada de la técnica de vertebroplastia percutánea, analizando sus indicaciones. MÉTODOS: Evaluación retrospectiva de 64 fracturas tratadas en 46 pacientes sometidos a vertebroplastia percutánea en el período de enero de 2000 a diciembre de 2008. Los pacientes fueron evaluados por las historias clínicas, por las radiografías pre y postoperatorias y consultas de rutina en las cuales se realizaron encuestas de dolor (escala universal visual del dolor. RESULTADOS: 37 (80,4% eran mujeres y 9 (19,6% eran varones, con edad promedio de 71 años (desvío estándar de + / - 9,2, que oscila entre 50 y 90 años. 64 niveles fueron operados, con predominio de lo segmento torácico-lumbar, se realizaron 17 (26,6% la mayoría en pedículos vertebroplastia de T12. Treinta y un pacientes (67,4% tenían sólo un nivel de fractura, 12 pacientes (26,1% tenían 02 niveles y 03 (6,5% pacientes tenían 03 o más niveles de fractura. El diagnóstico de osteoporosis fue el más común (33 casos, el 71,7%. Cuanto al alivio del dolor postoperatorio, hubo un alto índice de satisfacción de 90 a 100% en 37 (80% pacientes. CONCLUSIÓN: La vertebroplastia es un procedimiento que probó ser eficaz en el tratamiento del dolor por fractura patológica de la columna, y también se utiliza con fines de diagnóstico (biopsia de hueso. Es un procedimiento seguro y tiene bajas tasas de complicaciones.OBJECTIVE: This paper evaluates the analgesic effect and obtained vertebral stability of percutaneous vertebroplasty with polymethylmethacrylate (PMMA in patients with vertebral pathological fractures, and performs a detailed revision of this technique. METHODS: A retrospective analysis of 64 percutaneous vertebroplasty procedures in 46 patients was performed. Patients were evaluated by medical records, pre and post-operative radiographs, and by pain status (visual analog pain scale. RESULTS: 37 (80.4% patients were female and 9 (19.6% male, with mean age of 71 years (standard deviation + / - 9.2, ranging from 50 to 90 years. Sixty-four levels were treated, with a predominance of thoracic-lumbar segment, the majority 17 (26.6% of vertebroplaties at T12 pedicle. Thirty-one patients (67.4% presented only one fractured level, 12 patients (26.1% presented 02 levels and three (6.5% presented 03 or more treated levels. Osteoporosis was the most common diagnosis (33 cases, 71.7%. A high satisfaction rate of 90 to 100% was observed to the majority of patients when considering relief of pain postoperatively. CONCLUSIONS: Vertebroplasty has proven to be an effective procedure to treat pain caused by pathological fracture, and it is also used for diagnostic investigation (bone biopsy. The technique is secure and has provided low complications rates.

  3. Specialized consultant in radiological safety to the Reforma peripheral clinic, PEMEX. - I. - May-June of 2003; Asesoria especializada en seguridad radiologica a la clinica periferica Reforma, PEMEX.- I.- Mayo-Junio de 2003

    Energy Technology Data Exchange (ETDEWEB)

    Torres P, A.; Garcia A, J.; Rodriguez A, F

    2003-07-15

    The Reforma peripheral clinic, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the clinic can conserve its respective sanitary license.(Author)

  4. Clinical and morphologic evaluation of Er:YAG laser action at the front of cervical dentinal hypersensitivity; Avaliacao clinica e morfologica da acao do laser de Er:YAG frente a hipersensibilidade dentinaria cervical

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, Dalva Maria

    2001-07-01

    This work was achieved in vivo and in vitro to evaluate the efficiency of Er:YAG laser in the cervical dentinal hypersensitivity treatment (HSDC). The Clinical study was achieved in patients with HSDC. The treatment was realized in five sessions: the first for selection, the second for exams (clinic and X-Ray) and trying to remove the etiologic factors that could cause the HSDC. The third and fourth sessions were subjected to the radiation with that protocol: 60 mJ energy ,2 Hz frequency, 6 mm out of focus, under air cooling, 20 seconds each application which the same was repeated four times with one minute breaks, which scanning movements and without using anaesthetics. The fifth was evaluation. The patients were evaluated and registered in a subject scale of pain 0 to 3, in the beginning and end of each session of irradiation, and one month after the last session. The results showed that for the irradiated group occurs significant differences in the beginning of each session and between. For the control group did not occur significant differences in the beginning and after each session, but did show a difference between the sessions. As the control group as the irradiated group, had reduction of sensibility between the session. For the morphologic study nine teeth were selected, 7 molars and 2 pre-molars from operative dentistry discipline. Half of the surface was irradiated with Er:YAG laser, the same protocol used in vivo, and the other half was used as a control without receiving any laser irradiation. Subsequently, specimens were prepared for SEM examinations. The results showed that laser treated surfaces showed a reduction of dentine tubular diameter with partial or total closure of the dentine tubules. For the control group, it was observed bigger amounts smear layer and open dentine tubular. The results obtained indicated that the Er:YAG laser can contribute to the HSDC treatment. (author)

  5. Importance of the effective atomic number (Z{sub eff}) of TL materials for radiation dosimetry in clinical applications; Importancia del numero atomico efectivo (Z{sub eff}) de materiales TL para dosimetria de la radiacion en aplicaciones clinicas

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez M, P.R. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: pgm@nuclear.inin.mx

    2008-07-01

    The electric power generation, it has been one of the radiation applications of bigger weight, mainly in developed countries. Another sector of more impact is without a doubt that of the medicine. However, for a sure operation with radiations, those international organisms of radiological safety, exist every time more precise detection systems. The thermoluminescent dosimetry is one of the more reliable methods for this purpose, for that several groups of investigators from different parts of the world, they have guided its investigations in the development of new TL materials. However, to avoid underestimate or overestimation of the measured dose with the use of these materials, it should take into account it effective atomic number (Z{sub eff}) it is well known that some TL materials considered as equivalent to the tissue, presents smaller TL intensity when being irradiated with low energy photons, while the TL material known as not equivalent to the tissue, they present the supra sensitivity effect for this radiation type. Nowadays, the estimate of the Z{sub eff} has not been clear, in this work the Z{sub eff} is determined by means of the traditional methods and an own method is presented for its determination. The results of the TL signal of different materials, when being irradiated with photons of effective energy between 24 keV and 1.25 MeV and their relationship with their calculated Z{sub eff} are also presented. (Author)

  6. Dissection of the sentry ganglion by laparoscopic boarding in patients with cervix uterine cancer clinical stages IA2 at IIB; Diseccion de ganglio centinela por abordaje laparoscopico en pacientes con cancer cervicouterino etapas clinicas IA2 a IIB

    Energy Technology Data Exchange (ETDEWEB)

    Valdez U, J.J.; Pichardo M, P.A.; Cortes M, G.; Escudero de los Rios, P. [Hospital de Oncologia. Centro Medico Nacional Siglo XXI. IMSS, Mexico D.F. (Mexico)

    2005-07-01

    The obtained results in presently study demonstrate that the feasibility of the detection of the sentry ganglion in cervix uterine cancer using a boarding by laparoscopic via, being necessary the use of twice labelled as much with patent blue and radioisotope (colloid of labelled rhenium with {sup 99m}Tc, total dose of 3 MCi) to achieve the identification of the ganglion. (Author)

  7. Specialized consultant in radiological safety to the Macuspana peripheral clinic, PEMEX. - IV. - November and December of 2002; Asesoria especializada en seguridad radiologica a la clinica periferica Macuspana, PEMEX.- IV.- Noviembre y Diciembre de 2002

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Hernandez C, J. E.; Garcia A, J.; Rodriguez A, F

    2003-02-15

    The Macuspana peripheral clinic, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the clinic can conserve its respective sanitary license.(Author)

  8. Use of clinical practice as a motivating tool of radioprotection teaching and radiopharmacology in early semesters of pharmacy course; Uso da pratica clinica como ferramenta motivadora de ensino de radioprotecao e radiofarmacologia em semestres iniciais em cursos de farmacia

    Energy Technology Data Exchange (ETDEWEB)

    Andrighetto, Daniela; Lüdke, Everton, E-mail: daniela.andrighetto@hotmail.com, E-mail: evertonludke@gmail.com [Universidade Federal de Santa Maria (CCNE/DEFIS/UFSM), RS (Brazil). Departamento de Fisica

    2014-07-01

    The research teaching methods aimed at the success of the higher education student in pharmacology and medicine courses in technical expertise in the fields of radiological protection, radiopharmacology and interventional radiology is extremely important in view of the progress of these sectors. The objective of this work is to propose a methodological sequence of teaching work with first-year students of pharmacy and medicine courses within a biophysical discipline where the integrated knowledge to clinical practice can be used for this purpose. The methodology was to assess individual learning of a group of N = 49 students of the first half in the age group of 17-19 years through conceptual acquisition by the traditional method of 'blackboard and chalk' and developed method that includes four pedagogical moments focused on the area health. An analysis of the evaluation student performance through Variance Analysis of a pathway showed improved scores with respect to the performance of application issues of knowledge concerning radiation protection and biological mechanisms of radiation with respect to the method of 'blackboard and chalk' with p < 0.05. Therefore, work with students with respect to the content in the form of six steps of clinical interest are a promising technique for radiation protection education in the early grades of college courses with experimental effectiveness.

  9. Biological control of olive fruit fly in California – release, establishment and impact of Psyttalia lounsburyi and Psyttalia humilis

    Science.gov (United States)

    The invasive olive fruit fly Bactrocera oleae (Rossi) (Diptera: Tephritidae) likely originated in sub-Saharan Africa, where the wild olive Olea europaea cuspidata L. (Wall. ex G. Don) is found and from which the domesticated olive O. europaea europaea L. was derived. Following the path of olive cult...

  10. Efeito da incorporação de folhas de oliveira (Olea europaea L. no desenvolvimento e qualidade da carne de frangos

    Directory of Open Access Journals (Sweden)

    Cristiane MARANGONI

    2015-09-01

    Full Text Available Resumo Foi realizada suplementação de folhas de oliveira na ração de frangos na quantidade de 5 e 10 g de folhas/kg de ração e acompanhou-se o desempenho dos animais durante seu crescimento. Depois do abate, as coxas e sobrecoxas foram coletadas e armazenadas a 4 °C (± 1 °C por 12 dias. Os resultados mostraram melhor conversão alimentar dos frangos que receberam dieta suplementada com 5g/kg. As coxas e sobrecoxas dos frangos que receberam folhas de oliveira apresentaram melhor estabilidade microbiológica que o controle, em que 5 g/kg inibiu o crescimento de Staphylococcus aureus, aeróbios psicrotróficos e mesófilos e 10 g/kg inibiu o crescimento de Enterococcus spp., bactérias ácido láticas, coliformes termotolerantes e totais, Pseudomonas, Clostridium perfringens e Escherichia coli (p < 0,05. Os resultados indicam a possibilidade de uso de folhas de oliveira, como suplemento alimentar, com vistas à melhoria da qualidade microbiológica da carne de frango.

  11. Changes in the HPLC phenolic profile of virgin olive oil from young trees (Olea europaea L. Cv. Arbequina) grown under different deficit irrigation strategies.

    Science.gov (United States)

    Romero, M Paz; Tovar, M Jesús; Girona, Joan; Motilva, M José

    2002-09-11

    The HPLC phenolic profile of virgin olive oils obtained from young olive trees (Arbequina cv.) grown under different deficit irrigation strategies was studied. Deficit irrigation (RDI) did not affect all the phenolic compounds in the same way. Lignans, vanillic acid, vanillin, and the unknown phenolic compound named P24 increased in the oils from the most irrigated treatments. The secoiridoid derivatives and the unknown phenolic compound named P19 increased in the oils from the most stressed irrigation treatments. The period of growth where a water stress significantly affects the phenolic profile of oils was between pit hardening and the first stages of fruit growth and oil accumulation, independently of the water applied during the previous period to harvest. The phenolic profile and those parameters related to phenol content, oxidative stability, and the bitter index were significantly affected only in the most severe RDI strategies. Other strategies produced important savings in irrigation requirements and an increase in the water use efficiency without noticeably affecting the phenolic profile.

  12. Effect of irrigation, nitrogen application, and a nitrification inhibitor on nitrous oxide, carbon dioxide and methane emissions from an olive (Olea europaea L.) orchard.

    Science.gov (United States)

    Maris, S C; Teira-Esmatges, M R; Arbonés, A; Rufat, J

    2015-12-15

    Drip irrigation combined with nitrogen (N) fertigation is applied in order to save water and improve nutrient efficiency. Nitrification inhibitors reduce greenhouse gas emissions. A field study was conducted to compare the emissions of nitrous oxide (N2O), carbon dioxide (CO2) and methane (CH4) associated with the application of N fertiliser through fertigation (0 and 50kgNha(-1)), and 50kgNha(-1)+nitrification inhibitor in a high tree density Arbequina olive orchard. Spanish Arbequina is the most suited variety for super intensive olive groves. This system allows reducing production costs and increases crop yield. Moreover its oil has excellent sensorial features. Subsurface drip irrigation markedly reduced N2O and N2O+N2 emissions compared with surface drip irrigation. Fertiliser application significantly increased N2O+N2, but not N2O emissions. Denitrification was the main source of N2O. The N2O losses (calculated as emission factor) ranging from -0.03 to 0.14% of the N applied, were lower than the IPCC (2007) values. The N2O+N2 losses were the largest, equivalent to 1.80% of the N applied, from the 50kgNha(-1)+drip irrigation treatment which resulted in water filled pore space >60% most of the time (high moisture). Nitrogen fertilisation significantly reduced CO2 emissions in 2011, but only for the subsurface drip irrigation strategies in 2012. The olive orchard acted as a net CH4 sink for all the treatments. Applying a nitrification inhibitor (DMPP), the cumulative N2O and N2O+N2 emissions were significantly reduced with respect to the control. The DMPP also inhibited CO2 emissions and significantly increased CH4 oxidation. Considering global warming potential, greenhouse gas intensity, cumulative N2O emissions and oil production, it can be concluded that applying DMPP with 50kgNha(-1)+drip irrigation treatment was the best option combining productivity with keeping greenhouse gas emissions under control. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Comparison of the chemical composition and the organoleptic profile of virgin olive oil from two wild and two cultivated Tunisian Olea europaea.

    Science.gov (United States)

    Dabbou, Samia; Dabbou, Sihem; Selvaggini, Roberto; Urbani, Stefania; Taticchi, Agnese; Servili, Maurizio; Hammami, Mohamed

    2011-01-01

    With the aim to select new olive cultivars with superior physical and chemical properties than the cultivar Chemlali Sfax, the present study focused on the comparison of the chemical composition and the sensory profile of the virgin olive oils (VOOs) of two wild olive trees (Oleasters K and M) with those of VOOs obtained from Chemlali Sfax and Neb Jmel olive cultivars, all growing in the coastal region of Tunisia. Despite the variability in the chemical composition (fatty acids, pigments, and phenolic and volatile compounds) and the organoleptic profile of the VOOs of the oleasters and the cultivars, the quality indices (free fatty acids, peroxide value, and spectrophotometric indices K232 and K270) as well as the fatty acid composition of all VOOs studied met the commercial standards. Both the α-tocopherol and phenol contents varied between the genotypes. The Neb Jmel and Oleaster K VOOs had more than two times higher total phenol levels than the Chemlali Sfax and Oleaster M VOOs. Also the contents of volatile compounds differed between the olive oils studied. Chemlali Sfax and Oleaster K oils were more abundant in aldehydes, whereas Oleaster M VOO had higher contents of alcohols. These results were confirmed by a sensorial analysis showing that the later oil was deprived for consumption despite its abundance in α-tocopherol. In conclusion, the oleasters studied revealed to be interesting, since they produced oils with good quality characteristics in terms of minor compounds (phenols and volatiles) compared to the Chemlali Sfax cultivar. Copyright © 2011 Verlag Helvetica Chimica Acta AG, Zürich.

  14. BACTÉRIAS DIAZOTRÓFICAS NÃO SIMBIÓTICAS E ENRAIZAMENTO DE ESTACAS SEMILENHOSAS DE OLIVEIRA (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Talita Filomena Silva

    2017-01-01

    Full Text Available Non-symbiotic diazotrophic bacteria (NSDB influence plant growth mainly through biological nitrogenfixation and production and release of plant growth-regulating substances. The effect of these bacteria on rooting of olive is not described in the international literature, which has been provided by the use of hormonal treatment based on indole butyric acid (IBA. The purpose of this study was to evaluate the physiological diversity of isolates obtained from soil samples of the Biological Reserve Serra dos Toledos, Itajubá, MG state, and of reference strains of NSDB, and their potential of substitution of IBA on rooting of olive semi-hardwood cuttings from the experimental farm ‘Maria da Fé’ (FEMF-EPAMIG. The isolates were divided into five groups (G1 to G5 according with cultural phenotypic characteristics based on color, diameter and consistence of colonies, and reference strains used were Azospirillum brasilense (BR11001 t , Azospirillum amazonense (BR11040 t , Herbaspirillum seropedicae (BR11175 t and Burkholderia brasilensis (BR11340 t . The diversity of physiological was performed using phosphate solubilization, tolerance to different conditions of temperature and pH and production of indole acetic acid (IAA. To evaluate the potential of semi-hardwood cuttings rooting in olive cultivars were used the cultivars Ascolano 315, Arbequina and Grappolo 541, from the germoplasm blank of the FEMF-EPAMIG. There were 33 treatments, and the cuttings were inoculated with the bacterial isolate groups, with the reference strains, without inoculation (control and only IBA, commercially used in rooting. Only two isolates showed ability to solubilize phosphate. Groups of isolates and of reference strains showed very similar environmental requirements, with wide ranges of optimum conditions of pH (5,0-9,0 and temperature (15-35ºC for maximum growth. The isolates and reference strains showed a production IAA ranging from 110.53 to 383.58 μg mL -1 , and the groups of isolates generally did not differ significantly from the values obtained by reference strains. All the groups of isolates present potential of rooting of olive cuttings, and those of groups 1 and 4 are more indicated to Arbequina, group 2 to Grappolo 541 and groups 1 and 5 to Ascolano 315, with performances similar to those obtained from IBA.

  15. LOX Gene Transcript Accumulation in Olive (Olea europaea L. Fruits at Different Stages of Maturation: Relationship between Volatile Compounds, Environmental Factors, and Technological Treatments for Oil Extraction

    Directory of Open Access Journals (Sweden)

    Innocenzo Muzzalupo

    2012-01-01

    Full Text Available The quality of olive oil is influenced by genetic and environmental factors and by the maturation state of drupes, but it is equally affected by technological treatments of the process. This work investigates the possible correlation between olive LOX gene transcript accumulation, evaluated in fruits collected at different stages of maturation, and chemical biomarkers of its activity. During olive fruit ripening, the same genotype harvested from two different farms shows a positive linear trend between LOX relative transcript accumulation and the content of volatile compounds present in the olive oil aroma. Interestingly, a negative linear trend was observed between LOX relative transcript accumulation and the content of volatile compounds present in the olive pastes obtained from olive fruits with and without malaxation. The changes in the olive LOX transcript accumulation reveal its environmental regulation and suggest differential physiological functions for the LOXs.

  16. The Role of Polyphenoloxidase, Peroxidase, and β-Glucosidase in Phenolics Accumulation in Olea europaea L. Fruits under Different Water Regimes

    Directory of Open Access Journals (Sweden)

    Marco Cirilli

    2017-05-01

    Full Text Available Olive fruits and oils contain an array of compounds that contribute to their sensory and nutritional properties. Phenolic compounds in virgin oil and olive-derived products have been proven to be highly beneficial for human health, eliciting increasing attention from the food industry and consumers. Although phenolic compounds in olive fruit and oil have been extensively investigated, allowing the identification of the main classes of metabolites and their accumulation patterns, knowledge of the molecular and biochemical mechanisms regulating phenolic metabolism remains scarce. We focused on the role of polyphenoloxidase (PPO, peroxidase (PRX and β-glucosidase (β-GLU gene families and their enzyme activities in the accumulation of phenolic compounds during olive fruit development (35–146 days after full bloom, under either full irrigation (FI or rain-fed (RF conditions. The irrigation regime affected yield, maturation index, mesocarp oil content, fruit size, and pulp-to-pit ratio. Accumulation of fruit phenolics was higher in RF drupes than in FI ones. Members of each gene family were developmentally regulated, affected by water regime, and their transcript levels were correlated with the respective enzyme activities. During the early phase of drupe growth (35–43 days after full bloom, phenolic composition appeared to be linked to β-GLU and PRX activities, probably through their effects on oleuropein catabolism. Interestingly, a higher β-GLU activity was measured in immature RF drupes, as well as a higher content of the oleuropein derivate 3,4-DHPEA-EDA and verbascoside. Activity of PPO enzymes was slightly affected by the water status of trees during ripening (from 120 days after full bloom, but was not correlated with phenolics content. Overall, the main changes in phenolics content appeared soon after the supply of irrigation water and remained thereafter almost unchanged until maturity, despite fruit growth and the progressive decrease in pre-dawn leaf water potential. We suggest that enzymes involved in phenolic catabolism in the olive fruit have a differential sensitivity to soil water availability depending on fruit developmental stage.

  17. Aceitunas tipo negras. Estudio comparativo de tres procedimientos para ia conservación previa de frutos de la variedad gordal (O. europaea regalis

    Directory of Open Access Journals (Sweden)

    Garrido Fernández, A.

    1991-04-01

    Full Text Available This paper shows the physico-chemical and microbiological results of the brines from three procedures of previous conservation of Gordal cultivar olives and its effects on the main quality attributes of the final product: colour and texture. Two of them have used low NaCl levels and initial pH correction to facilitate the growth of lactic bacteria. The other has consisted of a solution highly acidified with acetic. In all procedures, a fermentation process has been found. During it the growth of lactic bacteria, mainly Lactobacillus plantarum and Pediococcus (that has predominated in some cases and yeats, which have coexisted with the previous mentioned microorganisms thought the whole conservation period, has been detected. The evolution of the physico-chemical characteristics has been different in the three processes, however they have not had any influence on the elaborated final product. For industrial work, the aerobic system is recommended due to its CO2 purging action which could have a favorable effect on shriveling. It would consist of putting the olives in a 6% NaCl brine, with the initial pH corrected with acetic to 4.00 units and bubbling air throughout the column at a rate of 0.3 l/h.l.c. during 8 h/day. The salt percentage should be raised to 8% once the lactic fermentation has finished.El trabajo presenta los resultados físico-químicos y microbiológicos de las salmueras de tres procedimientos de conservación previa de aceitunas de la variedad Gordal, así como sus efectos en los principales atributos de calidad del producto final: color y textura. Dos de ellos han consistido en la utilización de niveles bajos de NaCl y la corrección inicial del pH para facilitar el crecimiento de una flora láctica. El otro ha sido un medio fuertemente acidificado con acético. En todos ellos ha tenido lugar un proceso fermentativo en el que se han desarrollado bacterias lácticas, fundamentalmente Lactobacillus plantarum y Pediococcus (que incluso han predominado en algunos casos y levaduras, que han coexistido con las anteriores a lo largo de todo este período. La evolución de las características físico-químicas ha sido distinta, según el tipo de proceso, pero no han tenido influencia en el producto final elaborado. No obstante se recomienda que a nivel industrial se aplique el sistema aerobio por el probable efecto favorable del purgado del CO2 sobre el arrugado de los frutos. Consistiría en colocar las aceitunas en salmuera al 6% de NaCl, con el pH corregido a 4,00 unidades (0,2-0,4% de ácido acético, e inyectar aire por la columna a razón de 0,3 l/h.l. capacidad durante 8 horas al día. La concentración de sal debe elevarse a 8,00% una vez terminada la etapa de fermentación láctica.

  18. Evaluation of Chlorophyll Content and Chlorophyll Fluorescence Parameters and Relationships between Chlorophyll a, b and Chlorophyll Content Index under Water Stress in Olea europaea cv. Dezful

    OpenAIRE

    E. Khaleghi; K. Arzani; N. Moallemi; M. Barzegar

    2012-01-01

    This study was conducted to determine effect of water stress on chlorophyll content and chlorophyll fluorescence parameter in young `Dezful- olive trees. Three irrigation regimes (40% ETcrop, 65% ETcrop and 100% ETcrop) were used. After irrigation treatments were applied, some of biochemical parameters including chlorophyll a, b, total chlorophyll, chlorophyll fluorescence and also chlorophyll content index (C.C.I) were measured. Results of Analysis of variance showed that irrigation treatmen...

  19. Effect of bruising on respiration, superficial color, and phenolic changes in fresh Manzanilla olives (Olea europaea pomiformis): development of treatments to mitigate browning.

    Science.gov (United States)

    Segovia-Bravo, Kharla A; García-García, Pedro; López-López, Antonio; Garrido-Fernández, Antonio

    2011-05-25

    The aim of the work was to study the postharvest changes in Manzanilla olives and to find treatments to mitigate damages because of bruises. The phenolic content in bruised and unbruised fruits exposed to air always decreased, but the loss in phenols and the respiratory activity were greater in bruised olives; these changes were related to the appearance of brown spots. Immersion of the picked fruits in a cold (8 °C) acidic solution (pH 3), ascorbic acid solution (100 mM), or sodium metabisulfite solution (100 mM) significantly reduced the loss in phenols in olives and led to lighter brown bruised areas. This immersion did not affect the behavior of the fruits during the lye treatment and the subsequent fermentation. In the final product, no influence on the surface color of unbruised olives was observed and there was a significant color improvement in the bruised areas of damaged olives.

  20. Fatty acid profiles of varietal virgin olive oils (Olea europaea L. from mature orchards in warm arid valleys of Northwestern Argentina (La Rioja

    Directory of Open Access Journals (Sweden)

    Rousseaux, M. C.

    2011-12-01

    Full Text Available The olive industry in Northwestern Argentina has experienced substantial growth during the past two decades to produce virgin olive oil for export. To assess the fatty acid profiles of the main varietal olive oils, 563 oil samples from 17 varieties cultivated in the province of La Rioja were analyzed from 2005-2008. Olive varieties were ranked according to oleic acid content as low (65%; Manzanilla, Empeltre, Leccino, Coratina, Changlot, Picual. Using data from this study and the literature, the fatty acid composition of Spanish (Arbequina, Picual and Italian (Coratina, Frantoio varieties indicated consistently lower oleic acid contents when grown in NW Argentina versus the Mediterranean. For Arbequina, the oleic content decreased with increasing temperature during oil accumulation (-2% per °C. The classification of varieties should be useful in the selection of virgin olive oils for corrective blending and for choosing varieties for new orchards in order to meet IOOC requirements. The differences in fatty acid composition between NW Argentina and the Mediterranean Basin are most likely to be related to a genotype produced by environmental interaction, and the negative effect of the high seasonal mean temperature during oil accumulation will need further research.La industria oleícola del noroeste de Argentina creció sustancialmente durante las últimas dos décadas para producir aceite de oliva virgen exportable. Para evaluar el perfil de ácidos grasos de los principales aceites varietales, se analizaron 563 muestras de aceite de 17 variedades en la provincia de La Rioja durante 2005-2008. Las variedades se clasificaron de acuerdo a su contenido de ácido oleico en bajo (65%; Manzanilla, Empeltre, Leccino, Coratina, Changlot, Picual. Utilizando datos de este trabajo y de la literatura, los aceites de variedades de origen español (Arbequina y Picual e italiano (Coratina y Frantoio mostraron consistentemente menor contenido de ácido oleico cuando crecieron en el noroeste de Argentina versus el Mediterráneo. Para Arbequina, el contenido de oleico disminuyó con la temperatura durante la síntesis y acumulación lipídica (-2 % por °C. La clasificación varietal por acido oleico debe ser útil para seleccionar aceites para mezclas correctivas y variedades para futuras plantaciones que cumplan con la normativa del COI. Diferencias en los perfiles de ácidos grasos entre el noroeste de Argentina y el Mediterráneo indican una interacción genotipo x ambiente, y el efecto negativo de la alta temperatura media estacional durante la síntesis de lípidos requerirá mayor investigación.

  1. Time course of pentacyclic triterpenoids from fruits and leaves of olive tree (Olea europaea L.) cv. Picual and cv. Cornezuelo during ripening.

    Science.gov (United States)

    Peragón, Juan

    2013-07-10

    Pentacyclic triterpenoids are plant secondary metabolites of great interest for health and disease prevention. HPLC-UV/vis was used to determine the concentration of the pentacyclic triterpenoids present in fruits and leaves of Picual and Cornezuelo olive tree cultivars. Maslinic acid (MA) and oleanolic acid (OA) are the only two compounds present in fruits, MA being the more abundant. In leaves, in addition to MA and OA, uvaol (UO), and erythrodiol (EO) are found, with OA being the most abundant. In this work, the changes in the concentrations of these compounds during ripening as well as the effect of Jaén-style table-olive processing are reported. The amount of MA and OA found in Picual and Cornezuelo olives after processing was 1.26 ± 0.06, 1.30 ± 0.06, 0.31 ± 0.02, and 0.23 ± 0.01 mg per fruit, respectively. These results enable us to calculate the average intake of pentacyclic triterpenoids and reinforce the importance of table olives as a source of healthy compounds.

  2. Identification and Functional Annotation of Genes Differentially Expressed in the Reproductive Tissues of the Olive Tree (Olea europaeaL.) through the Generation of Subtractive Libraries.

    Science.gov (United States)

    Zafra, Adoración; Carmona, Rosario; Traverso, José A; Hancock, John T; Goldman, Maria H S; Claros, M Gonzalo; Hiscock, Simon J; Alche, Juan D

    2017-01-01

    The olive tree is a crop of high socio-economical importance in the Mediterranean area. Sexual reproduction in this plant is an essential process, which determines the yield. Successful fertilization is mainly favored and sometimes needed of the presence of pollen grains from a different cultivar as the olive seizes a self-incompatibility system allegedly determined of the sporophytic type. The purpose of the present study was to identify key gene products involved in the function of olive pollen and pistil, in order to help elucidate the events and signaling processes, which happen during the courtship, pollen grain germination, and fertilization in olive. The use of subtractive SSH libraries constructed using, on the one hand one specific stage of the pistil development with germinating pollen grains, and on the other hand mature pollen grains may help to reveal the specific transcripts involved in the cited events. Such libraries have also been created by subtracting vegetative mRNAs (from leaves), in order to identify reproductive sequences only. A variety of transcripts have been identified in the mature pollen grains and in the pistil at the receptive stage. Among them, those related to defense, transport and oxidative metabolism are highlighted mainly in the pistil libraries where transcripts related to stress, and response to biotic and abiotic stimulus have a prominent position. Extensive lists containing information as regard to the specific transcripts determined for each stage and tissue are provided, as well as functional classifications of these gene products. Such lists were faced up to two recent datasets obtained in olive after transcriptomic and genomic approaches. The sequences and the differential expression level of the SSH-transcripts identified here, highly matched the transcriptomic information. Moreover, the unique presence of a representative number of these transcripts has been validated by means of qPCR approaches. The construction of SSH libraries using pistil and pollen, considering the high interaction between male-female counterparts, allowed the identification of transcripts with important roles in stigma physiology. The functions of many of the transcripts obtained are intimately related, and most of them are of pivotal importance in defense, pollen-stigma interaction and signaling.

  3. The use of olive tree (Olea europaea L.) leaves as a bioindicator for environmental pollution in the Province of Aydın, Turkey.

    Science.gov (United States)

    Turan, Dilek; Kocahakimoglu, Cemre; Kavcar, Pınar; Gaygısız, Handan; Atatanir, Levent; Turgut, Cafer; Sofuoglu, Sait C

    2011-03-01

    In this study, olive tree leaves, collected from 50 sampling sites throughout the Province of Aydın, Turkey, were used to estimate level of pollution by measuring Al, As, B, Ba, Ca, Co, Cr, Cu, Fe, K, Li, Mg, Mn, Na, Ni, Pb, Sr, and Zn concentrations and calculating pollution factor (PF) values. After sample preparation, collected leaves were microwave digested, and extracts were analyzed by an inductively coupled plasma-mass spectrometer. The maximum PF values were ≥10 for a number of elements ranging from 11-13 (Al, As, Cr, Fe, Mn, Ni) to >100 for Cu, Li, and Na. Urban-rural and roadside-nonroadside concentration comparisons showed that some of the elements (As, Cu, and Pb) were at significantly higher levels on urban and/or roadside sampling sites. Correlations and factor analysis showed that there may be common sources for some elements, which included several soil types and anthropogenic activities. Based on the results of the statistical source apportionment, possible sources were narrowed down with help of the constructed elemental concentration maps. In conclusion, utilization of olive tree leaves for biomonitoring and assessment of environmental pollution was shown to be possible in the Mediterranean region where they are indigenous and cultivated.

  4. Phenological models to predict the main flowering phases of olive ( Olea europaea L.) along a latitudinal and longitudinal gradient across the Mediterranean region

    Science.gov (United States)

    Aguilera, Fátima; Fornaciari, Marco; Ruiz-Valenzuela, Luis; Galán, Carmen; Msallem, Monji; Dhiab, Ali Ben; la Guardia, Consuelo Díaz-de; del Mar Trigo, María; Bonofiglio, Tommaso; Orlandi, Fabio

    2015-05-01

    The aim of the present study was to develop pheno-meteorological models to explain and forecast the main olive flowering phenological phases within the Mediterranean basin, across a latitudinal and longitudinal gradient that includes Tunisia, Spain, and Italy. To analyze the aerobiological sampling points, study periods from 13 years (1999-2011) to 19 years (1993-2011) were used. The forecasting models were constructed using partial least-squares regression, considering both the flowering start and full-flowering dates as dependent variables. The percentages of variance explained by the full-flowering models (mean 84 %) were greater than those explained by the flowering start models (mean 77 %). Moreover, given the time lag from the North African areas to the central Mediterranean areas in the main olive flowering dates, the regional full-flowering predictive models are proposed as the most useful to improve the knowledge of the influence of climate on the olive tree floral phenology. The meteorological parameters related to the previous autumn and both the winter and the spring seasons, and above all the temperatures, regulate the reproductive phenology of olive trees in the Mediterranean area. The mean anticipation of flowering start and full flowering for the future period from 2081 to 2100 was estimated at 10 and 12 days, respectively. One question can be raised: Will the olive trees located in the warmest areas be northward displaced or will they be able to adapt their physiology in response to the higher temperatures? The present study can be considered as an approach to design more detailed future bioclimate research.

  5. Vegetative growth and fruit set of olive (Olea europaea L. cv. ‘Zard’ in response to some soil and plant factors

    Directory of Open Access Journals (Sweden)

    Omid NOORI

    2015-09-01

    Full Text Available This experiment was conducted to explore the reasons of difference between ‘Zard’ olive orchard with the poor vegetative growth rate and fruit set and orchard with suitable vegetative growth rate and fruit set in relation to some soil and plant factors during two seasons. Note that assumptions were based on the overall canopy greenness of the olive trees, so experimental orchards in which the planted trees showed optimum leaf greenness were considered good situations for optimum vegetative growth and productivity. Remote sensing technologies based on normalized difference vegetation index (NDVI were employed on olive orchards, and two orchards meeting the criteria of highest amount of greenness and lowest amount of greenness were selected. Length of current-year shoot (LCYS and fruit set were considered indicators of tree vegetative growth and productivity, respectively. Results clearly indicated a significant difference between the two selected orchards in terms of canopy volume (CV, leaf nitrogen content (N, leaf potassium content (K, silt, sand, Sodium adsorption rate (SAR, available phosphorous (Pavi, total neutralizing value (TNV, electrical conductivity (EC, chloride (Cl, and Fe variables. A stepwise regression method was used to evaluate the effects of soil and plant variables on fruit set and LCYS. According to the obtained results, the main reasons for differences between two orchards in fruit set and vegetative growth was N and K deficiencies, soil salinity, and a high percentage of silt in the soil.

  6. The effect of high temperature interruptions during inductive period on the extent of flowering and on metabolic responses in olives (Olea europaea L.)

    Science.gov (United States)

    The effect of the duration of high temperature interruption and the timing of it’s occurrence during inductive period on the extent of inhibition of inflorescence production in ‘Arbequina’ olive trees was investigated. Trees kept under inductive conditions in different growth chambers were subjected...

  7. Heat requirement for the onset of the Olea europaea L. pollen season in several sites in Andalusia and the effect of the expected future climate change.

    Science.gov (United States)

    Galán, C; García-Mozo, H; Vázquez, L; Ruiz, L; de la Guardia, C Díaz; Trigo, M M

    2005-01-01

    Olives are one of the largest crops in the Mediterranean region, especially in Andalusia, in southern Spain. A thermal model has been developed for forecasting the start of the olive tree pollen season at five localities in Andalusia: Cordoba, Priego, Jaen, Granada and Malaga using airborne pollen and meteorological data from 1982 to 2001. Threshold temperatures varied between 5 degrees C and 12.5 degrees C depending on bio-geographical characteristics. The external validity of the results was tested using the data for the year 2002 as an independent variable and it confirmed the model's accuracy with only a few days difference from predicted values. All the localities had increasingly earlier start dates during the study period. This could confirm that olive flower phenology can be considered as a sensitive indicator of the effects of climate fluctuations in the Mediterranean area. The theoretical impact of the predicted climatic warming on the olive's flowering phenology at the end of the century is also proposed by applying Regional Climate Model data. A general advance, from 1 to 3 weeks could be expected, although this advance will be more pronounced in mid-altitude inland areas.

  8. Procedimiento de obtención y determinación de ácidos terpénicos de la hoja del olivo (Olea europaea

    Directory of Open Access Journals (Sweden)

    Lanzón, A.

    2001-10-01

    Full Text Available The terpenic acids, mainly the oleanolic acid, are used for the pharmaceutical industry, among other, for its antitumoral, anti-inflammatory and germicide activities. A process of obtainment of oleanolic acid from olive leaves is described. Solid/liquid extraction with ethanol, treatment of the extract and concentration under defined conditions, being possible to obtain in a single extraction stage a yield of 90 % of the leaf content (2-3 %, referred to the leaf weight and with richness in excess of 95 %. The raw material is a by-product, coming from that of pruning yearly of the olive grove and of the cleaning of the olives. A method is described for the quantification of the terpenic acids from olive leaf of the alcoholic extract, by preparative thin layer chromatography fractionation and gas liquid chromatography quantification with betulinic acid standard.Los ácidos terpénicos y en particular el ácido oleanólico son de utilidad en la industria farmacéutica, entre otras, por su actividad antitumoral, antiinflamatoria y bactericida. Se describe un procedimiento para la obtención de ácido oleanólico, de las hojas de olivo, mediante extracción sólido/líquido con etanol, posterior tratamiento del extracto y concentración en condiciones definidas, siendo posible obtener en una sola etapa de extracción un rendimiento del 90 % del contenido de la hoja (2-3 %, referido al peso de hoja, y con un grado de pureza superior al 95 %. La materia prima es un subproducto, procedente de la poda anual del olivar y de la limpieza de las aceitunas. Se describe un método para la cuantificación de los ácidos terpénicos del extracto alcohólico de la hoja de olivo mediante el fraccionamiento en cromatografía preparativa en capa fina y cuantificación por cromatografía gaseosa con patrón de ácido betulínico.

  9. LOX Gene transcript accumulation in olive (Olea europaea L.) fruits at different stages of maturation: relationship between volatile compounds, environmental factors, and technological treatments for oil extraction.

    Science.gov (United States)

    Muzzalupo, Innocenzo; Macchione, Barbara; Bucci, Cristina; Stefanizzi, Francesca; Perri, Enzo; Chiappetta, Adriana; Tagarelli, Antonio; Sindona, Giovanni

    2012-01-01

    The quality of olive oil is influenced by genetic and environmental factors and by the maturation state of drupes, but it is equally affected by technological treatments of the process. This work investigates the possible correlation between olive LOX gene transcript accumulation, evaluated in fruits collected at different stages of maturation, and chemical biomarkers of its activity. During olive fruit ripening, the same genotype harvested from two different farms shows a positive linear trend between LOX relative transcript accumulation and the content of volatile compounds present in the olive oil aroma. Interestingly, a negative linear trend was observed between LOX relative transcript accumulation and the content of volatile compounds present in the olive pastes obtained from olive fruits with and without malaxation. The changes in the olive LOX transcript accumulation reveal its environmental regulation and suggest differential physiological functions for the LOXs.

  10. Effects of Olea europaea L. Leaf Metabolites on the Tilapia (Oreochromis niloticus and Three Stored Pests, Sitophilus granarius, Tribolium confusum and Acanthoscelides obtectus

    Directory of Open Access Journals (Sweden)

    Ahmet Kısa

    2018-05-01

    Full Text Available Olea europea L. emerged as a good source of traditional medicine for the treatment of various ailments of various countries of the world, in particular Mediterranean countries. In this study, oleuropein (1, oleanolic acid (2, maslinic acid (3, a mixture of erythrodiol and uvaol (4 and 5 isolated from the leaves of olive were added at two concentrations (1g/100g feed and 4g/100 g feed into fish feed. Oreochromis niloticus (Nile tilapia were fed twice a day with the feed during 96 hours. The levels of alanine aminotransferase (ALT, aspartate aminotransferase (AST, alkaline phosphatase (ALP enzymes and glucose levels in the serums of fishes fed with pure compounds were found to be higher as compared with the control group. Pure metabolites affect the liver metabolism of Nile tilapia. These results suggested that the compounds tested affect the liver metabolism of Nile tilapia. Compounds 1, 2, 3 and 4+5 (2.5, 5.0 and 7.5 mg/Petri dish concentrations were also tested for contact toxic effects against three important stored pests, Sitophilus granarius (weevil, Tribolium confusum (confused flour beetle and Acanthoscelides obtectus (bean weevil. The toxic effects of the metabolites were lower than those of the insecticide, dichlorvos (DDVP. DDVP caused complete mortality of the insects after 48 hours of treatments, the metabolites caused the mortality rates 16.7-63.3 %, 13.3-67.0 % and 26.7-59.0 % of S. granarius, T. confusum and A. obtectus, respectively. Maslinic acid (3 has the most toxic compound with the lowest LC 50 values (0.66 mg/Petri, 0.61 mg/Petri and 1.71 mg/Petri for S. granarius, T. confusum and A. obtectus, respectively. These results show that maslinic acid (3 as well as other substances can be used as natural insecticides against these pests.

  11. Contenido hídrico de dos variedades de olivo (Olea europaea L. en el Valle de Cañete, Lima-Perú

    Directory of Open Access Journals (Sweden)

    Ricardo Borjas

    2015-01-01

    Full Text Available El estudio de los índices del estado hídrico en Olea europea L. resulta de gran importancia porque permite una mejor comprensión de la capacidad hídrica de esta especie. El presente ensayo fue conducido en el Valle de Cañete con las variedades de olivo ‘Frantoio’ y ‘Sevillana’ (ambas con 10 años de edad, con el objetivo de determinar su contenido hídrico. En las dos variedades se midió el contenido hídrico relativo (CHR, el contenido de agua para la saturación (CAS, el déficit de agua para la saturación (DAS, el peso seco (PS y el peso fresco (PF. En la variedad ‘Sevillana’ los valores de CHR (73,7%, PS (0,180 g y PF (0,330 g fueron mayores que en la variedad ‘Frantoio’, esta última con valores de 68,2%, 0,140 g y 0,258 g respectivamente. En conclusión, estos resultados indican que la variedad ‘Sevillana’ tiene mayor capacidad hídrica que la ‘Frantoio’ para resistir ambientes áridos.

  12. Effect of irrigation, nitrogen application, and a nitrification inhibitor on nitrous oxide, carbon dioxide and methane emissions from an olive (Olea europaea L.) orchard

    Energy Technology Data Exchange (ETDEWEB)

    Maris, S.C., E-mail: stefania@macs.udl.cat [University of Lleida, Environment and Soil Science Department, Av. Alcalde Rovira Roure 191, E-25198 Lleida (Spain); Teira-Esmatges, M.R. [University of Lleida, Environment and Soil Science Department, Av. Alcalde Rovira Roure 191, E-25198 Lleida (Spain); Arbonés, A.; Rufat, J. [Programa Ús Eficient de l’Aigua, Institut de Recerca i Tecnologia Agroalimentàries (IRTA), Parc Científic i Tecnològic Agroalimentari de Lleida (PCiTAL). Parc de Gardeny, Edifici Fruitcentre, E-2503 Lleida (Spain)

    2015-12-15

    Drip irrigation combined with nitrogen (N) fertigation is applied in order to save water and improve nutrient efficiency. Nitrification inhibitors reduce greenhouse gas emissions. A field study was conducted to compare the emissions of nitrous oxide (N{sub 2}O), carbon dioxide (CO{sub 2}) and methane (CH{sub 4}) associated with the application of N fertiliser through fertigation (0 and 50 kg N ha{sup −1}), and 50 kg N ha{sup −1} + nitrification inhibitor in a high tree density Arbequina olive orchard. Spanish Arbequina is the most suited variety for super intensive olive groves. This system allows reducing production costs and increases crop yield. Moreover its oil has excellent sensorial features. Subsurface drip irrigation markedly reduced N{sub 2}O and N{sub 2}O + N{sub 2} emissions compared with surface drip irrigation. Fertiliser application significantly increased N{sub 2}O + N{sub 2}, but not N{sub 2}O emissions. Denitrification was the main source of N{sub 2}O. The N{sub 2}O losses (calculated as emission factor) ranging from − 0.03 to 0.14% of the N applied, were lower than the IPCC (2007) values. The N{sub 2}O + N{sub 2} losses were the largest, equivalent to 1.80% of the N applied, from the 50 kg N ha{sup −1} + drip irrigation treatment which resulted in water filled pore space > 60% most of the time (high moisture). Nitrogen fertilisation significantly reduced CO{sub 2} emissions in 2011, but only for the subsurface drip irrigation strategies in 2012. The olive orchard acted as a net CH{sub 4} sink for all the treatments. Applying a nitrification inhibitor (DMPP), the cumulative N{sub 2}O and N{sub 2}O + N{sub 2} emissions were significantly reduced with respect to the control. The DMPP also inhibited CO{sub 2} emissions and significantly increased CH{sub 4} oxidation. Considering global warming potential, greenhouse gas intensity, cumulative N{sub 2}O emissions and oil production, it can be concluded that applying DMPP with 50 kg N ha{sup −1} + drip irrigation treatment was the best option combining productivity with keeping greenhouse gas emissions under control. - Highlights: • Subsurface drip irrigation mitigated N{sub 2}O emission compared with drip irrigation. • Nitrogen application didn't increase N{sub 2}O–N nor (N{sub 2}O + N{sub 2})–N emissions. • The olive orchard acted as a net CH{sub 4} sink for all the treatments. • DMPP reduced the cumulative N{sub 2}O, N{sub 2}O + N{sub 2} and CO{sub 2} emission compared to the control. • The N50 + DI + DMPP treatment reduced emissions at a high yield (2737 kg oil ha{sup −1}).

  13. Environmental effects on proline accumulation and water potential in olive leaves (Olea europaea L. CV Chemlali)) under saline water irrigated field conditions

    International Nuclear Information System (INIS)

    Ben Ahmed, C.; Ben Rouina, B.; Boukhris, M.

    2009-01-01

    In arid regions in Tunisia suffering from limited water resources, the olive extension to irrigated lands has led to the urgent use of saline water, the most readily available water in the these areas. Nevertheless, the effects of salt stress on olive tree seem to be reinforced by environmental conditions. The issue of this paper is to determine how does the olive tree respond to environmental stress in the Mediterranean climate under saline water irrigated field conditions with respect to leaf proline concentrations and water Status. (Author)

  14. Identification of Predominant Phytochemical Compounds and Cytotoxic Activity of Wild Olive Leaves (Olea europaea L. ssp. sylvestris) Harvested in South Portugal.

    Science.gov (United States)

    Makowska-Wąs, Justyna; Galanty, Agnieszka; Gdula-Argasińska, Joanna; Tyszka-Czochara, Małgorzata; Szewczyk, Agnieszka; Nunes, Ricardo; Carvalho, Isabel S; Michalik, Marta; Paśko, Paweł

    2017-03-01

    This study has been aimed at providing a qualitative and quantitative evaluation of selected phytochemicals such as phenolic acids, flavonoids, oleuropein, fatty acids profile, and volatile oil compounds, present in wild olive leaves harvested in Portugal, as well as at determining their antioxidant and cytotoxic potential against human melanoma HTB-140 and WM793, prostate cancer DU-145 and PC-3, hepatocellular carcinoma Hep G2 cell lines, as well as normal human skin fibroblasts BJ and prostate epithelial cells PNT2. Gallic, protocatechuic, p-hydroxybenzoic, vanillic acids, apigenin 7-O-glucoside, luteolin 7-O-glucoside, and rutin were identified in olive leaves. The amount of oleuropein was equal to 22.64 g/kg dry weight. (E)-Anethole (32.35%), fenchone (11.89%), and (Z)-3-nonen-1-ol (8%) were found to be the main constituents of the oil volatile fraction, whereas palmitic, oleic, and alpha-linolenic acid were determined to be dominating fatty acids. Olive leaves methanol extract was observed to exerted a significant, selective cytotoxic effect on DU-145 and PC-3 cell lines. Except the essential oil composition, evaluated wild olive leaves, with regard to their quantitative and qualitative composition, do not substantially differ from the leaves of other cultivars grown for industrial purposes and they reveal considerable antioxidant and cytotoxic properties. Thus, the wild species may prove to be suitable for use in traditional medicine as cancer chemoprevention. © 2017 Wiley-VHCA AG, Zurich, Switzerland.

  15. Phenological models to predict the main flowering phases of olive (Olea europaea L.) along a latitudinal and longitudinal gradient across the Mediterranean region.

    Science.gov (United States)

    Aguilera, Fátima; Fornaciari, Marco; Ruiz-Valenzuela, Luis; Galán, Carmen; Msallem, Monji; Dhiab, Ali Ben; la Guardia, Consuelo Díaz-de; Del Mar Trigo, María; Bonofiglio, Tommaso; Orlandi, Fabio

    2015-05-01

    The aim of the present study was to develop pheno-meteorological models to explain and forecast the main olive flowering phenological phases within the Mediterranean basin, across a latitudinal and longitudinal gradient that includes Tunisia, Spain, and Italy. To analyze the aerobiological sampling points, study periods from 13 years (1999-2011) to 19 years (1993-2011) were used. The forecasting models were constructed using partial least-squares regression, considering both the flowering start and full-flowering dates as dependent variables. The percentages of variance explained by the full-flowering models (mean 84 %) were greater than those explained by the flowering start models (mean 77 %). Moreover, given the time lag from the North African areas to the central Mediterranean areas in the main olive flowering dates, the regional full-flowering predictive models are proposed as the most useful to improve the knowledge of the influence of climate on the olive tree floral phenology. The meteorological parameters related to the previous autumn and both the winter and the spring seasons, and above all the temperatures, regulate the reproductive phenology of olive trees in the Mediterranean area. The mean anticipation of flowering start and full flowering for the future period from 2081 to 2100 was estimated at 10 and 12 days, respectively. One question can be raised: Will the olive trees located in the warmest areas be northward displaced or will they be able to adapt their physiology in response to the higher temperatures? The present study can be considered as an approach to design more detailed future bioclimate research.

  16. From which soil metal fractions Fe, Mn, Zn and Cu are taken up by olive trees (Olea europaea L., cv. 'Chondrolia Chalkidikis') in organic groves?

    Science.gov (United States)

    Chatzistathis, T; Papaioannou, A; Gasparatos, D; Molassiotis, A

    2017-12-01

    Organic farming has been proposed as an alternative agricultural system to help solve environmental problems, like the sustainable management of soil micronutrients, without inputs of chemical fertilizers. The purposes of this study were: i) to assess Fe, Mn, Zn and Cu bioavailability through the determination of sequentially extracted chemical forms (fractions) and their correlation with foliar micronutrient concentrations in mature organic olive (cv. 'Chondrolia Chalkidikis') groves; ii) to determine the soil depth and the available forms (fractions) by which the 4 metals are taken up by olive trees. DTPA extractable (from the soil layers 0-20, 20-40 and 40-60 cm) and foliar micronutrient concentrations were determined in two organic olive groves. Using the Tessier fractionation, five fractions, for all the metals, were found: exchangeable, bound to carbonates (acid-soluble), bound to Fe-Mn oxides (reducible), organic (oxidizable), as well as residual form. Our results indicated that Fe was taken up by the olive trees as organic complex, mainly from the soil layer 40-60 cm. Manganese was taken up from the exchangeable fraction (0-20 cm); Zinc was taken up as organic complex from the layers 0-20 and 40-60 cm, as well as in the exchangeable form from the upper 20 cm. Copper was taken up from the soil layers 0-20 and 40-60 cm as soluble organic complex, and as exchangeable ion from the upper 20 cm. Our data reveal the crucial role of organic matter to sustain metal (Fe, Zn and Cu) uptake -as soluble complexes-by olive trees, in mature organic groves grown on calcareous soils; it is also expected that these data will constitute a thorough insight and useful tool towards a successful nutrient and organic C management for organic olive groves, since no serious nutritional deficiencies were found. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Phenolics profiles of olive fruits (Olea europaea L.) and oils from Ayvalık, Domat and Gemlik varieties at different ripening stages.

    Science.gov (United States)

    Dağdelen, Ayhan; Tümen, Gülendam; Ozcan, Mehmet Musa; Dündar, Ekrem

    2013-01-01

    Phenolic compounds in olive fruit and oils obtained from Ayvalık, Domat and Gemlik olive varieties collected at different ripening periods were evaluated by High Performance Liquid Chromatography (HPLC). Gallic acid and p-cumaric acid were identified for Ayvalık and Domat at each period of ripening, respectively. In addition, gallic acid, p-cumaric acid, sinapinic and apigenin acids were detected in Gemlik olive fruit. Hydroxytyrosol, rutin, oleoropein, luteolin, tyrosol, vanilic acid and gallic acid in Ayvalık olive fruit in all ripening periods were determined. The tyrasol contents varied between 0.18 to 1.57mg/kg. Luteolin contents of olive oils ranged at the levels between 0.12 to 2.28mg/kg. In contrast, oils had the lowest syringic, p-cumaric, chlorogenic and ferulic acids. Vanillic acid contents of oils ranged between 0.08 to 2.38mg/kg. Copyright © 2012 Elsevier Ltd. All rights reserved.

  18. Influence of phenols mass fraction in olive (Olea europaea L.) paste on volatile compounds in Buža cultivar virgin olive oil.

    Science.gov (United States)

    Germek, Valerija Majetić; Koprivnjak, Olivera; Butinar, Bojan; Pizzale, Lorena; Bučar-Miklavčič, Milena; Conte, Lanfranco S

    2013-06-26

    The influence of the phenolic content in olive paste of cv. Buža increased by the addition of an aqueous solution of phenolic extract of freeze-dried olive pulp (cv. Istarska bjelica) on the final products of the lipoxygenase pathway in oil was studied. Increases by 12, 38, and 56% for ripe fruits (maturity index = 4.0) and by 38% for unripe fruits (maturity index = 1.2) were examined. Phenols in the olive paste were determined according to the HPLC method, whereas volatiles in oil were determined according to SPME-GC-MS. A significant negative effect on Z-3-hexenal and E-2-hexen-1-ol (Tukey's test, p < 0.05) was found for ripe fruits (average decreases of 55 and 60%, respectively), but not for the unripe sample. Positive effects in both ripening levels were found for Z-3-hexenyl acetate (average increase of 68% for ripe and a double increase for unripe fruits) and total C5 compounds (average increase of 32% for ripe and an increase of 30% for unripe fruits).

  19. Analysis of the Olive genome

    OpenAIRE

    Julca Chávez, Irene Consuelo

    2017-01-01

    El olivo (Olea europaea, Oleaceae) es una planta icónica en el Mediterráneo por razones culturales, históricas y biológicas. El olivo como especie está formado por seis subespecies (europaea, maroccana, cerasiformis, laperrinei, guanchica, y cuspidata) que juntas forman el llamado complejo O. europaea. Del mismo modo, la subsp. europaea se divide en dos variedades: var. europaea, que comprende las formas cultivadas, y var. sylvestris (también llamado oleaster), que incluye las formas silvestr...

  20. Utilização de fotografia hemisférica na determinação do índice de área foliar de oliveiras jovens (Olea europaea L. Use of hemispherical photography for plant area index determination in young olive trees (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    M. P. Simões

    2007-01-01

    Full Text Available O índice de área foliar (LAI é um parâmetro essencial para a caracterização da estrutura das copas e consequentemente para a avaliação da vitalidade das plantas. Neste estudo compararam-se valores de LAI obtidos através de métodos directos destrutivos e através da análise de fotografia hemisférica, em oliveiras jovens das cultivares ‘Galega’ e ‘Cordovil de Serpa’, num olival da região de Moura. Os valores determinados por fotografia hemisférica subestimaram significativamente (PThe determination of leaf area index (LAI is essential in the characterization of the canopy structure and plants vitality evaluation. In this study destructive measurements of LAI were compared with values obtained by hemispherical photography analysis, of young olive trees cv. Galega and cv. Cordovil de Serpa, in an olive orchard of Moura region. As the direct method is assumed to be the most correct for estimating LAI, this method served as reference for the performance of the indirect methods. In order to be able to use the indirect methods to determine the LAI in the future, regression equations have been calculated taking into consideration the results of the indirect and the direct methods. Our results suggest that this procedure is an alternative method suitable to LAI determination in young olive trees after specific calibration.

  1. Cooperation-Induced Topological Complexity: A Promising Road to Fault Tolerance and Hebbian Learning

    Science.gov (United States)

    2012-03-16

    Information Science Directorate, United States Army Research Office, Durham, NC, USA 4 Istituto di Fisiologia Clinica del Consiglio Nazionale delle...Vadim Uritsky, Catholic University of America at NASA Goddard Space Flight Center, USA *Correspondence: Paolo Allegrini , Istituto di Fisiologia Clinica

  2. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MVPEMGDYYVPATQNNARILVRNENGIELLSNICRHRQATILEGRGSSRNIVCP 101 ... YVGHELMVPEMGDYYVPATQNNARILVRNENGIE...LLSNICRHRQATILEGRGSSRNIVCP Sbjct: 1 ... YVGHELMVPEMGDYYVPATQNNARILVRNENGIELLSNICRHRQATILEGRGSSRNIVCP 60 ... ...otein ... 2Fe-2S subunit [Nitrosomonas europaea ATCC 19718] ... Length = 99 ... Query: 42 ... YVGHEL

  3. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Nitrosomonas europaea ATCC 19718] ... Length = 75 ... Query: 1 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEH...QLELFEMLLSLSDHDLWNIIIGNT 60 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEHQLELFEM...LLSLSDHDLWNIIIGNT Sbjct: 1 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEHQLELFEMLLSLSDHDLWNIIIGNT 60 ...

  4. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Nitrosomonas europaea ATCC 19718] ... Length = 96 ... Query: 3 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDS...IDPGPAGFTGSLIV 62 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDS...IDPGPAGFTGSLIV Sbjct: 1 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDSIDPGPAGFTGSLIV 60 ...

  5. Cover Crops in West Africa

    International Development Research Centre (IDRC) Digital Library (Canada)

    Effects of UV-B on activities of enzymes of secondary phenolic metabolism in barley primary leaves. Physiologia Plantarum, 93, 734–739. Lubis, I.S.; Sastrapradha, S.H.A. 1981. L-dihydroxy-phenylalanine (L-Dopa) in Mucuna seeds. Annales Bogorienses, 7(3), 107–114. Manyam, B. 1995. An alternative medicine treatment ...

  6. In ricordo di Vittorio Bianchi

    Directory of Open Access Journals (Sweden)

    Maurizio Cutolo

    2011-09-01

    Full Text Available Vittorio Bianchi fu Ernesto e fu Mary Sbertoli naque a Cogoleto (Genova il 17 febbraio 1919. Laureato in Medicina e Chirurgia presso l’Università di Genova nel 1943 con lode fu Allievo interno della Clinica Medica di Genova negli anni 1942 e 1943, Assistente Volontario alla Clinica Medica di Perugia, quindi della Clinica Medica di Genova negli anni seguenti dove fu nominato Assistente di ruolo per concorso nel 1950. Successivamente Assistente di ruolo alla Patologia Medica diretta dal prof. Aminta Fieschi nel periodo 1954- 1969....

  7. Influence des modifications de l’équilibre source-puits sur les paramètres physiologiques et biochimiques chez l'olivier (Olea europaea L.), sous bioclimat semi-aride de Tunisie

    OpenAIRE

    Haouari, Afef

    2013-01-01

    La culture de l’olivier en Tunisie est restée globalement une culture traditionnelle de faible rentabilité. Les causes de cette situation sont multiples, y compris les traitements culturaux archaïques, les cultivars inadéquats et l’alternance de production. De ce fait, une bonne connaissance des aspects physiologiques et biologiques de l’arbre, est d’une importance fondamentale pour une gestion raisonnable des pratiques agronomiques et un bon développement d’une oléiculture moderne. Il est im...

  8. Investigación para caracterizar el volumen de suelo húmedo (VSH) en riego localizado. Influencia del VSH en olivo (Olea europaea L.), manzano (Malus domestica BORKH.) y avellano (Corylus avellana L.)

    OpenAIRE

    Gispert Folch, Juan Ramón

    2008-01-01

    La tesi Doctoral, de la que ara se‟n presenta un compendi resumit, manté com a fil conductor l'aplicació eficient de l'aigua de reg a nivell de parcel·la agrícola. El maneig de l'aigua a l'agricultura, sector productiu que usa el més alt percentatge d‟aquest element (77,5%), és fonamental si es vol incidir favorablement sobre el consum i l'actual política hidràulica, més orientada a un increment de l'oferta que a un control de la demanda. L'elecció d'un sistema de reg eficient, co...

  9. Estudio comparativo de las características físico-químicas del aceite de sacha inchi (Plukenetia volubilis l., aceite de oliva (Olea europaea y aceite crudo de pescado

    Directory of Open Access Journals (Sweden)

    Luz María Paucar-Menacho

    2015-01-01

    Full Text Available Los aceites vegetales tales como el aceite de sacha inchi (ASI y oliva (AO contienen ácidos grasos mono-insaturados (omega-9 y poliinsaturados (omega-6, y pequeñas cantidades de omega-3. Por el contrario, los aceites de origen marino como el aceite crudo de pescado (ACP se caracterizan por su alto contenido en omega-3. El objetivo de la presente investigación fue determinar y comparar las características físico-químicas de estos tres aceites a fin de establecer cuál es el mejor para el uso alimentario. El Índice de acidez, índice de refracción y densidad relativa se determinó por métodos oficiales AOAC, y el tiempo de vida útil por el método Rancimat, a tres temperaturas (100 °C; 120 °C y 150 °C, extrapolando los resultados a 25 °C.Los resultados obtenidos en la caracterización fisicoquímica indican que estos aceites son significativamente diferentes. Los índices de acidez en % de ácido oleico fueron de 1,08, 1,14 y 1,561 para ASI, AO y ACP respectivamente. Los índices de refracción (20 °C fueron 1,475, 1,469 y 1,481 para ASI, AO y ACP respectivamente, la densidad relativa fue 0,9283, 0,9152 y 0,9308 para ASI, AO y ACP respectivamente. La vida útil para ASI, AO y ACP fue de 93, 137 y 2 días respectivamente. La composición de ácidos grasos tanto en los aceites de origen vegetal y marino además de su vida útil, imparte gran importancia desde el punto de vista nutricional, ya que están contenidos significativamente en los aceites estudiados. Los resultados indican la importancia de este tipo de aceites en la alimentación humana.

  10. Whole-Organ analysis of calcium behaviour in the developing pistil of olive (Olea europaea L. as a tool for the determination of key events in sexual plant reproduction

    Directory of Open Access Journals (Sweden)

    Zienkiewicz Krzysztof

    2011-11-01

    Full Text Available Abstract Background The pistil is a place where multiple interactions between cells of different types, origin, and function occur. Ca2+ is one of the key signal molecules in plants and animals. Despite the numerous studies on Ca2+ signalling during pollen-pistil interactions, which constitute one of the main topics of plant physiology, studies on Ca2+ dynamics in the pistil during flower formation are scarce. The purpose of this study was to analyze the contents and in situ localization of Ca2+ at the whole-organ level in the pistil of olive during the whole course of flower development. Results The obtained results showed significant changes in Ca2+ levels and distribution during olive pistil development. In the flower buds, the lowest levels of detectable Ca2+ were observed. As flower development proceeded, the Ca2+ amount in the pistil successively increased and reached the highest levels just after anther dehiscence. When the anthers and petals fell down a dramatic but not complete drop in calcium contents occurred in all pistil parts. In situ Ca2+ localization showed a gradual accumulation on the stigma, and further expansion toward the style and the ovary after anther dehiscence. At the post-anthesis phase, the Ca2+ signal on the stigmatic surface decreased, but in the ovary a specific accumulation of calcium was observed only in one of the four ovules. Ultrastructural localization confirmed the presence of Ca2+ in the intracellular matrix and in the exudate secreted by stigmatic papillae. Conclusions This is the first report to analyze calcium in the olive pistil during its development. According to our results in situ calcium localization by Fluo-3 AM injection is an effective tool to follow the pistil maturity degree and the spatial organization of calcium-dependent events of sexual reproduction occurring in developing pistil of angiosperms. The progressive increase of the Ca2+ pool during olive pistil development shown by us reflects the degree of pistil maturity. Ca2+ distribution at flower anthesis reflects the spatio-functional relationship of calcium with pollen-stigma interaction, progamic phase, fertilization and stigma senescence.

  11. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  12. ORF Alignment: NC_002488 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  13. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  14. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  15. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  16. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  17. ORF Alignment: NC_003112 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  18. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  19. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21231567 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  20. ORF Alignment: NC_004551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  1. ORF Alignment: NC_004572 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  2. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  3. ORF Alignment: NC_003116 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  4. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  5. ORF Alignment: NC_004556 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004556 gi|28198275 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  6. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  7. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  8. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  9. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002516 gi|15598180 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  10. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  11. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  12. Spatial and taxonomical overlap of fungi on phylloplanes and invasive alien ladybirds with fungal infections in tree crowns of urban green spaces

    DEFF Research Database (Denmark)

    Howe, Andrew Gordon; Ravn, Hans Peter; Jensen, Annette Bruun

    2016-01-01

    Occurrence of entomopathogenic fungi on phylloplanes in Tilia x europaea crowns between 1 - 13m was assessed in urban parks. Prevalence of fungal infections in ladybirds (Coleoptera: Coccinellidae) collected from T. x europaea was assessed to determine whether fungi found on phylloplanes also occ...

  13. Síndrome psicótica evoluindo com demência como manifestação clinica de deleção do DNA mitocondrial Psycothic syndrome developing into dementia as a clinical manifestation of mitochondrial DNA deletion

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Rocha Vasconcellos

    2007-03-01

    Full Text Available As manifestações das doenças mitocondriais são variadas, acometendo, mais freqüentemente, órgãos com alto metabolismo aeróbico em que são mais abundantes, como, por exemplo, o sistema nervoso. O início dos sintomas em geral é observado na infância havendo relatos de início na idade adulta. Apresentamos caso atípico de doença mitocondrial associada à deleção do DNA mitocondrial em um homem de 39 anos com sintomas psiquiátricos configuraram quadro clínico inicial e somente 12 anos após o início dos sintomas surgiram alterações neurológicas. O diagnóstico da doença mitocondrial foi confirmado por biópsia de músculo sendo documentada deleção do DNA mitocondrial.The manifestations of mitochondrial disease are variable, affecting more frequently the organs with high aerobic metabolism in which they are more abundant, for example the nervous system. The beginning of symptoms in general is observed at chilhood, but some patients presented on adult age. We present an atypical case associated with mitochondrial DNA deletion. A 39-years-old man with psychiatric symptoms that configured initial clinical picture and only after 12 years of the beginning of symptoms neurological alterations became noticeable. The diagnosis of mitochondrial illness was confirmed by muscle biopsy being documented mitochondrial DNA deletion.

  14. Clinical evolution of patients hospitalized due to the first episode of Acute Coronary Syndrome Evolución clínica de pacientes internados debido el primer episodio de la Síndrome Aguda de las Coronarias Evolução clinica de pacientes internados em decorrência do primeiro episódio da Síndrome Coronariana Aguda

    Directory of Open Access Journals (Sweden)

    Gislaine Pinn Gil

    2012-10-01

    Full Text Available AIM: to assess the clinical evolution of patients hospitalized due to the first episode of Acute Coronary Syndrome (ACS according to its clinical manifestation. METHODS: data were collected from 234 patients, hospitalized between May 2006 and July 2009 due to the first episode of an ACS, by consulting their medical records. RESULTS: 234 patients were hospitalized, 140 (59.8% due to Acute Myocardial Infarction (AMI. In the group with AMI, 19.3% presented complications, against 12.8% in the group with Unstable Angina (UA (p=0.19. Angioplasty levels were higher among patients with AMI than with UA (p=0.02 and coronary artery bypass graft surgery was more frequent among UA patients (p=0.03. The majority (227; 97% survived after the coronary event. Among the seven patients who died during the hospitalization, four had AMI (2.9% and three UA (3.2%. CONCLUSIONS: A larger number of complications were found among infarction victims and the accomplishment of coronary artery bypass graft surgery differed between the groups.OBJETIVO: evaluar la evolución clínica de pacientes internados por el primer episodio del Síndrome Aguda de Coronarias según su manifestación clínica. MÉTODOS: Fueron colectados datos de 234 pacientes internados entre mayo de 2006 y julio de 2009 debido el primer episodio de una ACA mediante consultas a los prontuarios. RESULTADOS: La mayoría (59,8% internó debido al Infarto Agudo del Miocardio (IAM. En el grupo con IAM, 19,3% presentaron complicaciones y 12,8% en el grupo con Angina Inestable (AI(p=0,19. La realización de angioplastia fue mayor entre los pacientes con IAM de lo que con AI (p=0,02 y la cirugía de revascularización fue más realizada entre los pacientes con AI (p=0,03. La mayoría (227; 97% sobrevivió al evento de las coronarias. Entre los siete pacientes que murieron en la internación, cuatro tenían IAM (2,9% y tres AI (3,2%. CONCLUSIONES: Hubo mayor número de complicaciones entre los infartados y la realización de revascularización del miocardio fue diferente en los dos grupos.OBJETIVO: avaliar a evolução clínica de pacientes internados pelo primeiro episódio da síndrome coronariana aguda (SCA, segundo sua manifestação clínica. MÉTODOS: foram coletados dados de 234 pacientes internados entre maio de 2006 e julho de 2009, em decorrência do primeiro episódio de uma SCA, mediante consultas aos prontuários. RESULTADOS: a maioria (59,8% foi internada devido ao infarto agudo do miocárdio (IAM. No grupo com IAM, 19,3% apresentaram complicações e 12,8% no grupo com angina instável (AI (p=0,19. A realização de angioplastia foi maior entre os pacientes com IAM do que com AI (p=0,02 e a cirurgia de revascularização foi mais realizada entre os pacientes com AI (p=0,03. A maioria (227 - 97% sobreviveu ao evento coronariano. Entre os sete pacientes que morreram na internação, quatro tinham IAM (2,9% e três AI (3,2%. CONCLUSÕES: houve maior número de complicações entre os infartados e a realização de revascularização do miocárdio foi diferente nos dois grupos.

  15. Study of the positioning of the films of the MLC by a Test of bands and your influence in the clinic dosimetry in IMRT; Estudio del posicionamiento de las laminas del MLC mediante un test de bandas y su influencia en la dosimetria clinica en IMRT

    Energy Technology Data Exchange (ETDEWEB)

    Serrano Zabaleta, S.; Millan Cebrian, E.; Calvo Carrillo, S.; Alba Escorihuela, V.; Garcia Romero, A.; Ortega Pardina, P.; Canella Anoz, M.; Hernandez Vitoria, A.

    2015-07-01

    We performed a test of adjacent bands inspired by the proposed in AAPM Report No. 72, we provides a parameter characterizing the state of the MLC as to the actual position of its blades. This test has been validated by studying repeatability and reproducibility and has found the correlation between the parameter and creep detected by the ILD. Subsequently it has studied the impact of changes in the positioning of the blades on clinical dosimetry in IMRT patients, reconstructing the patient dose by Matrix Evolution team and Compass software, IBA Dosimetry. (Author)

  16. Vinculos, transferencia y transversalidad en la clinica grupal. Un estudio realizado en la casa de la niñez II, con niños y adolescentes varones entre 8 y 17 años con experiencia de vida en calle

    OpenAIRE

    Leiva, Paola

    2011-01-01

    En América Latina el fenómeno de la callejización se agudiza cada día más transformándose en un problema social, gestando una población vulnerable del entorno callejero. En nuestro país este emergente se ha ido desarrollando a pasos muy gigantescos. UNICEF indica que existe un aproximado de cien millones de niños que viven en las calles del mundo. En algunas metrópolis de América Latina hay más de 100.0001 niños que viven en las calles, se ha ido incrementando este fenómeno y s...

  17. Práticas locais em clínica e educação: compromissos com a atual América = Local practices in education and clinical psychology: commitments to today’s America = Prácticas locales en clinica y educación: compromissos com la América actual

    Directory of Open Access Journals (Sweden)

    Menezes, Ana Luisa Teixeira de

    2016-01-01

    Full Text Available A experiência de 12 anos de contato e de pesquisa com os Guarani1, através de pesquisas acerca da dança Guarani2, além dos estudos "Infâncias e educação Guarani"3 e "Pensamento originário e mestiço: caminhos decoloniais na formação acadêmica da educação e da psicologia"4, tem oportunizado que se pense o lugar da atual América, os trabalhos clínicos, de educação em diálogo com a ciência moderna, tendo em vista o projeto científico no campo da psicologia e da educação que evidenciam as práticas locais. Por meio da obra de Rodolfo Kusch, propõe-se uma intersecção, desde um ponto de vista situado não apenas geograficamente

  18. Collimator with compensated filtration: clinical adaptation for recommendation 4f of the EU about the radiation protection in oral dental radiology; Colimador con filtracion compensada: adaptacion clinica para alcanzar la recomendacion 4F de la Union Europea sobre proteccion radiologica al paciente en radiologia odontologica

    Energy Technology Data Exchange (ETDEWEB)

    Alcaraz, M.; Garcia-Vera, C.; Bravo, C. La; Morant, J. J.; Armedo, D. Y.; Canteras, M.

    2006-07-01

    Recent recommendations by the European Union (2004) for performing lateral cranial cephalometry (LCC) state that collimation should be maximized so that only those tissues necessary are irradiated when performing clinical diagnoses, although the fact that many manufacturers do not incorporate these elements in their equipment design has been recognised (recommendations 4f). Aim: the manufacture and utilization of a collimator with a pre-patient compensating filter for LLC which may be used in most extraoraldental radiology units, as well as determining the reduction in the dose of radiation absorbed by more sensitive tissues exposed to said clinical exploration. Making use of mannequins, phantom and craniums, we constructed a collimator with a compensating filter and established the necessary technical, dosimetric and quality specifications for its clinical use. Subsequently, we studied 16 patients referred for cephalometric study, determining the radiation dose (TLDs) in both the patients (crystalline lens, frontal lobe, parotid/submaxillary/thyroid glands and brain) and in the radiographic film, as well as in different parts of the collimator/filter. Al presented we are aiming for its clinical use by carrying out LCC in another 16 patients referred of orthodontic treatment but with the pre-a patient introduction of the tested collimator with the compensating filter as a substitute for the usual technique. The collimation reduced the field or radiation by some 40% and with that, so too the radiated tissues. The compensating filter reduced the dose in tissues by some 34.2. Our collimator has allowed the radiological image to be obtained with only one third the usual radiation dose. The dose reaching the film shies only between 17% less than in the usual technique and didn't alter its diagnostic capacity. A reduction of 61,6% of the dose administered to the patient is achieved by incorporating the collimator and filter to most radiological equipment without the need for renovating or substituting existing apparatus. (Author)

  19. Alteration in the absorption cell dose arising from the use of gold nanoparticle associated with the radionuclides of clinical application: simulate study; Alteracao na absorcao de dose celular decorrente da utilizacao de nanoparticulas de ouro associadas a radionuclideos de aplicacao clinica: estudo simulado

    Energy Technology Data Exchange (ETDEWEB)

    Culik, Lucas; Schwarcke, Marcelo, E-mail: mschwarcke@unifra.br [Centro Universitario Franciscano (UNIFRA), Santa Maria, RS (Brazil)

    2015-12-15

    The present work is a proposal to assess, which is the efficiency in the use of radionuclides of clinical application in nuclear medicine service conjugated system with gold nanoparticles.To obtain the results needed for the interpretation of this combination, was using the Monte Carlo simulation code PENELOPE, where was the main structures of a simulated eukaryote cell. To simulate irradiation on cellular structures was used the emission spectrum of main radionuclide clinical use in nuclear medicine service. The material containing gold nanoparticles was modeled according the stoichiometric proportions found in the literature. The results obtained, present for the simulated energies to smaller bodies than 2,0μm, no substantial response to the use of nanoparticles in the reinforcement of locally absorbed dose. Is observed a small decrease in locally dose absorbed due to emission of charged particles, it is believed that causes an increase in the emission secondary range to be placed outside the study body. But this effect is small when comparing to the increase of energy absorbed due to interaction with the bodies containing nanoparticles, so demonstrating an increase in the locally dose absorbed. Being observed that there is an increase in dose absorbed locally due to the use of nanoparticles. For protocols based on the principle of target radionuclide therapy, the imaging of the treaty sit will be affected in their statistical accuracy, since the gamma radiation will be attenuated by the nanoparticles present in the material. Being necessary to know if this increase in the locally absorbed dose has greater importance in the treatment protocol than the image of the absorption of the radioactive material in the target organ. (author)

  20. Resultados do exame anátomo-patológico e "Polymerase Chain Reaction (PCR" na forma clinica e subclinica da infecção anal pelo Papilomavirus Humano (HPV: estudo em quatro grupos de pacientes Histopathological and PCR results for clinical and subclinical forms of HPV anal infection: study of four groups of patients

    Directory of Open Access Journals (Sweden)

    João Carlos Magi

    2006-12-01

    Full Text Available O Papilomavírus Humano tem alta incidência na população. O objetivo deste trabalho é o estudo dos resultados encontrados no exame anatomo-patológico e no PCR das formas clínica e subclínica da infecção anal por HPV em quatro grupos de pacientes. MÉTODO: Foram estudados 10 pacientes com prurido anal idiopático, seis com infecção genital pelo HPV, tratada, seis com condiloma anal tratado e oito com condiloma anal. As verrugas foram biopsiadas nos oito pacientes com condiloma e feito exame de anuscopia de alta resolução com biópsia dirigida nos outros 22 pacientes. O material foi encaminhado para exame anátomo-patológico e depois, a partir do mesmo bloco de parafina, foi feito o exame de PCR. Resultados: O anátomo-patológico foi positivo para HPV em todos os pacientes, sendo que nos oito com condiloma confirmou-se a forma clínica e em 22 diagnosticou-se a subclínica com 13 casos de neoplasia intraepitelial associada. O PCR foi positivo em 91,9% dos 22 pacientes da forma subclínica ao anátomo-patológico e em 87,5% dos oito pacientes da forma clínica. O tipo predominante nos casos de HPV anal subclínico foi o 16 e o predominante nas verrugas foi o 11. CONCLUSÕES: O exame anátomo-patológico foi positivo para HPV em todos os pacientes, propiciando também o diagnóstico de 13 casos de neoplasia intraepitelial, sendo dois de carcinoma "in situ". O PCR foi positivo em 91,9% dos pacientes da forma subclínica ao anátomo-patológico e em 87,5% da forma clínica ao anátomo-patológico. O tipo predominante da forma subclinica foi o 16 e das verrugas foi o 11.The purpose of this study is to analyze the results found in the pathological examination and PCR test for clinical and subclinical HPV anal infections in four groups of patients. Methods: The four groups studied were: ten patients with idiopathic anal pruritus, six with treated HPV genital infection, six with treated anal condyloma, and eight with anal condyloma. Eight patients with condyloma underwent wart biopsy, and high-resolution anoscopy with directed biopsy was performed in the remaining 22 patients. Paraffin wax embedded biopsy specimens were sent to pathological analysis, and later PCR was carried out on the same samples. Results: Through the pathological examination, the presence of HPV is positive in all patients studied: clinically in the eight patients with condyloma, and subclinically in the others 22. Thirteen of these 22 patients presented and associated intraepithelial neoplasia. PCR was positive in 91,9% of the 22 patients those who presented the subclinical infection at pathology examination and 87,5% of the eight patients that presented the clinical infection the most common type of anal subclinical HPV infection was HPV-16 and HPV-11 when warts were presented. Conclusions: Pathological findings related to HPV were presented in all patients studied, and 13 cases were diagnosed two of them were carcinoma in situ. PCR was positive in 91,9% of patients presenting the subclinical infection, and in 87,5% with the clinical infection was HPV-16, and for warts HPV-11.

  1. Quantification of the influence of the choice of the algorithm and planning system on the calculation of a treatment plan; Cuantificacion de la influencia que tiene la eleccion del algoritmo y del sistema de planificacion en el calculo de una dosimetria clinica

    Energy Technology Data Exchange (ETDEWEB)

    Moral, F. del; Ramos, A.; Salgado, M.; Andrade, B; Munoz, V.

    2010-07-01

    In this work an analysis of the influence of the choice of the algorithm or planning system, on the calculus of the same treatment plan is introduced. For this purpose specific software has been developed for comparing plans of a series of IMRT cases of prostate and head and neck cancer calculated using the convolution, superposition and fast superposition algorithms implemented in the XiO 4.40 planning system (CMS). It has also been used for the comparison of the same treatment plan for lung pathology calculated in XiO with the mentioned algorithms, and calculated in the Plan 4.1 planning system (Brainlab) using its pencil beam algorithm. Differences in dose among the treatment plans have been quantified using a set of metrics. The recommendation for the dosimetry of a careful choice of the algorithm has been numerically confirmed. (Author).

  2. Evaluation of the response of modified MAGIC-f polymeric gel using a clinical brachytherapy source and Monte Carlo simulation with package PENELOPE; Avaliacao da resposta do gel polimerico MAGIC-f modificado utilizando uma fonte clinica de braquiterapia e simulacao Monte Carlo com o pacote PENELOPE

    Energy Technology Data Exchange (ETDEWEB)

    Quevedo, Ana Luiza; Nicolucci, Patricia, E-mail: anaquevedo@usp.br [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Dept. de Fisica; Borges, Leandro F. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Setor de Radioterapia

    2016-07-01

    A comparison of experimental and simulated relative doses of a clinical brachytherapy source was performed. A 5 x 5 x 7 cm{sup 3} phantom with a modified MAGIC-f gel was irradiated using a clinical {sup 192}Ir source, Varian, model GammaMed Plus. The phantom was irradiated with 7,5 Gy, commonly used in gynecological treatments. The dose distributions readings were performed 24h after irradiation using Magnetic Resonance Imaging, weighted in T2, with repetition time of 6000 ms, echo-time of 15 ms, 16 echos and 0.40 mm pixel size. The same brachytherapy source was modeled in the Monte Carlo package PENELOPE to obtain dose distributions. The energy cutoff for electrons, photons and positrons was 100 keV, the primary particles condensation parameters remained the same at 0.3. The dose distributions were obtained in two planes perpendicular to the source: one passing through the source’s center and the other at 0.5 cm away from the source’s center in direction of the top of encapsulation. A comparison of the experimental results using the polymeric gel to the computational results showed maximum differences of 12.5%, at 0.62 cm from the source for the central plane, and 6.4% at 0.5 cm from the source for the superior plane. Considering the high dose gradient of these clinical brachytherapy sources, the results obtained in these work show that MAGIC-f gel with modified formulation, is promising for dosimetry in brachytherapy. (author)

  3. Calidad de vida en el trabajo: Profesionales de la salud de Clínica Río Blanco y Centro de Especialidades Médicas Quality of life at work: Health Professionals Clinica Rio Blanco and Center Especialidades Médicas

    Directory of Open Access Journals (Sweden)

    Diemen Delgado García

    2012-09-01

    Full Text Available Objetivo: Identificar un constructo sobre la calidad de vida en el trabajo de los médicos/as y enfermeros/as de Clínica Río Blanco y Centro de Especialidades Médicas. Métodos y Materiales: Estudio transversal y analítico. Se aplicó un cuestionario de datos socio-laborales integrados por 10 ítems y el instrumento CVT-GOHISALO, el cual consta de 74 ítems y mide la calidad de vida en el trabajo en siete dimensiones Resultados: En un grupo de 20 trabajadores entre médicos/as y enfermeros/as, el 40 % cuenta con dos trabajos, el 20 % reporta ausentismo por enfermedad el año previo. El 60 % se desempeñan principalmente en turno mixto. El 40 % tiene una antigüedad de dos a cinco años y el 30 % menos de dos años. El número de horas semanales que dedican al descanso es menor a 20 horas en un 50 % de los trabajadores. Las siete dimensiones evaluadas: soporte institucional para el trabajo, seguridad en el trabajo, integración al puesto de trabajo, satisfacción por el trabajo, bienestar a través del trabajo, desarrollo personal y administración del tiempo libre, reflejan grados de insatisfacción en la calidad de vida en el trabajo. Conclusiones: Los trabajadores de la salud evaluados muestran una serie de percepciones subjetivas que reflejan una realidad de su medio laboral.Objective: To identify a construct on quality of life in the work of doctors and nurses Clínica Río Blanco and Center Especialidades Médicas. Methods and Materials: Cross-sectional and analytical. A questionnaire was social and labor data consisting of 10 question and CVT-GOHISALO instrument, which consists of 74 question and measures the quality of life at work in seven dimensions. Results: In a group of 20 workers among doctors and nurses, 40 % have two jobs, 20 % reported absenteeism due to illness the previous year. 60 % work mainly in mixed shift. 40 % have a length of two to five years and 30 % less than two years. The number of hours per week devoted to rest is less than 20 hours in 50 % of workers. The seven dimensions assessed: institutional support for work, job security, integration into the workplace, job satisfaction, well-being through work, personal development and leisure management, reflect a degree of dissatisfaction in the quality of work life. Conclusions: The health workers evaluated show a series of subjective perceptions that reflect a reality of their workplace.

  4. Determinação do prognostico de pacientes com lesão medular submetidos a estimulação eletrica neuromuscular e fisioterapia convencional, atraves da avaliação fisioterapica, avaliação clinica asia e potencial evocado somato-sensorial

    OpenAIRE

    Beatriz de Oliveira Peixoto

    2002-01-01

    Resumo: Este estudo avaliou o diagnóstico e o prognóstico de pacientes com lesão medular através do potencial evocado sômato sensorial (PESS), avaliação ASIA (classificação neurológica da lesão medular e medida de independência funcional (FIM) e escala de deficiência) e avaliação fisioterápica. O efeito da estimulação elétrica neuromuscular (EENM) foi comparado ao tratamento fisioterápico convencional (FC). Foram estudados 19 pacientes com lesão medular, com idade de 16 a 50 anos e de ambos ...

  5. [The role of biochemical markers of myocardial damage in clinical practice: the diagnosis of infarct and risk stratification. The Intersociety Interdisciplinary Study Group of the ANMCO-SIBioC-SIMeL, Markers of Muocardial Lesions. L'Associazione Nazionale Medici Cardiologi Ospedalieri-Società Italiana di Biochimica Clinica-Società Italiana di Medicina di Laboratorio].

    Science.gov (United States)

    Ottani, F; Galvani, M; Panteghini, M; Dolci, A; Plebani, M; Tubaro, M; Zaninotto, M

    2000-01-01

    For many years creatine kinase (CK) and CK-MB isoenzymes were used together with the ECG to confirm the presence of myocardial infarction. During the last decade newer cardiac markers have been introduced and immunological test systems developed for their quantification. Among these new markers, a prominent role has emerged for cardiac troponins (T or I). These technological advanced assays have shown greater sensitivity compared to "conventional cardiac enzymes;, thereby identifying patients with small--at times, microscopic--infarcts who would not have met defining criteria for myocardial infarction in an earlier era. Another major advantage shown by both cardiac troponins with respect to "conventional cardiac enzymes" is their ability to predict clinical outcome over a short- or long-term follow-up in patients with acute coronary syndromes, and this appears to be particularly relevant in patients with micronecrosis, who constitute a high-risk subgroup of unstable angina patients. Recently, myoglobin has also been widely applied as a marker. Although lacking in myocardial specificity, it is the earliest marker to show an increase after coronary occlusion. Thus, the combined use of myoglobin and a cardiospecific structural protein such as troponin T or I may prove an attractive strategy for biochemical testing in chest pain patients. With the routine use of these novel cardiac markers, fascinating opportunities are now open in the field of diagnostic classification (making the World Health Organization definition of myocardial infarction obsolete) and risk stratification in chest pain patients; opportunities that were unforeseen in the era of cardiac enzymes. However, the use of these markers has also posed some important questions on: a) the best and most cost-effective diagnostic strategy in chest pain patients; b) the remaining role of cardiac enzymes; c) the therapeutic consequences of a positive test result.

  6. Práticas da psicologia clínica em face do sofrimento psíquico causado pelo desemprego contemporâneo Prácticas de psicologia clinica frente al sufrimiento psíquico causado por el desempleo contemporáneo Psychology clinical practices towards psychological suffering caused by contemporary unemployment

    Directory of Open Access Journals (Sweden)

    Daniel Abs

    2010-06-01

    Full Text Available Este estudo objetivou compreender as práticas da Psicologia Clínica em face do sofrimento psíquico causado pelo desemprego contemporâneo. Para tanto, foram entrevistados 8 psicólogos da região metropolitana de Porto Alegre, abordando os seus entendimentos sobre as temáticas de trabalho e desemprego, as suas consequências para a subjetividade dos pacientes, as intervenções utilizadas, o auxílio da abordagem teórica nessas intervenções e as possíveis contribuições da Psicologia em relação ao fenômeno estudado. Foi realizada análise de conteúdo para os dados coletados. Os enunciados foram agrupados em quatro temáticas, com as respectivas categorias: Trabalho, Desemprego, Intervenções sobre o desemprego na clínica e Lugar da Psicologia em face do desemprego. Os enunciados destacaram a falta de operadores clínicos para se lidar com esse fenômeno. Concluiu-se que o desemprego é uma temática da clínica psicológica contemporânea, e que esta necessita produzir operadores capazes de, na clínica, dar conta de fenômenos contemporâneos que estão emergindo, como o desemprego. Concluiu-se igualmente que são necessários mais estudos abordando essa temática.Este estudio tuvo el objetivo de comprender las prácticas de Psicología Clínica frente al sufrimiento psíquico causado por el desempleo contemporáneo. Para tal, fueron entrevistados 8 psicólogos de La región metropolitana de Porto Alegre, abordando sus entendimientos de las temáticas de trabajo y desempleo, consecuencias estas para la subjetividad de los pacientes, intervenciones utilizadas, auxilio del abordaje teórico en estas y posibles contribuciones de la Psicología frente al fenómeno estudiado. Fueron realizados análisis del contenido para los datos colectados. Los enunciados fueron agrupados en cuatro temáticas, con sus respectivas categorias: Trabajo, Desempleo, Intervenciones sobre el desempleo en la clínica y lugar de la Psicología frente al desempleo. Los enunciados destacaron la falta de operadores clínicos para lidar con ese fenómeno. Ese estudio concluyó que el desempleo es una temática de la Clínica Psicológica contemporánea, y que hay una necesidad de producirse operadores que den cuenta, en la clínica, de fenómenos contemporáneos que están emergiendo, como el desempleo, y que más estudios son necesarios acercándose a esta temática.This paper aims at understanding the practices of Clinical Psychology towards psychological suffering caused by contemporary unemployment. To this end, eight psychologists from Porto Alegre outskirts were interviewed. They were asked about their understanding of issues regarding work and unemployment and consequences to patients' subjectivity, intervention practices they used and the relationship of these interventions to theories and possible contributions of psychology towards the phenomenon under scrutiny. Content analysis was used to study the data collected during the interviews.Psychologists' utterances have been divided in four groups based on the following categories: work, unemployment, interventions towards unemployment and psychology's contributions to unemployment. The author concludes that clinical psychology needs to prepare professionals who are able to deal, in their clinical practices, with ever emerging contemporary phenomena such as unemployment. It is also highlighted that more investigations on this area of study are necessary.

  7. APOE epsilon4 and Alzheimer's disease: positive association in a Colombian clinical series and review of the Latin-American studies Asociación positiva entre APOE épsilon4 y demencia de Alzheimer en una serie clinica en Bogotá (Colombia y revision de los estudios latinoamericanos

    Directory of Open Access Journals (Sweden)

    Martine Jacquier

    2001-03-01

    Full Text Available OBJECTIVE: As the strength of the association between the APOE epsilon4 allele and Alzheimer's disease (AD varies across ethnic groups, we studied if there was such an association in Colombian patients. METHOD: We performed apolipoprotein E (APOE genotyping in a clinical sample of 83 unrelated AD patients, predominantly late-onset (>65 yrs including familial ( n =30 and sporadic AD cases (n= 53 diagnosed according to NINCDS-ADRDA criteria and assessed by a multi-disciplinary team. Control subjects (n = 44 had no significant cognitive impairment by medical interview and neuro-psychological testing. RESULTS: We found a high association (OR= 5.1 95%CI 1.9 -13.6 between APOE epsilon4 and AD, in this series with predominantly late-onset cases with familial aggregation in 24 cases (28.9%. A significant negative association was found between epsilon2 and AD (OR= 0.2 95% CI 0.05-0.75. CONCLUSION: Further population-based surveys in Colombia are warranted to precise a possible dose effect of APOE epsilon4.OBJETIVO: Como la fortaleza de la asociación entre el alelo épsilon4 del gen APOE y la enfermedad de Alzheimer (EA difiere entre grupos étnicos, quisimos evaluar si esta asociación existe en pacientes colombianos. MÉTODOS: Realizamos una genotipificación para el gen de la apolipoproteina E (APOE en una muestra clínica de 83 pacientes con EA no relacionados, de inicio predominantemente tardío (> 65 años, incluyendo casos familiares (n=30 y esporádicos (n=53 diagnosticados según los criterios del NINCDS-ADRDA y evaluados por un equipo multi-disciplinario. Los sujetos control (n= 44 no presentaban deterioro cognoscitivo de acuerdo con la entrevista médica y la evaluación neuropsicológica. RESULTADOS: Hallamos una alta asociación (OR= 5.1; IC95% 1.9- 13.6 entre APOE épsilon4 y EA en la serie de casos de inicio tardío y con agregación familiar en 24 sujetos (28.9%. Una asociación negativa, estadísticamente significativa, fue encontrada entre épsilon2 y EA (OR= 0.2; IC95% 0.05-0.75. CONCLUSIÓN: En Colombia son necesarios futuros estudios con base poblacional para poder precisar la existencia o no de un efecto de dosis de APOE épsilon4.

  8. Clinical evaluation of the low intensity laser antialgic action of GaAlAs ({lambda}=785 nm) in the treatment of the temporomandibular disorders; Avaliacao clinica da acao antialgica do laser em baixa intensidade de arseneto de galio e aluminio ({lambda}=785 nm) no tratamento das disfuncoes da articulacao temporo-mandibular

    Energy Technology Data Exchange (ETDEWEB)

    Sanseverino, Nelly Tichauer Maluf

    2001-07-01

    The therapy with laser emitting low intensity has been currently used in the most diverse fields of medicine as therapeutic conduct for pain. It is a non invasive, painless, non-thermal and aseptic type therapy, without any collateral effects, having a good cost/benefit relationship. However, for the therapy with low-intensity laser to result in positive effects, a correct diagnosis is fundamental, as well as a protocol of adequate application. n odontology, the majority of patients diagnosed with temporomandibular disorders (TMD), present pain and limitations in the movements of the jaw. In this work, a GaAlAs laser emitting low intensity, was used, {lambda}=785 nm, in patients having a dysfunction of the temporomandibular joint with a complaint of pain. Twenty patients were divided into two groups. The group treated received laser therapy in the temporomandibular articulations and in the muscles affected. The dose applied was 45 J/cm{sup 2}, while the ten patients in the control group received 0 J/cm{sup 2}, in a total of nine applications, carried out three times a week, during three weeks. he evaluation of the patients was made through clinical examinations of manual palpation of the masseter, temporal, cervical, posterior neck and sternocleidomastoid muscles, and measurements of opening and laterality of the mouth. The results obtained showed a diminishing of the pain and an increase of the mandibular mobility in the patients treated, when compared to the control group. These results point to this therapy as being an important tool in the treatment of pain in patients with a dysfunction in the TMJ, indicating this therapeutic modality as a co-adjuvant in these treatments. (author)

  9. Evaluation of conventional x-ray diagnostic equipment and radiological protection systems of hospitals and clinics installed in Recife city, Brazil; Avaliacao dos equipamentos de raios-X diagnostico convencionais e dos sistemas de protecao radiologica de clinicas e hospitais da cidade de Recife

    Energy Technology Data Exchange (ETDEWEB)

    Passos, Robson Silva

    1999-05-15

    Diagnostic radiology is the main contributor to the man-made exposure of general population. Since Quality Assurance (QA) programs ensure high quality diagnostic images with the lowest possible radiation dose to the patient, it has been recommended that all introduce QA programs for their radiological facilities. Consequently it is important to check the adequacy of equipment operating parameters in diagnostic radiography facilities, to ensure that a high quality of service is delivered. The purpose of this study was to evaluate the operating conditions of diagnostic units installed in Recife, Pernambuco. The study included 31 X-ray units from both public and private diagnostic services. The following parameters were evaluated: coincidence between the luminous and radiation fields; alignment of the radiation beam; agreement between the real and preset values of kVp and exposure time; filtration; half value lower (HVL); luminance of the view box; uniformity of the luminance; illuminance of the environment. The results showed that 20% of the equipment surveyed exhibited discrepancies between the luminous and radiation fields greater than 2% of the source to skin distance. The test of kilovoltage showed that 48% of the units do not fulfill the acceptability criteria, presenting discrepancies higher than {+-} 10% between the measured and preset values. The results of the accuracy of the timer indicated that 81% of the equipment surveyed present a discrepancy greater than {+-} 10% between the time selected in the control panel and actual exposure time.The test of the filtration shown that, in 20% of the equipment, this was inferior to 2,5 mm Al. The test of the luminance of view box shown that 96% of the equipment, shown a luminance lower of 2.000 cd/m{sup 2}. Related to the test of the uniformity of the luminance, 81 % of the equipment shown a variation of the uniformity higher then 10%. The test of the iluminancy of the environment shown that 61 % of the equipment presented on iluminancy level out of the gap between 50 and 100 lux. The results of this survey showed that a high percentage of the equipment surveyed demonstrated inadequate operating conditions, reinforcing the need to implement quality control protocols in conventional x-ray units located in Recife. (author)

  10. Association among nursing diagnoses, demographic variables, and clinical characteristics of patients with high blood pressure Asociación entre diagnósticos de enfermería y variables sociales/clinicas en pacientes hipertensos Associação entre diagnósticos de enfermagem e variáveis sociais/clínicas em pacientes hipertensos

    Directory of Open Access Journals (Sweden)

    Francisca de Fátima Vasconcelos

    2007-09-01

    Full Text Available OBJECTIVES: To analyze the association among diagnoses, demographic variables, and clinical characteristics of patients with high blood pressure. METHODS: The data were collected in 67 patients from a primary care unit in Fortaleza, Brazil. The NANDA Taxonomy was used to determine the nursing diagnoses. Data analysis consisted of Fisher's exact test, Chi-square test, and likelihood ratio test. RESULTS: Fifty four nursing diagnoses were identified; fifteen were above the 75th percentile. Ineffective individual therapeutic regimen management and number of medication, sleep pattern disturbance and marital status, activity intolerance and education, activity intolerance and time of diagnoses, sexual dysfunction and gender, sexual dysfunction and education, risk for falls and age, marital status and time of diagnoses, chronic pain and marital status all had significant association coefficients. CONCLUSION: Some demographic characteristics were associated with nursing diagnoses.OBJETIVO: Analizar la asociación estadística entre diagnósticos y características sociales / clínicas de pacientes hipertensos. MÉTODOS: Los datos fueron recolectados en una unidad básica de salud de Fortaleza-Ceará con 67 pacientes. La identificación de los diagnósticos se llevó a cabo según la taxonomía de la NANDA. Para el análisis de los datos se utilizó test de Fisher, Chi-Cuadrado de Pearson y Razón de Verosemejanza. RESULTADOS: Se encontró 54 diagnósticos de enfermería y 15 sobre el percentil 75. Se verificó asociación estadística entre: Control eficaz del régimen terapéutico y número de medicamentos; Patrón de sueño perturbado y estado civil; Intolerancia a la actividad y escolaridad y años de diagnóstico; Disfunción sexual y sexo y escolaridad; Riesgo para caídas y edad, estado civil y tiempo de diagnóstico de la enfermedad; Dolor crónico y estado civil. CONCLUSIÓN: Algunas características demográficas están asociadas a la ocurrencia de diagnósticos de enfermería.OBJETIVO: Analisar a associação estatística entre diagnósticos e características sociais / clínicas de pacientes hipertensos. MÉTODOS: Os dados foram coletados numa unidade básica de saúde de Fortaleza-Ce com 67 pacientes. A identificação dos diagnósticos foi procedida segundo a taxonomia da NANDA. Para análise dos dados utilizou-se testes de Fisher, Qui-Quadrado de Pearson e Razão de Verossimilhança. RESULTADOS: Encontrou-se 54 diagnósticos de enfermagem e 15 acima do percentil 75. Verificou-se associação estatística entre: Controle eficaz do regime terapêutico e número de medicamentos; Padrão de sono perturbado e estado civil; Intolerância à atividade e escolaridade e anos de diagnóstico; Disfunção sexual e sexo e escolaridade; Risco para quedas e idade, estado civil e tempo de diagnóstico da doença; Dor crônica e estado civil. CONCLUSÃO: Algumas características demográficas estão associadas à ocorrência de diagnósticos de enfermagem.

  11. EL ESTRÉS CRÓNICO Y LA MEDICIÓN PSICOMÉTRICA DEL DISTRÉS EMOCIONAL PERCIBIDO EN MEDICINA Y PSICOLOGÍA CLINICA DE LA SALUD/ CHRONIC STRESS AND THE MEASUREMENT OF PERCEIVED EMOTIONAL DISTRESS IN MEDICINE & HEALTH PSYCHOLOGY

    Directory of Open Access Journals (Sweden)

    Manolete S. Moscoso*

    2011-02-01

    Full Text Available RESUMENEl propósito central de este artículo es presentar el Inventario de Distrés Emocional Percibido (IDEP e indicar su utilidaden el área de la psicología clínica de la salud. Se presenta un marco conceptual coherente y multidimensional acerca deldistrés emocional percibido. Los resultados del análisis factorial de componentes principales con rotaciones promaxclaramente indican que el IDEP es un instrumento psicométrico que presenta una descripción válida y confiable del distrésemocional percibido en pacientes con diagnóstico de cáncer. Dichas observaciones sugieren que el IDEP provee informaciónsignificativa acerca de los diferentes factores multidimensionales del distrés emocional percibido. Nuestra intención es queeste reporte empírico estimule la investigación psicométrica en Latinoamérica con la intención de replicar los resultadosobservados en el presente estudio de investigación.ABSTRACTThe central purpose of this study is to describe the Perceived Emotional Distress Inventory (PEDI and point out itsusefulness in the field of health psychology. The conceptual framework that guided the development of the PEDI, factorstructure, internal consistency, and construct validity are reported. Item responses were examined by Factor Analyses ofPrincipal Components with promax rotations. The PEDI presents three subscales that assesses Anxiety/Depression,Hopelessness, and Anger Expression as components of perceived emotional distress in cancer patients. We also discussthe important implications of replicating these results in the different regions of Latin America.

  12. Comparative analysis between two-dimensional (2D) and three-dimensional (3D) MRI acquisitions - clinical applications for the evaluation of the knees in juvenile rheumatoid arthritis (JRA); Analise comparativa entre aquisicao tri (3D) e bidimensional (2D) em ressonancia magnetica - aplicabilidade clinica em joelhos em artrite reumatoide juvenil (ARJ)

    Energy Technology Data Exchange (ETDEWEB)

    Doria, Andre S. [Hospital das Clinicas, Sao Paulo, SP (Brazil). Inst. de Radiologia; Rebelo, Marina de Sa [Hospital das Clinicas, Sao Paulo, SP (Brazil). Instituto do Coracao. Servico de Informatica; Castro, Claudio Campi de [Hospital das Clinicas, Sao Paulo, SP (Brazil). Instituto do Coracao. Servico de Ressonancia Magnetica] [and others

    2000-06-01

    In this cross-sectional study in patients with juvenile rheumatoid arthritis the authors compare two-dimensional evaluation of the maximum synovial diameter on post-contrast axial T1-weighted SE (spin-echo) sequences with volumetric (three-dimensional assessment) on post-contrast axial T1-weighted SPIR (spectral presaturation with inversion recovery) SE sequences. With the aim of determining their cost-effectiveness these two methods of assessment were compared to clinical and laboratorial parameters, as well as the presence of synovial enhancement seen on magnetic resonance imaging. (author)

  13. Evaluation of the response of polymeric gel modified MAGIC-f using a clinical brachytherapy source and Monte Carlo simulation with package PENELOPE; Avaliacao da resposta do gel polimerico MAGIC-f modificado utilizando uma fonte clinica de braquiterapia e simulacao Monte Carlo com o pacote PENELOPE

    Energy Technology Data Exchange (ETDEWEB)

    Quevedo, Ana Luiza; Nicolucci, Patricia [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Filosofia Ciencias e Letras. Dept. de Fisica; Borges, Leandro F. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Hospital das Clinicas. Setor de Radioterapia

    2016-07-01

    In this work a comparison of experimental and simulated relative doses of a clinical brachytherapy source was performed. A 5 x 5 x 7 cm{sup 3} phantom with a modified MAGIC-f gel was irradiated using a clinical {sup 192}Ir source and read using Magnetic Resonance Imaging. The Monte Carlo simulation package PENELOPE was used to simulate the dose distributions of the same radiation source. The dose distributions were obtained in two planes perpendicular to the source: one passing through the source's center and the other at 0.5 cm away from the source's center. The higher differences found between experimental and computational distributions were 12.5% at a point 0.62 cm from the source for the central plane and 8.6% at 1.3 cm from the source to the plane 0.5 cm away from the source's center. Considering the high dose gradient of these dose distributions, the results obtained show that the modified MAGIC-f gel is promising for brachytherapy dosimetry. (author)

  14. Lesión cutánea esporotricoide en un paciente procedente de una región subtropical de Ecuador

    OpenAIRE

    Hashiguchi, Yoshihisa

    2014-01-01

    Universidad Central del Ecuador http://www.elsevier.es/es-revista-enfermedades-infecciosas-microbiologia-clinica-28-articulo-lesion-cutanea-esporotricoide-un-paciente-S0213005X14000603?redirectNew=true

  15. Eesti nimekaim ilukirurg jagab enesekindlust / Peep Pree ; intevjueerinud Priit Pullerits

    Index Scriptorium Estoniae

    Pree, Peep, 1958-

    2006-01-01

    Vestlus Tartu esteetilise kirurgia erakliiniku Clinica juhatajaga tööst, vastutustundest, ebaõnnestumistest. Kommenteerivad Tartu linnapea Laine Jänes ja Tartu Ülikooli arstiteaduskonna emeriitprofessor Ennu Sepp

  16. Disease: H01580 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available l features and dietary history, and there is rapid resolution of signs and symptoms after vitamin C suppleme...because alcohol decreases the absorption of vitamin C. The diagnosis of scurvy is generally based on clinica

  17. Equipment for the extraction of 99sup(m)TcO4Na

    International Nuclear Information System (INIS)

    Pliego, O.H.; Fraga de Suarez, A.H.; Goncalvez, Maria de; Marques, Roberto; Guerrero, Gustavo; Mitta, A.E.A

    1980-04-01

    An equipment is described for the extraction of 99 sup(m)Tc by the liquid-liquid extraction method, installed at the Nuclear Medicine Center of theHospital de Clinicas ''Jose de San Martin''. (author) [es

  18. Criptococose em pacientes submetidos a transplante renal

    OpenAIRE

    Ponzio, Vinicius [UNIFESP

    2007-01-01

    Introdução: A criptococose e a terceira causa de infeccao fungica invasiva nos pacientes submetidos a transplante renal, apresentando alta mortalidade. Objetivo: Descrever as caracteristicas epidemiologicas, clinicas e diagnostica, assim como os fatores prognosticos e o impacto da anfotericina B sobre a funcao do enxerto da criptococose em pacientes submetidos a transplante renal. Metodos: Foi utilizada ficha clinica padrao, com mais de 250 variaveis, para avaliar todos os casos de criptococo...

  19. Genetic similarity among Tunisian cultivated olive estimated through SSR markers

    OpenAIRE

    Abdelhamid, S.; Grati_kamoun, N.; Marra, F.; Caruso, T.

    2013-01-01

    Olive (Olea europaea L. subsp. europaea var. europaea) is one of the oldest fruit tree in the Mediterranean basin, and is cultivated for oil and canned fruit. Part of this interest is driven by the economic importance of olive oil which is increasing throughout the world due to its beneficial effect to human health. In Tunisia, olive has great socio-economic importance, with more than 60 millions olive trees cultivated for olive oil production including a wide range of cultivars which are wid...

  20. Interessante waarnemingen van Lepidoptera in België in 2007 (Lepidoptera)

    NARCIS (Netherlands)

    de Prins, W.

    2008-01-01

    Een hele reeks nieuwe provinciewaarnemingen en enkele andere bijzonderheden worden vermeld. De families, genera en soorten worden in alfabetische volgorde opgegeven. De nomenclatuur volgt de lijst in Fauna Europaea (www.faunaeur.org).

  1. Nitrification by immobilized cells

    NARCIS (Netherlands)

    Wijffels, R.H.

    1994-01-01

    Nitrosomonas europaea and Nitrobacteragilis are nitrifying bacteria. Subsequently they oxidize ammonia to nitrite and nitrite to nitrate. Nitrification is a key process for the removal of nitrogen compounds from

  2. Pathogenicity of Phytophthora species isolated from rhizosphere soil in the eastern United States

    Science.gov (United States)

    Y. Balci; S. Balci; W.L. MacDonald; K.W. Gottschalk

    2008-01-01

    Pathogenicity of seven Phytophthora species was assessed by inoculation of stem and foliar tissues of oak species (Quercus spp.) native to the eastern United States. Phytophthora cambivora, P. cinnamomi, P. citricola, P. europaea, P. quercina...

  3. African Journal of Biotechnology - Vol 9, No 4 (2010)

    African Journals Online (AJOL)

    Comparative molecular analysis of old olive (Olea europaea L.) genotypes from Eastern Mediterranean Region of Turkey · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C Durgac, Y Kiyga, M Ulas ...

  4. African Journal of Biotechnology - Vol 7, No 21 (2008)

    African Journals Online (AJOL)

    Heavy metal accumulation in under crown Olea europaea L forest irrigated with wastewater · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. SS Amiri, H Maralian, A Aghabarati ...

  5. Competition for Ammonium between Plant-Roots and Nitrifying and Heterotrophic Bacteria and the Effects of Protozoan Grazing

    NARCIS (Netherlands)

    Verhagen, F.J.M.; Laanbroek, H.J.; Woldendorp, J.W.

    1995-01-01

    The competition for limiting amounts of ammonium between the chemolithotrophic ammonium-oxidizing species Nitrosomonas europaea, the heterotrophic species Arthrobacter globiformis and roots of Plantago lanceolata (Ribwort plantain) was studied in a series of model systems of increasing complexity,

  6. Growth at low ammonium concentrations and starvation response as potential factors involved in niche differentiation among ammonia-oxidizing bacteria.

    Science.gov (United States)

    Bollmann, Annette; Bär-Gilissen, Marie-José; Laanbroek, Hendrikus J

    2002-10-01

    In nature, ammonia-oxidizing bacteria have to compete with heterotrophic bacteria and plants for limiting amounts of ammonium. Previous laboratory experiments conducted with Nitrosomonas europaea suggested that ammonia-oxidizing bacteria are weak competitors for ammonium. To obtain a better insight into possible methods of niche differentiation among ammonia-oxidizing bacteria, we carried out a growth experiment at low ammonium concentrations with N. europaea and the ammonia oxidizer G5-7, a close relative of Nitrosomonas oligotropha belonging to Nitrosomonas cluster 6a, enriched from a freshwater sediment. Additionally, we compared the starvation behavior of the newly enriched ammonia oxidizer G5-7 to that of N. europaea. The growth experiment at low ammonium concentrations showed that strain G5-7 was able to outcompete N. europaea at growth-limiting substrate concentrations of about 10 micro M ammonium, suggesting better growth abilities of the ammonia oxidizer G5-7 at low ammonium concentrations. However, N. europaea displayed a more favorable starvation response. After 1 to 10 weeks of ammonium deprivation, N. europaea became almost immediately active after the addition of fresh ammonium and converted the added ammonium within 48 to 96 h. In contrast, the regeneration time of the ammonia oxidizer G5-7 increased with increasing starvation time. Taken together, these results provide insight into possible mechanisms of niche differentiation for the ammonia-oxidizing bacteria studied. The Nitrosomonas cluster 6a member, G5-7, is able to grow at ammonium concentrations at which the growth of N. europaea, belonging to Nitrosomonas cluster 7, has already ceased, providing an advantage in habitats with continuously low ammonium concentrations. On the other hand, the ability of N. europaea to become active again after longer periods of starvation for ammonium may allow better exploitation of irregular pulses of ammonium in the environment.

  7. Generator 113{sup S}n-113m{sup I}n. Study of the most important characteristics in the evaluate composition for the preparation of clinical labelled compounds; Generador de 113{sup S}n- 113m{sup I}n. Estudio de las caracteristicas mas relevantes en la composicion del eluido con miras a la obtencion de compuestos marcados de aplicacion clinica

    Energy Technology Data Exchange (ETDEWEB)

    Adan, L.; Rebollo, D. V.

    1978-07-01

    The design for the construction of a generator 113{sup S}n -113m{sup l}n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs.

  8. Importance of parathyroid SPECT and {sup 99m}Tc scintigraphy, and of clinical, laboratorial, ultrasonographic and cytologic correlation in the pre-operative localization of the parathyroid adenoma - pictorial assay;Importancia da complementacao com SPECT e {sup 99m}Tc na cintilografia das paratiroides e da correlacao clinica, laboratorial, ultrassonografica e citologica na localizacao pre-operatoria do adenoma de paratiroide: ensaio pictorico

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Marco Antonio Conde de, E-mail: marco.oliveira@fleury.com.b [Fleury Medicina e Saude, Sao Paulo, SP (Brazil). Servicos de Medicina Nuclear; Maeda, Sergio Setsuo; Dreyer, Patricia; Lobo, Alberto; Andrade, Victor Piana de; Hoff, Ana O.; Biscolla, Rosa Paula Mello; Smanio, Paola; Brandao, Cynthia M.A.; Vieira, Jose G. [Fleury Medicina e Saude, Sao Paulo, SP (Brazil)

    2010-06-15

    Objective: In patients with primary hyperparathyroidism, candidates for surgical intervention, the parathyroid pre-operative localization is of fundamental importance in planning the appropriate surgical approach. Materials and methods: The additional acquisition of SPECT and Technetium-99m images, during parathyroid scintigraphy with Sestamibi, is not common practice. Usually, only planar image acquisition, 15 minutes prior and 2 hours after radiopharmaceutical administration, is performed. Results: in our experience, the complete protocol in parathyroid scintigraphy increases the accuracy of pre-operative parathyroid localization. Conclusion: the complete utilization of all available nuclear medicine methods (SPECT e {sup 99m}Tc) and image interpretation in a multidisciplinary context can improve the accuracy of parathyroid scintigraphy. (author)

  9. “EVALUACIÓN DE LA MICROFILTRACIÓN APICAL POSTERIOR A LA OBTURACIÓN CON GUTAPERCHA REBLANDECIDA EN XILOL Y GUTAPERCHA SIN REBLANDECER POR MEDIO DE LA MEDICIÓN APICO CORONAL DEL MATERIAL DE TINCIÓN EN CINCUENTA RAICES DE PREMOLARES UNIRRADICULARES INFERIORES EN EL LABORATORIO DE LA CLINICA DE ENDODONCIA DE LA UNIVERSIDAD MICHOACANA DE SAN NICOLAS HIDALGO.SEPTIEMBRE 2005 A AGOSTO 2006”

    OpenAIRE

    Carreón Ochoa, Susana Leticia

    2012-01-01

    1. La obturación de conductos es el reemplazo del contenido pulpar (normal o patológico), por materiales inertes y/o antisépticos que aíslen, en lo posible el conducto radicular, obturándolo de la zona periapical.(1) 2. El objetivo de la obturación de conductos es la incomunicación entre ambas zonas (conducto y periápice), para impedir el paso de gérmenes, exudado, toxinas y alérgenos en un sentido y en otro; es decir, del periápice al conducto y del conducto al periáp...

  10. Comparative study of bridge plate associated to the intramedullary pin and the dynamic compression plate on the experimental osteotomy fixation of femoral in rabbits (Oryctolagus cuniculus). Clinical, radiographic, histological and scintigraphy analyses; Estudo comparativo da placa em ponte associada ao pino intramedular e da placa de compressao dinamica na fixacao de osteotomia experimental em femur de coelhos (Oryctolagus cuniculus). Analises clinica, radiografica, histologica e cintilografica

    Energy Technology Data Exchange (ETDEWEB)

    Borges, Natalie Ferreira

    2011-07-01

    The objectives were to benchmark and monitor the fracture healing of femoral osteotomy in rabbits after fixation with dynamic compression plate and bridge plate associated with intramedullary pin. Were used 14 New Zealand rabbits, four months old with mean weight of 3.5 pounds, from the Experimental Farm Professor Helio Barbosa of the Veterinary School of Minas Gerais Federal Univ. (UFMG). The animals were randomly divided into two groups (I and II). All rabbits underwent osteotomy across the middle third of right femur. In the group I was made to fix the osteotomy with the bridge plate (BP) associated with intramedullary pin, introduced the technique of minimal invasion. In group II, we used dynamic compression plate (DCP) via the conventional approach. Both groups were evaluated clinical, radiographic, histologic and scintigraphic findings. Clinical assessments were performed weekly until the 12{sup th} postoperative week and radiographic examinations were performed before, immediately after, at 15, 30, 45, 60 and 90 days. The bone scintigraphy were performed before and at 20, 50 and 90 days after surgery to monitor the bone metabolism qualitatively and quantitatively. Observed perfusion and bone healing process. After 90 days of study, there was histopathologic evaluation of the osteotomized area and the insertion of screws. In the region of the osteotomy was observed predominance of trabecular bone in group I and group II, the predominance of bone osteons, compatible with the original bone. On insertion of the screws did not differ between groups and there was cortical discontinuity, little necrosis and local hemorrhage. The two types of fixation have led to consolidation within the scheduled period, maturing in early fixation with DCP fixation compared with BP. Scintigraphy demonstrated by the indices of activity and image characteristics, the process of bone healing was significantly greater in animals undergoing early fixation with DCP. (author)

  11. Chryseobacterium oleae sp. nov., an efficient plant growth promoting bacterium in the rooting induction of olive tree (Olea europaea L.) cuttings and emended descriptions of the genus Chryseobacterium, C. daecheongense, C. gambrini, C. gleum, C. joostei, C. jejuense, C. luteum, C. shigense, C. taiwanense, C. ureilyticum and C. vrystaatense.

    Science.gov (United States)

    Montero-Calasanz, Maria del Carmen; Göker, Markus; Rohde, Manfred; Spröer, Cathrin; Schumann, Peter; Busse, Hans-Jürgen; Schmid, Michael; Klenk, Hans-Peter; Tindall, Brian J; Camacho, Maria

    2014-07-01

    A novel non-motile, Gram-staining-negative, yellow-pigmented bacterium, designated CT348(T), isolated from the ectorhizosphere of an organic olive tree in Spain and characterised as an efficient plant growth promoting bacterium, was investigated to determine its taxonomic status. The isolate grew best in a temperature range of 5-35°C, at pH 5.0-8.0 and with 0-1% (w/v) NaCl. Chemotaxonomic and molecular characteristics of the isolate matched those described for members of the genus Chryseobacterium. The DNA G+C content of the novel strain was 38.2mol%. The strain contained a polyamine pattern with sym-homospermidine as the major compound and produced flexirubin-type pigments. MK-6 was the dominant menaquinone and the major cellular fatty acids were iso-C15:0, C17:1ω9c, iso-C17:0 3-OH and iso-C15:0 2-OH. The main polar lipids were phosphatidylethanolamine and several unidentified lipids and aminolipids. The 16S rRNA gene showed 92.2-97.8% sequence identity with the members of the genus Chyseobacterium. Based on the phenotypic traits and DNA-DNA hybridizations with the type strains of the most closely related species, the isolate is shown to represent a novel species, Chyseobacterium oleae, type strain CT348(T) (=DSM 25575 =CCUG 63020). Emended descriptions of the genus Chryseobacterium and C. daecheongense, C. gambrini, C. gleum, C. joostei, C. jejuense, C. luteum, C. shigense, C. taiwanense, C. ureilyticum and C. vrystaatense are also proposed. Copyright © 2014 Elsevier GmbH. All rights reserved.

  12. Reavaliação crítica da utilidade dos potenciais evocados em neurologia clínica

    OpenAIRE

    Joaquim P. Brasil-Neto

    1992-01-01

    O autor se propõe a revisar a literatura acerca das indicações clinicas dos potenciais evocados multimodais, com ênfase em sua relação custo-benefício, eficácia diagnóstica e comparação às modernas técnicas de diagnóstico por imagem.

  13. Farmacos orales para el control quimico de las biopeliculas dentales (placa bacteriana

    Directory of Open Access Journals (Sweden)

    Rodrigo Abello Moreno

    2013-12-01

    Full Text Available La placa dentobacteriana o biopelicula es la responsable de patologias clinicas como la caries dental, gingivitis y enfermedad periodontal, por lo tanto productos con agentes germicidas actuan en la prevencion de la biopelicula dental cuando las medidas de higiene oral no son las mas apropiadas.

  14. The BESCT Lung Cancer Program (Biology, Education, Screening, Chemoprevention, and Treatment)

    Science.gov (United States)

    2005-03-01

    Copyright?,Z 2004 by the Amerian Soety of Clinica ea Onology . Atl rights reserved, Prolnostle Fac~tors tn Stagn I NSCLC Tabla 3, tUc.vtraisý of Nlo...American Sooienr of Clinical Onology -’- -. --- ---- :-- : -Unfortunately, even among patients with i stage I NSCLC, 40% will die of the disease Lung

  15. original article candida species amongst pregnant women in benin

    African Journals Online (AJOL)

    Dr Oboro VO

    occupation, use of contraceptive pill, were also collected from the women alongside the specimens. For the controls (non pregnant women) absence of pregnancy was confirmed with the. HCG Pregnancy Kit (Quimica Clinica. Aplicada,S.A. Amposta,, Spain). Microscopic examination of specimens. One swab from each pair ...

  16. Un caso anatomo-clínico de Sindrome de Benedikt

    OpenAIRE

    Trelles, J.O.; Suarez, L.; Mendez, M.

    2012-01-01

    El nucleo rojo, cuyas funciones y significado eran completamente desconocidos hace aun muy pocos años, es actualmente objeto de numerosas investigaciones que tienden  a resolver las incofnitas de su rol fisiologico y el papel que desempeña en clinica.

  17. Oligonucleic Acid Drug List: monrd0020 [Nucleic Acid Drug Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 1c) was significantly reduced compared to the placebo group. ... https://www.clinica...ltrialsregister.eu/ctr-search/trial/2015-003337-10/HU, https://link.springer.com/article/10.1007/s10928-017-9505-5, http://www.biospace.com/news_story.aspx?StoryID=443134 ... P47871 4ERS

  18. [The physiotherapic aspect of omeral epicondilitis (author's transl)].

    Science.gov (United States)

    Marenghi, P; Tella, G C

    1976-01-01

    The Authors describe history, etiopatogenesis, clinic, therapy of omeral epicondilitis, very frequent affection. Physiotherapic aspects are studied by different methods. The indications are different compared to clinical aspect, pain modality, relapse eventuality. They conclude with personal considerations based on what observed in Orthopedic Clinica of Parma University.

  19. Analysis of Activity Patterns and Performance in Polio Survivors

    Science.gov (United States)

    2006-10-01

    subjective estimate of their activity level over the past week using the Physical Activity Scale for the Elderly (PASE).3 This instrument dealt with...May 2004. Talaty M. Models for Gait Analysis. 5th SIAMOC (Societa Italiana Di Analisi Del Movimento in Clinica) Congress, Loano, Italy November

  20. An oncofetal glycosaminoglycan modification provides therapeutic access to Cisplatin-resistant bladder cancer

    DEFF Research Database (Denmark)

    Seiler, Roland; Oo, Htoo Zarni; Tortora, Davide

    2017-01-01

    BACKGROUND: Although cisplatin-based neoadjuvant chemotherapy (NAC) improves survival of unselected patients with muscle-invasive bladder cancer (MIBC), only a minority responds to therapy and chemoresistance remains a major challenge in this disease setting. OBJECTIVE: To investigate the clinica...