[Analysis of utilization of information in the journal Medicina Clinica].

Science.gov (United States)

Aleixandre, R; Giménez Sánchez, J V; Terrada, M L; López Piñero, J M

1994-09-10

Scientific communication knowledge is specifically based in the analysis of the bibliographic references inside the publications. Pattern and laws determining the information consumption in the items of the journal Medicina Clinica are investigated in the present study as its own aim. An analysis was performed on the 13,286 references downloaded from 618 papers published by the journal in 1990. With dBASE IV was generated a database for the management of the information; data was distributed in several tables through criteria of age, documentary types, countries, journals and Bradford zones. The analysed references belong to 1,241 different journals, 110 from Spain. Being two thirds of the total sum, the publications from United States and United Kingdom have received more citations than those from Spain. The publications from european countries, like France, Germany and Italy, are scarcely present. Bradford core is constituted by the journals Medicina Clinica and The Lancet. The analysis of the bibliographic references available from the articles in this journal is able to produce knowledge on the information consumption by the practitioners; its usefulness as a complementary utility to the Indice de Citas e Indicadores Bibliométricos de Revistas Españolas de Medicina Interna y sus especialidades 1990 must be considered.

Olea europaea Linn (Oleaceae) Fruit Pulp Extract Exhibits Potent ...

African Journals Online (AJOL)

HP

Alzheimer's disease (AD) and Huntington's disease [1, 2]. Activation ... Olea europaea Linn. (family, Oleaceae), commonly ... Although the health beneficial effects of olive fruit and leaf oils have ..... are up-regulated in the brains of patients with.

Yeast functional screen to identify genes conferring salt stress tolerance in Salicornia europaea.

Science.gov (United States)

Nakahara, Yoshiki; Sawabe, Shogo; Kainuma, Kenta; Katsuhara, Maki; Shibasaka, Mineo; Suzuki, Masanori; Yamamoto, Kosuke; Oguri, Suguru; Sakamoto, Hikaru

2015-01-01

Salinity is a critical environmental factor that adversely affects crop productivity. Halophytes have evolved various mechanisms to adapt to saline environments. Salicornia europaea L. is one of the most salt-tolerant plant species. It does not have special salt-secreting structures like a salt gland or salt bladder, and is therefore a good model for studying the common mechanisms underlying plant salt tolerance. To identify candidate genes encoding key proteins in the mediation of salt tolerance in S. europaea, we performed a functional screen of a cDNA library in yeast. The library was screened for genes that allowed the yeast to grow in the presence of 1.3 M NaCl. We obtained three full-length S. europaea genes that confer salt tolerance. The genes are predicted to encode (1) a novel protein highly homologous to thaumatin-like proteins, (2) a novel coiled-coil protein of unknown function, and (3) a novel short peptide of 32 residues. Exogenous application of a synthetic peptide corresponding to the 32 residues improved salt tolerance of Arabidopsis. The approach described in this report provides a rapid assay system for large-scale screening of S. europaea genes involved in salt stress tolerance and supports the identification of genes responsible for such mechanisms. These genes may be useful candidates for improving crop salt tolerance by genetic transformation.

Yeast functional screen to identify genes conferring salt stress tolerance in Salicornia europaea

Directory of Open Access Journals (Sweden)

Yoshiki eNakahara

2015-10-01

Full Text Available Salinity is a critical environmental factor that adversely affects crop productivity. Halophytes have evolved various mechanisms to adapt to saline environments. Salicornia europaea L. is one of the most salt-tolerant plant species. It does not have special salt-secreting structures like a salt gland or salt bladder, and is therefore a good model for studying the common mechanisms underlying plant salt tolerance. To identify candidate genes encoding key proteins in the mediation of salt tolerance in S. europaea, we performed a functional screen of a cDNA library in yeast. The library was screened for genes that allowed the yeast to grow in the presence of 1.3 M NaCl. We obtained three full-length S. europaea genes that confer salt tolerance. The genes are predicted to encode (1 a novel protein highly homologous to thaumatin-like proteins, (2 a novel coiled-coil protein of unknown function, and (3 a novel short peptide of 32 residues. Exogenous application of a synthetic peptide corresponding to the 32 residues improved salt tolerance of Arabidopsis. The approach described in this report provides a rapid assay system for large-scale screening of S. europaea genes involved in salt stress tolerance and supports the identification of genes responsible for such mechanisms. These genes may be useful candidates for improving crop salt tolerance by genetic transformation.

Comparative proteomic analysis of differentially expressed proteins in shoots of Salicornia europaea under different salinity.

Science.gov (United States)

Wang, Xuchu; Fan, Pengxiang; Song, Hongmiao; Chen, Xianyang; Li, Xiaofang; Li, Yinxin

2009-07-01

Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is a succulent annual euhalophyte and one of the most salt tolerant plant species. The elucidation of its salt tolerance mechanism is of significance for generating salt-tolerant crops. In this study, we provided high resolution of proteome reference maps of S. europaea shoot and obtained evidence on the salt tolerance mechanism by analyzing the proteomic responses of this plant to high salinity. Our results demonstrated significant variations existed in 196 out of 1880 protein spots detected on CBB stained 2-DE gels. Of these, 111 proteins were identified by mass spectrometry. Among them, the majority was energy production and conversion related proteins, followed by photosynthesis and carbohydrate metabolism associated enzymes. Analysis of protein expression patters revealed that energy production and ion homeostasis associated proteins played important roles for this plant salt tolerance ability. Hierarchical clustering results revealed many proteins were involved in S. europaea salt tolerance mechanism as a dynamic network. Finally, based on our proteomic results, we brought forward a possible schematic representation of mechanism associated with the systematic salt tolerance phenotype in S. europaea.

Fauna Europaea: Helminths (Animal Parasitic

Directory of Open Access Journals (Sweden)

David Gibson

2014-09-01

Full Text Available Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms of all living European land and freshwater animals, their geographical distribution at country level (up to the Urals, excluding the Caucasus region, and some additional information. The Fauna Europaea project covers about 230,000 taxonomic names, including 130,000 accepted species and 14,000 accepted subspecies, which is much more than the originally projected number of 100,000 species. This represents a huge effort by more than 400 contributing specialists throughout Europe and is a unique (standard reference suitable for many users in science, government, industry, nature conservation and education. Helminths parasitic in animals represent a large assemblage of worms, representing three phyla, with more than 200 families and almost 4,000 species of parasites from all major vertebrate and many invertebrate groups. A general introduction is given for each of the major groups of parasitic worms, i.e. the Acanthocephala, Monogenea, Trematoda (Aspidogastrea and Digenea, Cestoda and Nematoda. Basic information for each group includes its size, host-range, distribution, morphological features, life-cycle, classification, identification and recent key-works. Tabulations include a complete list of families dealt with, the number of species in each and the name of the specialist responsible for data acquisition, a list of additional specialists who helped with particular groups, and a list of higher taxa dealt with down to the family level. A compilation of useful references is appended.

High-throughput deep sequencing reveals that microRNAs play important roles in salt tolerance of euhalophyte Salicornia europaea.

Science.gov (United States)

Feng, Juanjuan; Wang, Jinhui; Fan, Pengxiang; Jia, Weitao; Nie, Lingling; Jiang, Ping; Chen, Xianyang; Lv, Sulian; Wan, Lichuan; Chang, Sandra; Li, Shizhong; Li, Yinxin

2015-02-26

microRNAs (miRNAs) are implicated in plant development processes and play pivotal roles in plant adaptation to environmental stresses. Salicornia europaea, a salt mash euhalophyte, is a suitable model plant to study salt adaptation mechanisms. S. europaea is also a vegetable, forage, and oilseed that can be used for saline land reclamation and biofuel precursor production on marginal lands. Despite its importance, no miRNA has been identified from S. europaea thus far. Deep sequencing was performed to investigate small RNA transcriptome of S. europaea. Two hundred and ten conserved miRNAs comprising 51 families and 31 novel miRNAs (including seven miRNA star sequences) belonging to 30 families were identified. About half (13 out of 31) of the novel miRNAs were only detected in salt-treated samples. The expression of 43 conserved and 13 novel miRNAs significantly changed in response to salinity. In addition, 53 conserved and 13 novel miRNAs were differentially expressed between the shoots and roots. Furthermore, 306 and 195 S. europaea unigenes were predicted to be targets of 41 conserved and 29 novel miRNA families, respectively. These targets encoded a wide range of proteins, and genes involved in transcription regulation constituted the largest category. Four of these genes encoding laccase, F-box family protein, SAC3/GANP family protein, and NADPH cytochrome P-450 reductase were validated using 5'-RACE. Our results indicate that specific miRNAs are tightly regulated by salinity in the shoots and/or roots of S. europaea, which may play important roles in salt tolerance of this euhalophyte. The S. europaea salt-responsive miRNAs and miRNAs that target transcription factors, nucleotide binding site-leucine-rich repeat proteins and enzymes involved in lignin biosynthesis as well as carbon and nitrogen metabolism may be applied in genetic engineering of crops with high stress tolerance, and genetic modification of biofuel crops with high biomass and regulatable

Prevalence of Toxoplasma gondii in common moles (Talpa europaea)

NARCIS (Netherlands)

Krijger, I.M.; Cornelissen, J.B.W.J.; Wisselink, H.J.; Meerburg, B.G.

2014-01-01

Background The prevalence of Toxoplasma gondii in common moles, Talpa europaea, was investigated in order to determine whether moles can serve as an indicator species for T. gondii infections in livestock. Findings In total, 86 moles were caught from 25 different sites in the Netherlands. Five

Nitrite as a stimulus for ammonia-starved Nitrosomonas europaea

NARCIS (Netherlands)

Laanbroek, H.J.; Bär-Gilissen, M.J.; Hoogveld, H.L.

2002-01-01

Ammonia-starved cells of Nitrosomonas europaea are able to preserve a high level of ammonia-oxidizing activity in the absence of ammonium. However, when the nitrite-oxidizing cells that form part of the natural nitrifying community do not keep pace with the ammonia-oxidizing cells, nitrite

Transformations of Aromatic Compounds by Nitrosomonas europaea

OpenAIRE

Keener, William K.; Arp, Daniel J.

1994-01-01

Benzene and a variety of substituted benzenes inhibited ammonia oxidation by intact cells of Nitrosomonas europaea. In most cases, the inhibition was accompanied by transformation of the aromatic compound to a more oxidized product or products. All products detected were aromatic, and substituents were often oxidized but were not separated from the benzene ring. Most transformations were enhanced by (NH4)2SO4 (12.5 mM) and were prevented by C2H2, a mechanism-based inactivator of ammonia monoo...

Nonsterol Triterpenoids as Major Constituents of Olea europaea

Science.gov (United States)

Stiti, Naïm; Hartmann, Marie-Andrée

2012-01-01

Plant triterpenoids represent a large and structurally diverse class of natural products. A growing interest has been focused on triterpenoids over the past decade due to their beneficial effects on human health. We show here that these bioactive compounds are major constituents of several aerial parts (floral bud, leaf bud, stem, and leaf) of olive tree, a crop exploited so far almost exclusively for its fruit and oil. O. europaea callus cultures were analyzed as well. Twenty sterols and twenty-nine nonsteroidal tetra- and pentacyclic triterpenoids belonging to seven types of carbon skeletons (oleanane, ursane, lupane, taraxerane, taraxastane, euphane, and lanostane) were identified and quantified by GC and GC-MS as free and esterified compounds. The oleanane-type compounds, oleanolic acid and maslinic acid, were largely predominant in all the organs tested, whereas they are practically absent in olive oil. In floral buds, they represented as much as 2.7% of dry matter. In callus cultures, lanostane-type compounds were the most abundant triterpenoids. In all the tissues analyzed, free and esterified triterpene alcohols exhibited different distribution patterns of their carbon skeletons. Taken together, these data provide new insights into largely unknown triterpene secondary metabolism of Olea europaea. PMID:22523691

In Vitro Culture Conditions and OeARF and OeH3 Expressions Modulate Adventitious Root Formation from Oleaster (Olea europaea L. subsp. europaea var. sylvestris) Cuttings

Science.gov (United States)

Gagliardi, Cinzia; Bruno, Leonardo; Bitonti, Maria Beatrice

2014-01-01

Olea europaea L. subsp. europaea var. sylvestris, also named oleaster, is the wild form of olive and it is used as rootstock and pollen donor for many cultivated varieties. An efficient procedure for in vitro propagation of oleaster was established in this study. A zeatin concentration of 2.5 mg/L was effective to induce an appreciable vegetative growth. Also high rooting efficiency was obtained by using a short IBA pulse, followed by two different IBA concentrations in the culture medium. With the aim to enlarge knowledge on the molecular aspects of adventitious rooting, we also evaluated the transcriptional modulation of an ARFs member and HISTONE H3 genes, involved in auxin signaling and cell replication, respectively, during the root induction phase of cuttings. The obtained results suggest that the selected genes, as markers of the induction phase, could be very useful for setting up efficient culture conditions along the rooting process, thus increasing micropropagation efficiency. PMID:24587768

In vitro culture conditions and OeARF and OeH3 expressions modulate adventitious root formation from oleaster (Olea europaea L. subsp. europaea var. sylvestris) cuttings.

Science.gov (United States)

Chiappetta, Adriana; Gagliardi, Cinzia; Bruno, Leonardo; Bitonti, Maria Beatrice

2014-01-01

Olea europaea L. subsp. europaea var. sylvestris, also named oleaster, is the wild form of olive and it is used as rootstock and pollen donor for many cultivated varieties. An efficient procedure for in vitro propagation of oleaster was established in this study. A zeatin concentration of 2.5 mg/L was effective to induce an appreciable vegetative growth. Also high rooting efficiency was obtained by using a short IBA pulse, followed by two different IBA concentrations in the culture medium. With the aim to enlarge knowledge on the molecular aspects of adventitious rooting, we also evaluated the transcriptional modulation of an ARFs member and HISTONE H3 genes, involved in auxin signaling and cell replication, respectively, during the root induction phase of cuttings. The obtained results suggest that the selected genes, as markers of the induction phase, could be very useful for setting up efficient culture conditions along the rooting process, thus increasing micropropagation efficiency.

Investigation on the anti- inflammatory and analgesic effects of Olea europaea L. metanolic extract on male NMRI mouse

Directory of Open Access Journals (Sweden)

Elaheh Tekye

2012-04-01

Full Text Available Background: Different mediators are involved in pain and edema induction during different stages of inflammation. Then, treatment of them encounters some difficulties. Medicinal plants are an important source of substances which are claimed to induce anti-inflammatory effects. This study was aimed to investigate anti-inflammatory and analgesic effects of Olea europaea L.methanolic extract on male NMRI mouse. Methods: Methanolic extraction was done for leaf of Olea europaea L. and different doses (200, 300 and 400 mg/kg were intraperitoneally (i.p. adminstered to male NMRI mice. Analgesic and anti-inflammatory effects of extract was measured during both phases of Formalin test, Acetic acid induced visceral pain and xylene inflammation tests. A standard analgesic and anti-inflammatory drug such as indomethacin, dexamethasone and morphine were administered in positive control groups where appropriates. Results: Results indicated significant dose-dependent analgesic and anti-inflammatory effects of methanolic extract of Olea europaea L. leaf on pain which induced by formalin (both phase and acetic acid, and inflammation caused by xylene. Conclusion: Our findings Showed that administration of methanolic extract of Olea europaea L.leaf can suppress pain and inflammation dose dependently which, may mediate via different components of extract. However, more investigations need to be done.

Polyphenols benefits of olive leaf (Olea europaea L) to human health.

Science.gov (United States)

Vogel, Patrícia; Kasper Machado, Isabel; Garavaglia, Juliano; Zani, Valdeni Terezinha; de Souza, Daiana; Morelo Dal Bosco, Simone

2014-12-17

The phenolic compounds present in olive leaves (Olea europaea L.) confer benefits to the human health. To review the scientific literature about the benefits of the polyphenols of olive leaves to human health. Literature review in the LILACS-BIREME, SciELO and MEDLINE databases for publications in English, Portuguese and Spanish with the descriptors "Olea europaea", "olive leaves", "olive leaf", "olive leaves extracts", "olive leaf extracts", "phenolic compounds", "polyphenols", "oleuropein", "chemical composition", and "health". There were identified 92 articles, but only 38 related to the objectives of the study and 9 articles cited in the works were included due to their relevance. The phenolic compounds present in olive leaves, especially the oleuropein, are associated to antioxidant, antihypertensive, hypoglycemic, hypocholesterolemic and cardioprotective activity. Furthermore, studies associate the oleuropein to an anti-inflammatory effect in trauma of the bone marrow and as a support in the treatment of obesity. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

15N Kinetic Analysis of N2O Production by Nitrosomonas europaea: an Examination of Nitrifier Denitrification

OpenAIRE

Poth, Mark; Focht, Dennis D.

1985-01-01

A series of 15N isotope tracer experiments showed that Nitrosomonas europaea produces nitrous oxide only under oxygen-limiting conditions and that the labeled N from nitrite, but not nitrate, is incorporated into nitrous oxide, indicating the presence of the “denitrifying enzyme” nitrite reductase. A kinetic analysis of the m/z 44, 45, and 46 nitrous oxide produced by washed cell suspensions of N. europaea when incubated with 4 mM ammonium (99% 14N) and 0.4 mM nitrite (99% 15N) was performed....

Isolation and identification of radical scavengers in olive tree (Olea europaea) wood

NARCIS (Netherlands)

Pérez-Bonilla, M.; Salido, S.; Beek, van T.A.; Linares-Palomino, P.J.; Altarejos, J.; Nogueras, M.; Sánchez, A.

2006-01-01

Several extracts of Olea europaea wood (Picual olive cultivar) were obtained with solvents of different polarity and their antioxidant activities determined. The active compounds were detected in fractions of an ethyl acetate extract using HPLC with on-line radical scavenging detection. After

Proteomic platform for the identification of proteins in olive (Olea europaea) pulp.

Science.gov (United States)

Capriotti, Anna Laura; Cavaliere, Chiara; Foglia, Patrizia; Piovesana, Susy; Samperi, Roberto; Stampachiacchiere, Serena; Laganà, Aldo

2013-10-24

The nutritional and cancer-protective properties of the oil extracted mechanically from the ripe fruits of Olea europaea trees are attracting constantly more attention worldwide. The preparation of high-quality protein samples from plant tissues for proteomic analysis poses many challenging problems. In this study we employed a proteomic platform based on two different extraction methods, SDS and CHAPS based protocols, followed by two precipitation protocols, TCA/acetone and MeOH precipitation, in order to increase the final number of identified proteins. The use of advanced MS techniques in combination with the Swissprot and NCBI Viridiplantae databases and TAIR10 Arabidopsis database allowed us to identify 1265 proteins, of which 22 belong to O. europaea. The application of this proteomic platform for protein extraction and identification will be useful also for other proteomic studies on recalcitrant plant/fruit tissues. Copyright © 2013. Published by Elsevier B.V.

AAU-Specific RNA Cleavage Mediated by MazF Toxin Endoribonuclease Conserved in Nitrosomonas europaea

Directory of Open Access Journals (Sweden)

Tatsuki Miyamoto

2016-06-01

Full Text Available Nitrosomonas europaea carries numerous toxin-antitoxin systems. However, despite the abundant representation in its chromosome, studies have not surveyed the underlying molecular functions in detail, and their biological roles remain enigmatic. In the present study, we found that a chromosomally-encoded MazF family member, predicted at the locus NE1181, is a functional toxin endoribonuclease, and constitutes a toxin-antitoxin system, together with its cognate antitoxin, MazE. Massive parallel sequencing provided strong evidence that this toxin endoribonuclease exhibits RNA cleavage activity, primarily against the AAU triplet. This sequence-specificity was supported by the results of fluorometric assays. Our results indicate that N. europaea alters the translation profile and regulates its growth using the MazF family of endoribonuclease under certain stressful conditions.

Global metabolomic responses of Nitrosomonas europaea 19718 to cold stress and altered ammonia feeding patterns

KAUST Repository

Lu, Huijie; Ulanov, Alexander V.; Nobu, Masaru; Liu, Wen-Tso

2015-01-01

© 2015 Springer-Verlag Berlin Heidelberg The model ammonia-oxidizing bacterium Nitrosomonas europaea represents one of the environmentally and biotechnologically significant microorganisms. Genome-based studies over the last decade have led to many intriguing discoveries about its cellular biochemistry and physiology. However, knowledge regarding the regulation of overall metabolic routes in response to various environmental stresses is limited due to a lack of comprehensive, time-resolved metabolomic analyses. In this study, gas chromatography–mass spectrometry (GC-MS)-based metabolic profiling was performed to characterize the temporal variations of N. europaea 19718 intercellular metabolites in response to varied temperature (23 and 10 °C) and ammonia feeding patterns (shock loading and continuous feeding of 20 mg N/L). Approximately 87 metabolites were successfully identified and mapped to the existing pathways of N. europaea 19718, allowing interpretation of the influence of temperature and feeding pattern on metabolite levels. In general, varied temperature had a more profound influence on the overall metabolism than varied feeding patterns. Total extracellular metabolite concentrations (relative to internal standards and normalized to biomass weight) were lower under cold stress and shock loading conditions compared with the control (continuous feeding at 23 °C). Cold stress caused the widespread downregulation of metabolites involved in central carbon metabolism, amino acid, and lipid synthesis (e.g., malonic acid, succinic acid, putrescine, and phosphonolpyruvate). Metabolites that showed differences under varied feeding patterns were mainly involved in nucleotide acid, amino acid, and lipid metabolism (e.g., adenine, uracil, and spermidine). This study highlighted the roles of central carbon and nitrogen metabolism in countering cold stress and altered ammonia availability. In addition, transcriptomic, proteomic, and metabolomic data from three

Global metabolomic responses of Nitrosomonas europaea 19718 to cold stress and altered ammonia feeding patterns

KAUST Repository

Lu, Huijie

2015-11-05

© 2015 Springer-Verlag Berlin Heidelberg The model ammonia-oxidizing bacterium Nitrosomonas europaea represents one of the environmentally and biotechnologically significant microorganisms. Genome-based studies over the last decade have led to many intriguing discoveries about its cellular biochemistry and physiology. However, knowledge regarding the regulation of overall metabolic routes in response to various environmental stresses is limited due to a lack of comprehensive, time-resolved metabolomic analyses. In this study, gas chromatography–mass spectrometry (GC-MS)-based metabolic profiling was performed to characterize the temporal variations of N. europaea 19718 intercellular metabolites in response to varied temperature (23 and 10 °C) and ammonia feeding patterns (shock loading and continuous feeding of 20 mg N/L). Approximately 87 metabolites were successfully identified and mapped to the existing pathways of N. europaea 19718, allowing interpretation of the influence of temperature and feeding pattern on metabolite levels. In general, varied temperature had a more profound influence on the overall metabolism than varied feeding patterns. Total extracellular metabolite concentrations (relative to internal standards and normalized to biomass weight) were lower under cold stress and shock loading conditions compared with the control (continuous feeding at 23 °C). Cold stress caused the widespread downregulation of metabolites involved in central carbon metabolism, amino acid, and lipid synthesis (e.g., malonic acid, succinic acid, putrescine, and phosphonolpyruvate). Metabolites that showed differences under varied feeding patterns were mainly involved in nucleotide acid, amino acid, and lipid metabolism (e.g., adenine, uracil, and spermidine). This study highlighted the roles of central carbon and nitrogen metabolism in countering cold stress and altered ammonia availability. In addition, transcriptomic, proteomic, and metabolomic data from three

Global metabolomic responses of Nitrosomonas europaea 19718 to cold stress and altered ammonia feeding patterns.

Science.gov (United States)

Lu, Huijie; Ulanov, Alexander V; Nobu, Masaru; Liu, Wen-Tso

2016-02-01

The model ammonia-oxidizing bacterium Nitrosomonas europaea represents one of the environmentally and biotechnologically significant microorganisms. Genome-based studies over the last decade have led to many intriguing discoveries about its cellular biochemistry and physiology. However, knowledge regarding the regulation of overall metabolic routes in response to various environmental stresses is limited due to a lack of comprehensive, time-resolved metabolomic analyses. In this study, gas chromatography-mass spectrometry (GC-MS)-based metabolic profiling was performed to characterize the temporal variations of N. europaea 19718 intercellular metabolites in response to varied temperature (23 and 10 °C) and ammonia feeding patterns (shock loading and continuous feeding of 20 mg N/L). Approximately 87 metabolites were successfully identified and mapped to the existing pathways of N. europaea 19718, allowing interpretation of the influence of temperature and feeding pattern on metabolite levels. In general, varied temperature had a more profound influence on the overall metabolism than varied feeding patterns. Total extracellular metabolite concentrations (relative to internal standards and normalized to biomass weight) were lower under cold stress and shock loading conditions compared with the control (continuous feeding at 23 °C). Cold stress caused the widespread downregulation of metabolites involved in central carbon metabolism, amino acid, and lipid synthesis (e.g., malonic acid, succinic acid, putrescine, and phosphonolpyruvate). Metabolites that showed differences under varied feeding patterns were mainly involved in nucleotide acid, amino acid, and lipid metabolism (e.g., adenine, uracil, and spermidine). This study highlighted the roles of central carbon and nitrogen metabolism in countering cold stress and altered ammonia availability. In addition, transcriptomic, proteomic, and metabolomic data from three studies on N. europaea were compared to achieve a

Evaluation of the effects of Olea europaea L. subsp. africana (Mill.) P.S. Green (Oleaceae) leaf methanol extract against castor oil-induced diarrhoea in mice.

Science.gov (United States)

Amabeoku, George J; Bamuamba, Kapinga

2010-03-01

Olea europaea L. subsp. africana (Mill.) P.S. Green is widely used in South Africa by traditional medicine practitioners to treat diarrhoea. However, little is known scientifically about this South African species in the treatment of diarrhoea. The main aim of the study therefore was to investigate the antidiarrhoeal effect of the leaf methanol extract of the plant species in mice. The antidiarrhoeal activity of the leaf methanol extract of O. europaea subsp. africana was studied using a castor oil-induced diarrhoeal test. The antipropulsive activity of the plant extract was also investigated using the charcoal meal transit test. Standard methods were used to investigate the acute toxicity and effect of O. europaea subsp. africana on castor oil-induced intraluminal fluid accumulation. Leaf methanol extract of O. europaea subsp. africana and loperamide, a standard antidiarrhoeal drug, significantly reduced the number of diarrhoeal episodes induced by castor oil, significantly decreased the stool mass, significantly delayed the onset of the diarrhoea and protected the animals against castor oil-induced diarrhoea. Both O. europaea subsp. africana and loperamide significantly decreased the gastrointestinal transit of charcoal meal and castor oil-induced intraluminal fluid accumulation in mice. The LD50 value was found to be 3475 mg/kg (p.o.). The results obtained suggest that the leaf methanol extract of O. europaea subsp. africana has an antidiarrhoeal property and that, given orally, it may be non-toxic and/or safe in mice.

Global transcriptome profiling of Salicornia europaea L. shoots under NaCl treatment.

Science.gov (United States)

Ma, Jinbiao; Zhang, Meiru; Xiao, Xinlong; You, Jinjin; Wang, Junru; Wang, Tao; Yao, Yinan; Tian, Changyan

2013-01-01

Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is well adapted to extreme saline environments with more than 1,000 mM NaCl in the soil, so it could serve as an important model species for studying halophilic mechanisms in euhalophytes. To obtain insights into the molecular basis of salt tolerance, we present here the first extensive transcriptome analysis of this species using the Illumina HiSeq™ 2000. A total of 41 and 39 million clean reads from the salt-treated (Se200S) and salt-free (SeCKS) tissues of S. europaea shoots were obtained, and de novo assembly produced 97,865 and 101,751 unigenes, respectively. Upon further assembly with EST data from both Se200S and SeCKS, 109,712 high-quality non-redundant unigenes were generated with a mean unigene size of 639 bp. Additionally, a total of 3,979 differentially expressed genes (DEGs) were detected between the Se200S and SeCKS libraries, with 348 unigenes solely expressed in Se200S and 460 unigenes solely expressed in SeCKS. Furthermore, we identified a large number of genes that are involved in ion homeostasis and osmotic adjustment, including cation transporters and proteins for the synthesis of low-molecular compounds. All unigenes were functionally annotated within the COG, GO and KEGG pathways, and 10 genes were validated by qRT-PCR. Our data contains the extensive sequencing and gene-annotation analysis of S. europaea. This genetic knowledge will be very useful for future studies on the molecular adaptation to abiotic stress in euhalophytes and will facilitate the genetic manipulation of other economically important crops.

Degradation of halogenated aliphatic compounds by the ammonia- oxidizing bacterium Nitrosomonas europaea.

OpenAIRE

Vannelli, T; Logan, M; Arciero, D M; Hooper, A B

1990-01-01

Suspensions of Nitrosomonas europaea catalyzed the ammonia-stimulated aerobic transformation of the halogenated aliphatic compounds dichloromethane, dibromomethane, trichloromethane (chloroform), bromoethane, 1,2-dibromoethane (ethylene dibromide), 1,1,2-trichloroethane, 1,1,1-trichloroethane, monochloroethylene (vinyl chloride), gem-dichloroethylene, cis- and trans-dichloroethylene, cis-dibromoethylene, trichloroethylene, and 1,2,3-trichloropropane, Tetrachloromethane (carbon tetrachloride),...

Global transcriptome profiling of Salicornia europaea L. shoots under NaCl treatment.

Directory of Open Access Journals (Sweden)

Jinbiao Ma

Full Text Available Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is well adapted to extreme saline environments with more than 1,000 mM NaCl in the soil, so it could serve as an important model species for studying halophilic mechanisms in euhalophytes. To obtain insights into the molecular basis of salt tolerance, we present here the first extensive transcriptome analysis of this species using the Illumina HiSeq™ 2000.A total of 41 and 39 million clean reads from the salt-treated (Se200S and salt-free (SeCKS tissues of S. europaea shoots were obtained, and de novo assembly produced 97,865 and 101,751 unigenes, respectively. Upon further assembly with EST data from both Se200S and SeCKS, 109,712 high-quality non-redundant unigenes were generated with a mean unigene size of 639 bp. Additionally, a total of 3,979 differentially expressed genes (DEGs were detected between the Se200S and SeCKS libraries, with 348 unigenes solely expressed in Se200S and 460 unigenes solely expressed in SeCKS. Furthermore, we identified a large number of genes that are involved in ion homeostasis and osmotic adjustment, including cation transporters and proteins for the synthesis of low-molecular compounds. All unigenes were functionally annotated within the COG, GO and KEGG pathways, and 10 genes were validated by qRT-PCR.Our data contains the extensive sequencing and gene-annotation analysis of S. europaea. This genetic knowledge will be very useful for future studies on the molecular adaptation to abiotic stress in euhalophytes and will facilitate the genetic manipulation of other economically important crops.

Pollen-mediated gene flow and fine-scale spatial genetic structure in Olea europaea subsp. europaea var. sylvestris.

Science.gov (United States)

Beghè, D; Piotti, A; Satovic, Z; de la Rosa, R; Belaj, A

2017-03-01

Wild olive ( Olea europaea subsp. europaea var. sylvestris ) is important from an economic and ecological point of view. The effects of anthropogenic activities may lead to the genetic erosion of its genetic patrimony, which has high value for breeding programmes. In particular, the consequences of the introgression from cultivated stands are strongly dependent on the extent of gene flow and therefore this work aims at quantitatively describing contemporary gene flow patterns in wild olive natural populations. The studied wild population is located in an undisturbed forest, in southern Spain, considered one of the few extant hotspots of true oleaster diversity. A total of 225 potential father trees and seeds issued from five mother trees were genotyped by eight microsatellite markers. Levels of contemporary pollen flow, in terms of both pollen immigration rates and within-population dynamics, were measured through paternity analyses. Moreover, the extent of fine-scale spatial genetic structure (SGS) was studied to assess the relative importance of seed and pollen dispersal in shaping the spatial distribution of genetic variation. The results showed that the population under study is characterized by a high genetic diversity, a relatively high pollen immigration rate (0·57), an average within-population pollen dispersal of about 107 m and weak but significant SGS up to 40 m. The population is a mosaic of several intermingled genetic clusters that is likely to be generated by spatially restricted seed dispersal. Moreover, wild oleasters were found to be self-incompatible and preferential mating between some genotypes was revealed. Knowledge of the within-population genetic structure and gene flow dynamics will lead to identifying possible strategies aimed at limiting the effect of anthropogenic activities and improving breeding programmes for the conservation of olive tree forest genetic resources. © The Author 2016. Published by Oxford University Press on behalf

Degradation of halogenated aliphatic compounds by the ammonia- oxidizing bacterium Nitrosomonas europaea.

Science.gov (United States)

Vannelli, T; Logan, M; Arciero, D M; Hooper, A B

1990-01-01

Suspensions of Nitrosomonas europaea catalyzed the ammonia-stimulated aerobic transformation of the halogenated aliphatic compounds dichloromethane, dibromomethane, trichloromethane (chloroform), bromoethane, 1,2-dibromoethane (ethylene dibromide), 1,1,2-trichloroethane, 1,1,1-trichloroethane, monochloroethylene (vinyl chloride), gem-dichloroethylene, cis- and trans-dichloroethylene, cis-dibromoethylene, trichloroethylene, and 1,2,3-trichloropropane, Tetrachloromethane (carbon tetrachloride), tetrachloroethylene (perchloroethylene), and trans-dibromoethylene were not degraded. PMID:2339874

Polyploidy in the olive complex (Olea europaea): Evidence from flow cytometry and nuclear microsatellite analyses

DEFF Research Database (Denmark)

Besnard, G.; Garcia-Verdugo, C.; Rubio de Casas, R.

2008-01-01

Background: Phylogenetic and phylogeographic investigations have been previously performed to study the evolution of the olive tree complex (Olea europaea). A particularly high genomic diversity has been found in north-west Africa. However, to date no exhaustive study has been addressed to infer...

Green fabricated CuO nanobullets via Olea europaea leaf extract shows auspicious antimicrobial potential.

Science.gov (United States)

Maqbool, Qaisar; Iftikhar, Sidra; Nazar, Mudassar; Abbas, Fazal; Saleem, Asif; Hussain, Talib; Kausar, Rizwan; Anwaar, Sadaf; Jabeen, Nyla

2017-06-01

In present investigation, copper oxide (CuO) nanostructures have been prepared via green chemistry. Olea europaea leaf extract act as strong chelating agent for tailoring physical as well as bio-medical characteristics of CuO at the nano-size. Physical characterisation such as scanning electron microscope analysis depicts the formation of homogenised spherical shape nanoparticles (NPs) with average size of 42 nm. X-ray diffraction and Fourier transform infrared spectroscopy further confirmed the crystalline pure phase and monoclinic structure. High performance liquid chromatography (HPLC) testing is performed to evaluate the relative concentration of bioactive molecules in the O. europaea leaf extract. From HPLC results capping action of organic molecules around CuO-NPs is hypothesised. The antimicrobial potency of biosynthesised CuO-NPs have been evaluated using colony forming unit (CFU) counting assay and disc diffusion method which shows a significant zone of inhibition against bacterial and fungal strains may be highly potential for future antimicrobial pharmaceutics. Furthermore, reduction of various precursors by plant extract will reduce environmental impact over chemical synthesis.

THE BIOENERGETICS OF AMMONIA AND HYDROXYLAMINE OXIDATION IN NITROSOMONAS-EUROPAEA AT ACID AND ALKALINE PH

NARCIS (Netherlands)

FRIJLINK, MJ; ABEE, T; LAANBROEK, HJ; DEBOER, W; KONINGS, WN

Autotrophic ammonia oxidizers depend on alkaline or neutral conditions for optimal activity. Below pH 7 growth and metabolic activity decrease dramatically. Actively oxidizing cells of Nitrosomonas europaea do not maintain a constant internal pH when the external pH is varied from 5 to 8. Studies of

15N kinetic analysis of N2O production by Nitrosomonas europaea: an examination of nitrifier denitrification

International Nuclear Information System (INIS)

Poth, M.; Focht, D.D.

1985-01-01

A series of 15 N isotope tracer experiments showed that Nitrosomonas europaea produces nitrous oxide only under oxygen-limiting conditions and that the labeled N from nitrite, but not nitrate, is incorporated into nitrous oxide, indicating the presence of the denitrifying enzyme nitrite reductase. A kinetic analysis of the m/z 44, 45, and 46 nitrous oxide produced by washed cell suspensions of N. europaea when incubated with 4 mM ammonium (99% 14 N) and 0.4 mM nitrite (99% 15 N) was performed. No labeled nitirte was reduced to ammonium. All labeled material added was accounted for as either nitrite or nitrous oxide. The hypothesis that nitrous oxide is produced directly from nitrification was rejected since (i) it does not allow for the large amounts of double-labeled (m/z 46) nitrous oxide observed; (ii) the observed patterns of m/z 44, 45, 46 nitrous oxide were completely consistent with a kinetic analysis based on denitrification as the sole mechanism of nitrous oxide production but not with a kinetic analysis based on both mechanisms; (iii) the asymptotic ratio of m/z 45 to m/z 46 nitrous oxide was consistent with denitrification kinetics but inconsistent with nitrification kinetics, which predicted no limit to m/z 45 production. It is concluded that N. europaea is a denitrifier which, under conditions of oxygen stress, uses nitrite as a terminal electron acceptor and produces nitrous oxide

Polyploidy in the Olive Complex (Olea europaea): Evidence from Flow Cytometry and Nuclear Microsatellite Analyses

Science.gov (United States)

Besnard, G.; Garcia-Verdugo, C.; Rubio De Casas, R.; Treier, U. A.; Galland, N.; Vargas, P.

2008-01-01

Background Phylogenetic and phylogeographic investigations have been previously performed to study the evolution of the olive tree complex (Olea europaea). A particularly high genomic diversity has been found in north-west Africa. However, to date no exhaustive study has been addressed to infer putative polyploidization events and their evolutionary significance in the diversification of the olive tree and its relatives. Methods Representatives of the six olive subspecies were investigated using (a) flow cytometry to estimate genome content, and (b) six highly variable nuclear microsatellites to assess the presence of multiple alleles at co-dominant loci. In addition, nine individuals from a controlled cross between two individuals of O. europaea subsp. maroccana were characterized with microsatellites to check for chromosome inheritance. Key Results Based on flow cytometry and genetic analyses, strong evidence for polyploidy was obtained in subspp. cerasiformis (tetraploid) and maroccana (hexaploid), whereas the other subspecies appeared to be diploids. Agreement between flow cytometry and genetic analyses gives an alternative approach to chromosome counting to determine ploidy level of trees. Lastly, abnormalities in chromosomes inheritance leading to aneuploid formation were revealed using microsatellite analyses in the offspring from the controlled cross in subsp. maroccana. Conclusions This study constitutes the first report for multiple polyploidy in olive tree relatives. Formation of tetraploids and hexaploids may have played a major role in the diversification of the olive complex in north-west Africa. The fact that polyploidy is found in narrow endemic subspecies from Madeira (subsp. cerasiformis) and the Agadir Mountains (subsp. maroccana) suggests that polyploidization has been favoured to overcome inbreeding depression. Lastly, based on previous phylogenetic analyses, we hypothesize that subsp. cerasiformis resulted from hybridization between ancestors

Antimicrobial potential of green synthesized CeO2 nanoparticles from Olea europaea leaf extract.

Science.gov (United States)

Maqbool, Qaisar; Nazar, Mudassar; Naz, Sania; Hussain, Talib; Jabeen, Nyla; Kausar, Rizwan; Anwaar, Sadaf; Abbas, Fazal; Jan, Tariq

This article reports the green fabrication of cerium oxide nanoparticles (CeO 2 NPs) using Olea europaea leaf extract and their applications as effective antimicrobial agents. O. europaea leaf extract functions as a chelating agent for reduction of cerium nitrate. The resulting CeO 2 NPs exhibit pure single-face cubic structure, which is examined by X-ray diffraction, with a uniform spherical shape and a mean size 24 nm observed through scanning electron microscopy and transmission electron microscopy. Ultraviolet-visible spectroscopy confirms the characteristic absorption peak of CeO 2 NPs at 315 nm. Fourier transform infrared spectroscopy reflects stretching frequencies at 459 cm -1 , showing utilization of natural components for the production of NPs. Thermal gravimetric analysis predicts the successful capping of CeO 2 NPs by bioactive molecules present in the plant extract. The antimicrobial studies show significant zone of inhibition against bacterial and fungal strains. The higher activities shown by the green synthesized NPs than the plant extract lead to the conclusion that they can be effectively used in biomedical application. Furthermore, reduction of cerium salt by plant extract will reduce environmental impact over chemical synthesis.

Characteristics, Phytochemical Analysis and Biological Activities of Extracts from Tunisian Chetoui Olea europaea Variety

OpenAIRE

Ines Khlif; Karim Jellali; Thomas Michel; Maria Halabalaki; Alexios Leandros Skaltsounis; Noureddine Allouche

2015-01-01

This study selected 10 extracts from Tunisian chetoui O. europaea variety for their total phenolics, flavonoids, and phytochemical analyses as well as for their antioxidant and antimicrobial activities determination. The in vitro antioxidant property was investigated using DPPH, ferric reducing antioxidant capacity (FRAP), oxygen reducing antioxidant capacity (ORAC), and β-carotene-linoleic acid bleaching assays while antimicrobial activity was evaluated using macrodilutions method. For all o...

Phytochemical properties and anti-proliferative activity of Olea europaea L. leaf extracts against pancreatic cancer cells.

Science.gov (United States)

Goldsmith, Chloe D; Vuong, Quan V; Sadeqzadeh, Elham; Stathopoulos, Costas E; Roach, Paul D; Scarlett, Christopher J

2015-07-17

Olea europaea L. leaves are an agricultural waste product with a high concentration of phenolic compounds; especially oleuropein. Oleuropein has been shown to exhibit anti-proliferative activity against a number of cancer types. However, they have not been tested against pancreatic cancer, the fifth leading cause of cancer related death in Western countries. Therefore, water, 50% ethanol and 50% methanol extracts of Corregiola and Frantoio variety Olea europaea L. leaves were investigated for their total phenolic compounds, total flavonoids and oleuropein content, antioxidant capacity and anti-proliferative activity against MiaPaCa-2 pancreatic cancer cells. The extracts only had slight differences in their phytochemical properties, and at 100 and 200 μg/mL, all decreased the viability of the pancreatic cancer cells relative to controls. At 50 μg/mL, the water extract from the Corregiola leaves exhibited the highest anti-proliferative activity with the effect possibly due to early eluting HPLC peaks. For this reason, olive leaf extracts warrant further investigation into their potential anti-pancreatic cancer benefits.

Detection of Olea europaea subsp. cuspidata and Juniperus procera in the dry Afromontane forest of northern Ethiopia using subpixel analysis of Landsat imagery

Science.gov (United States)

Hishe, Hadgu; Giday, Kidane; Neka, Mulugeta; Soromessa, Teshome; Van Orshoven, Jos; Muys, Bart

2015-01-01

Comprehensive and less costly forest inventory approaches are required to monitor the spatiotemporal dynamics of key species in forest ecosystems. Subpixel analysis using the earth resources data analysis system imagine subpixel classification procedure was tested to extract Olea europaea subsp. cuspidata and Juniperus procera canopies from Landsat 7 enhanced thematic mapper plus imagery. Control points with various canopy area fractions of the target species were collected to develop signatures for each of the species. With these signatures, the imagine subpixel classification procedure was run for each species independently. The subpixel process enabled the detection of O. europaea subsp. cuspidata and J. procera trees in pure and mixed pixels. Total of 100 pixels each were field verified for both species. An overall accuracy of 85% was achieved for O. europaea subsp. cuspidata and 89% for J. procera. A high overall accuracy level of detecting species at a natural forest was achieved, which encourages using the algorithm for future species monitoring activities. We recommend that the algorithm has to be validated in similar environment to enrich the knowledge on its capability to ensure its wider usage.

Crystallization and preliminary X-ray crystallographic analysis of a new crystal form of hydroxylamine oxidoreductase from Nitrosomonas europaea

International Nuclear Information System (INIS)

Cedervall, Peder E.; Hooper, Alan B.; Wilmot, Carrie M.

2009-01-01

A new crystal form of N. europaea hydroxylamine oxidoreductase (space group P2 1 2 1 2) diffracted to 2.25 Å resolution at a third-generation synchrotron X-ray source. Hydroxylamine oxidoreductase (HAO) from Nitrosomonas europaea is a homotrimeric protein that catalyzes the oxidation of hydroxylamine to nitrite. Each monomer, with a molecular weight of 67.1 kDa, contains seven c-type hemes and one heme P460, the porphyrin ring of which is covalently linked to a tyrosine residue from an adjacent subunit. HAO was first crystallized and structurally characterized at a resolution of 2.8 Å in 1997. The structure was solved in space group P6 3 and suffered from merohedral twinning. Here, a crystallization procedure is presented that yielded untwinned crystals belonging to space group P2 1 2 1 2, which diffracted to 2.25 Å resolution and contained one trimer in the asymmetric unit. The unit-cell parameters were a = 140.7, b = 142.6, c = 107.4 Å

Know your audience: analysis of chief complaints at clinica esperanza, a student-run free clinic in memphis, tennessee.

Science.gov (United States)

Cesari, Whitney A; Vaikunth, Sumeet S; Lewis, Jim B; Panda, Mukta

2012-10-01

To identify the chief complaints and demographics at Clinica Esperanza, a student-run free clinic for an underserved Hispanic population. A retrospective chart review of patient files from 2005 through 2010 was undertaken, as approved by the University of Tennessee Health Science Center's Institutional Review Board. From 2005 through 2010, Clinica Esperanza fielded 2551 patient visits, consisting of 951 unique patients, 609 females and 342 males. Mean age was 34 years, and 60% of patients presented once, while 13% followed up for 1 year, 9% for 2 years, 6% for 3, 6% for 4, and 4% for 5. "Pap smear," "abdominal pain," and "follow-up lab results" ranked, in order, as the 3 top chief complaints. Resulting data have led to several improvements. The clinic has remained open weekly to improve patient continuity. With the top 10 chief complaints identified, they are better addressed. More funding is allocated for speculums and proper training of Pap smear technique. Systematic reporting of lab results is being implemented. Physical therapists and pharmacists now participate to address musculoskeletal and medication-based needs, respectively. A volunteer gastroenterologist has been recruited to provide specialized care for abdominal pain. An electrocardiogram machine is now used to evaluate chest pain. To improve student-patient communication, online language learning modules have been created. Based on these data, improvements in health care services have been made, including better continuity, emphasis on top chief complaints, and provider education in medical Spanish. Future plans include on-site pharmacy, smoother referrals, and similar clinics on the University of Tennessee Health Science Center's other campuses.

Evaluation of skin entry kerma in radiological examinations at the Hospital de Clinicas, Parana, Brazil; Avaliacao de kerma de entrada na pele em exames radiologicos no Hospital de Clinicas do Parana, Brasil

Energy Technology Data Exchange (ETDEWEB)

Porto, Lorena E.; Schelin, Hugo R.; Santos, Amanda C. dos; Bunick, Ana Paula; Paschuk, Sergei; Denyak, Valeriy [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Tilly Junior, Joao G. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Hospital de Clinicas; Khoury, Helen J., E-mail: khoury@ufpe.b [Universidade Federal de Pernambuco (UFPE/DEN), Recife, PE (Brazil). Dept. de Energia Nuclear

2011-10-26

This paper evaluates the skin entry dose of pediatric and adults patients when submitted to radiological examinations at the Hospital de Clinicas do Parana, Brazil, as part integrate of the data assessment of International Atomic Energy Agency (IAEA) for Latin America. It was performed measurements of dose for evaluation of skin entry kerma in pediatric patients in thorax AP/PA examinations, adults of thorax in AP/PA, cranio caudal mammography and median lateral and patients of computerized tomography in examination of head, thorax and abdomen. The obtained data demonstrate the necessity of verification of diagnostic analysis standards. The great value amplitudes demonstrate the incompatibility of examination executions with those recommended by the literature. The dose values presented partially inside the range recommended and the other over the expected for the due examination when compared with the literature

MELiSSA third compartment: Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures in bioreactors

Science.gov (United States)

Cruvellier, Nelly; Lasseur, Christophe; Poughon, Laurent; Creuly, Catherine; Dussap, Gilles

Nitrogen is a key element for the life and its balance on Earth is regulated by the nitrogen cycle. This loop includes several steps among which nitrification that permits the transformation of the ammonium into nitrate. The MELiSSA loop is an artificial ecosystem designed for life support systems (LSS). It is based on the carbon and nitrogen cycles and the recycling of the non-edible part of the higher plants and the waste produced by the crew. In this order, all the wastes are collected in the first compartment to degrade them into organic acids and CO2. These compounds are joining the second compartment which is a photoheterotrophic compartment where at the outlet an organic-free medium containing ammonium is produced. This solution will be the substrate of the third compartment where nitrification is done. This compartment has to oxidize the ammonium into nitrate, and this biological reaction needs two steps. In the MELiSSA loop, the nitrification is carried out by two bacteria: Nitrosomonas europaea ATCC® 19718™ which is oxidizing ammonia into nitrite and Nitrobacter winogradskyi ATCC® 25391™ which is producing nitrate from nitrite in the third compartment. These two bacteria are growing in axenic conditions on a fixed bed bioreactor filled with Biostyr® beads. The nitrogen compounds are controlled by Ionic Chromatography and colorimetric titration for each sample. The work presented here deals with the culture of both bacteria in pure cultures and mixed cultures in stirred and aerated bioreactors of different volumes. The first aim of our work is the characterization of the bacteria growth in bioreactors and in the nitrifying fixed-bed column. The experimental results confirm that the growth is slow; the maximal growth rate in suspended cultures is 0.054h-1 for Nitrosomonas europaea and 0.022h-1 for Nitrobacter winogradskyi. Mixed cultures are difficult to control and operate but one could be done for more than 500 hours. The characterization of the

Isolation of antioxidative secoiridoids from olive wood (Olea europaea L.) guided by on-line HPLC-DAD-radical scavenging detection

NARCIS (Netherlands)

Pérez-Bonilla, M.; Salido, S.; Beek, van T.A.; Waard, de P.; Linares-Palomino, P.J.; Sánchez, A.; Altarejos, J.

2011-01-01

The woody portion of olive tree pruning is a source of natural antioxidants of potential interest for the food industry. This work deals with the isolation and identification of further antioxidants present in an ethyl acetate extract of olive (Olea europaea L.) wood. Thus, a new secoiridoid,

Conveyor Cultivation of the Halophytic Plant Salicornia europaea for the Recycling of NaCl from Human Liquid Waste in a Biological Life Support System.

Science.gov (United States)

Balnokin, Yurii; Myasoedov, Nikolay; Popova, Larissa; Tikhomirov, Alexander A.; Ushakova, Sofya; Tikhomirova, Natalia; Lasseur, Christophe; Gros, Jean-Bernard

One problem in designing bioregenerative life support systems (BLSS) is developing technolo-gies to include human liquid and solid waste in intrasystem recycling. A specific task is recycling of NaCl excreted in urine by humans. We showed recently that this could be achieved through inclusion of the salt accumulating halophyte Salicornia europaea in the autotrophic compart-ment of the BLSS (Balnokin et al., ASR, 2010, in press). A model of NaCl circulation in BLSS with inclusion of S. europaea was based on the NaCl turnover in the human -urine -nutrient solution -S. europaea -human cycle. Mineralized urine was used as a basis for preparation of a nutrient solution for the halophyte cultivation. The shoots of the halophyte cultivated in the mineralized urine and containing NaCl could to be used by the BLSS inhabitants in their diets. In this report we describe cultivation of S. europaea which allows turnover of NaCl and produces daily shoot biomass containing Na+ and Cl- in quantities approximately equal to those excreted in daily human urine. The plants were grown in water culture in a climatic chamber under controlled conditions. A solution simulating mineralized urine (SSMU) was used as a basis for preparation of a nutri-ent solution for S. europaea cultivation. For continuous biomass production, seedlings of S. europaea, germinated preliminary in moist sand, were being transferred to the nutrient solu-tion at regular intervals (every two days). Duration of the conveyor operation was 112 days. During the first 56 days, the seedlings were being planted in SSMU diluted by a factor of 1.5 (2/3 SSMU). The same solution was introduced into the growth vessels as volumes of growth medium decreased due to plant transpiration. Starting from the 56th day as conveyor operation was initiated, the plants were being harvested every two days; the solutions from the discharged vessels were mixed with the fresh SSMU and the mixture was introduced into all other growth vessels of

Implementation of radioactive wastes management system in nuclear medicine service of Hospital das Clinicas of Universidade de Campinas - UNICAMP, in Sao Paulo State, Brazil

International Nuclear Information System (INIS)

Rinaldi Neto, A.; Coelho, R.F.; Brunetto, S.Q.

2001-01-01

This work reports the experience acquired at the Servico de Medicina Nuclear of the Hospital de Clinicas/UNICAMP (SMN/HC) in planning and implementing the management system of radioactive waste. This system respects the Comissao Nacional de Energia Nuclear' (CNEN) standards and has been of relatively easy and simple performance, without disturbing the SMN/HC's routine. It has also proof to keep its quality along the time. (author)

Activity-Based Protein Profiling of Ammonia Monooxygenase in Nitrosomonas europaea

Energy Technology Data Exchange (ETDEWEB)

Bennett, Kristen; Sadler, Natalie C.; Wright, Aaron T.; Yeager, Chris; Hyman, Michael R.; Löffler, F. E.

2016-01-29

Nitrosomonas europaeais an aerobic nitrifying bacterium that oxidizes ammonia (NH₃) to nitrite (NO₂^₋) through the sequential activities of ammonia monooxygenase (AMO) and hydroxylamine dehydrogenase (HAO). Many alkynes are mechanism-based inactivators of AMO, and here we describe an activity-based protein profiling method for this enzyme using 1,7-octadiyne (17OD) as a probe. Inactivation of NH₄⁺-dependent O₂uptake byN. europaeaby 17OD was time- and concentration-dependent. The effects of 17OD were specific for ammonia-oxidizing activity, andde novoprotein synthesis was required to reestablish this activity after cells were exposed to 17OD. Cells were reacted with Alexa Fluor 647 azide using a copper-catalyzed azide-alkyne cycloaddition (CuAAC) (click) reaction, solubilized, and analyzed by SDS-PAGE and infrared (IR) scanning. A fluorescent 28-kDa polypeptide was observed for cells previously exposed to 17OD but not for cells treated with either allylthiourea or acetylene prior to exposure to 17OD or for cells not previously exposed to 17OD. The fluorescent polypeptide was membrane associated and aggregated when heated with β-mercaptoethanol and SDS. The fluorescent polypeptide was also detected in cells pretreated with other diynes, but not in cells pretreated with structural homologs containing a single ethynyl functional group. The membrane fraction from 17OD-treated cells was conjugated with biotin-azide and solubilized in SDS. Streptavidin affinity-purified polypeptides were on-bead trypsin-digested, and amino acid sequences of the peptide fragments were determined by liquid chromatography-mass spectrometry (LC-MS) analysis. Peptide fragments from AmoA were the predominant peptides detected in 17OD-treated samples. In-gel digestion and

Salt stress induces differential regulation of the phenylpropanoid pathway in Olea europaea cultivars Frantoio (salt-tolerant) and Leccino (salt-sensitive)

NARCIS (Netherlands)

Rossi, Lorenzo; Borghi, Monica; Francini, Alessandra; Lin, Xiuli; Xie, De Yu; Sebastiani, Luca

2016-01-01

Olive tree (Olea europaea L.) is an important crop in the Mediterranean Basin where drought and salinity are two of the main factors affecting plant productivity. Despite several studies have reported different responses of various olive tree cultivars to salt stress, the mechanisms that convey

Evaluation of skin entry kerma in radiological examinations at the Hospital de Clinicas, Parana, Brazil

International Nuclear Information System (INIS)

Porto, Lorena E.; Schelin, Hugo R.; Santos, Amanda C. dos; Bunick, Ana Paula; Paschuk, Sergei; Denyak, Valeriy; Tilly Junior, Joao G.; Khoury, Helen J.

2011-01-01

This paper evaluates the skin entry dose of pediatric and adults patients when submitted to radiological examinations at the Hospital de Clinicas do Parana, Brazil, as part integrate of the data assessment of International Atomic Energy Agency (IAEA) for Latin America. It was performed measurements of dose for evaluation of skin entry kerma in pediatric patients in thorax AP/PA examinations, adults of thorax in AP/PA, cranio caudal mammography and median lateral and patients of computerized tomography in examination of head, thorax and abdomen. The obtained data demonstrate the necessity of verification of diagnostic analysis standards. The great value amplitudes demonstrate the incompatibility of examination executions with those recommended by the literature. The dose values presented partially inside the range recommended and the other over the expected for the due examination when compared with the literature

Isolation of Endophytic Plant Growth-Promoting Bacteria Associated with the Halophyte Salicornia europaea and Evaluation of their Promoting Activity Under Salt Stress.

Science.gov (United States)

Zhao, Shuai; Zhou, Na; Zhao, Zheng-Yong; Zhang, Ke; Wu, Guo-Hua; Tian, Chang-Yan

2016-10-01

Several reports have highlighted that many plant growth-promoting endophytic bacteria (PGPE) can assist their host plants in coping with various biotic and abiotic stresses. However, information about the PGPE colonizing in the halophytes is still scarce. This study was designed to isolate and characterize PGPE from salt-accumulating halophyte Salicornia europaea grown under extreme salinity and to evaluate in vitro the bacterial mechanisms related to plant growth promotion. A total of 105 isolates were obtained from the surface-sterilized roots, stems, and assimilation twigs of S. europaea. Thirty-two isolates were initially selected for their ability to produce 1-aminocyclopropane-1-carboxylate deaminase as well as other properties such as production of indole-3-acetic acid and phosphate-solubilizing activities. The 16S rRNA gene-sequencing analysis revealed that these isolates belong to 13 different genera and 19 bacterial species. For these 32 strains, seed germination and seedling growth in axenically grown S. europaea seedlings at different NaCl concentrations (50-500 mM) were quantified. Five isolates possessing significant stimulation of the host plant growth were obtained. The five isolates were identified as Bacillus endophyticus, Bacillus tequilensis, Planococcus rifietoensis, Variovorax paradoxus, and Arthrobacter agilis. All the five strains could colonize and can be reisolated from the host plant interior tissues. These results demonstrate that habitat-adapted PGPE isolated from halophyte could enhance plant growth under saline stress conditions.

Antimicrobial activity of Olea europaea Linné extracts and their applicability as natural food preservative agents.

Science.gov (United States)

Thielmann, J; Kohnen, S; Hauser, C

2017-06-19

The antimicrobial activity of phenolic compounds from Olea (O.) europaea Linné (L.) is part of the scientific discussion regarding the use of natural plant extracts as alternative food preservative agents. Although, the basic knowledge on the antimicrobial potential of certain molecules such as oleuropein, hydroxytyrosol or elenolic acid derivatives is given, there is still little information regarding their applicability for food preservation. This might be primarily due to the lack of information regarding the full antimicrobial spectrum of the compounds, their synergisms in natural or artificial combinations and their interaction with food ingredients. The present review accumulates available literature from the past 40 years, investigating the antimicrobial activity of O. europaea L. derived extracts and compounds in vitro and in food matrices, in order to evaluate their food applicability. In summary, defined extracts from olive fruit or leaves, containing the strongest antimicrobial compounds hydroxytyrosol, oleacein or oleacanthal in considerable concentrations, appear to be suitable for food preservation. Nonetheless there is still need for consequent research on the compounds activity in food matrices, their effect on the natural microbiota of certain foods and their influence on the sensorial properties of the targeted products. Copyright © 2017 Elsevier B.V. All rights reserved.

Rapid and sensitive Nitrosomonas europaea biosensor assay for quantification of bioavailable ammonium sensu strictu in soil.

Science.gov (United States)

Nguyen, Minh Dong; Risgaard-Petersen, Nils; Sørensen, Jan; Brandt, Kristian K

2011-02-01

Knowledge on bioavailable ammonium sensu strictu (i.e., immediately available for cellular uptake) in soil is required to understand nutrient uptake processes in microorganisms and thus of vital importance for plant production. We here present a novel ammonium biosensor approach based on the lithoautotrophic ammonia-oxidizing bacterium Nitrosomonas europaea transformed with a luxAB sensor plasmid. Bioluminescence-based ammonium detection was achieved within 10 min with a quantification limit in liquid samples of ∼20 μM and a linear response range up to 400 μM. Biosensor and conventional chemical quantification of ammonium in soil solutions agreed well across a range of sample and assay conditions. The biosensor was subsequently applied for a solid phase-contact assay allowing for direct interaction of biosensor cells with soil particle-associated (i.e., exchangeable plus fixed) ammonium. The assay successfully quantified bioavailable ammonium even in unfertilized soil and demonstrated markedly higher ratios of bioavailable ammonium to water- or 2 M KCl-exchangeable ammonium in anoxic soil than in corresponding oxic soil. Particle-associated ammonium contributed by at least 74% and 93% of the total bioavailable pool in oxic and anoxic soil, respectively. The N. europaea biosensor should have broad relevance for environmental monitoring of bioavailable ammonium and processes depending on ammonium bioavailability.

Fifty years of mapping the Balkan flora for Atlas Florae Europaeae

Directory of Open Access Journals (Sweden)

Uotila Pertti

2017-10-01

Full Text Available Atlas Florae Europaeae (AFE, a programme for mapping the distribution of vascular plants in Europe, was launched in 1965 as a collaborative effort between European botanists. A historical review of the mapping for AFE in the Balkan countries, cited in the last volume (16 from 2013 as Albania, Bosnia and Herzegovina, Bulgaria, Croatia, Former Yugoslav Republic (F. Y. R. of Macedonia, Greece, Kosovo, Montenegro, Serbia, Slovenia, and Turkey (European part, is presented and achievements and problems discussed. The special challenges facing mapping of the Balkan area during the past 50 years include the extremely rich flora, diverse and mountainous relief, political and economic difficulties, inaccessibility of available data, and scarcity of botanists contributing and collecting data for mapping.

THE EUROPEAN COMPANY (SOCIETAS EUROPAEA ON RIND SIGHT

Directory of Open Access Journals (Sweden)

Liviana Andreea Niminet

2016-07-01

Full Text Available The article deals with the rind aspects of European Company (also known by its Latin name Societas Europaea or SE, a “type of public limited-liability company regulated under European Union law”. Although this form of company was proposed more than 40 years ago, it was only in 2001 when the Council issued Regulation (EC No 2157/2001 of 8 October 2001 on the Statute for a European company defining the European company (SE as “a legal structure that permits a company to operate in different European Union (EU countries under a single statute”, as determined by the law of the Union and common to all EU countries. Being a new legal form, the SE coexists with the corporate forms that already were in each Member Statebeing governed by both European Regulation and national law. As it follows we address the rules, classification, conditions for settling an SE, organization structures, tax harmonization, employee involvement in the SE, advantages and disadvantages of SEs, as well as the opportunity of SPEs.

Comparative and evaluation of anti-leech (Limnatis Nilotica effect of Olive (Olea Europaea L. with Levamisol and Tiabendazole

Directory of Open Access Journals (Sweden)

Majid Gholami-Ahangaran

2012-05-01

Full Text Available Objective: Until now, there is no registered drug for treatment of complications with leech in the world. According to the available scientific evidence, Olive is an effective anti-parasitic plant. Hence, in the present experiment we studied the inhibitory and killing effect of Olive methanolic extract on Limnatis nilotica. Methods: In this study, 100 leeches (Limnatis nilotica were collected from some wells in western area of Iran (south region in Ilam province and evaluated the antileech effects of Olive methanolic extract (Olea europaea L. in comparison with levamisole and tinidazole. Results: The results indicated no effect of tinidasole and distilled water on killing or mortality rate of the leeches but Olea europaea L. plant and levamisole have more effect on the L. nilotica. The mean death time of leech for levamisole and Olive determined 10依0.98 and 210依 24.1 minutes, respectively. Conclusions: The results showed that treatments of Olive methanolic extract and levamisole have the most effects on leeches and could be used as natural anti-L. nilotica. However it is necessary to achieve further studies for confirm of this subject.

Genetic Diversity Among Historical Olive (Olea europaea L.) Genotypes from Southern Anatolia Based on SSR Markers.

Science.gov (United States)

Sakar, Ebru; Unver, Hulya; Ercisli, Sezai

2016-12-01

Olive (Olea europaea) is an ancient and important crop in both olive oil production and table use. It is important to identify the genetic diversity of olive genetic resources for cultivar development and evaluation of olive germplasm. In the study, 14 microsatellite markers (UDO4, UDO8, UDO9, UDO11, UDO12, UDO22, UDO24, UDO26, UDO28, DCA9, DCA11, DCA13, DCA15, and DCA18) were used to assess the genetic variation on 76 olive (Olea europaea L.) genotypes from Mardin province together with 6 well-known Turkish and 4 well-known foreign reference cultivars. All microsatellite markers showed polymorphism and the number of alleles varied between 9 and 22, with an average of 14.57. The most informative loci were DCA 11 (22 alleles) and DCA 9 (21 alleles). Dendrogram based on genetic distances was constructed for the 86 olive genotypes/cultivars, which revealed the existence of different clusters. The high genetic similarity was evident between Bakırkire2 and Zinnar5 (0.74) genotypes, while the most genetically divergent genotypes were Gürmeşe5 and Yedikardeşler2 (0.19). It was concluded that there was abundant SSR polymorphism in olive germplasm in southern Anatolia in Turkey and could be important for future breeding activities.

Olea europaea L. in the North Mediterranean Basin during the Pleniglacial and the Early-Middle Holocene

Science.gov (United States)

Carrión, Yolanda; Ntinou, Maria; Badal, Ernestina

2010-04-01

The paper aims to define the natural distribution of Olea europaea L. var. sylvestris (Miller) Lehr. in the North Mediterranean basin during the Pleniglacial and the Early-Middle Holocene by means of the identification of its wood-charcoal and/or wood at prehistoric sites. For this purpose we have reviewed the previously available information and we have combined it with new wood-charcoal analyses data. We have taken under consideration the presence and frequency of O. europaea L. in the available wood-charcoal sequences, the characteristics of the accompanying flora, the associated chrono-cultural contexts, the broader biogeographical context and the AMS dates provided by Olea wood-charcoal or endocarps. According to the available evidence, during the Middle and Late Pleniglacial (ca 59-11.5 ka cal. BP), Olea would have persisted in thermophilous refugia located in the southern areas of the North Mediterranean basin, the southern Levant and the north of Africa. The Last Glacial Maximum (ca 22-18 ka cal. BP) probably reduced the distribution area of Olea. During the Preboreal and the Boreal (ca 11 500-8800 cal. BP) the species started to expand in the thermomediterranean bioclimatic level. In the western Mediterranean, during the Atlantic period (ca 8800-5600 cal. BP), the species became very abundant or dominant in the thermophilous plant formations and expanded to favorable enclaves outside the limits of the thermomediterranean level.

Growth modelling of Nitrosomonas europaea ATCC® 19718 and Nitrobacter winogradskyi ATCC® 25391: A new online indicator of the partial nitrification.

Science.gov (United States)

Cruvellier, Nelly; Poughon, Laurent; Creuly, Catherine; Dussap, C-Gilles; Lasseur, Christophe

2016-11-01

The aim of the present work was to study the growth of two nitrifying bacteria. For modelling the nitrifying subsystem of the MELiSSA loop, Nitrosomonas europaea ATCC® 19718 and Nitrobacter winogradskyi ATCC® 25931 were grown separately and in cocultures. The kinetic parameters of a stoichiometric mass balanced Pirt model were identified: μmax=0.054h(-1), decay rate b=0.003h(-1) and maintenance rate m=0.135gN-NH4(+)·gX(-1)·h(-1) for Nitrosomonas europaea; μmax=0.024h(-1), b=0.001h(-1) and m=0.467gN-NO2(-)·gX(-1)·h(-1) for Nitrobacter winogradskyi. A predictive structured model of nitrification in co-culture was developed. The online evolution of the addition of KOH is correlated to the nitritation; the dissolved oxygen concentration is correlated to both nitritation and nitratation. The model suitably represents these two variables so that transient partial nitrification is assessed. This is a clue for avoiding partial nitrification by predictive functional control. Copyright © 2016 Elsevier Ltd. All rights reserved.

Permanent draft genomes of the two Rhodopirellula europaea strains 6C and SH398.

Science.gov (United States)

Richter-Heitmann, Tim; Richter, Michael; Klindworth, Anna; Wegner, Carl-Eric; Frank, Carsten S; Glöckner, Frank Oliver; Harder, Jens

2014-02-01

The genomes of two Rhodopirellula europaea strains were sequenced as permanent drafts to study the genomic diversity within this genus, especially in comparison with the closed genome of the type strain Rhodopirellula baltica SH1(T). The isolates are part of a larger study to infer the biogeography of Rhodopirellula species in European marine waters, as well as to amend the genus description of R. baltica. This genomics resource article is the second of a series of five publications describing a total of eight new permanent daft genomes of Rhodopirellula species. Copyright © 2013 Elsevier B.V. All rights reserved.

Steady-State Growth under Inorganic Carbon Limitation Conditions Increases Energy Consumption for Maintenance and Enhances Nitrous Oxide Production in Nitrosomonas europaea.

Science.gov (United States)

Mellbye, Brett L; Giguere, Andrew; Chaplen, Frank; Bottomley, Peter J; Sayavedra-Soto, Luis A

2016-06-01

Nitrosomonas europaea is a chemolithoautotrophic bacterium that oxidizes ammonia (NH3) to obtain energy for growth on carbon dioxide (CO2) and can also produce nitrous oxide (N2O), a greenhouse gas. We interrogated the growth, physiological, and transcriptome responses of N. europaea to conditions of replete (>5.2 mM) and limited inorganic carbon (IC) provided by either 1.0 mM or 0.2 mM sodium carbonate (Na2CO3) supplemented with atmospheric CO2 IC-limited cultures oxidized 25 to 58% of available NH3 to nitrite, depending on the dilution rate and Na2CO3 concentration. IC limitation resulted in a 2.3-fold increase in cellular maintenance energy requirements compared to those for NH3-limited cultures. Rates of N2O production increased 2.5- and 6.3-fold under the two IC-limited conditions, increasing the percentage of oxidized NH3-N that was transformed to N2O-N from 0.5% (replete) up to 4.4% (0.2 mM Na2CO3). Transcriptome analysis showed differential expression (P ≤ 0.05) of 488 genes (20% of inventory) between replete and IC-limited conditions, but few differences were detected between the two IC-limiting treatments. IC-limited conditions resulted in a decreased expression of ammonium/ammonia transporter and ammonia monooxygenase subunits and increased the expression of genes involved in C1 metabolism, including the genes for RuBisCO (cbb gene cluster), carbonic anhydrase, folate-linked metabolism of C1 moieties, and putative C salvage due to oxygenase activity of RuBisCO. Increased expression of nitrite reductase (gene cluster NE0924 to NE0927) correlated with increased production of N2O. Together, these data suggest that N. europaea adapts physiologically during IC-limited steady-state growth, which leads to the uncoupling of NH3 oxidation from growth and increased N2O production. Nitrification, the aerobic oxidation of ammonia to nitrate via nitrite, is an important process in the global nitrogen cycle. This process is generally dependent on ammonia

Antimicrobial potential of green synthesized CeO2 nanoparticles from Olea europaea leaf extract

Directory of Open Access Journals (Sweden)

Maqbool Q

2016-10-01

Full Text Available Qaisar Maqbool,1 Mudassar Nazar,1 Sania Naz,2 Talib Hussain,3 Nyla Jabeen,4 Rizwan Kausar,5 Sadaf Anwaar,4 Fazal Abbas,6,7 Tariq Jan6 1Department of Biotechnology, Virtual University of Pakistan, Lahore, Pakistan; 2Department of Biotechnology, Quaid-i-Azam University, Islamabad, Pakistan; 3National Institute of Vacuum Science and Technology (NINVAST, Islamabad, Pakistan; 4Department of Biotechnology and Bioinformatics Lab., International Islamic University, Islamabad, Pakistan; 5Department of Chemistry, University of Sargodha, Sargodha, Pakistan; 6Department of Physics, International Islamic University, Islamabad, Pakistan; 7Interdisciplinary Research Organization, University of Chakwal (UOC, Chakwal, Pakistan Abstract: This article reports the green fabrication of cerium oxide nanoparticles (CeO2 NPs using Olea europaea leaf extract and their applications as effective antimicrobial agents. O. europaea leaf extract functions as a chelating agent for reduction of cerium nitrate. The resulting CeO2 NPs exhibit pure single-face cubic structure, which is examined by X-ray diffraction, with a uniform spherical shape and a mean size 24 nm observed through scanning electron microscopy and transmission electron microscopy. Ultraviolet-visible spectroscopy confirms the characteristic absorption peak of CeO2 NPs at 315 nm. Fourier transform infrared spectroscopy reflects stretching frequencies at 459 cm-1, showing utilization of natural components for the production of NPs. Thermal gravimetric analysis predicts the successful capping of CeO2 NPs by bioactive molecules present in the plant extract. The antimicrobial studies show significant zone of inhibition against bacterial and fungal strains. The higher activities shown by the green synthesized NPs than the plant extract lead to the conclusion that they can be effectively used in biomedical application. Furthermore, reduction of cerium salt by plant extract will reduce environmental impact over

The role of temperature in the onset of the Olea europaea L. pollen season in southwestern Spain

Science.gov (United States)

Galán, C.; García-Mozo, H.; Cariñanos, P.; Alcázar, P.; Domínguez-Vilches, E.

Temperature is one of the main factors affecting the flowering of Mediterranean trees. In the case of Olea europaea L., a low-temperature period prior to bud development is essential to interrupt dormancy. After that, and once a base temperature is reached, the plant accumulates heat until flowering starts. Different methods of obtaining the best-forecast model for the onset date of the O. europaea pollen season, using temperature as the predictive parameter, are proposed in this paper. An 18-year pollen and climatic data series (1982-1999) from Cordoba (Spain) was used to perform the study. First a multiple-regression analysis using 15-day average temperatures from the period prior to flowering time was tested. Second, three heat-summation methods were used, determining the the quantities heat units (HU): accumulated daily mean temperature after deducting a threshold, growing degree-days (GDD): proposed by Snyder [J Agric Meteorol 35:353-358 (1985)] as a measure of physiological time, and accumulated maximum temperature. In the first two, the optimum base temperature selected for heat accumulation was 12.5°C. The multiple-regression equation for 1999 gives a 7-day delay from the observed date. The most accurate results were obtained with the GDD method, with a difference of only 4.7 days between predicted and observed dates. The average heat accumulation expressed as GDD was 209.9°C days. The HU method also gives good results, with no significant statistical differences between predictions and observations.

Community structure variability of Uropodina mites (Acari: Mesostigmata) in nests of the common mole, Talpa europaea, in Central Europe

OpenAIRE

Napiera?a, Agnieszka; M?dra, Anna; Leszczy?ska-Deja, Kornelia; Gwiazdowicz, Dariusz J.; Go?dyn, Bart?omiej; B?oszyk, Jerzy

2016-01-01

Underground nests of Talpa europaea, known as the common mole, are very specific microhabitats, which are also quite often inhabited by various groups of arthropods. Mites from the suborder Uropodina (Acari: Mesostigmata) are only one of them. One could expect that mole nests that are closely located are inhabited by communities of arthropods with similar species composition and structure. However, results of empirical studies clearly show that even nests which are close to each other can be ...

Heavy metal bioaccumulation by the important food plant, olea europaea L., in an ancient metalliferous polluted area of Cyprus

OpenAIRE

Wilson, B; Pyatt, FB

2007-01-01

Aspects of the bioaccumulation of heavy metals are reviewed and possible evidence of homeostasis is highlighted. Examination and analysis of olive (Olea europaea L.) trees growing in close proximity to a copper dominated spoil tip dating from at least 2000 years BP, on the island of Cyprus, revealed both bioaccumulation and partitioning of copper, lead and zinc in various parts of the tree. A factor to quantify the degree of accumulation is illustrated and a possible seed protective mechanism...

Peroxynitrite mediates programmed cell death both in papillar cells and in self-incompatible pollen in the olive (Olea europaea L.)

Science.gov (United States)

Serrano, Irene; Romero-Puertas, María C.; Rodríguez-Serrano, María; Sandalio, Luisa M.; Olmedilla, Adela

2012-01-01

Programmed cell death (PCD) has been found to be induced after pollination both in papillar cells and in self-incompatible pollen in the olive (Olea europaea L.). Reactive oxygen species (ROS) and nitric oxide (NO) are known to be produced in the pistil and pollen during pollination but their contribution to PCD has so far remained elusive. The possible role of ROS and NO was investigated in olive pollen–pistil interaction during free and controlled pollination and it was found that bidirectional interaction appears to exist between the pollen and the stigma, which seems to regulate ROS and NO production. Biochemical evidence strongly suggesting that both O2˙− and NO are essential for triggering PCD in self-incompatibility processes was also obtained. It was observed for the first time that peroxynitrite, a powerful oxidizing and nitrating agent generated during a rapid reaction between O2˙− and NO, is produced during pollination and that this is related to an increase in protein nitration which, in turn, is strongly associated with PCD. It may be concluded that peroxynitrite mediates PCD during pollen–pistil interaction in Olea europaea L. both in self-incompatible pollen and papillar cells. PMID:22140239

H(+) -pyrophosphatase from Salicornia europaea confers tolerance to simultaneously occurring salt stress and nitrogen deficiency in Arabidopsis and wheat.

Science.gov (United States)

Lv, Sulian; Jiang, Ping; Nie, Lingling; Chen, Xianyang; Tai, Fang; Wang, Duoliya; Fan, Pengxiang; Feng, Juanjuan; Bao, Hexigeduleng; Wang, Jinhui; Li, Yinxin

2015-11-01

High salinity and nitrogen (N) deficiency in soil are two key factors limiting crop productivity, and they usually occur simultaneously. Here we firstly found that H(+) -PPase is involved in salt-stimulated NO3 (-) uptake in the euhalophyte Salicornia europaea. Then, two genes (named SeVP1 and SeVP2) encoding H(+) -PPase from S. europaea were characterized. The expression of SeVP1 and SeVP2 was induced by salt stress and N starvation. Both SeVP1 or SeVP2 transgenic Arabidopsis and wheat plants outperformed the wild types (WTs) when high salt and low N occur simultaneously. The transgenic Arabidopsis plants maintained higher K(+) /Na(+) ratio in leaves and exhibited increased NO3 (-) uptake, inorganic pyrophosphate-dependent vacuolar nitrate efflux and assimilation capacity under this double stresses. Furthermore, they had more soluble sugars in shoots and roots and less starch accumulation in shoots than WT. These performances can be explained by the up-regulated expression of ion, nitrate and sugar transporter genes in transgenic plants. Taken together, our results suggest that up-regulation of H(+) -PPase favours the transport of photosynthates to root, which could promote root growth and integrate N and carbon metabolism in plant. This work provides potential strategies for improving crop yields challenged by increasing soil salinization and shrinking farmland. © 2015 John Wiley & Sons Ltd.

Heavy metal bioaccumulation by the important food plant, Olea europaea L., in an ancient metalliferous polluted area of Cyprus.

Science.gov (United States)

Wilson, B; Pyatt, F B

2007-05-01

Aspects of the bioaccumulation of heavy metals are reviewed and possible evidence of homeostasis is highlighted. Examination and analysis of olive (Olea europaea L.) trees growing in close proximity to a copper dominated spoil tip dating from at least 2000 years BP, on the island of Cyprus, revealed both bioaccumulation and partitioning of copper, lead and zinc in various parts of the tree. A factor to quantify the degree of accumulation is illustrated and a possible seed protective mechanism suggested.

Profundization of acetabular cup uncemented in total substitution of hip in-patient with acetabular dysplasia - Experience university hospital - Clinica San Rafael

International Nuclear Information System (INIS)

Dimian Mayorga, Omar David; Sandoval Daza, Alejandro; Vargas Turriago, Marcela; Perez Torres, Javier

2005-01-01

14 patients with acetabular dysplasia were treated at Hospital Universitario Clinica San Rafael with total hip arthroplasty with uncemented cup internization. According to Crowe classification, one was type 1, eight were type 2 and five were type 3. The average follow up was twenty-four months. The Harris hip score was used for the clinical evaluation with a pre operative average of 35 points and 37 points post operative. The average cup internization was four millimeters, with an average cup protrutio of 47% and an average of cup coverage of 81%. The average internization of the femoral head's center was 26mm. screws for cup fixation were used in 3 patients. We did not have complications nor implant revision at the time of follow up

Intra-specific genetic diversity in wild olives (Olea europaea ssp cuspidata) in Hormozgan Province, Iran.

Science.gov (United States)

Noormohammadi, Z; Samadi-Molayousefi, H; Sheidai, M

2012-03-19

Wild olive (O. europaea ssp cuspidata) plants grow in various regions of Iran and are expected to have considerable genetic diversity due to adaptation to the various environmental conditions. We examined the genetic diversity of four populations of wild olive growing in Hormozgan Province located in southern Iran by using 30 RAPDs and 10 ISSR markers. The mean value of polymorphism for RAPD loci was 73.71%, while the value for ISSR loci was 81.74%. The Keshar population had the highest value of intra-population polymorphism for both RAPD and ISSR loci (66.86 and 62.71%, respectively), while the Tudar population had the lowest values (20.35 and 28.81%, respectively). Similarly, the highest and lowest number of effective alleles, Shannon index and Nei's genetic diversity were also found for these two populations. The highest value of H(pop)/H(sp) within population genetic diversity for RAPD and ISSR loci was found for the Keshar population (H(pop) = 0.85 and H(sp) = 0.90). OPA04-750, OPA13-650 and OPA02-350 RAPD bands were specific for Tudar, Bondon and Keshar populations, respectively, while no specific ISSR bands were observed. Analysis of molecular variance as well as the pairwise F(ST) test showed significant differences for RAPD and ISSR markers among the populations. The NJ and UPGMA trees also separated the wild olive populations from each other, indicating their genetic distinctness. UPGMA clustering of the four wild olive populations placed the Tudar population far from the other populations; Keshar and Bokhoon population samples revealed more similarity and were grouped together. We conclude that there is high genetic diversity among O. europaea ssp cuspidata populations located in southern Iran. We also found RAPD and ISSR markers to be useful molecular tools to discriminate and evaluate genetic variations in wild olive trees.

Oncology patients hospitalized in the Clinicas Hospital Dr. Manuel Quintela

International Nuclear Information System (INIS)

Arostegui, M.; Borba, M.; Caldarelli, D.; Eguiia, A.; Fernandez, E.; Peleteiro, M.; Pereira, C.; Vico, M.

2004-01-01

This work was carried out by a nursery licensed group in the Clinicas Hospital - Dr. Manuel Quintela.The nature and functioning of Services and the allocation of resources, are essential for the analysis of the Survey of the hospitalized oncology patients in the Institution. To develop a model of care that constitutes a health care as well as teaching and research in the country regarding the quality of care was defined the following topics: lower risks for the patient, safer care, personal trained and specialized to promote relationship between the offering and the person receiving the service. The assessment and management performance of the services involved in the operation are the result of the degree of user satisfaction. Objective: To determine the human and material necessary for the care of cancer resources users, considering their number, treatment, complications and nursing care derived from each pathology and stage of disease. Methodology: A comparative descriptive study of the same population was conducted in two transverse sections in relation to two different times which are based on the design of a form that allowed hospitalized to collect information on users 6/12/03 and 6/16/04. Other instruments used were the clinical history and the daily census staff Patients and Nursing Division. Results and conclusions: A comparative descriptive analysis already mentioned are: increased internships and cancer patients; between 50 and 64 is the highest number of patients; diagnoses Face and Neck and maintain the Digestive System more cases; the number of patients doubles and Hematology Neurological from one to another period. Chemotherapy is the treatment choice and there is a decrease in the surgical and medical; more patients in the study; in the origin, Montevideo has the largest number of patients followed by Canelones. Line of nursing intervention will be carried out in short, medium and long term

System precision assessment ExacTrac 6D® BrainLab of the Hospital das Clinicas da Faculdade de Medicina da USP; Avaliacao da precisao do sistema Exactrac 6D® BrainLab do Hospital das Clinicas da Faculdade de Medicina da USP

Energy Technology Data Exchange (ETDEWEB)

Maistro, Carlos E.B., E-mail: carloseduardo.bravinmaistro@gmail.com [Programa de Residencia Multiprofissional em Fisica Medica, Faculdade de Medicina de Sao Paulo, SP (Brazil); Nakandakari, Marcos V.N.; Ribeiro, Victor A.B.; Sales, Camila P. de; Rodrigues, Laura N. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Radiologia. Servico de Radioterapia. Hospital das Clinicas

2015-08-15

The goal of this study was to evaluate the precision of ExacTrac 6D® Brainlab system, installed at Hospital das Clinicas da Faculdade de Medicina da USP, in frameless radiosurgery treatments. Four sets of tests were performed for different purposes in order to assess the following parameters: the accuracy of location through infrared system; evaluation of the reproducibility of fusion algorithm; evaluation of the X-ray system; and the end-to-end test with the goal of assess the overall accuracy of the system. It was found that the infrared system showed a maximum deviation of 0.5 mm in terms of positioning and the X-ray system showed a precision of 0.15 mm and 0.6°. The reproducibility of fusion algorithms provided a maximum deviation in position which was less than 0.5 mm and 0.5° and the quantitative analysis of the results for end-to-end test showed an overall accuracy of the system better than 0.8 mm. (author)

Synthesis of deuterium-labelled substrates for the study of oleuropein biosynthesis in Olea europaea callus cultures.

Science.gov (United States)

Serrilli, Anna Maria; Maggi, Agnese; Casagrande, Valentina; Bianco, Armandodoriano

2016-01-01

We propose the cell culture approach to investigate oleuropein (1) biogenesis in Olea europaea L. We suggest employing olive callus cultures to identify the iridoidic precursor of oleuropein. In fact, we confirmed that callus cells from olive shoot explants are able to produce key secoiridoid as 1. To enable this approach, we synthesised and characterised deuterium-labelled iridoidic precursors belonging both to the loganin and the 8-epiloganin series. These iridoids are [7,8-(2)H2]-7-deoxy-8-epi-loganin (2(D)), [8,10-(2)H2]-8-epi-loganin (4(D)) and [7,8-(2)H2]-7-deoxy-loganin (3(D)).

Proteome regulation during Olea europaea fruit development.

Directory of Open Access Journals (Sweden)

Linda Bianco

Full Text Available Widespread in the Mediterranean basin, Olea europaea trees are gaining worldwide popularity for the nutritional and cancer-protective properties of the oil, mechanically extracted from ripe fruits. Fruit development is a physiological process with remarkable impact on the modulation of the biosynthesis of compounds affecting the quality of the drupes as well as the final composition of the olive oil. Proteomics offers the possibility to dig deeper into the major changes during fruit development, including the important phase of ripening, and to classify temporal patterns of protein accumulation occurring during these complex physiological processes.In this work, we started monitoring the proteome variations associated with olive fruit development by using comparative proteomics coupled to mass spectrometry. Proteins extracted from drupes at three different developmental stages were separated on 2-DE and subjected to image analysis. 247 protein spots were revealed as differentially accumulated. Proteins were identified from a total of 121 spots and discussed in relation to olive drupe metabolic changes occurring during fruit development. In order to evaluate if changes observed at the protein level were consistent with changes of mRNAs, proteomic data produced in the present work were compared with transcriptomic data elaborated during previous studies.This study identifies a number of proteins responsible for quality traits of cv. Coratina, with particular regard to proteins associated to the metabolism of fatty acids, phenolic and aroma compounds. Proteins involved in fruit photosynthesis have been also identified and their pivotal contribution in oleogenesis has been discussed. To date, this study represents the first characterization of the olive fruit proteome during development, providing new insights into fruit metabolism and oil accumulation process.

Proteome regulation during Olea europaea fruit development.

Science.gov (United States)

Bianco, Linda; Alagna, Fiammetta; Baldoni, Luciana; Finnie, Christine; Svensson, Birte; Perrotta, Gaetano

2013-01-01

Widespread in the Mediterranean basin, Olea europaea trees are gaining worldwide popularity for the nutritional and cancer-protective properties of the oil, mechanically extracted from ripe fruits. Fruit development is a physiological process with remarkable impact on the modulation of the biosynthesis of compounds affecting the quality of the drupes as well as the final composition of the olive oil. Proteomics offers the possibility to dig deeper into the major changes during fruit development, including the important phase of ripening, and to classify temporal patterns of protein accumulation occurring during these complex physiological processes. In this work, we started monitoring the proteome variations associated with olive fruit development by using comparative proteomics coupled to mass spectrometry. Proteins extracted from drupes at three different developmental stages were separated on 2-DE and subjected to image analysis. 247 protein spots were revealed as differentially accumulated. Proteins were identified from a total of 121 spots and discussed in relation to olive drupe metabolic changes occurring during fruit development. In order to evaluate if changes observed at the protein level were consistent with changes of mRNAs, proteomic data produced in the present work were compared with transcriptomic data elaborated during previous studies. This study identifies a number of proteins responsible for quality traits of cv. Coratina, with particular regard to proteins associated to the metabolism of fatty acids, phenolic and aroma compounds. Proteins involved in fruit photosynthesis have been also identified and their pivotal contribution in oleogenesis has been discussed. To date, this study represents the first characterization of the olive fruit proteome during development, providing new insights into fruit metabolism and oil accumulation process.

Volatile constituents of commercial imported and domestic black-ripe table olives (Olea europaea).

Science.gov (United States)

Sansone-Land, Angelina; Takeoka, Gary R; Shoemaker, Charles F

2014-04-15

Volatile constituents of commercial black-ripe table olives (Olea europaea) from the United States, Spain, Egypt and Morocco were analysed by gas chromatography and gas chromatography-mass spectrometry (GC-MS). Dynamic headspace sampling was used to isolate a variety of aldehydes, alcohols, esters, ketones, phenols, terpenes, norisoprenoids, and pyridines. Odour unit values, calculated from concentration and odour threshold data, indicate that the following compounds are major contributors to black-ripe table olive aroma: β-damascenone, nonanal, (E)-dec-2-enal, 3-methylbutanal, ethyl benzoate, octanal, 2-methoxyphenol, 2-methylbutanal and 2-methoxy-4-methylphenol. Imported olives contained a variety of fermentation derived volatiles that were not detected in domestic olives. Constituents such as ethyl 2-methylbutanoate, ethyl 3-methylbutanoate, 3-methylbutyl acetate, oct-1-en-3-one, ethyl hexanoate, (Z)-hex-3-enyl acetate, hexyl acetate, ethyl cyclohexanecarboxylate, benzyl acetate and 4-ethylphenol contributed to the odour of imported olives but were not detected in domestic olives. Published by Elsevier Ltd.

Characterization of antioxidant enzymes and peroxisomes of olive (Olea europaea L.) fruits.

Science.gov (United States)

Lopez-Huertas, Eduardo; del Río, Luis A

2014-10-15

The presence of peroxisomes in olive (Olea europaea L.) fruits and different antioxidant enzymes occurring in this plant tissue is reported for the first time. Ultrastructural analysis showed that olive cells were characterized by the presence of large vacuoles and lipid drops. Plastids, mitochondria and peroxisomes were placed near the cell wall, showing some type of association with it. Olive fruit peroxisomes were purified by sucrose density-gradient centrifugation, and catalase, glutathione reductase and ascorbate peroxidase were found in peroxisomes. In olive fruit tissue the presence of a battery of antioxidant enzymes was demonstrated, including catalase, four superoxide dismutase isozymes (mainly an Fe-SOD plus 2 Cu,Zn-SOD and a Mn-SOD), all the enzymes of the ascorbate-glutathione cycle, reduced and oxidized glutathione, ascorbate, and four NADPH-recycling dehydrogenases. The knowledge of the full composition of antioxidants (enzymatic and non-enzymatic) in olive fruits is crucial to be able to understand the processes regulating the antioxidant composition of olive oil. Copyright © 2014 Elsevier GmbH. All rights reserved.

A Comprehensive Toxicological Safety Assessment of an Extract of Olea Europaea L. Leaves (Bonolive™).

Science.gov (United States)

Clewell, Amy E; Béres, Erzsébet; Vértesi, Adél; Glávits, Róbert; Hirka, Gábor; Endres, John R; Murbach, Timothy S; Szakonyiné, Ilona Pasics

2016-01-01

A battery of toxicological studies was conducted to investigate the genotoxicity and repeated-dose oral toxicity of Bonolive™, a proprietary water-soluble extract of the leaves of the olive tree (Olea europaea L.), in accordance with internationally accepted protocols. There was no evidence of mutagenicity in a bacterial reverse mutation test and in an vitro mammalian chromosomal aberration test nor was any genotoxic activity observed in an in vivo mouse micronucleus test at concentrations up to the limit dose of 2000 mg/kg bw/d. Bonolive™ did not cause mortality or toxic effects in Crl:(WI)BR Wistar rats in a 90-day repeated-dose oral toxicity study at doses of 360, 600, and 1000 mg/kg bw/d. The no observed adverse effect level in the 90-day study was 1000 mg/kg bw/d for both male and female rats, the highest dose tested. © The Author(s) 2015.

Identification and characterization of the iridoid synthase involved in oleuropein biosynthesis in olive (Olea europaea) fruits

DEFF Research Database (Denmark)

Alagna, Fiammetta; Geu-Flores, Fernando; Kries, Hajo

2016-01-01

The secoiridoids are the main class of specialized metabolites present in olive (Olea europaea L.) fruit. In particular, the secoiridoid oleuropein strongly influences olive oil quality because of its bitterness, which is a desirable trait. In addition, oleuropein possesses a wide range...... of pharmacological properties, including antioxidant, anti-inflammatory, and anti-cancer activities. In accordance, obtaining high oleuropein varieties is a main goal of molecular breeding programs. Here we use a transcriptomic approach to identify candidate genes belonging to the secoiridoid pathway in olive. From...... these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive...

Feeding and Development of Emerald Ash Borer (Coleoptera: Buprestidae) on Cultivated Olive, Olea europaea.

Science.gov (United States)

Cipollini, Don; Rigsby, Chad M; Peterson, Donnie L

2017-08-01

We examined the suitability of cultivated olive, Olea europaea L., as a host for emerald ash borer, Agrilus planipennis Fairmaire. In a bioassay using cut stems from a field-grown olive tree (cv. 'Manzanilla') we found that 45% of larvae that had emerged from eggs used to inoculate stems, were recovered alive, many as larvae or prepupae, during periodic debarking of a subset of stems. Three intact stems that 19 larvae successfully entered were exposed to a simulated overwintering treatment. Four live adults emerged afterwards, and an additional pupa and several prepupae were discovered after debarking these stems. Cultivated olive joins white fringetree as one of the two species outside of the genus Fraxinus capable of supporting the development of emerald ash borer from neonate to adult. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Olive plants (Olea europaea L.) as a bioindicator for pollution.

Science.gov (United States)

Eliwa, Amal Mohamed; Kamel, Ehab Abdel-Razik

2013-06-15

In the present work, olive plant (Olea europaea L.) was used as a biological indicator for pollution in which, molecular and physiological parameters were studied. Olive plants were collected from polluted and non-polluted areas in Jeddah - Saudi Arabia, traffic area as an air polluted area, sewage treatment station as water polluted area, industrial area as solid waste polluted, costal area as marine polluted area and an area without a direct source of pollution far away from the city center, which was used as control. These changes conducted with nucleic acid content, minerals content, pigments and some growth parameters. Results showed significant reductions in DNA and RNA contents under all polluted sites. Mineral contents were varied widely depending on the different pollutants and locations of olive plant. Generally, micro-elements varied (increase/decrease) significantly within collected samples and the source of pollution. All growth parameters were decreased significantly within the studied samples of all pollutant areas except the relative water content was increased. The content of chlorophyll a has decreased highly significantly in all polluted leaves. While the content of chlorophyll b has increased significantly in all polluted leaves especially in air polluted leaves. The total content of carotenoid pigments has decreased highly significantly in all polluted leaves. It was concluded that olive plant can be used as a biological indicator to the environmental pollutants.

Genetic Markers Analyses and Bioinformatic Approaches to Distinguish Between Olive Tree (Olea europaea L.) Cultivars.

Science.gov (United States)

Ben Ayed, Rayda; Ben Hassen, Hanen; Ennouri, Karim; Rebai, Ahmed

2016-12-01

The genetic diversity of 22 olive tree cultivars (Olea europaea L.) sampled from different Mediterranean countries was assessed using 5 SNP markers (FAD2.1; FAD2.3; CALC; SOD and ANTHO3) located in four different genes. The genotyping analysis of the 22 cultivars with 5 SNP loci revealed 11 alleles (average 2.2 per allele). The dendrogram based on cultivar genotypes revealed three clusters consistent with the cultivars classification. Besides, the results obtained with the five SNPs were compared to those obtained with the SSR markers using bioinformatic analyses and by computing a cophenetic correlation coefficient, indicating the usefulness of the UPGMA method for clustering plant genotypes. Based on principal coordinate analysis using a similarity matrix, the first two coordinates, revealed 54.94 % of the total variance. This work provides a more comprehensive explanation of the diversity available in Tunisia olive cultivars, and an important contribution for olive breeding and olive oil authenticity.

Early performance of Olea europaea cv. Arbequina, Picual and Frantoio in the southern Atacama Desert

Directory of Open Access Journals (Sweden)

Freddy Mora

2008-01-01

Full Text Available The cultivars Arbequina, Picual and Frantoio of Olea europaea are cultivated in severalMediterranean countries. In 1999, these cultivars were planted at three locations in the region of Coquimbo,an arid, Mediterranean-like area in Chile. A generalized linear modeling approach was used in view of thenon-normal distribution of the agronomic data sets. Fruit yield (harvests of 2002-2003, precocity (2002 andtree survival (after four growing seasons differed significantly between the cultivars. Arbequina and Picualhad a positive effect on the yield. Picual was the earliest cultivar at two sites. The survival rate of Frantoio washigh at the three sites (90-100%, as opposed to Picual (56-83%. The approach of Generalized Linear Modelswas particularly useful where the assumption of normality was not satisfied. The selection of cultivars ispromising in this arid region of Chile, while the success will depend on the selection of well-adapted genotypesto a particular location.

Observation of eight ancient olive trees (Olea europaea L.) growing in the Garden of Gethsemane.

Science.gov (United States)

Petruccelli, Raffaella; Giordano, Cristiana; Salvatici, Maria Cristina; Capozzoli, Laura; Ciaccheri, Leonardo; Pazzini, Massimo; Lain, Orietta; Testolin, Raffaele; Cimato, Antonio

2014-05-01

For thousands of years, olive trees (Olea europaea L.) have been a significant presence and a symbol in the Garden of Gethsemane, a place located at the foot of the Mount of Olives, Jerusalem, remembered for the agony of Jesus Christ before his arrest. This investigation comprises the first morphological and genetic characterization of eight olive trees in the Garden of Gethsemane. Pomological traits, morphometric, and ultrastructural observations as well as SSR (Simple Sequence Repeat) analysis were performed to identify the olive trees. Statistical analyses were conducted to evaluate their morphological variability. The study revealed a low morphological variability and minimal dissimilarity among the olive trees. According to molecular analysis, these trees showed the same allelic profile at all microsatellite loci analyzed. Combining the results of the different analyses carried out in the frame of the present work, we could conclude that the eight olive trees of the Gethsemane Garden have been propagated from a single genotype. Copyright © 2014. Published by Elsevier SAS.

Epicuticular Wax in Developing Olives (Olea europaea) Is Highly Dependent upon Cultivar and Fruit Ripeness.

Science.gov (United States)

Vichi, Stefania; Cortés-Francisco, Nuria; Caixach, Josep; Barrios, Gonçal; Mateu, Jordi; Ninot, Antonia; Romero, Agustí

2016-08-03

The epicuticular wax (EW) layer is located on the surface of most plant organs. It provides the cuticle with most of its properties and is the primary barrier against biotic and abiotic stress. Despite the importance of Olea europaea cultivation, few studies have characterized the EW covering leaves and olives, which could be involved in resistance to both infection and environmental conditions. In the present study, wide-ranging screening was carried out using direct-injection electrospray ionization coupled to high-resolution mass spectrometry to analyze EW in developing olives of nine varieties. The proportions of EW fractions [wax esters (WEs), diacylglycerols, triacylglycerols (TAGs), triterpenic acids, and aldehydes] strongly depended upon the olive cultivar and, in only a few cases, were influenced by the sampling date. The specific compositions of the major fractions, WEs and TAGs, were strictly related to the cultivar, while the degree of unsaturation and chain length of the WEs evolved throughout the 4 weeks prior to the olive turning color.

Chemical Composition and Water Permeability of Fruit and Leaf Cuticles of Olea europaea L.

Science.gov (United States)

Huang, Hua; Burghardt, Markus; Schuster, Ann-Christin; Leide, Jana; Lara, Isabel; Riederer, Markus

2017-10-11

The plant cuticle, protecting against uncontrolled water loss, covers olive (Olea europaea) fruits and leaves. The present study describes the organ-specific chemical composition of the cuticular waxes and the cutin and compares three developmental stages of fruits (green, turning, and black) with the leaf surface. Numerous organ-specific differences, such as the total coverage of cutin monomeric components (1034.4 μg cm -2 and 630.5 μg cm -2 ) and the cuticular waxes (201.6 μg cm -2 and 320.4 μg cm -2 ) among all three fruit stages and leaves, respectively, were detected. Water permeability as the main cuticular function was 5-fold lower in adaxial leaf cuticles (2.1 × 10 -5 m s -1 ) in comparison to all three fruit stages (9.5 × 10 -5 m s -1 ). The three fruit developmental stages have the same cuticular water permeability. It is hypothesized that a higher weighted average chain length of the acyclic cuticular components leads to a considerably lower permeability of the leaf as compared to the fruit cuticle.

454 Pyrosequencing of Olive (Olea europaea L.) Transcriptome in Response to Salinity.

Science.gov (United States)

Bazakos, Christos; Manioudaki, Maria E; Sarropoulou, Elena; Spano, Thodhoraq; Kalaitzis, Panagiotis

2015-01-01

Olive (Olea europaea L.) is one of the most important crops in the Mediterranean region. The expansion of cultivation in areas irrigated with low quality and saline water has negative effects on growth and productivity however the investigation of the molecular basis of salt tolerance in olive trees has been only recently initiated. To this end, we investigated the molecular response of cultivar Kalamon to salinity stress using next-generation sequencing technology to explore the transcriptome profile of olive leaves and roots and identify differentially expressed genes that are related to salt tolerance response. Out of 291,958 obtained trimmed reads, 28,270 unique transcripts were identified of which 35% are annotated, a percentage that is comparable to similar reports on non-model plants. Among the 1,624 clusters in roots that comprise more than one read, 24 were differentially expressed comprising 9 down- and 15 up-regulated genes. Respectively, inleaves, among the 2,642 clusters, 70 were identified as differentially expressed, with 14 down- and 56 up-regulated genes. Using next-generation sequencing technology we were able to identify salt-response-related transcripts. Furthermore we provide an annotated transcriptome of olive as well as expression data, which are both significant tools for further molecular studies in olive.

[Mobbing and its effects on health. the experience of the "Clinica del Lavoro Luigi Devoto" in Milan].

Science.gov (United States)

Punzi, Silvia; Cassitto, Maria Grazia; Castellini, Giovanna; Costa, G; Gilioli, R

2007-01-01

There is increasing interest in research, prevention and management of mobbing in the field of occupational psychosocial risks. To describe mobbing and its health effects by analysis of the cases examined from 1997 to 2003 at the Department of Occupational Health "Clinica del Lavoro Luigi Devoto" in Milan. A total of 226 clinical records of patients who reported a mobbing situation when undergoing medical examination were selected out of 2455 patients examined for stress-related disorders. The percentage of women was higher (53.1%) than in men (46.9%) with a prevalent age range of 35-54 years. There was a great variety of jobs, especially white-collars and workers in large service companies. In one third of the cases, mobbing occurred within 4 years from beginning of employment and mostly after company reorganization and management changes. The most frequent negative acts included social isolation and demotion. The most frequent symptoms were exhaustion, sleep, mood and sexual disorders. The number of symptoms was not related to the duration of mobbing but to the number and frequency of negative actions. 61.1% of the subjects took psychotropic drugs. Occupational health physicians play an essential role in primary prevention (information on occupational risks) and in early diagnosis and rehabilitation and could act as mediators between workers and enterprises.

Identification and Characterization of the Iridoid Synthase Involved in Oleuropein Biosynthesis in Olive (Olea europaea) Fruits*

Science.gov (United States)

Kries, Hajo; Panara, Francesco; Baldoni, Luciana; O'Connor, Sarah E.; Osbourn, Anne

2016-01-01

The secoiridoids are the main class of specialized metabolites present in olive (Olea europaea L.) fruit. In particular, the secoiridoid oleuropein strongly influences olive oil quality because of its bitterness, which is a desirable trait. In addition, oleuropein possesses a wide range of pharmacological properties, including antioxidant, anti-inflammatory, and anti-cancer activities. In accordance, obtaining high oleuropein varieties is a main goal of molecular breeding programs. Here we use a transcriptomic approach to identify candidate genes belonging to the secoiridoid pathway in olive. From these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive fruits. OeISY, the first pathway gene characterized for this type of secoiridoid, is a potential target for breeding programs in a high value secoiridoid-accumulating species. PMID:26709230

Antioxidant activity and chemical components as potential anticancer agents in the olive leaf (Olea europaea L. cv Leccino.) decoction.

Science.gov (United States)

De Marino, Simona; Festa, Carmen; Zollo, Franco; Nini, Antonella; Antenucci, Lina; Raimo, Gennaro; Iorizzi, Maria

2014-01-01

Epidemiological studies have shown that a reduced risk of chronic diseases such as cancer and cardiovascular diseases is correlated with a regular consumption of fruits and vegetable, many of which are rich in polyphenols. The additive and synergistic effect of phytochemicals in fruits and vegetables may reduce chronic diseases related to oxidative stress in human body. Olea europaea L. leaf are rich in phenolic components, which have been proposed to play a role in cancer prevention. The purpose of this study was to identify the main components in the Olea europaea L. leaf (cv. Leccino) preserved during the decoction preparation, in order to delineate the antioxidant activities of the crude extracts and its isolated compounds by using different in vitro assays including DPPH radicalscavenging capacity, total antioxidant capacity (TAC), xanthine oxidase (XO) inhibitory effect and the ability to delay the linoleic acid peroxidation process (ALP). The aqueous decoction was partitioned obtaining four extracts and the n-butanol extract showed the highest antioxidant activity and the highest total phenolic content. Phytochemical investigation leads to the isolation of thirteen secondary metabolites including simple phenolics, flavonoids, secoiridoids whose structures were elucidated by spectroscopic data (1D and 2D NMR) and spectrometric techniques. A significant free radical scavenging effect against DPPH has been evidenced in fraxamoside (1) (EC50 62.6 µM) and taxifolin (5) (EC50 50.0 µM), isolated for the first time from the water decoction. The most active compound in the TAC evaluation, was the 3,4 dihydro-phenyl glycol (8) (0.90 caffeic acid equiv.) while taxifolin and fraxamoside resulted as the most efficient inhibitors of XO activity (IC50 2.7 and 5.2 µM, respectively). Secoxyloganin (4), oleuropein (2) and tyrosol (6) showed the highest ALP activity. This study adds to the growing body of data supporting the bioactivities of phytochemicals and their

The first cytogenetic description of Euleptes europaea (Gené, 1839 from Northern Sardinia reveals the highest diploid chromosome number among sphaerodactylid geckos (Sphaerodactylidae, Squamata

Directory of Open Access Journals (Sweden)

Ekaterina Gornung

2013-06-01

Full Text Available The karyotype of a sphaerodactylid gecko Euleptes europaea (Gené, 1839 was assembled for the first time in this species. It is made of 2n = 42 gradually decreasing in size chromosomes, the highest chromosome number so far acknowledged in the family Sphaerodactylidae. The second chromosome pair of the karyotype appears slightly heteromorphic in the male individual. Accordingly, FISH with a telomeric probe revealed an uneven distribution of telomeric repeats on the two homologues of this pair, which may be indicative of an XY sex-determination system in the species, to be further investigated.

Soil fluoride spiking effects on olive trees (Olea europaea L. cv. Chemlali).

Science.gov (United States)

Zouari, M; Ben Ahmed, C; Fourati, R; Delmail, D; Ben Rouina, B; Labrousse, P; Ben Abdallah, F

2014-10-01

A pot experiment under open air conditions was carried out to investigate the uptake, accumulation and toxicity effects of fluoride in olive trees (Olea europaea L.) grown in a soil spiked with inorganic sodium fluoride (NaF). Six different levels (0, 20, 40, 60, 80 and 100mM NaF) of soil spiking were applied through NaF to irrigation water. At the end of the experiment, total fluoride content in soil was 20 and 1770mgFkg(-1) soil in control and 100mM NaF treatments, respectively. The comparative distribution of fluoride partitioning among the different olive tree parts showed that the roots accumulated the most fluoride and olive fruits were minimally affected by soil NaF spiking as they had the lowest fluoride content. In fact, total fluoride concentration varied between 12 and 1070µgFg(-1) in roots, between 9 and 570µgFg(-1) in shoots, between 12 and 290µgFg(-1) in leaves, and between 10 and 29µgFg(-1) in fruits, respectively for control and 100mM NaF treatments. Indeed, the fluoride accumulation pattern showed the following distribution: roots>shoots>leaves>fruits. On the other hand, fluoride toxicity symptoms such as leaf necrosis and leaf drop appeared only in highly spiked soils (60, 80 and 100mM NaF). Copyright © 2014 Elsevier Inc. All rights reserved.

Assessment of Olea europaea L. fruit extracts: Phytochemical characterization and anticancer pathway investigation.

Science.gov (United States)

Maalej, Amina; Bouallagui, Zouhaier; Hadrich, Fatma; Isoda, Hiroko; Sayadi, Sami

2017-06-01

Olea europaea L. has been widely used as an advantageous rich source of bioactive compounds of high economic value leading to its use in pharmaceutical, cosmetic, and agriculture industries. Ethanolic extracts of olive fruits from three different cultivars (OFE) were studied for their phytochemical contents and were investigated for antioxidant activities and anticancer potential. Major polyphenols detected in these extracts were tyrosol, hydroxytyrosol, oleuropein, rutin, quercetin and glucoside forms of luteolin and apigenin. All these compounds have shown to significantly contribute to the antioxidant activity of OFE, which was evaluated by DPPH and ABTS assays. Proliferation of hepatic and colon cancer cells, HepG2 and Caco-2, were shown to be sensitive to OFE with IC 50 less than 1.6mg/ml for all tested extracts. Moreover, flow cytometry analysis showed that OFE induced cell cycle arrest in the S-phase within both HepG2 and Caco-2 cells. This has triggered a cell death mechanism as shown by DNA fragmentation, expression of p53 and phosphorylation level of Akt and Erk proteins. Interestingly, these extracts could be further used as a potential source of natural compounds with both antioxidant and anticancer effects. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Selective ultrasound-enhanced enzymatic hydrolysis of oleuropein to its aglycon in olive (Olea europaea L.) leaf extracts.

Science.gov (United States)

Delgado-Povedano, María Del Mar; Priego-Capote, Feliciano; Luque de Castro, María Dolores

2017-04-01

Hydrolysis of oleuropein, the main phenol in olive (Olea europaea L.) leaf extracts, to oleuropein aglycon and other subsequent products in the hydrolytic pathway can be catalyzed by different enzymes. Three of the most used hydrolases were assayed to catalyze the process, and β-glucosidase from Aspergillus niger was selected. Acceleration of the enzymatic hydrolysis by ultrasound (US) was studied using a Box-Behnken design (duty cycle, amplitude, cycle time) and an oleuropein standard, and the optimum US conditions for achieving maximum yield of oleuropein aglycon were 0.5s/s duty cycle, 50% amplitude and 45s cycle. The method was applied to obtain oleuropein aglycon from commercial and laboratory extracts from olive leaves, which may have a pharmacological use as deduced by its healthy properties. The kinetics of the US-assisted enzymatic hydrolysis was monitored by analysis of the target compounds using liquid chromatography-tandem mass spectrometry. Copyright © 2016 Elsevier Ltd. All rights reserved.

Identification and Characterization of the Iridoid Synthase Involved in Oleuropein Biosynthesis in Olive (Olea europaea) Fruits.

Science.gov (United States)

Alagna, Fiammetta; Geu-Flores, Fernando; Kries, Hajo; Panara, Francesco; Baldoni, Luciana; O'Connor, Sarah E; Osbourn, Anne

2016-03-11

The secoiridoids are the main class of specialized metabolites present in olive (Olea europaea L.) fruit. In particular, the secoiridoid oleuropein strongly influences olive oil quality because of its bitterness, which is a desirable trait. In addition, oleuropein possesses a wide range of pharmacological properties, including antioxidant, anti-inflammatory, and anti-cancer activities. In accordance, obtaining high oleuropein varieties is a main goal of molecular breeding programs. Here we use a transcriptomic approach to identify candidate genes belonging to the secoiridoid pathway in olive. From these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive fruits. OeISY, the first pathway gene characterized for this type of secoiridoid, is a potential target for breeding programs in a high value secoiridoid-accumulating species. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

Transformación genética de olivo (Olea europaea L.) con un gen de Medicago truncatula que codifica para un proteína tipo FT

OpenAIRE

Cerezo Medina, Sergio; Barceló-Muñoz, Araceli; Samach, Alon; Mercado Carmona, José A.; Pliego Alfaro, Fernando

2013-01-01

En el olivo (Olea europaea L.), la modificación de la arquitectura de la planta y la reducción del periodo juvenil son caracteres de interés en la mejora. Las proteínas codificadas por genes tipo FT (FLOWERING LOCUS T), además de actuar como componente principal de la señal sistémica inductora de floración conocida como florígeno, participan en la regulación de otros procesos del desarrollo en plantas, entre ellos, la determinación de la arquitectura o la dormancia. El objetivo de este trabaj...

Efecto vasodilatador e inhibidor de vasoconstricción del extracto hidroalcohólico de hojas de Olea europaea (olivo sobre anillos aórticos de ratas

Directory of Open Access Journals (Sweden)

Job Nexar-QH

2013-10-01

Full Text Available Objetivos: Evaluar el efecto vasodilatador, la inhibición de la vasoconstricción, así como el mecanismo responsable, del extracto hidroalcohólico de hojas de Olea europaea (olivo, sobre anillos aórticos en ratas. Diseño: Experimental. Lugar: Centro de Investigación y Desarrollo Científico, Facultad de Medicina, Universidad Nacional de San Agustín, Arequipa, Perú. Material biológico: Hojas de Olea europea y anillos aórticos de Rattus norvegicus, variedad albina swiss. Intervenciones: Se obtuvo un extracto hidroalcohólico de las hojas de Olea europaea. Se usó anillos aórticos de rata en cámara de órganos aislados y se registró la actividad vasomotora con un transductor de tensión isométrica. Se produjo contracción basal máxima con CaCl2 6 mM y se determinó el efecto vasodilatador con dosis de 25, 50 y 100 mg/mL de extracto hidroalcohólico de las hojas de Olea europaea. Se usó 1H-[1,2,4] oxadiazolo [4,3 alquinoxalin-1-one] (ODQ y nifedipino para determinar el mecanismo de acción. Se comparó la inhibición de la vasoconstricción tras la incubación durante 30 minutos con extracto 100 mg/mL y con captopril 10 µM. Principales medidas de resultados: Porcentaje de vasodilatación y de vasoconstricción. Resultados: Se obtuvo una vasodilatación de 7,20 ± 1,49%, 9,84 ± 1,42% y 12,31 ± 1,16% para las dosis de 25, 50 y 100 mg/mL, respectivamente, siendo significativa con la dosis de 100 mg/mL. La vasodilatación se incrementó tras la administración de ODQ 100 mM. La vasodilatación se inhibió tras la incubación con ODQ 100 mM más nifedipino 5 µM. No se encontró diferencia significativa entre la inhibición de la vasoconstricción con captopril 10µM y extracto a 100 mg/mL. Conclusiones: El extracto hidroalcohólico de hojas de Olea europea, a una dosis de 100 mg/mL, tiene efecto vasodilatador sobre anillos aórticos de ratas, mediado por el bloqueo de canales de calcio; además, posee efecto inhibidor de la

Salicornia europaea L. Na⁺/H⁺ antiporter gene improves salt tolerance in transgenic alfalfa (Medicago sativa L.).

Science.gov (United States)

Zhang, L Q; Niu, Y D; Huridu, H; Hao, J F; Qi, Z; Hasi, A

2014-07-24

In order to obtain a salt-tolerant perennial alfalfa (Medicago sativa L.), we transferred the halophyte Salicornia europaea L. Na(+)/H(+) antiporter gene, SeNHX1, to alfalfa by using the Agrobacterium-mediated transformation method. The transformants were confirmed by both PCR and RT-PCR analyses. Of 197 plants that were obtained after transformation, 36 were positive by PCR analysis using 2 primer pairs for the CaMV35S-SeNHX1 and SeNHX1-Nos fragments; 6 plants survived in a greenhouse. RT-PCR analysis revealed that SeNHX1 was expressed in 5 plants. The resultant transgenic alfalfa had better salt tolerance. After stress treatment for 21 days with 0.6% NaCl, the chlorophyll and MDA contents in transgenic plants were lower, but proline content and SOD, POD, and CAT activities were higher than those in wild-type plants. These results suggest that the salt tolerance of transgenic alfalfa was improved by the overexpression of the SeNHX1 gene.

Virtual-reality-based attention assessment of ADHD: ClinicaVR: Classroom-CPT versus a traditional continuous performance test.

Science.gov (United States)

Neguț, Alexandra; Jurma, Anda Maria; David, Daniel

2017-08-01

Virtual-reality-based assessment may be a good alternative to classical or computerized neuropsychological assessment due to increased ecological validity. ClinicaVR: Classroom-CPT (VC) is a neuropsychological test embedded in virtual reality that is designed to assess attention deficits in children with attention deficit hyperactivity disorder (ADHD) or other conditions associated with impaired attention. The present study aimed to (1) investigate the diagnostic validity of VC in comparison to a traditional continuous performance test (CPT), (2) explore the task difficulty of VC, (3) address the effect of distractors on the performance of ADHD participants and typically-developing (TD) controls, and (4) compare the two measures on cognitive absorption. A total of 33 children diagnosed with ADHD and 42 TD children, aged between 7 and 13 years, participated in the study and were tested with a traditional CPT or with VC, along with several cognitive measures and an adapted version of the Cognitive Absorption Scale. A mixed multivariate analysis of covariance (MANCOVA) revealed that the children with ADHD performed worse on correct responses had more commissions and omissions errors than the TD children, as well as slower target reaction times . The results showed significant differences between performance in the virtual environment and the traditional computerized one, with longer reaction times in virtual reality. The data analysis highlighted the negative influence of auditory distractors on attention performance in the case of the children with ADHD, but not for the TD children. Finally, the two measures did not differ on the cognitive absorption perceived by the children.

Olive tree (Olea europaea L.) leaf as a waste by-product of table olive and olive oil industry: a review.

Science.gov (United States)

Şahin, Selin; Bilgin, Mehmet

2018-03-01

Research into finding new uses for by-products of table olive and olive oil industry are of great value not only to the economy but also to the environment where olives are grown and to the human health. Since leaves represent around 10% of the total weight of olives arriving at the mill, it is worth obtaining high added-value compounds from those materials for the preparation of dietary supplements, nutraceuticals, functional food ingredients or cosmeceuticals. In this review article, olive tree (Olea europaea L.) leaf is reviewed as being a potential inexpensive, renewable and abundant source of biophenols. The importance of this agricultural and industrial waste is emphasised by means of describing its availability, nutritional and therapeutic effects and studies conducted on this field. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Olea europaea leaf extract and bevacizumab synergistically exhibit beneficial efficacy upon human glioblastoma cancer stem cells through reducing angiogenesis and invasion in vitro.

Science.gov (United States)

Tezcan, Gulcin; Taskapilioglu, Mevlut Ozgur; Tunca, Berrin; Bekar, Ahmet; Demirci, Hilal; Kocaeli, Hasan; Aksoy, Secil Ak; Egeli, Unal; Cecener, Gulsah; Tolunay, Sahsine

2017-06-01

Patients with glioblastoma multiforme (GBM) that are cancer stem-cell-positive (GSC [+]) essentially cannot benefit from anti-angiogenic or anti-invasive therapy. In the present study, the potential anti-angiogenic and anti-invasive effects of Olea europaea (olive) leaf extract (OLE) were tested using GSC (+) tumours. OLE (2mg/mL) caused a significant reduction in tumour weight, vascularisation, invasiveness and migration (p=0.0001, p<0.001, p=0.004; respectively) that was associated with reducing the expression of VEGFA, MMP-2 and MMP-9. This effect was synergistically increased in combination with bevacizumab. Therefore, our current findings may contribute to research on drugs that inhibit the invasiveness of GBM. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

The peculiar landscape of repetitive sequences in the olive (Olea europaea L.) genome.

Science.gov (United States)

Barghini, Elena; Natali, Lucia; Cossu, Rosa Maria; Giordani, Tommaso; Pindo, Massimo; Cattonaro, Federica; Scalabrin, Simone; Velasco, Riccardo; Morgante, Michele; Cavallini, Andrea

2014-04-01

Analyzing genome structure in different species allows to gain an insight into the evolution of plant genome size. Olive (Olea europaea L.) has a medium-sized haploid genome of 1.4 Gb, whose structure is largely uncharacterized, despite the growing importance of this tree as oil crop. Next-generation sequencing technologies and different computational procedures have been used to study the composition of the olive genome and its repetitive fraction. A total of 2.03 and 2.3 genome equivalents of Illumina and 454 reads from genomic DNA, respectively, were assembled following different procedures, which produced more than 200,000 differently redundant contigs, with mean length higher than 1,000 nt. Mapping Illumina reads onto the assembled sequences was used to estimate their redundancy. The genome data set was subdivided into highly and medium redundant and nonredundant contigs. By combining identification and mapping of repeated sequences, it was established that tandem repeats represent a very large portion of the olive genome (∼31% of the whole genome), consisting of six main families of different length, two of which were first discovered in these experiments. The other large redundant class in the olive genome is represented by transposable elements (especially long terminal repeat-retrotransposons). On the whole, the results of our analyses show the peculiar landscape of the olive genome, related to the massive amplification of tandem repeats, more than that reported for any other sequenced plant genome.

Characterisation of chlorophyll oxidation mediated by peroxidative activity in olives (Olea europaea L.) cv. Hojiblanca.

Science.gov (United States)

Vergara-Domínguez, Honorio; Roca, María; Gandul-Rojas, Beatriz

2013-08-15

The oxidation of chlorophyll a (chl a) catalysed by peroxidase (POD) from mesocarp of the olive fruit (Olea europaea L., cv Hojiblanca) in the presence of H2O2 and 2,4-dichlorophenol (2,4-DCP), is characterised via the individualised quantification of the products of the enzymatic reaction using a new methodology of HPLC-UV spectrometry. This innovation has allowed the discovery that, in addition to 13(2) OH chl a and 15(1) OH lactone chl a, which are the first products of POD on chl a, the reaction process sequentially creates another series of oxidised chlorophyll derivatives which have not been previously described. Their origins have been linked to POD activity in the presence of 2,4-DCP. Likewise, a study of the effect of the concentration of the various cosubstrates on the POD reaction rate demonstrated that the correct establishment of the relative concentrations of the same ([H2O2]/[2,4-DCP]/[Chl]=1:3:0.02) is crucial to explaining inhibition effects by substrates and carrying out optimum measurements. Therefore, new essential parameters for the determination of POD activity on a chlorophyll substrate are established. Copyright © 2013 Elsevier Ltd. All rights reserved.

Effect of cognitive stimulation in patients with mild congenital deterioration, in the reduction of progression to dementia, in the Clinica de la Memoria, Hospital Nacional de Geriatria y Gerontologia, during the period from September 2008 to September 2013

International Nuclear Information System (INIS)

Giangiulio Lobo, Andrea

2014-01-01

The efficacy of cognitive stimulation in the progression to dementia is verified in patients with mild cognitive impairment, from the Clinica de Memoria of the Hospital Nacional de Geriatria y Gerontologia, between September 2008 and September 2013. A sample of 190 patients of the Metropolitan Area, the majority of female, complete primary, with self-care, aged 70 to 79 years are selected. The investigated group has had a history of hypertension, diabetes mellitus to a lesser extent and some degree of associated sensory deficit. The evolution time of memory loss presented is 2.6 years at the time of the medical evaluation. The most common cognitive impairment in the study has been the multiple dominion amnesia, followed by the non-amnesic dominion multiple. The etiology has leaded the degenerative, followed by vascular and thirdly the deficit of vitamin B12. Patients with mild cognitive impairment almost half of the cases have had neuro-behavioral disorder, being the depression most frequent, followed by anxiety and apathy. Patients have been partial independent in ABVD and dependent on AIVD. Absenteeism to dating has existed both in Clinica de Memoria; but mainly to the appointment with psychology. During the study it is determined that the deterioration was developed without progress to dementia, relatives have reported cognitive stability in more than half of the cases, only 18 patients have progressed to dementia. In the process only 29 patients have concluded and were reevaluated; without being able to demonstrate that the cognitive stimulation delays the cognitive deterioration to the dementia, but nevertheless; this result is given without unduly discrediting cognitive stimulation as a non-pharmacological measure for the prevention and delaying of dementia. (author) [es

In vitro propagation of olive (Olea europaea L.) by nodal segmentation of elongated shoots.

Science.gov (United States)

Lambardi, Maurizio; Ozudogru, Elif Aylin; Roncasaglia, Romano

2013-01-01

Olive (Olea europaea L.), long-living, ever-green fruit tree of the Old World, has been part of a traditional landscape in the Mediterranean area for centuries. Both the fruits consumed after processing and the oil extracted from the fruits are among the main components of the Mediterranean diet, widely used for salads and cooking, as well as for preserving other food. Documentations show that the ancient use of this beautiful tree also includes lamp fuel production, wool treatment, soap production, medicine, and cosmetics. However, unlike the majority of the fruit species, olive propagation is still a laborious practice. As regards traditional propagation, rooting of cuttings and grafting stem segments onto rootstocks are possible, former being achieved only when the cuttings are collected in specific periods (spring or beginning of autumn), and latter only when skilled grafters are available. In both the cases, performance of the cultivars varies considerably. The regeneration of whole plants from ovules, on the other hand, is used only occasionally. Micropropagation of olive is not easy mainly due to explant oxidation, difficulties in explant disinfection, and labor-oriented establishment of in vitro shoot cultures. However today, the progress in micropropagation technology has made available the complete protocols for several Mediterranean cultivars. This chapter describes a micropropagation protocol based on the segmentation of nodal segments obtained from elongated shoots.

Genetic improvement of olive (Olea europaea L.) by conventional and in vitro biotechnology methods.

Science.gov (United States)

Rugini, E; Cristofori, V; Silvestri, C

2016-01-01

In olive (Olea europaea L.) traditional methods of genetic improvement have up to now produced limited results. Intensification of olive growing requires appropriate new cultivars for fully mechanized groves, but among the large number of the traditional varieties very few are suitable. High-density and super high-density hedge row orchards require genotypes with reduced size, reduced apical dominance, a semi-erect growth habit, easy to propagate, resistant to abiotic and biotic stresses, with reliably high productivity and quality of both fruits and oil. Innovative strategies supported by molecular and biotechnological techniques are required to speed up novel hybridisation methods. Among traditional approaches the Gene Pool Method seems a reasonable option, but it requires availability of widely diverse germplasm from both cultivated and wild genotypes, supported by a detailed knowledge of their genetic relationships. The practice of "gene therapy" for the most important existing cultivars, combined with conventional methods, could accelerate achievement of the main goals, but efforts to overcome some technical and ideological obstacles are needed. The present review describes the benefits that olive and its products may obtain from genetic improvement using state of the art of conventional and unconventional methods, and includes progress made in the field of in vitro techniques. The uses of both traditional and modern technologies are discussed with recommendations. Copyright © 2016 Elsevier Inc. All rights reserved.

[The scientific progress of the "Clinica del Lavoro Luigi Devoto" as seen through the contents of the journal "La Medicina del Lavoro". ].

Science.gov (United States)

Foà, V; Camerino, Donatella

2003-01-01

On occasion of the Centenary of the "Clinica del Lavoro Luigi Devoto", its researchers suggested that awareness of its historical identity and scientific development should constitute the basis for the future of the Institution. The directors of the Institute who have succeeded one to the other over the years have left a vivid report of the vast amount of work developed in several research fields and also of the original results achieved with significant impact on the scientific community and on society. Content analysis of "La Medicina del Lavoro" allowed us to shed light on strong bonds existing between manufacturing techniques, work organization and health, in the different political and social periods in which they developed. Many actions have been defined and several research subjects have been renewed (according to current demands and new methodological possibilities) between the past and the present, nevertheless many new approaches need to be taken in the fields of epidemiology, indoor air quality, ergophthalmology, muskuloskeletal disorders, environmental and molecular toxicology, and further research will be undertaken thanks to the potential of this discipline for the future. The aim of this report is also to express our thanks to all the medical and non-medical staff who have made their contribution over 100 years of engagement.

The expression of light-related leaf functional traits depends on the location of individual leaves within the crown of isolated Olea europaea trees.

Science.gov (United States)

Escribano-Rocafort, Adrián G; Ventre-Lespiaucq, Agustina B; Granado-Yela, Carlos; Rubio de Casas, Rafael; Delgado, Juan A; Balaguer, Luis

2016-04-01

The spatial arrangement and expression of foliar syndromes within tree crowns can reflect the coupling between crown form and function in a given environment. Isolated trees subjected to high irradiance and concomitant stress may adjust leaf phenotypes to cope with environmental gradients that are heterogeneous in space and time within the tree crown. The distinct expression of leaf phenotypes among crown positions could lead to complementary patterns in light interception at the crown scale. We quantified eight light-related leaf traits across 12 crown positions of ten isolated Olea europaea trees in the field. Specifically, we investigated whether the phenotypic expression of foliar traits differed among crown sectors and layers and five periods of the day from sunrise to sunset. We investigated the consequences in terms of the exposed area of the leaves at the tree scale during a single day. All traits differed among crown positions except the length-to-width ratio of the leaves. We found a strong complementarity in the patterns of the potential exposed area of the leaves among day periods as a result of a non-random distribution of leaf angles across the crown. Leaf exposure at the outer layer was below 60 % of the displayed surface, reaching maximum interception during morning periods. Daily interception increased towards the inner layer, achieving consecutive maximization from east to west positions within the crown, matching the sun's trajectory. The expression of leaf traits within isolated trees of O. europaea varies continuously through the crown in a gradient of leaf morphotypes and leaf angles depending on the exposure and location of individual leaves. The distribution of light-related traits within the crown and the complementarity in the potential exposure patterns of the leaves during the day challenges the assumption of low trait variability within individuals. © The Author 2016. Published by Oxford University Press on behalf of the Annals of

Short communication: Promotion of glucagon-like peptide-2 secretion in dairy calves with a bioactive extract from Olea europaea.

Science.gov (United States)

Morrison, S Y; Pastor, J J; Quintela, J C; Holst, J J; Hartmann, B; Drackley, J K; Ipharraguerre, I R

2017-03-01

Diarrhea episodes in dairy calves involve profound alterations in the mechanism controlling gut barrier function that ultimately compromise intestinal permeability to macromolecules, including pathogenic bacteria. Intestinal dysfunction models suggest that a key element of intestinal adaptation during the neonatal phase is the nutrient-induced secretion of glucagon-like peptide (GLP)-2 and associated effects on mucosal cell proliferation, barrier function, and inflammatory response. Bioactive molecules found in Olea europaea have been shown to induce the release of regulatory peptides from model enteroendocrine cells. The ability to enhance GLP-2 secretion via the feeding of putative GLP-2 secretagogues is untested in newborn calves. The objectives of this study were to determine whether feeding a bioactive extract from Olea europaea (OBE) mixed in the milk replacer (1) can stimulate GLP-2 secretion beyond the response elicited by enteral nutrients and, thereby, (2) improve intestinal permeability and animal growth as well as (3) reduce the incidence of diarrhea in preweaning dairy calves. Holstein heifer calves (n = 60) were purchased, transported to the research facility, and blocked by body weight and total serum protein and assigned to 1 of 3 treatments. Treatments were control (CON), standard milk replacer (MR) and ad libitum starter; CON plus OBE added into MR at 30 mg/kg of body weight (OBE30); and CON plus OBE added into MR at 60 mg/kg of body weight (OBE60). The concentration of GLP-2 was measured at the end of wk 2. Intestinal permeability was measured at the onset of the study and the end of wk 2 and 6, with lactulose and d-mannitol as markers. Treatments did not affect calf growth and starter intake. Compared with CON, administration of OBE60 increased the nutrient-induced response in GLP-2 by about 1 fold and reduced MR intake during the second week of study. Throughout the study, however, all calves had compromised intestinal permeability and a high

A sensitive liquid chromatography-mass spectrometry method for the simultaneous determination in plasma of pentacyclic triterpenes of Olea europaea L.

Science.gov (United States)

Giménez, Estela; Juan, M Emília; Calvo-Melià, Sara; Planas, Joana M

2017-08-15

Table olives are especially rich in pentacyclic triterpenic compounds, which exert several biological activities. A crucial step in order to know if these compounds could contribute to the beneficial and healthy properties of this food is their measurement in blood. Therefore, the present study describes a simple and accurate liquid-liquid extraction followed by LC-QqQ-MS analysis for the simultaneous determination of the main pentacyclic triterpenes from Olea europaea L. in rat plasma. The method was validated by the analysis of blank plasma samples spiked with pure compounds, obtaining a linear correlation, adequate sensitivity with a limit of quantification ranging from 1nM for maslinic acid to 10nM for uvaol. Precision and accuracy were lower than 10% in all cases and recoveries were between 95 and 104%. The oral administration of olives to rats and its determination in plasma verified that the established methodology is appropriate for bioavailability studies. Copyright © 2017 Elsevier Ltd. All rights reserved.

Sustainability, Innovation, and Green Chemistry in the Production and Valorization of Phenolic Extracts from Olea europaea L.

Directory of Open Access Journals (Sweden)

Annalisa Romani

2016-10-01

Full Text Available This paper describes a circular economy process based on environmentally and economically sustainable procedures which was applied to the sector of olive oil processing on an industrial scale. Olea europaea L. tissues and by-products represent a renewable and low-cost source of polyphenols, in particular hydroxytyrosol (HTyr, a naturally occurring compound well known for its biological properties. Specifically, green leaves (GL, dried leaves (DL, and pitted olive pulp were treated with water in a pneumatic extractor to obtain the corresponding polyphenolic extracts. Three standardized fractions, named Soft Extract Olea GL, Soft Extract Olea DL, and Soft Extract Olea HTyr resulted after the following two steps: a separation process carried out by membrane technology, and a concentration step performed under reduced pressure and low temperature. The polyphenolic fractions showed antiradical activity and have potential industrial applications in the food, nutraceutical, pharmaceutical, feed, and agronomic fields. Novel functionalized extracts containing hydroxytyrosol methyl carbonate (HTyr-MC were obtained from Soft Extract Olea HTyr through an innovative approach based on green chemistry procedures, which appear to be a promising tool to increase the applications of the polyphenolic extracts.

High-throughput sequencing of RNA silencing-associated small RNAs in olive (Olea europaea L..

Directory of Open Access Journals (Sweden)

Livia Donaire

Full Text Available Small RNAs (sRNAs of 20 to 25 nucleotides (nt in length maintain genome integrity and control gene expression in a multitude of developmental and physiological processes. Despite RNA silencing has been primarily studied in model plants, the advent of high-throughput sequencing technologies has enabled profiling of the sRNA component of more than 40 plant species. Here, we used deep sequencing and molecular methods to report the first inventory of sRNAs in olive (Olea europaea L.. sRNA libraries prepared from juvenile and adult shoots revealed that the 24-nt class dominates the sRNA transcriptome and atypically accumulates to levels never seen in other plant species, suggesting an active role of heterochromatin silencing in the maintenance and integrity of its large genome. A total of 18 known miRNA families were identified in the libraries. Also, 5 other sRNAs derived from potential hairpin-like precursors remain as plausible miRNA candidates. RNA blots confirmed miRNA expression and suggested tissue- and/or developmental-specific expression patterns. Target mRNAs of conserved miRNAs were computationally predicted among the olive cDNA collection and experimentally validated through endonucleolytic cleavage assays. Finally, we use expression data to uncover genetic components of the miR156, miR172 and miR390/TAS3-derived trans-acting small interfering RNA (tasiRNA regulatory nodes, suggesting that these interactive networks controlling developmental transitions are fully operational in olive.

Metabarcoding Analysis of Fungal Diversity in the Phyllosphere and Carposphere of Olive (Olea europaea).

Science.gov (United States)

Abdelfattah, Ahmed; Li Destri Nicosia, Maria Giulia; Cacciola, Santa Olga; Droby, Samir; Schena, Leonardo

2015-01-01

The fungal diversity associated with leaves, flowers and fruits of olive (Olea europaea) was investigated in different phenological stages (May, June, October and December) using an implemented metabarcoding approach. It consisted of the 454 pyrosequencing of the fungal ITS2 region and the subsequent phylogenetic analysis of relevant genera along with validated reference sequences. Most sequences were identified up to the species level or were associated with a restricted number of related taxa enabling supported speculations regarding their biological role. Analyses revealed a rich fungal community with 195 different OTUs. Ascomycota was the dominating phyla representing 93.6% of the total number of detected sequences followed by unidentified fungi (3.6%) and Basidiomycota (2.8%). A higher level of diversity was revealed for leaves compared to flowers and fruits. Among plant pathogens the genus Colletotrichum represented by three species (C. godetiae syn. C. clavatum, C. acutatum s.s and C. karstii) was the most abundant on ripe fruits but it was also detected in other organs. Pseudocercospora cladosporioides was detected with a high frequency in all leaf samples and to a less extent in ripe fruits. A much lower relative frequency was revealed for Spilocaea oleagina and for other putative pathogens including Fusarium spp., Neofusicoccum spp., and Alternaria spp. Among non-pathogen taxa, Aureobasidium pullulans, the species complex of Cladosporium cladosporioides and Devriesia spp. were the most represented. This study highlights the existence of a complex fungal consortium including both phytopathogenic and potentially antagonistic microorganisms that can have a significant impact on olive productions.

Valuable Nutrients and Functional Bioactives in Different Parts of Olive (Olea europaea L.)—A Review

Science.gov (United States)

Ghanbari, Rahele; Anwar, Farooq; Alkharfy, Khalid M.; Gilani, Anwarul-Hassan; Saari, Nazamid

2012-01-01

The Olive tree (Olea europaea L.), a native of the Mediterranean basin and parts of Asia, is now widely cultivated in many other parts of the world for production of olive oil and table olives. Olive is a rich source of valuable nutrients and bioactives of medicinal and therapeutic interest. Olive fruit contains appreciable concentration, 1–3% of fresh pulp weight, of hydrophilic (phenolic acids, phenolic alchohols, flavonoids and secoiridoids) and lipophilic (cresols) phenolic compounds that are known to possess multiple biological activities such as antioxidant, anticarcinogenic, antiinflammatory, antimicrobial, antihypertensive, antidyslipidemic, cardiotonic, laxative, and antiplatelet. Other important compounds present in olive fruit are pectin, organic acids, and pigments. Virgin olive oil (VOO), extracted mechanically from the fruit, is also very popular for its nutritive and health-promoting potential, especially against cardiovascular disorders due to the presence of high levels of monounsaturates and other valuable minor components such as phenolics, phytosterols, tocopherols, carotenoids, chlorophyll and squalene. The cultivar, area of production, harvest time, and the processing techniques employed are some of the factors shown to influence the composition of olive fruit and olive oil. This review focuses comprehensively on the nutrients and high-value bioactives profile as well as medicinal and functional aspects of different parts of olives and its byproducts. Various factors affecting the composition of this food commodity of medicinal value are also discussed. PMID:22489153

The influence of light, temperature and feeding on the growth of the Coras cladocora caespitosa and Balanophyllia europaea; L'influenza di luce, temperatura e alimentazione sulla crescita dei coralli mediterranei Cladocora caespitosa e Balanophyllia europaea. Risultati preliminari di una sperimentazione in ambiente controllato

Energy Technology Data Exchange (ETDEWEB)

Rodolfo-Metalpa, R.; Abbate, M.; Peirano, A. [ENEA, Divisione Ambiente Globale e Mediterraneo, Centro Ricerche S. Teresa, La Spezia (Italy)

2001-07-01

In the course of the environmental studies, carried out by ENEA-CRAM Center of S. Teresa near La Spezia, research has been performed about bioconstructional organisms in the Mediterranean Sea. To understand how these organisms respond to environmental parameters an experiment has been carried out in aquaria. Specimens of the Mediterranean coral Cladocora caespitosa and Balanophyllia europaea has been maintained in 80 independent aquaria for four months. Growth rates, pigments concentration and asexual reproduction of the corals were compared in experimental procedures with controlled conditions of light, temperature and food. Environmental parameters have been set out to simulate natural (winter and summer) ambient in the Ligurian Sea. Heterotrophic and autotrophic abilities of the corals have been compared. Results show different growth rates between the two species but similar heterotrophic growth patterns. Summer temperature largely influences growth rates and asexual reproduction of the species while light influence is small. [Italian] Nell'ambito delle ricerche svolte dall'ENEA sullo studio degli organismi biocostruttori nell'ambiente marino, e' stata svolta una sperimentazione al fine di valutare l'influenza di alcuni parametri ambientali (luce, temperatura e alimentazione), impostati in modo da simulare la naturale stagionalita' (inverno ed estate), sulla crescita e sulla riproduzione asessuale dei coralli mediterranei Cladocora caespitosa e Balanophyllia europaea. Queste sperimentazioni sono state condotte, per un periodo di circa quattro mesi, in ottanta acquari indipendenti caratterizzati da differenti livelli di luce, temperatura e alimentazione. Le valutazioni degli incrementi di peso e della crescita lineare sono state eseguite utilizzando differenti metodiche note in letteratura. Soprattutto la tecnica del Peso Galleggiante (Buoyant Weight) si e' dimostrata molto sensibile ed efficace. La capacita' (eterotrofia

De Novo Transcriptome Sequencing of Olea europaea L. to Identify Genes Involved in the Development of the Pollen Tube.

Science.gov (United States)

Iaria, Domenico; Chiappetta, Adriana; Muzzalupo, Innocenzo

2016-01-01

In olive (Olea europaea L.), the processes controlling self-incompatibility are still unclear and the molecular basis underlying this process are still not fully characterized. In order to determine compatibility relationships, using next-generation sequencing techniques and a de novo transcriptome assembly strategy, we show that pollen tubes from different olive plants, grown in vitro in a medium containing its own pistil and in combination pollen/pistil from self-sterile and self-fertile cultivars, have a distinct gene expression profile and many of the differentially expressed sequences between the samples fall within gene families involved in the development of the pollen tube, such as lipase, carboxylesterase, pectinesterase, pectin methylesterase, and callose synthase. Moreover, different genes involved in signal transduction, transcription, and growth are overrepresented. The analysis also allowed us to identify members in actin and actin depolymerization factor and fibrin gene family and member of the Ca(2+) binding gene family related to the development and polarization of pollen apical tip. The whole transcriptomic analysis, through the identification of the differentially expressed transcripts set and an extended functional annotation analysis, will lead to a better understanding of the mechanisms of pollen germination and pollen tube growth in the olive.

Profiling and functional classification of esterases in olive (Olea europaea) pollen during germination.

Science.gov (United States)

Rejón, Juan D; Zienkiewicz, Agnieszka; Rodríguez-García, María Isabel; Castro, Antonio J

2012-10-01

A pollen grain contains a number of esterases, many of which are released upon contact with the stigma surface. However, the identity and function of most of these esterases remain unknown. In this work, esterases from olive pollen during its germination were identifided and functionally characterized. The esterolytic capacity of olive (Olea europaea) pollen was examined using in vitro and in-gel enzymatic assays with different enzyme substrates. The functional analysis of pollen esterases was achieved by inhibition assays by using specific inhibitors. The cellular localization of esterase activities was performed using histochemical methods. Olive pollen showed high levels of non-specific esterase activity, which remained steady after hydration and germination. Up to 20 esterolytic bands were identified on polyacrylamide gels. All the inhibitors decreased pollen germinability, but only diisopropyl fluorophosphate (DIFP) hampered pollen tube growth. Non-specific esterase activity is localized on the surface of oil bodies (OBs) and small vesicles, in the pollen intine and in the callose layer of the pollen tube wall. Acetylcholinesterase (AChE) activity was mostly observed in the apertures, exine and pollen coat, and attached to the pollen tube wall surface and to small cytoplasmic vesicles. In this work, for the first time a systematic functional characterization of esterase enzymes in pollen from a plant species with wet stigma has been carried out. Olive pollen esterases belong to four different functional groups: carboxylesterases, acetylesterases, AChEs and lipases. The cellular localization of esterase activity indicates that the intine is a putative storage site for esterolytic enzymes in olive pollen. Based on inhibition assays and cellular localization of enzymatic activities, it can be concluded that these enzymes are likely to be involved in pollen germination, and pollen tube growth and penetration of the stigma.

The skeletal organic matrix from Mediterranean coral Balanophyllia europaea influences calcium carbonate precipitation.

Science.gov (United States)

Goffredo, Stefano; Vergni, Patrizia; Reggi, Michela; Caroselli, Erik; Sparla, Francesca; Levy, Oren; Dubinsky, Zvy; Falini, Giuseppe

2011-01-01

Scleractinian coral skeletons are made mainly of calcium carbonate in the form of aragonite. The mineral deposition occurs in a biological confined environment, but it is still a theme of discussion to what extent the calcification occurs under biological or environmental control. Hence, the shape, size and organization of skeletal crystals from the cellular level through the colony architecture, were attributed to factors as diverse as mineral supersaturation levels and organic mediation of crystal growth. The skeleton contains an intra-skeletal organic matrix (OM) of which only the water soluble component was chemically and physically characterized. In this work that OM from the skeleton of the Balanophyllia europaea, a solitary scleractinian coral endemic to the Mediterranean Sea, is studied in vitro with the aim of understanding its role in the mineralization of calcium carbonate. Mineralization of calcium carbonate was conducted by overgrowth experiments on coral skeleton and in calcium chloride solutions containing different ratios of water soluble and/or insoluble OM and of magnesium ions. The precipitates were characterized by diffractometric, spectroscopic and microscopic techniques. The results showed that both soluble and insoluble OM components influence calcium carbonate precipitation and that the effect is enhanced by their co-presence. The role of magnesium ions is also affected by the presence of the OM components. Thus, in vitro, OM influences calcium carbonate crystal morphology, aggregation and polymorphism as a function of its composition and of the content of magnesium ions in the precipitation media. This research, although does not resolve the controversy between environmental or biological control on the deposition of calcium carbonate in corals, sheds a light on the role of OM, which appears mediated by the presence of magnesium ions.

The Skeletal Organic Matrix from Mediterranean Coral Balanophyllia europaea Influences Calcium Carbonate Precipitation

Science.gov (United States)

Goffredo, Stefano; Vergni, Patrizia; Reggi, Michela; Caroselli, Erik; Sparla, Francesca; Levy, Oren; Dubinsky, Zvy; Falini, Giuseppe

2011-01-01

Scleractinian coral skeletons are made mainly of calcium carbonate in the form of aragonite. The mineral deposition occurs in a biological confined environment, but it is still a theme of discussion to what extent the calcification occurs under biological or environmental control. Hence, the shape, size and organization of skeletal crystals from the cellular level through the colony architecture, were attributed to factors as diverse as mineral supersaturation levels and organic mediation of crystal growth. The skeleton contains an intra-skeletal organic matrix (OM) of which only the water soluble component was chemically and physically characterized. In this work that OM from the skeleton of the Balanophyllia europaea, a solitary scleractinian coral endemic to the Mediterranean Sea, is studied in vitro with the aim of understanding its role in the mineralization of calcium carbonate. Mineralization of calcium carbonate was conducted by overgrowth experiments on coral skeleton and in calcium chloride solutions containing different ratios of water soluble and/or insoluble OM and of magnesium ions. The precipitates were characterized by diffractometric, spectroscopic and microscopic techniques. The results showed that both soluble and insoluble OM components influence calcium carbonate precipitation and that the effect is enhanced by their co-presence. The role of magnesium ions is also affected by the presence of the OM components. Thus, in vitro, OM influences calcium carbonate crystal morphology, aggregation and polymorphism as a function of its composition and of the content of magnesium ions in the precipitation media. This research, although does not resolve the controversy between environmental or biological control on the deposition of calcium carbonate in corals, sheds a light on the role of OM, which appears mediated by the presence of magnesium ions. PMID:21799830

Clinical manifestations of peripheral nervous system involvement in human chronic chagas disease Manifestaciones clinicas de compromiso del sistema nervioso periférico en el estádio crônico de la enfermedad de Chagas

Directory of Open Access Journals (Sweden)

Osvaldo Genovese

1996-06-01

Full Text Available We conducted a clinical and electromyographical study in patients with Chagas' disease in the indeterminate or chronic stages of the illness. Altogether 841 patients were examined. Only 511 were admitted within the protocol; the remainder patients were rejected because they showed other causes able to damage the nervous system. Fifty two (10.17% out of the 511 patients showed signs and symptoms of peripheral nervous system involvement in the form of sensory impairment and diminished tendon jerks suggesting the presence of neuropathy. Forty five of them were submitted to a conventional electromyographical examination. Fifteen of mem showed normal results, while the remainder 30 disclosed a reduced interference pattern, being most of the remaining motor unit potentials fragmented or poliphasic, reduced sensory and motor conduction velocities and diminished amplitude of the sensory action potential. The findings suggest that some chagasic patients in the indeterminate or chronic stages of the disease may develop a clinical mild sensory-motor peripheral neuropathy.El estúdio presente fue diseftado con ei objeto de pesquizar Ia existência de manifestaciones clinicas en pacientes afectados por enfermedad de Chagas, en estádio indeterminado o crônico, que tuviesen, ai menos, 2 reacciones serologicas positivas. En total fueron examinados 841 enfermos. De ellos solo 511 fueron admitidos en ei protocolo; los restantes fueron rechazados por mostrar Ia presencia de otras causas que hubiesen podido danar su sistema nervioso. Dentro de los 511 pacientes admitidos, 52 (10.17% evidenciaron alteraciones objetivas y subjetivas de Ia sensibilidad y disminucion de los reflejos osteotendinosos. Estos signos y sintomas, que sugieren la presencia de neuropatia, podian combinarse de diferente manera. Como complemento dei examen clinico, se efectuo estúdio electromiografico convencional en 45 de estos pacientes. En 15 los hallazgos fueron normales, en tanto que en

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004757 gi|30248965 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004757 gi|30250266 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004757 gi|30249984 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

Thermal stability of oils added with avocado (Persea americana cv. Hass) or olive (Olea europaea cv. Arbequina) leaf extracts during the French potatoes frying.

Science.gov (United States)

Jiménez, Paula; García, Paula; Bustamante, Andrés; Barriga, Andrés; Robert, Paz

2017-04-15

Effect of the addition of avocado (Persea americana cv. Hass) or olive (Olea europaea cv. Arbequina) hydroalcoholic leaf extracts (AHE and OHE, respectively) on thermal stability of canola oil (CO) and high oleic sunflower oil (HOSO) during French potatoes frying at 180°C was studied. The extracts were characterized by the total phenolic content, phenol chromatographic profiles and antioxidant activity. B-type trimer procyanidins were the major phenolic compounds identified in AHE. OHE showed higher phenol content, antioxidant activity regarding AHE. CO+OHE and HOSO+OHE decreased the formation of polar compounds and showed an anti-polymeric effect with respect to oils without extracts, whereas AHE extract showed a prooxidant effect on HOSO. Therefore, OHE showed an antioxidant effect on HOSO and CO under the studied conditions. In addition, all systems (CO+AHE, HOSO+AHE, CO+OHE and HOSO+OHE) increased the retention of tocopherols. These results demonstrate the potential utility of OHE as natural antioxidant for oils. Copyright © 2016 Elsevier Ltd. All rights reserved.

Expression and purification of recombinant proteins in Escherichia coli tagged with a small metal-binding protein from Nitrosomonas europaea.

Science.gov (United States)

Vargas-Cortez, Teresa; Morones-Ramirez, Jose Ruben; Balderas-Renteria, Isaias; Zarate, Xristo

2016-02-01

Escherichia coli is still the preferred organism for large-scale production of recombinant proteins. The use of fusion proteins has helped considerably in enhancing the solubility of heterologous proteins and their purification with affinity chromatography. Here, the use of a small metal-binding protein (SmbP) from Nitrosomonas europaea is described as a new fusion protein for protein expression and purification in E. coli. Fluorescent proteins tagged at the N-terminal with SmbP showed high levels of solubility, compared with those of maltose-binding protein and glutathione S-transferase, and low formation of inclusion bodies. Using commercially available IMAC resins charged with Ni(II), highly pure recombinant proteins were obtained after just one chromatography step. Proteins may be purified from the periplasm of E. coli if SmbP contains the signal sequence at the N-terminal. After removal of the SmbP tag from the protein of interest, high-yields are obtained since SmbP is a protein of just 9.9 kDa. The results here obtained suggest that SmbP is a good alternative as a fusion protein/affinity tag for the production of soluble recombinant proteins in E. coli. Copyright © 2015 Elsevier Inc. All rights reserved.

Freezing avoidance by supercooling in Olea europaea cultivars: the role of apoplastic water, solute content and cell wall rigidity.

Science.gov (United States)

Arias, Nadia S; Bucci, Sandra J; Scholz, Fabian G; Goldstein, Guillermo

2015-10-01

Plants can avoid freezing damage by preventing extracellular ice formation below the equilibrium freezing temperature (supercooling). We used Olea europaea cultivars to assess which traits contribute to avoid ice nucleation at sub-zero temperatures. Seasonal leaf water relations, non-structural carbohydrates, nitrogen and tissue damage and ice nucleation temperatures in different plant parts were determined in five cultivars growing in the Patagonian cold desert. Ice seeding in roots occurred at higher temperatures than in stems and leaves. Leaves of cold acclimated cultivars supercooled down to -13 °C, substantially lower than the minimum air temperatures observed in the study site. During winter, leaf ice nucleation and leaf freezing damage (LT50 ) occurred at similar temperatures, typical of plant tissues that supercool. Higher leaf density and cell wall rigidity were observed during winter, consistent with a substantial acclimation to sub-zero temperatures. Larger supercooling capacity and lower LT50 were observed in cold-acclimated cultivars with higher osmotically active solute content, higher tissue elastic adjustments and lower apoplastic water. Irreversible leaf damage was only observed in laboratory experiments at very low temperatures, but not in the field. A comparative analysis of closely related plants avoids phylogenetic independence bias in a comparative study of adaptations to survive low temperatures. © 2015 John Wiley & Sons Ltd.

Histochemical location of key enzyme activities involved in receptivity and self-incompatibility in the olive tree (Olea europaea L.).

Science.gov (United States)

Serrano, Irene; Olmedilla, Adela

2012-12-01

Stigma-surface and style enzymes are important for pollen reception, selection and germination. This report deals with the histochemical location of the activity of four basic types of enzyme involved in these processes in the olive (Olea europaea L.). The detection of peroxidase, esterase and acid-phosphatase activities at the surface of the stigma provided evidence of early receptivity in olive pistils. The stigma maintained its receptivity until the arrival of pollen. Acid-phosphatase activity appeared in the style at the moment of anthesis and continued until the fertilization of the ovule. RNase activity was detected in the extracellular matrix of the styles of flowers just before pollination and became especially evident in pistils after self-pollination. This activity gradually decreased until it practically disappeared in more advanced stages. RNase activity was also detected in pollen tubes growing in pollinated pistils and appeared after in vitro germination in the presence of self-incompatible pistils. These findings suggest that RNases may well be involved in intraspecific pollen rejection in olive flowers. To the best of our knowledge this is the first time that evidence of enzyme activity in stigma receptivity and pollen selection has been described in this species. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

Clinical utility from the determination of serico galactomannan in the diagnosis of invasive aspergillosis in hematological patients of the Hospital San Juan de Dios, between January 2009 and December 2012; Utilidad clinica de la determinacion de galactomanano serico en el diagnostico de aspergilosis invasiva en pacientes hematologicos del Hospital San Juan de Dios, entre enero 2009 y diciembre 2012

Energy Technology Data Exchange (ETDEWEB)

Li Sandi, Silvia

2014-07-01

Nosocomial infections have become more important to the health system by the high costs of these, but are little data available about them in recent years. The clinical utility of the determination of serum galactomannan (GMS) in patients with high risk of contracting the infection by Aspergillus spp, was assessed, between January 2009 and December 2012 at the Hospital San Juan de Dios. Several existing studies in the scientific literature have already evaluated the clinical usefulness, specific data have been inexistent for Costa Rica or for Central America and the Caribbean; so it is important to have known whether the conduct of the test has been similar to the other populations or have specific variations [Spanish] Las enfermedades nosocomiales han cobrado mayor importancia para el sistema de salud por el gasto elevado que han representado, pero son pocos los datos disponibles respecto a ellas en los ultimos anos. La utilidad clinica de la determinacion de galactomanano serico (GMS) en pacientes con alto riesgo a contraer la infeccion por Aspergillus spp, fue evaluada, entre enero del 2009 y diciembre del 2012 en el Hospital San Juan de Dios. Varios estudios existentes en la literatura cientifica ya han evaluado esta utilidad clinica, datos especificos han sido inexistentes para Costa Rica, o para la region Centroamericana y el Caribe, por lo que es importante haber conocido si el comportamiento de la prueba ha sido similar a las otras poblaciones o tiene variaciones.

Nutrition metabolism plays an important role in the alternate bearing of the olive tree (Olea europaea L..

Directory of Open Access Journals (Sweden)

Mine Turktas

Full Text Available The olive tree (Olea europaea L. is widely known for its strong tendency for alternate bearing, which severely affects the fruit yield from year to year. Microarray based gene expression analysis using RNA from olive samples (on-off years leaves and ripe-unripe fruits are particularly useful to understand the molecular mechanisms influencing the periodicity in the olive tree. Thus, we carried out genome wide transcriptome analyses involving different organs and temporal stages of the olive tree using the NimbleGen Array containing 136,628 oligonucleotide probe sets. Cluster analyses of the genes showed that cDNAs originated from different organs could be sorted into separate groups. The nutritional control had a particularly remarkable impact on the alternate bearing of olive, as shown by the differential expression of transcripts under different temporal phases and organs. Additionally, hormonal control and flowering processes also played important roles in this phenomenon. Our analyses provide further insights into the transcript changes between "on year" and "off year" leaves along with the changes from unrpipe to ripe fruits, which shed light on the molecular mechanisms underlying the olive tree alternate bearing. These findings have important implications for the breeding and agriculture of the olive tree and other crops showing periodicity. To our knowledge, this is the first study reporting the development and use of an olive array to document the gene expression profiling associated with the alternate bearing in olive tree.

Nutrition Metabolism Plays an Important Role in the Alternate Bearing of the Olive Tree (Olea europaea L.)

Science.gov (United States)

Turktas, Mine; Inal, Behcet; Okay, Sezer; Erkilic, Emine Gulden; Dundar, Ekrem; Hernandez, Pilar; Dorado, Gabriel; Unver, Turgay

2013-01-01

The olive tree (Olea europaea L.) is widely known for its strong tendency for alternate bearing, which severely affects the fruit yield from year to year. Microarray based gene expression analysis using RNA from olive samples (on-off years leaves and ripe-unripe fruits) are particularly useful to understand the molecular mechanisms influencing the periodicity in the olive tree. Thus, we carried out genome wide transcriptome analyses involving different organs and temporal stages of the olive tree using the NimbleGen Array containing 136,628 oligonucleotide probe sets. Cluster analyses of the genes showed that cDNAs originated from different organs could be sorted into separate groups. The nutritional control had a particularly remarkable impact on the alternate bearing of olive, as shown by the differential expression of transcripts under different temporal phases and organs. Additionally, hormonal control and flowering processes also played important roles in this phenomenon. Our analyses provide further insights into the transcript changes between ”on year” and “off year” leaves along with the changes from unrpipe to ripe fruits, which shed light on the molecular mechanisms underlying the olive tree alternate bearing. These findings have important implications for the breeding and agriculture of the olive tree and other crops showing periodicity. To our knowledge, this is the first study reporting the development and use of an olive array to document the gene expression profiling associated with the alternate bearing in olive tree. PMID:23555820

Mannitol transport and mannitol dehydrogenase activities are coordinated in Olea europaea under salt and osmotic stresses.

Science.gov (United States)

Conde, Artur; Silva, Paulo; Agasse, Alice; Conde, Carlos; Gerós, Hernâni

2011-10-01

The intracellular accumulation of organic compatible solutes functioning as osmoprotectants, such as polyols, is an important response mechanism of several plants to drought and salinity. In Olea europaea a mannitol transport system (OeMaT1) was previously characterized as a key player in plant response to salinity. In the present study, heterotrophic sink models, such as olive cell suspensions and fruit tissues, and source leaves were used for analytical, biochemical and molecular studies. The kinetic parameters of mannitol dehydrogenase (MTD) determined in cells growing in mannitol, at 25°C and pH 9.0, were as follows: K(m), 54.5 mM mannitol; and V(max), 0.47 μmol h⁻¹ mg⁻¹ protein. The corresponding cDNA was cloned and named OeMTD1. OeMTD1 expression was correlated with MTD activity, OeMaT1 expression and carrier-mediated mannitol transport in mannitol- and sucrose-grown cells. Furthermore, sucrose-grown cells displayed only residual OeMTD activity, even though high levels of OeMTD1 transcription were observed. There is evidence that OeMTD is regulated at both transcriptional and post-transcriptional levels. MTD activity and OeMTD1 expression were repressed after Na+, K+ and polyethylene glycol (PEG) treatments, in both mannitol- and sucrose-grown cells. In contrast, salt and drought significantly increased mannitol transport activity and OeMaT1 expression. Taken together, these studies support that olive trees cope with salinity and drought by coordinating mannitol transport with intracellular metabolism.

The use of phenological data to calculate chilling units in Olea europaea L. in relation to the onset of reproduction

Science.gov (United States)

Orlandi, F.; Fornaciari, M.; Romano, B.

2002-02-01

The aim of this study was to develop a practical method to evaluate the effective relationship between the amount of winter chilling and the response expressed as the spring reproductive re-starting dates in the olive ( Olea europaea L.). Two olive cultivars growing in a special olive orchard in Umbria (central Italy) were studied over a 3-year period (1998-2000): the cultivar Ascolana, typical of central Italy, and the cultivar Giarraffa, typical of southern Italy. The spring reproductive re-starts were assessed using data from detailed phenological observations made on 60 trees of each cultivar in an effort to establish the exact date of reproductive bud swelling. The chilling phenomenon was evaluated by using 341 functions derived from a formula developed by researchers at Utah State University to calculate chilling units. The mathematical functions are defined, and show the very close relationship between the amount of winter chilling and the spring reproductive response in the two cultivars in the orchard studied. The results can be used to define the relationship between local climate and plant development, and the mathematical approach can be used to draw maps that can show the suitability of different cultivars on the basis of local climatic conditions.

Cooperation-Induced Topological Complexity: A Promising Road to Fault Tolerance and Hebbian Learning

Science.gov (United States)

2012-03-16

Information Science Directorate, United States Army Research Office, Durham, NC, USA 4 Istituto di Fisiologia Clinica del Consiglio Nazionale delle...Vadim Uritsky, Catholic University of America at NASA Goddard Space Flight Center, USA *Correspondence: Paolo Allegrini , Istituto di Fisiologia Clinica

Learning curve of sentinel lymph nodes in early breast cancer at the Teaching Hospital 'Hospital das Clinicas' in Belo Horizonte, MG

International Nuclear Information System (INIS)

Homma, L.A.H.; Campos, T.P.R.; Silva, S.Z.C.; Siqueira, C.F.; Lima, C.F.

2007-01-01

The research of the sentinel lymph node in early breast cancer, an already worldwide established method, was standardized at the teaching hospital 'Hospital das Clinicas' in Belo Horizonte (MG, Brazil). This standardization was carried out from December 2000 through December 2002, in which 39 patients were included in a learning curve and method validation. The applied methodology is based on the combination of a lymphoscintillography and the blue stain. A periareolar colloid 99m Tc injection was given 24 hours before the surgery. The blue dye was injected in the peritumoral region during the surgery. The sentinel lymph node was identified by the blue color pattern of the lymph node and by the use of a portable gamma probe detector. Radioactive contamination was evaluated before, during and after the surgery. The measurement of the radioactivity of the breast area was taken by using a GM detector and an ionization chamber on a humid piece of gauze (passed on the breast area), from which the radioactivity was recorded as well as the gloves used during the surgery, and the gauzes with contaminated blood. The sentinel lymph node identification rate was found to be 95%, there was a false negative rate of 4,8% and a predictive negative value (PNV) of 94%. The identification figures, the predictive negative value and the false negative rate were similar to the figures found in technical literature. The technique of the biopsy of the sentinel lymph node (BSL) is the method chosen for staging patients with invasive breast cancer and with clinically negative results for the armpit. The combined method using radio-colloid and the stain is the most indicated. There is a minimum radio isotopic contamination and there is scarcely any danger for the patient or the medical staff involved in the procedure. (author)

Community structure variability of Uropodina mites (Acari: Mesostigmata) in nests of the common mole, Talpa europaea, in Central Europe.

Science.gov (United States)

Napierała, Agnieszka; Mądra, Anna; Leszczyńska-Deja, Kornelia; Gwiazdowicz, Dariusz J; Gołdyn, Bartłomiej; Błoszyk, Jerzy

2016-04-01

Underground nests of Talpa europaea, known as the common mole, are very specific microhabitats, which are also quite often inhabited by various groups of arthropods. Mites from the suborder Uropodina (Acari: Mesostigmata) are only one of them. One could expect that mole nests that are closely located are inhabited by communities of arthropods with similar species composition and structure. However, results of empirical studies clearly show that even nests which are close to each other can be different both in terms of the species composition and abundance of Uropodina communities. So far, little is known about the factors that can cause these differences. The major aim of this study was to identify factors determining species composition, abundance, and community structure of Uropodina communities in mole nests. The study is based on material collected during a long-term investigation conducted in western parts of Poland. The results indicate that the two most important factors influencing species composition and abundance of Uropodina communities in mole nests are nest-building material and depth at which nests are located. Composition of Uropodina communities in nests of moles was also compared with that of other microhabitats (e.g. rotten wood, forest litter, soil) based on data from 4421 samples collected in Poland. Communities of this habitat prove most similar to these of open areas, especially meadows, as well as some forest types.

Biological control of olive fruit fly in California – release, establishment and impact of Psyttalia lounsburyi and Psyttalia humilis

Science.gov (United States)

The invasive olive fruit fly Bactrocera oleae (Rossi) (Diptera: Tephritidae) likely originated in sub-Saharan Africa, where the wild olive Olea europaea cuspidata L. (Wall. ex G. Don) is found and from which the domesticated olive O. europaea europaea L. was derived. Following the path of olive cult...

Lipophilization of Hydroxytyrosol-Enriched Fractions from Olea europaea L. Byproducts and Evaluation of the in Vitro Effects on a Model of Colorectal Cancer Cells.

Science.gov (United States)

Bernini, Roberta; Carastro, Isabella; Palmini, Gaia; Tanini, Annalisa; Zonefrati, Roberto; Pinelli, Patrizia; Brandi, Maria Luisa; Romani, Annalisa

2017-08-09

A hydroxytyrosol (HTyr)-enriched fraction containing HTyr 6% w/w, derived from Olea europaea L. byproducts and obtained using an environmentally and economically sustainable technology, was lipophilized under green chemistry conditions. The effects of three fractions containing hydroxytyrosyl butanoate, octanoate, and oleate, named, respectively, lipophilic fractions 5, 6, and 7, and unreacted HTyr on the human colon cancer cell line HCT8-β8 engineered to overexpress estrogen receptor β (ERβ) were evaluated and compared to those of pure HTyr. The experimental data demonstrated that HTyr and all fractions showed an antiproliferative effect, as had been observed by the evaluation of the cellular doubling time under these different conditions (mean control, 32 ± 4 h; HTyr 1, 65 ± 9 h; fraction 5, 64 ± 11 h; fraction 6, 62 ± 14 h; fraction 7, 133 ± 30 h). As evidenced, fraction 7 containing hydroxytyrosyl oleate showed the highest activity. These results were related to the link with ER-β, which was assessed through simultaneous treatment with an inhibitor of ERβ.

Influence of Soil Based Growing Media on Vegetative Propagation of Selected Cultivars of Olea Europaea

International Nuclear Information System (INIS)

Ahmed, M. I.; Ashraf, M. I.; Malik, S. U.; Husaain, Q.

2016-01-01

Pothwar region of Pakistan is a natural habitat of Olea spp. There is a high demand of certified olive plants to establish olive orchids in the region, because native wild species are non-fruit bearing. Plants of certified fruit bearing olive (Olea europaea L.) cultivars are rarely available. Vegetative propagation of olive is highly responsive to texture of soil based growing media. This study examined the effect of growing media composition (soil texture and nutrients) on vegetative propagation of five cultivars of olive. The experiment was carried out in randomized complete block design (RCBD) with two factors factorial having 25 repeats of each four treatments. Plant growth and survival data were collected and analyzed for the influence of soil attributes. In sandy loam soil, cv. Bari-1 had 82 percent plant survival, highest number of roots per plant (3.5), and longest root length (13.01 cm). Highest number of shoots per plant (4.25) and maximum shoot length (15.64 cm) were also recorded for Bari-1 with sandy loam growing media. Silt loam soil is least suitable growing media for vegetative propagation of olive. In the silt loam soil, plants survival rate was 59 percent for cv. Gemlik, number of roots per plant was 1.5 for cv. Ottobrattica, minimum root length 5.65 cm, minimum number of shoots per plant one, and minimum shoot length 7.42 cm were recorded for cv. Pendolino with silt loam soil. Results suggested that sandy loam growing media is better than the others for vegetative propagation of olive. Cultivar Bari-1 performed better than the others examined in this study by indicating highest (1) survival percentage, (2) root and shoot length, and (3) number of roots and shoots produced within a specific period of time. (author)

Effects of moistening, salinity and competitive interactions on vitality and production activity of Salicorniaeuropaea (Chenopodiaceae

Directory of Open Access Journals (Sweden)

S. F. Kotov

2005-09-01

Full Text Available Dynamics of competitive interactions in populations of annual euhalophyte S. europaea was investigated. For S. europaea the hypothesis of Newman and Tilman is confirmed, concerning presence of intensive competition between plants on unproductive habitats for soil resources. Vital state of plants in populations of S. europaea is determined by intensity of competitive interactions, level of humidity and degree of salinity of ecotype. On an example of S. europaea, productive activity of plants on salted habitats was analyzed and the role of interspecific competition in this process was determined.

Separation and identification of phenolic compounds of extra virgin olive oil from Olea europaea L. by HPLC-DAD-SPE-NMR/MS. Identification of a new diastereoisomer of the aldehydic form of oleuropein aglycone.

Science.gov (United States)

Pérez-Trujillo, Míriam; Gómez-Caravaca, Ana María; Segura-Carretero, Antonio; Fernández-Gutiérrez, Alberto; Parella, Teodor

2010-08-25

The phenolic fraction of a monovarietal extra virgin olive oil (EVOO) from Olea europaea L. var. Cornezuelo was studied by the hyphenated HPLC-DAD-SPE-NMR/MS techniques. This survey led to the identification of 25 main compounds. One was identified as a new diastereoisomer of the aldehydic form of oleuropein aglycone (AOA) and characterized by 1D and 2D NMR techniques. The relative configuration of this new AOA was determined as 5R*,8S*,9S* on the basis of the results obtained from the combination of NOE experiments and Monte Carlo conformational search calculations. Assuming, as for the described diastereoisomers, that the new AOA comes from the natural oleuropein aglycone (OA), the absolute configuration was proposed as 5S,8R,9R.

Variability of Virgin Olive Oil Phenolic Compounds in a Segregating Progeny from a Single Cross in Olea europaea L. and Sensory and Nutritional Quality Implications

Science.gov (United States)

Pérez, Ana G.; León, Lorenzo; Pascual, Mar; Romero-Segura, Carmen; Sánchez-Ortiz, Araceli; de la Rosa, Raúl; Sanz, Carlos

2014-01-01

Virgin olive oil phenolic compounds are responsible for its nutritional and sensory quality. The synthesis of phenolic compounds occurs when enzymes and substrates meet as olive fruit is crushed during the industrial process to obtain the oil. The genetic variability of the major phenolic compounds of virgin olive oil was studied in a progeny of the cross of Picual x Arbequina olive cultivars (Olea europaea L.). They belong to four different groups: compounds that included tyrosol or hydroxytyrosol in their molecules, lignans, flavonoids, and phenolic acids. Data of phenolics in the oils showed that the progeny displayed a large degree of variability, widely transgressing the genitor levels. This high variability can be of interest on breeding programs. Thus, multivariate analysis allowed to identify genotypes within the progeny particularly interesting in terms of phenolic composition and deduced organoleptic and nutritional quality. The present study has demonstrated that it is possible to obtain enough degree of variability with a single cross of olive cultivars for compounds related to the nutritional and organoleptic properties of virgin olive oil. PMID:24651694

Variability of virgin olive oil phenolic compounds in a segregating progeny from a single cross in Olea europaea L. and sensory and nutritional quality implications.

Science.gov (United States)

Pérez, Ana G; León, Lorenzo; Pascual, Mar; Romero-Segura, Carmen; Sánchez-Ortiz, Araceli; de la Rosa, Raúl; Sanz, Carlos

2014-01-01

Virgin olive oil phenolic compounds are responsible for its nutritional and sensory quality. The synthesis of phenolic compounds occurs when enzymes and substrates meet as olive fruit is crushed during the industrial process to obtain the oil. The genetic variability of the major phenolic compounds of virgin olive oil was studied in a progeny of the cross of Picual x Arbequina olive cultivars (Olea europaea L.). They belong to four different groups: compounds that included tyrosol or hydroxytyrosol in their molecules, lignans, flavonoids, and phenolic acids. Data of phenolics in the oils showed that the progeny displayed a large degree of variability, widely transgressing the genitor levels. This high variability can be of interest on breeding programs. Thus, multivariate analysis allowed to identify genotypes within the progeny particularly interesting in terms of phenolic composition and deduced organoleptic and nutritional quality. The present study has demonstrated that it is possible to obtain enough degree of variability with a single cross of olive cultivars for compounds related to the nutritional and organoleptic properties of virgin olive oil.

Determination of the Effects of Medium Composition on the Monochloramine Disinfection Kinetics of Nitrosomonas europaea by the Propidium Monoazide Quantitative PCR and Live/Dead BacLight Methods ▿

Science.gov (United States)

Wahman, David G.; Schrantz, Karen A.; Pressman, Jonathan G.

2010-01-01

Various medium compositions (phosphate, 1 to 50 mM; ionic strength, 2.8 to 150 meq/liter) significantly affected Nitrosomonas europaea monochloramine disinfection kinetics, as determined by the Live/Dead BacLight (LD) and propidium monoazide quantitative PCR (PMA-qPCR) methods (lag coefficient, 37 to 490 [LD] and 91 to 490 [PMA-qPCR] mg·min/liter; Chick-Watson rate constant, 4.0 × 10−3 to 9.3 × 10−3 [LD] and 1.6 × 10−3 to 9.6 × 10−3 [PMA-qPCR] liter/mg·min). Two competing effects may account for the variation in disinfection kinetic parameters: (i) increasing kinetics (disinfection rate constant [k] increased, lag coefficient [b] decreased) with increasing phosphate concentration and (ii) decreasing kinetics (k decreased, b increased) with increasing ionic strength. The results support development of a standard medium for evaluating disinfection kinetics in drinking water. PMID:20952645

Identification and characterisation of Short Interspersed Nuclear Elements in the olive tree (Olea europaea L.) genome.

Science.gov (United States)

Barghini, Elena; Mascagni, Flavia; Natali, Lucia; Giordani, Tommaso; Cavallini, Andrea

2017-02-01

Short Interspersed Nuclear Elements (SINEs) are nonautonomous retrotransposons in the genome of most eukaryotic species. While SINEs have been intensively investigated in humans and other animal systems, SINE identification has been carried out only in a limited number of plant species. This lack of information is apparent especially in non-model plants whose genome has not been sequenced yet. The aim of this work was to produce a specific bioinformatics pipeline for analysing second generation sequence reads of a non-model species and identifying SINEs. We have identified, for the first time, 227 putative SINEs of the olive tree (Olea europaea), that constitute one of the few sets of such sequences in dicotyledonous species. The identified SINEs ranged from 140 to 362 bp in length and were characterised with regard to the occurrence of the tRNA domain in their sequence. The majority of identified elements resulted in single copy or very lowly repeated, often in association with genic sequences. Analysis of sequence similarity allowed us to identify two major groups of SINEs showing different abundances in the olive tree genome, the former with sequence similarity to SINEs of Scrophulariaceae and Solanaceae and the latter to SINEs of Salicaceae. A comparison of sequence conservation between olive SINEs and LTR retrotransposon families suggested that SINE expansion in the genome occurred especially in very ancient times, before LTR retrotransposon expansion, and presumably before the separation of the rosids (to which Oleaceae belong) from the Asterids. Besides providing data on olive SINEs, our results demonstrate the suitability of the pipeline employed for SINE identification. Applying this pipeline will favour further structural and functional analyses on these relatively unknown elements to be performed also in other plant species, even in the absence of a reference genome, and will allow establishing general evolutionary patterns for this kind of repeats in

Olea europaea leaf extract improves the treatment response of GBM stem cells by modulating miRNA expression.

Science.gov (United States)

Tezcan, Gulcin; Tunca, Berrin; Bekar, Ahmet; Budak, Ferah; Sahin, Saliha; Cecener, Gulsah; Egeli, Unal; Taskapılıoglu, Mevlut Ozgur; Kocaeli, Hasan; Tolunay, Sahsine; Malyer, Hulusi; Demir, Cevdet; Tumen, Gulendam

2014-01-01

The stem-like cells of Glioblastoma multiforme (GBM) tumors (GSCs) are one of the important determinants of recurrence and drug resistance. The aims of the current study were to evaluate the anticancer effect of Olea europaea leaf extract (OLE) on GBM cell lines, the association between OLE and TMZ responses, and the effect of OLE and the OLE-TMZ combination in GSCs and to clarify the molecular mechanism of this effect on the expression of miRNAs related to cell death. The anti-proliferative activity of OLE and the effect of the OLE-TMZ combination were tested in the T98G, U-138MG and U-87MG GBM cell lines using WST-1 assay. The mechanism of cell death was analyzed with Annexin V/FITC and TUNEL assays. The effects of OLE on the expression levels of miR-181b, miR-153, miR-145 and miR-137 and potential mRNA targets were analyzed in GSCs using RT-qPCR. OLE exhibited anti-proliferative effects via apoptosis and necrosis in the GBM cell lines. In addition, OLE significantly induced the expression of miR-153, miR-145, and miR-137 and decreased the expression of the target genes of these miRNAs in GSCs (p GBM cells with different TMZ responses, and this effect is synergistically increased when the cells are treated with a combination of OLE and TMZ. This is the first study to indicate that OLE may interfere with the pluripotency of GSCs by modulating miRNA expression. Further studies are required, but we suggest that OLE may have a potential for advanced therapeutic cancer drug studies in GBM.

Thriving at the limit: Differential reproductive performance in range-edge populations of a Mediterranean sclerophyll (Olea europaea)

Science.gov (United States)

Granado-Yela, Carlos; Balaguer, Luis; García-Verdugo, Carlos; Carrillo, Katty; Méndez, Marcos

2013-10-01

Peripheral populations are often lumped together on the assumption of thriving in marginal habitats where reproductive performance is compromised. We have tested this hypothesis in peripheral populations of wild olive tree (Olea europaea L.) presumably limited by different factors at the westernmost limit of the species range. Additionally, we hypothesized that differences in reproductive outcome among populations are better explained by site-specific environmental conditions (PAR, soil water, soil nutrients, air humidity and air temperature) than by differences in phenotypic traits (tree size and leaf traits). To test these hypotheses, we assessed the number of flowering trees, the flowering intensity, fruit set and seed viability in eight populations for three consecutive years. Our findings provided sufficient evidence to reject the first hypothesis. Peripheral populations that occur under oceanic conditions, resembling the Tertiary subtropical climate, consistently presented higher values for all components of reproductive performance than those at the thermal and rainfall tolerance limits. In support of our second hypothesis, the variation in reproductive performance among populations was primarily accounted for by local environmental conditions. Leaf traits, however, also explained reproductive variation but to a lesser extent. Finally, we found that small changes in tree size may cause large differences in reproductive performance. This close relationship between tree size and reproductive performance suggests that any impact on population size structure would likely jeopardize persistence and expansion at the range edge. Our results suggest that reproductive performance of wild olive trees was not shaped by the population geographic position within the species range, but by the interaction between local environment, as the main driver, and individual phenotypic traits.

Cold perception and gene expression differ in Olea europaea seed coat and embryo during drupe cold acclimation.

Science.gov (United States)

D'Angeli, S; Falasca, G; Matteucci, M; Altamura, M M

2013-01-01

FAD2 and FAD7 desaturases are involved in cold acclimation of olive (Olea europaea) mesocarp. There is no research information available on cold acclimation of seeds during mesocarp cold acclimation or on differences in the cold response of the seed coat and embryo. How FAD2 and FAD7 affect seed coat and embryo cold responses is unknown. Osmotin positively affects cold acclimation in olive tree vegetative organs, but its role in the seeds requires investigation. OeFAD2.1, OeFAD2.2, OeFAD7 and Oeosmotin were investigated before and after mesocarp acclimation by transcriptomic, lipidomic and immunolabelling analyses, and cytosolic calcium concentration ([Ca(2+)](cyt)) signalling, F-actin changes and seed development were investigated by epifluorescence/histological analyses. Transient [Ca(2+)](cyt) rises and F-actin disassembly were found in cold-shocked protoplasts from the seed coat, but not from the embryo. The thickness of the outer endosperm cuticle increased during drupe exposure to lowering of temperature, whereas the embryo protoderm always lacked cuticle. OeFAD2 transcription increased in both the embryo and seed coat in the cold-acclimated drupe, but linoleic acid (i.e. the product of FAD2 activity) increased solely in the seed coat. Osmotin was immunodetected in the seed coat and endosperm of the cold-acclimated drupe, and not in the embryo. The results show cold responsiveness in the seed coat and cold tolerance in the embryo. We propose a role for the seed coat in maintaining embryo cold tolerance by increasing endosperm cutinization through FAD2 and osmotin activities. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.

Correlation between airborne Olea europaea pollen concentrations and levels of the major allergen Ole e 1 in Córdoba, Spain, 2012-2014

Science.gov (United States)

Plaza, M. P.; Alcázar, P.; Galán, C.

2016-12-01

Olea europaea L. pollen is the second-largest cause of pollinosis in the southern Iberian Peninsula. Airborne-pollen monitoring networks provide essential data on pollen dynamics over a given study area. Recent research, however, has shown that airborne pollen levels alone do not always provide a clear indicator of actual exposure to aeroallergens. This study sought to evaluate correlations between airborne concentrations of olive pollen and Ole e 1 allergen levels in Córdoba (southern Spain), in order to determine whether atmospheric pollen concentrations alone are sufficient to chart changes in hay fever symptoms. The influence of major weather-related variables on local airborne pollen and allergen levels was also examined. Monitoring was carried out from 2012 to 2014. Pollen sampling was performed using a Hirst-type sampler, following the protocol recommended by the Spanish Aerobiology Network. A multi-vial cyclone sampler was used to collect aeroallergens, and allergenic particles were quantified by ELISA assay. Significant positive correlations were found between daily airborne allergen levels and atmospheric pollen concentrations, although there were occasions when allergen was detected before and after the pollen season and in the absence of airborne pollen. The correlation between the two was irregular, and pollen potency displayed year-on-year variations and did not necessarily match pollen-season-intensity.

Influence of inorganic and organic amendments in the soil properties and the growth and survival of Olea Europaea var. Sylvestris in the semiarid Mediterranean area

Science.gov (United States)

Ortega, Raúl; Miralles, Isabel; Anguita-Maeso, Manuel; Domene, Miguel; Soriano, Miguel

2017-04-01

Selecting the most appropriate types of plants adapted to the harsh climatic conditions of restoring drylands is essential to success in landscape restoration. Besides improving soil quality is a key factor to consider when designing the restoration procedures. The use of organic and inorganic amendments can help with this task. On this study, we evaluated the influence of different mineral (clays) and organic (compost and poultry) amendments on the properties of a bare soil and how this influenced on the growth and survival of the Olea europaea var. sylvestrys, a perennial bush plant adapted to the Mediterranean semi-arid zone. Tests were designed and carried out in a greenhouse at the "Experimental Station of Cajamar foundation "Las Palmerillas" in El Ejido (Almería, Spain). Plants were grown in 250L pots and their substrate was bare soil and mineral and/or organic amendments. The experimental design consisted of three replicas for five treatments: 1. compost, 2. "ZeoPro", a cliptonolite commercial clay, 3. mordenite clay from local quarries plus compost, 4. cliptonolite clay from Turkey plus compost, 5. cliptonolite from Turquey plus poultry; with four levels each one: 5%, 10%, 20%, 30% volume of amendment. Including three control samples without amendment total plants accounted for 63. Climatic sensors inside and outside the greenhouse permitted to establish the same meteorological conditions for the plants and only emergency watering was supplied when necessary for the survival of the plants when arid conditions were extreme. The physico-chemical soil properties of each treatment and level were analyzed before planting and the biovolume and the survival rates of the plants were measured regularly along eleven months. Statistically the best treatment for the growing of the plants was number 3 (mordenite and compost) with no deaths recorded. According to the growing rates the best level was soil with 20% of amendment. Besides we analyzed the evolution of the

Evaluation of RNA extraction methods and identification of putative reference genes for real-time quantitative polymerase chain reaction expression studies on olive (Olea europaea L.) fruits.

Science.gov (United States)

Nonis, Alberto; Vezzaro, Alice; Ruperti, Benedetto

2012-07-11

Genome wide transcriptomic surveys together with targeted molecular studies are uncovering an ever increasing number of differentially expressed genes in relation to agriculturally relevant processes in olive (Olea europaea L). These data need to be supported by quantitative approaches enabling the precise estimation of transcript abundance. qPCR being the most widely adopted technique for mRNA quantification, preliminary work needs to be done to set up robust methods for extraction of fully functional RNA and for the identification of the best reference genes to obtain reliable quantification of transcripts. In this work, we have assessed different methods for their suitability for RNA extraction from olive fruits and leaves and we have evaluated thirteen potential candidate reference genes on 21 RNA samples belonging to fruit developmental/ripening series and to leaves subjected to wounding. By using two different algorithms, GAPDH2 and PP2A1 were identified as the best reference genes for olive fruit development and ripening, and their effectiveness for normalization of expression of two ripening marker genes was demonstrated.

Workshop Euratom Directive 97/43. New trends in radiation protection in clinical practice, in research and in regulation; Giornata di studio La Direttiva Europea 97/43: nuovi orientamenti per la radioprotezione nella pratica clinica, nella ricerca e nel quadro normativo

Energy Technology Data Exchange (ETDEWEB)

Mazzei, F [ed.; Istituto Superiore di Sanita' , Rome (Italy). Lab. di Fisica

1999-07-01

The Euratom Directive 97/43 on health protection of individuals against the dangers of ionizing radiation in relation to medical exposure is presented. In particular the following topics are focused, with a multidisciplinary approach, on: diagnostic reference levels in radiodiagnostics and nuclear medicine; radiation protection in paediatrics, in interventional radiology and in computer tomography; radiation protection radiotherapy, radiation protection in medical research; radiation protection in prenatal and neonatal exposure; radiation protection in medical-legal exposures. [Italian] Il rapporto raccoglie una presentazione della Direttiva Euratom 97/43 riguardante la protezione sanitaria delle persone contro i pericoli delle radiazioni ionizzanti connessi a esposizioni mediche. In particolare sono affrontati in modo interdisciplinare i seguenti argomenti: livelli diagnostici di riferimento in radiodiagnostica e in medicina nucleare; radioprotezione nelle esposizioni in eta' pediatrica, in radiologica interventistica e in tomografia computerizzata; radioprotezione in radioterapia; radioprotezione nella ricerca scientifica clinica; radioprotezione nell'esposizione in eta' prenatale e neonatale; esposizioni potenziali e radioprotezione nelle esposizioni medico-legali.

Workshop Euratom Directive 97/43. New trends in radiation protection in clinical practice, in research and in regulation; Giornata di studio La Direttiva Europea 97/43: nuovi orientamenti per la radioprotezione nella pratica clinica, nella ricerca e nel quadro normativo

Energy Technology Data Exchange (ETDEWEB)

Mazzei, F. [ed.] [Istituto Superiore di Sanita' , Rome (Italy). Lab. di Fisica

1999-07-01

The Euratom Directive 97/43 on health protection of individuals against the dangers of ionizing radiation in relation to medical exposure is presented. In particular the following topics are focused, with a multidisciplinary approach, on: diagnostic reference levels in radiodiagnostics and nuclear medicine; radiation protection in paediatrics, in interventional radiology and in computer tomography; radiation protection radiotherapy, radiation protection in medical research; radiation protection in prenatal and neonatal exposure; radiation protection in medical-legal exposures. [Italian] Il rapporto raccoglie una presentazione della Direttiva Euratom 97/43 riguardante la protezione sanitaria delle persone contro i pericoli delle radiazioni ionizzanti connessi a esposizioni mediche. In particolare sono affrontati in modo interdisciplinare i seguenti argomenti: livelli diagnostici di riferimento in radiodiagnostica e in medicina nucleare; radioprotezione nelle esposizioni in eta' pediatrica, in radiologica interventistica e in tomografia computerizzata; radioprotezione in radioterapia; radioprotezione nella ricerca scientifica clinica; radioprotezione nell'esposizione in eta' prenatale e neonatale; esposizioni potenziali e radioprotezione nelle esposizioni medico-legali.

Changes in olive oil volatile organic compounds induced by water status and light environment in canopies of Olea europaea L. trees.

Science.gov (United States)

Benelli, Giovanni; Caruso, Giovanni; Giunti, Giulia; Cuzzola, Angela; Saba, Alessandro; Raffaelli, Andrea; Gucci, Riccardo

2015-09-01

Light and water are major factors in fruit development and quality. In this study, the effect of water and light in Olea europaea trees on volatile organic compounds (VOCs) in olive oil was studied over 2 years. Mature fruits were harvested from three zones of the canopy with different light exposure (64%, 42% and 30% of incident light) of trees subjected to full, deficit or complementary irrigation. VOCs were determined by SPME GC-MS and analysed by principal component analysis followed by discriminant analysis to partition treatment effects. Fruit fresh weight and mesocarp oil content decreased in zones where intercepted light was less. Low light levels significantly slowed down fruit maturation, whereas conditions of water deficit accelerated the maturation process. The presence of cyclosativene and α-muurulene was associated with water deficit, nonanal, valencene with full irrigation; α-muurulene, (E)-2-hexanal were related to low light conditions, while trans-β-ocimene, α-copaene, (Z)-2-penten-1-ol, hexanal and nonanal to well exposed zones. The year strongly affected the VOC profile of olive oil. This is the first report on qualitative changes in VOCs induced by light environment and/or water status. This information is valuable to better understand the role of environmental factors on the sensory quality of virgin olive oil. © 2014 Society of Chemical Industry.

Hepatoprotective and antioxidant properties of the aqueous extract of Olea europaea leaves against Diclofenac-induced liver damages in mice.

Science.gov (United States)

Soussi, Rawya; Hfaiedh, Najla; Guesmi, Fatma; Sakly, Mohsen; Ben Rhouma, Khémais

2018-04-20

Historically, olive tree "Olea europaea" is one of the most important fruit trees in Mediterranean countries. Several studies suggest that olive leaf is a significant source of bioactive phenolic compounds compared to olive oil and fruits. This study was undertaken to investigate, the protective effect of the aqueous extract of « Chemlali » olive leaves against diclofenac-induced damages in liver and haematological alterations in swiss albinos mice. For this, twenty-eight mice were divided into four groups: a control group, a diclofenac-treated group (2.37 mg/kg) for 5 consecutive days, a group orally gavaged with aqueous extract of olive leaves, (3.3g/kg) during 28 days, and a group pre-treated with aqueous extract of olive leaves during 23 days then injected with diclofenac for 5 days. Results obtained from this study revealed that administration of diclofenac alone led to disturbance of some haematological parameters including red and white blood cells (RBC), (WBC) haemoglobin (Hb) and platelets content (PLT). However, diclofenac-treated mice group showed a increasing in the levels of cholesterol, triglyceride, glucose, creatinine, urea, aspartate aminotransferase (ASAT), and alanine aminotransferase (ALAT). Additionally we noted a state of oxidative stress in hepatic tissue indicated by the increasing of lipid peroxidation level (TBARS) and decreasing of superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPX). Interstingly, pre-treatment with olive leaves extract improved the haematological parameters and minimised the adverse effect on the hepatic function markers induced by diclofenac. The beneficial effect of olive leaves could be attributed to its antioxidant components as confirmed by phytochemical analysis.

Genome-Scale, Constraint-Based Modeling of Nitrogen Oxide Fluxes during Coculture of Nitrosomonas europaea and Nitrobacter winogradskyi

Science.gov (United States)

Giguere, Andrew T.; Murthy, Ganti S.; Bottomley, Peter J.; Sayavedra-Soto, Luis A.

2018-01-01

ABSTRACT Nitrification, the aerobic oxidation of ammonia to nitrate via nitrite, emits nitrogen (N) oxide gases (NO, NO2, and N2O), which are potentially hazardous compounds that contribute to global warming. To better understand the dynamics of nitrification-derived N oxide production, we conducted culturing experiments and used an integrative genome-scale, constraint-based approach to model N oxide gas sources and sinks during complete nitrification in an aerobic coculture of two model nitrifying bacteria, the ammonia-oxidizing bacterium Nitrosomonas europaea and the nitrite-oxidizing bacterium Nitrobacter winogradskyi. The model includes biotic genome-scale metabolic models (iFC578 and iFC579) for each nitrifier and abiotic N oxide reactions. Modeling suggested both biotic and abiotic reactions are important sources and sinks of N oxides, particularly under microaerobic conditions predicted to occur in coculture. In particular, integrative modeling suggested that previous models might have underestimated gross NO production during nitrification due to not taking into account its rapid oxidation in both aqueous and gas phases. The integrative model may be found at https://github.com/chaplenf/microBiome-v2.1. IMPORTANCE Modern agriculture is sustained by application of inorganic nitrogen (N) fertilizer in the form of ammonium (NH4+). Up to 60% of NH4+-based fertilizer can be lost through leaching of nitrifier-derived nitrate (NO3−), and through the emission of N oxide gases (i.e., nitric oxide [NO], N dioxide [NO2], and nitrous oxide [N2O] gases), the latter being a potent greenhouse gas. Our approach to modeling of nitrification suggests that both biotic and abiotic mechanisms function as important sources and sinks of N oxides during microaerobic conditions and that previous models might have underestimated gross NO production during nitrification. PMID:29577088

Genome-Scale, Constraint-Based Modeling of Nitrogen Oxide Fluxes during Coculture of Nitrosomonas europaea and Nitrobacter winogradskyi.

Science.gov (United States)

Mellbye, Brett L; Giguere, Andrew T; Murthy, Ganti S; Bottomley, Peter J; Sayavedra-Soto, Luis A; Chaplen, Frank W R

2018-01-01

Nitrification, the aerobic oxidation of ammonia to nitrate via nitrite, emits nitrogen (N) oxide gases (NO, NO 2 , and N 2 O), which are potentially hazardous compounds that contribute to global warming. To better understand the dynamics of nitrification-derived N oxide production, we conducted culturing experiments and used an integrative genome-scale, constraint-based approach to model N oxide gas sources and sinks during complete nitrification in an aerobic coculture of two model nitrifying bacteria, the ammonia-oxidizing bacterium Nitrosomonas europaea and the nitrite-oxidizing bacterium Nitrobacter winogradskyi . The model includes biotic genome-scale metabolic models (iFC578 and iFC579) for each nitrifier and abiotic N oxide reactions. Modeling suggested both biotic and abiotic reactions are important sources and sinks of N oxides, particularly under microaerobic conditions predicted to occur in coculture. In particular, integrative modeling suggested that previous models might have underestimated gross NO production during nitrification due to not taking into account its rapid oxidation in both aqueous and gas phases. The integrative model may be found at https://github.com/chaplenf/microBiome-v2.1. IMPORTANCE Modern agriculture is sustained by application of inorganic nitrogen (N) fertilizer in the form of ammonium (NH 4 + ). Up to 60% of NH 4 + -based fertilizer can be lost through leaching of nitrifier-derived nitrate (NO 3 - ), and through the emission of N oxide gases (i.e., nitric oxide [NO], N dioxide [NO 2 ], and nitrous oxide [N 2 O] gases), the latter being a potent greenhouse gas. Our approach to modeling of nitrification suggests that both biotic and abiotic mechanisms function as important sources and sinks of N oxides during microaerobic conditions and that previous models might have underestimated gross NO production during nitrification.

Identification of new polymorphic regions and differentiation of cultivated olives (Olea europaea L.) through plastome sequence comparison

Science.gov (United States)

2010-01-01

Background The cultivated olive (Olea europaea L.) is the most agriculturally important species of the Oleaceae family. Although many studies have been performed on plastid polymorphisms to evaluate taxonomy, phylogeny and phylogeography of Olea subspecies, only few polymorphic regions discriminating among the agronomically and economically important olive cultivars have been identified. The objective of this study was to sequence the entire plastome of olive and analyze many potential polymorphic regions to develop new inter-cultivar genetic markers. Results The complete plastid genome of the olive cultivar Frantoio was determined by direct sequence analysis using universal and novel PCR primers designed to amplify all overlapping regions. The chloroplast genome of the olive has an organisation and gene order that is conserved among numerous Angiosperm species and do not contain any of the inversions, gene duplications, insertions, inverted repeat expansions and gene/intron losses that have been found in the chloroplast genomes of the genera Jasminum and Menodora, from the same family as Olea. The annotated sequence was used to evaluate the content of coding genes, the extent, and distribution of repeated and long dispersed sequences and the nucleotide composition pattern. These analyses provided essential information for structural, functional and comparative genomic studies in olive plastids. Furthermore, the alignment of the olive plastome sequence to those of other varieties and species identified 30 new organellar polymorphisms within the cultivated olive. Conclusions In addition to identifying mutations that may play a functional role in modifying the metabolism and adaptation of olive cultivars, the new chloroplast markers represent a valuable tool to assess the level of olive intercultivar plastome variation for use in population genetic analysis, phylogenesis, cultivar characterisation and DNA food tracking. PMID:20868482

A possible role for flowering locus T-encoding genes in interpreting environmental and internal cues affecting olive (Olea europaea L.) flower induction.

Science.gov (United States)

Haberman, Amnon; Bakhshian, Ortal; Cerezo-Medina, Sergio; Paltiel, Judith; Adler, Chen; Ben-Ari, Giora; Mercado, Jose Angel; Pliego-Alfaro, Fernando; Lavee, Shimon; Samach, Alon

2017-08-01

Olive (Olea europaea L.) inflorescences, formed in lateral buds, flower in spring. However, there is some debate regarding time of flower induction and inflorescence initiation. Olive juvenility and seasonality of flowering were altered by overexpressing genes encoding flowering locus T (FT). OeFT1 and OeFT2 caused early flowering under short days when expressed in Arabidopsis. Expression of OeFT1/2 in olive leaves and OeFT2 in buds increased in winter, while initiation of inflorescences occurred i n late winter. Trees exposed to an artificial warm winter expressed low levels of OeFT1/2 in leaves and did not flower. Olive flower induction thus seems to be mediated by an increase in FT levels in response to cold winters. Olive flowering is dependent on additional internal factors. It was severely reduced in trees that carried a heavy fruit load the previous season (harvested in November) and in trees without fruit to which cold temperatures were artificially applied in summer. Expression analysis suggested that these internal factors work either by reducing the increase in OeFT1/2 expression or through putative flowering repressors such as TFL1. With expected warmer winters, future consumption of olive oil, as part of a healthy Mediterranean diet, should benefit from better understanding these factors. © 2017 John Wiley & Sons Ltd.

Impact of proline application on cadmium accumulation, mineral nutrition and enzymatic antioxidant defense system of Olea europaea L. cv Chemlali exposed to cadmium stress.

Science.gov (United States)

Zouari, Mohamed; Ben Ahmed, Chedlia; Elloumi, Nada; Bellassoued, Khaled; Delmail, David; Labrousse, Pascal; Ben Abdallah, Ferjani; Ben Rouina, Bechir

2016-06-01

Proline plays an important role in plant response to various environmental stresses. However, its involvement in mitigation of heavy metal stress in plants remains elusive. In this study, we examined the effectiveness of exogenous proline (10 and 20 mM) in alleviating cadmium induced inhibitory effects in young olive plants (Olea europaea L. cv. Chemlali) exposed to two Cd levels (10 and 30 mg CdCl2 kg(-1) soil). The Cd treatment induced substantial accumulation of Cd in both root and leaf tissues and a decrease in gas exchange, photosynthetic pigments contents, uptake of essential elements (Ca, Mg and K) and plant biomass. Furthermore, an elevation of antioxidant enzymes activities (superoxide dismutase, catalase, glutathione peroxydase) and proline content in association with relatively high amounts of hydrogen peroxide, thiobarbituric acid reactive substances and electrolyte leakage were observed. Interestingly, the application of exogenous proline alleviated the oxidative damage induced by Cd accumulation. In fact, Cd-stressed olive plants treated with proline showed an increase of antioxidant enzymes activities, photosynthetic activity, nutritional status, plant growth and oil content of olive fruit. Generally, it seems that proline supplementation alleviated the deleterious effects of young olive plants exposed to Cd stress. Copyright © 2016 Elsevier Inc. All rights reserved.

Genome-wide identification of alternate bearing-associated microRNAs (miRNAs) in olive (Olea europaea L.)

Science.gov (United States)

2013-01-01

Background Alternate bearing is a widespread phenomenon among crop plants, defined as the tendency of certain fruit trees to produce a high-yield crop one year ("on-year"), followed by a low-yield or even no crop the following year ("off-year"). Several factors may affect the balance between such developmental phase-transition processes. Among them are the microRNA (miRNA), being gene-expression regulators that have been found to be involved as key determinants in several physiological processes. Results Six olive (Olea europaea L. cv. Ayvalik variety) small RNA libraries were constructed from fruits (ripe and unripe) and leaves (”on year” and ”off year” leaves in July and in November, respectively) and sequenced by high-throughput Illumina sequencing. The RNA was retrotranscribed and sequenced using the high-throughput Illumina platform. Bioinformatics analyses of 93,526,915 reads identified 135 conserved miRNA, belonging to 22 miRNA families in the olive. In addition, 38 putative novel miRNAs were discovered in the datasets. Expression of olive tree miRNAs varied greatly among the six libraries, indicating the contribution of diverse miRNA in balancing between reproductive and vegetative phases. Predicted targets of miRNA were categorized into 108 process ontology groups with significance abundance. Among those, potential alternate bearing-associated processes were found, such as development, hormone-mediated signaling and organ morphogenesis. The KEGG analyses revealed that the miRNA-targeted genes are involved in seven main pathways, belonging to carbohydrate metabolism and hormone signal-transduction pathways. Conclusion A comprehensive study on olive miRNA related to alternate bearing was performed. Regulation of miRNA under different developmental phases and tissues indicated that control of nutrition and hormone, together with flowering processes had a noteworthy impact on the olive tree alternate bearing. Our results also provide significant data

La clinica parapsicologica

Directory of Open Access Journals (Sweden)

Evrard Renaud

2007-09-01

Full Text Available Gli ultimi due decenni hanno visto nascere una disciplina nuova: l'accoglienza e il sostegno psicologico delle persone che vivono esperienze eccezionali. Avere l'impressione di vivere in una casa abitata, testimoniare l’apparizione di OVNI, interrogarsi sulle possibilità di influenze telepatiche o anche conservare per sé la sensazione irreale di uscire “fuori dal corpo”, sono alcuni esempi di ciò che provano queste persone. L'eterogeneità di queste testimonianze le classifica spesso nella categoria delle "esperienze vissute come paranormali". Se tali resoconti sono sempre pervenuti agli esperti, si deve ai recenti lavori di ripristino dell'ascolto di queste persone.

Assessing ambient ozone injury in olive (Olea europaea L.) plants by using the antioxidant ethylenediurea (EDU) in Saudi Arabia.

Science.gov (United States)

Basahi, J M; Ismail, I M; Haiba, N S; Hassan, I A; Lorenzini, G

2016-06-01

The antiozonant chemical, ethylenediurea (N-[2-(2-oxo-1-imidazolidinyl)ethyl]-N'-phenylurea, abbreviated as EDU), was applied as stem injections or soil drenches to 5-year-old containerized plants of olive (Olea europaea L. cultivar Kalamata) in growth chambers in order to assess its ameliorative effects against realistic ozone (O3) stress. Visible injury symptoms were reduced greatly in individuals treated with EDU, with injection applications having greater protection than soil drenches. EDU application caused increases in the measured ecophysiological parameters compared to untreated individuals. In particular, the stem injection protected plants against photosynthetic impairment (unchanged net photosynthetic rates and intercellular CO2 concentration, in comparison to plants grown in filtered air). EDU application increased the protection of PSII from ambient O3 oxidative stress, although it did not retain the proportion of redox state of QA, pigment composition of photosynthetic apparatus and size of light-harvesting complex of PSII. However, the stem injection of plants with EDU induced lower non-photochemical quenching (NPQ) values in comparison to ambient air (-2 %), indicating a better photoprotection of PSII in comparison to soil drench application. EDU application caused increases in the morphological and biometric parameters compared to individuals exposed to ambient air. To the best of our knowledge, this is the first study highlighting the protection of Kalamata olive trees due to EDU in terms of growth, yield, visible injury, and photosynthetic performance. Furthermore, this study proved that EDU could be a low-cost and a low-technology efficient tool for assessing O3 effects on plant performances in the field in Saudi Arabia.

Human Invariant Natural Killer T Cells Respond to Antigen-Presenting Cells Exposed to Lipids from Olea europaea Pollen.

Science.gov (United States)

Abos Gracia, Beatriz; López Relaño, Juan; Revilla, Ana; Castro, Lourdes; Villalba, Mayte; Martín Adrados, Beatriz; Regueiro, Jose Ramon; Fernández-Malavé, Edgar; Martínez Naves, Eduardo; Gómez Del Moral, Manuel

2017-01-01

Allergic sensitization might be influenced by the lipids present in allergens, which can be recognized by natural killer T (NKT) cells on antigen-presenting cells (APCs). The aim of this study was to analyze the effect of olive pollen lipids in human APCs, including monocytes as well as monocyte-derived macrophages (Mϕ) and dendritic cells (DCs). Lipids were extracted from olive (Olea europaea) pollen grains. Invariant (i)NKT cells, monocytes, Mϕ, and DCs were obtained from buffy coats of healthy blood donors, and their cell phenotype was determined by flow cytometry. iNKT cytotoxicity was measured using a lactate dehydrogenase assay. Gene expression of CD1A and CD1D was performed by RT-PCR, and the production of IL-6, IL-10, IL-12, and TNF-α cytokines by monocytes, Mϕ, and DCs was measured by ELISA. Our results showed that monocytes and monocyte-derived Mϕ treated with olive pollen lipids strongly activate iNKT cells. We observed several phenotypic modifications in the APCs upon exposure to pollen-derived lipids. Both Mϕ and monocytes treated with olive pollen lipids showed an increase in CD1D gene expression, whereas upregulation of cell surface CD1d protein occurred only in Mϕ. Furthermore, DCs differentiated in the presence of human serum enhance their surface CD1d expression when exposed to olive pollen lipids. Finally, olive pollen lipids were able to stimulate the production of IL-6 but downregulated the production of lipopolysaccharide- induced IL-10 by Mϕ. Olive pollen lipids alter the phenotype of monocytes, Mϕ, and DCs, resulting in the activation of NKT cells, which have the potential to influence allergic immune responses. © 2017 S. Karger AG, Basel.

Pentacyclic triterpene in Olea europaea L: A simultaneous determination by high-performance liquid chromatography coupled to mass spectrometry.

Science.gov (United States)

Giménez, Estela; Juan, M Emília; Calvo-Melià, Sara; Barbosa, José; Sanz-Nebot, Victoria; Planas, Joana M

2015-09-04

Pentacyclic triterpenes are gaining interest due to their beneficial health effects, as anti-inflammatory, anti-diabetic and anti-tumoral, among others. In this study, an analytical LC-MS method was developed for the simultaneous determination of maslinic, oleanolic and ursolic acids along with erythrodiol and uvaol, which are the main triterpenic compounds present in the fruits and leaves of Olea europaea L. A Zorbax Eclipse PAH column at 30°C with mobile phase of water (17%) and methanol (83%) at 0.8mL/min conformed the optimal chromatographic conditions that allowed the separation of the compounds of interest, two pairs of which are isomers differing only in the position of one methyl group (oleanolic-ursolic and erythrodiol-uvaol). The ionization was performed in an APCI source at 450°C programmed in negative mode for the triterpenic acids, and in positive for the alcohols. An ion trap (LC-IT-MS) and a triple quadrupole (LC-QqQ-MS) were assessed for maximal sensitivity that was achieved with LC-QqQ-MS. The LODs of triterpenic acids were lower than 1nM, whereas for erythrodiol and uvaol were 4.5 and 7.5nM, respectively. The method was linear for the five analytes in the range of concentrations from 0.005 to 15μM with correlation coefficients exceeding 0.99. The precision and accuracy were ≤9.90% and ≤9.57%, respectively. The applicability of the validated method was assessed in the analysis of the pentacyclic triterpenes in Marfil table olives, after the optimization of the extraction procedure. The developed method constitutes the first step for future studies of triterpenic compounds present in foods that would allow establishing their effects on human health. Copyright © 2015 Elsevier B.V. All rights reserved.

Vulnerability to cavitation in Olea europaea current-year shoots: further evidence of an open-vessel artifact associated with centrifuge and air-injection techniques.

Science.gov (United States)

Torres-Ruiz, José M; Cochard, Hervé; Mayr, Stefan; Beikircher, Barbara; Diaz-Espejo, Antonio; Rodriguez-Dominguez, Celia M; Badel, Eric; Fernández, José Enrique

2014-11-01

Different methods have been devised to analyze vulnerability to cavitation of plants. Although a good agreement between them is usually found, some discrepancies have been reported when measuring samples from long-vesseled species. The aim of this study was to evaluate possible artifacts derived from different methods and sample sizes. Current-year shoot segments of mature olive trees (Olea europaea), a long-vesseled species, were used to generate vulnerability curves (VCs) by bench dehydration, pressure collar and both static- and flow-centrifuge methods. For the latter, two different rotors were used to test possible effects of the rotor design on the curves. Indeed, high-resolution computed tomography (HRCT) images were used to evaluate the functional status of xylem at different water potentials. Measurements of native embolism were used to validate the methods used. The pressure collar and the two centrifugal methods showed greater vulnerability to cavitation than the dehydration method. The shift in vulnerability thresholds in centrifuge methods was more pronounced in shorter samples, supporting the open-vessel artifact hypothesis as a higher proportion of vessels were open in short samples. The two different rotor designs used for the flow-centrifuge method revealed similar vulnerability to cavitation. Only the bench dehydration or HRCT methods produced VCs that agreed with native levels of embolism and water potential values measured in the field. © 2014 Scandinavian Plant Physiology Society.

The transcriptional response to the olive fruit fly (Bactrocera oleae) reveals extended differences between tolerant and susceptible olive (Olea europaea L.) varieties.

Science.gov (United States)

Grasso, Filomena; Coppola, Mariangela; Carbone, Fabrizio; Baldoni, Luciana; Alagna, Fiammetta; Perrotta, Gaetano; Pérez-Pulido, Antonio J; Garonna, Antonio; Facella, Paolo; Daddiego, Loretta; Lopez, Loredana; Vitiello, Alessia; Rao, Rosa; Corrado, Giandomenico

2017-01-01

The olive fruit fly Bactrocera oleae (Diptera: Tephritidae) is the most devastating pest of cultivated olive (Olea europaea L.). Intraspecific variation in plant resistance to B. oleae has been described only at phenotypic level. In this work, we used a transcriptomic approach to study the molecular response to the olive fruit fly in two olive cultivars with contrasting level of susceptibility. Using next-generation pyrosequencing, we first generated a catalogue of more than 80,000 sequences expressed in drupes from approximately 700k reads. The assembled sequences were used to develop a microarray layout with over 60,000 olive-specific probes. The differential gene expression analysis between infested (i.e. with II or III instar larvae) and control drupes indicated a significant intraspecific variation between the more tolerant and susceptible cultivar. Around 2500 genes were differentially regulated in infested drupes of the tolerant variety. The GO annotation of the differentially expressed genes implies that the inducible resistance to the olive fruit fly involves a number of biological functions, cellular processes and metabolic pathways, including those with a known role in defence, oxidative stress responses, cellular structure, hormone signalling, and primary and secondary metabolism. The difference in the induced transcriptional changes between the cultivars suggests a strong genetic role in the olive inducible defence, which can ultimately lead to the discovery of factors associated with a higher level of tolerance to B. oleae.

EFSA NDA Panel (EFSA Panel on Dietetic Products, Nutrition and Allergies), 2014. Scientific Opinion on the substantiation of a health claim related to olive leaf (Olea europaea L.) water extract and increase in glucose tolerance pursuant to Article 13(5) of Regulation (EC) No 1924/2006

DEFF Research Database (Denmark)

Tetens, Inge

substantiation of a health claim related to olive (Olea europaea L.) leaf water extract and increase in glucose tolerance. The food that is the subject of the health claim, olive leaf water extract standardised by its content of oleuropein, is sufficiently characterised. The claimed effect, an increase...... is insufficient to establish a cause and effect relationship between the consumption of olive leaf water extract and an increase in glucose tolerance....... in glucose tolerance, is a beneficial physiological effect as long as serum insulin concentrations are not disproportionately increased. One human intervention study showed an increase in glucose tolerance without disproportionate increase in insulin concentrations after daily consumption of the olive leaf...

Olive (Olea europaea) leaf methanolic extract prevents HCl/ethanol-induced gastritis in rats by attenuating inflammation and augmenting antioxidant enzyme activities.

Science.gov (United States)

Al-Quraishy, Saleh; Othman, Mohamed S; Dkhil, Mohamed A; Abdel Moneim, Ahmed Esmat

2017-07-01

Gastritis is preponderantly characterized by inflammation of the lining epithelial layer and the chronic gastritis is considered as a pre-cancer lesion. For many centuries olive (Olea europaea) leaf has been used for its putative health potential, nonetheless, to date, the gastroprotective effects of olive leaves have not been studied yet. Hence, in this study we investigated whether olive leaf extract (OLE) could protect gastric mucosa against HCl/ethanol-induced gastric mucosal damage in rats. Hcl/ethanol administration caused significant damage to the gastric mucosa, as confirmed by gastric ulcer index and histological evaluation. However, this damage was largely prevented by pre-administering 20mg/kg omeprazole or 100mg/kg OLE. Interestingly, the damage was completely prevented by pre-administering 200 and 300mg/kg OLE. Moreover, OLE attenuated the inflammatory response by decreasing nuclear factor-κB (NF-κB), cycloxygenase-2 (COX-2) and tumor necrosis factor-α (TNF-α) expressions, and down-regulating inducible nitric oxide synthase (iNOS) and interleukin-1β (IL-1β) in gastric mucosa. The gastroprotective mechanism of OLE involved the promotion of enzymatic and nonenzymatic molecules (superoxide dismutase, catalase, glutathione peroxidase, glutathione reductase and glutathione reduced form), promoting nuclear factor erythroid 2-related factor 2 (Nrf2) mRNA expression, halting lipid peroxidation and preventing the overproduction of nitric oxide. Together, our findings clearly demonstrated that OLE could prevent HCl/ethanol-induced gastritis by attenuating inflammation and oxidant/antioxidant imbalance. Indeed, OLE could potentially be useful as a natural therapy for gastritis. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Endophytic colonization and biocontrol performance of Pseudomonas fluorescens PICF7 in olive (Olea europaea L.) are determined neither by pyoverdine production nor swimming motility.

Science.gov (United States)

Maldonado-González, M Mercedes; Schilirò, Elisabetta; Prieto, Pilar; Mercado-Blanco, Jesús

2015-09-01

Pseudomonas fluorescens PICF7 is an indigenous inhabitant of olive (Olea europaea L.) rhizosphere, able to display endophytic lifestyle in roots, to induce a wide range of defence responses upon colonization of this organ and to exert effective biological control against Verticillium wilt of olive (VWO) (Verticillium dahliae). We aimed to evaluate the involvement of specific PICF7 phenotypes in olive root colonization and VWO biocontrol effectiveness by generating mutants impaired in swimming motility (fliI) or siderophore pyoverdine production (pvdI). Besides, the performance of mutants with diminished in vitro growth in potato dextrose agar medium (gltA) and cysteine (Cys) auxotrophy was also assessed. Results showed that olive root colonization and VWO biocontrol ability of the fliI, pvdI and gltA mutants did not significantly differ from that displayed by the parental strain PICF7. Consequently, altered in vitro growth, swimming motility and pyoverdine production contribute neither to PICF7 VWO suppressive effect nor to its colonization ability. In contrast, the Cys auxotroph mutant showed reduced olive root colonization capacity and lost full biocontrol efficacy. Moreover, confocal laser scanning microscopy revealed that all mutants tested were able to endophytically colonize root tissue to the same extent as wild-type PICF7, discarding these traits as relevant for its endophytic lifestyle. © 2014 Society for Applied Microbiology and John Wiley & Sons Ltd.

Identification of leaf volatiles from olive (Olea europaea) and their possible role in the ovipositional preferences of olive fly, Bactrocera oleae (Rossi) (Diptera: Tephritidae).

Science.gov (United States)

Malheiro, Ricardo; Casal, Susana; Cunha, Sara C; Baptista, Paula; Pereira, José Alberto

2016-01-01

The olive fly, Bactrocera oleae (Rossi), is a monophagous pest that displays an oviposition preference among cultivars of olive (Olea europaea L.). To clarify the oviposition preference, the olive leaf volatiles of three olive cultivars (Cobrançosa, Madural and Verdeal Transmontana) were assessed by headspace solid-phase microextraction gas chromatography-mass spectrometry (HS-SPME-GC/MS) at six different periods of olive fruit maturation and degrees of infestation. A total of 39 volatiles were identified, mainly esters and alcohols, with a minor percentage of aldehydes, ketones and terpenic compounds, including sesquiterpenes. At sampling dates with higher degrees of infestation, cv. Cobrançosa had, simultaneously, significantly lower infestation degrees and higher volatile amounts than the other two cultivars, with a probable deterrent effect for oviposition. The green leaf volatiles (GLVs) (Z)-3-hexen-1-ol and (Z)-3-hexen-1-ol acetate) were the main compounds identified in all cultivars, together with toluene. The abundance of GLVs decreased significantly throughout maturation, without significant differences among cultivars, while toluene showed a general increase and positive correlation with olive fly infestation levels. The results obtained could broaden our understanding of the roles of various types and amounts of olive volatiles in the environment, especially in olive fly host selection and cultivar preference. Copyright © 2015 Elsevier Ltd. All rights reserved.

Immunoproteomic tools are used to identify masked allergens: Ole e 12, an allergenic isoflavone reductase from olive (Olea europaea) pollen.

Science.gov (United States)

Castro, Lourdes; Crespo, Jesús F; Rodríguez, Julia; Rodríguez, Rosalía; Villalba, Mayte

2015-12-01

Proteins performing important biochemical activities in the olive tree (Olea europaea) pollen have been identified as allergens. One novel 37-kDa protein seems to be associated to the IgE-binding profile of a group of patients suffering allergy to peach and olive pollen. Three previously described olive pollen allergens exhibit very similar molecular mass. Our objective was to identify this allergen by using immunoproteomic approaches. After 2D-electrophoresis and mass spectrometry, peptide sequences from several IgE-binding spots, allowed identifying this new allergen, as well as cloning and DNA sequencing of the corresponding gene. The allergen, named Ole e 12, is a polymorphic isoflavone reductase-like protein of 308 amino acids showing 80% and 74% identity with birch and pear allergens, Bet v 6 and Pyr c 5, respectively. A prevalence of 33% in the selected population is in contrast to 4%-10% in groups of subjects suffering from pollinosis. Recombinant allergen was produced in Escherichia coli, and deeply characterised. Immunoblotting and ELISA detection as well as inhibition experiments were performed with polyclonal antisera and allergic patients' sera. The recombinant allergen retains the IgE reactivity of its natural counterpart. Close structural and immunological relationships between members of this protein family were supported by their IgG recognition in vegetable species. In summary, Ole e 12 is a minor olive pollen allergen, which gains relevance in patients allergic to peach with olive pollinosis. Proteomic approaches used to analyse this allergen provide useful tools to identify hidden allergens, relevant for several allergic populations and thus complete allergenic panels. Copyright © 2015 Elsevier B.V. All rights reserved.

Construction of Core Collections Suitable for Association Mapping to Optimize Use of Mediterranean Olive (Olea europaea L.) Genetic Resources

Science.gov (United States)

El Bakkali, Ahmed; Haouane, Hicham; Moukhli, Abdelmajid; Costes, Evelyne; Van Damme, Patrick; Khadari, Bouchaib

2013-01-01

Phenotypic characterisation of germplasm collections is a decisive step towards association mapping analyses, but it is particularly expensive and tedious for woody perennial plant species. Characterisation could be more efficient if focused on a reasonably sized subset of accessions, or so-called core collection (CC), reflecting the geographic origin and variability of the germplasm. The questions that arise concern the sample size to use and genetic parameters that should be optimized in a core collection to make it suitable for association mapping. Here we investigated these questions in olive (Olea europaea L.), a perennial fruit species. By testing different sampling methods and sizes in a worldwide olive germplasm bank (OWGB Marrakech, Morocco) containing 502 unique genotypes characterized by nuclear and plastid loci, a two-step sampling method was proposed. The Shannon-Weaver diversity index was found to be the best criterion to be maximized in the first step using the Core Hunter program. A primary core collection of 50 entries (CC50) was defined that captured more than 80% of the diversity. This latter was subsequently used as a kernel with the Mstrat program to capture the remaining diversity. 200 core collections of 94 entries (CC94) were thus built for flexibility in the choice of varieties to be studied. Most entries of both core collections (CC50 and CC94) were revealed to be unrelated due to the low kinship coefficient, whereas a genetic structure spanning the eastern and western/central Mediterranean regions was noted. Linkage disequilibrium was observed in CC94 which was mainly explained by a genetic structure effect as noted for OWGB Marrakech. Since they reflect the geographic origin and diversity of olive germplasm and are of reasonable size, both core collections will be of major interest to develop long-term association studies and thus enhance genomic selection in olive species. PMID:23667437

Colonization of olive trees (Olea europaea L.) with the arbuscular mycorrhizal fungus Glomus sp. modified the glycolipids biosynthesis and resulted in accumulation of unsaturated fatty acids.

Science.gov (United States)

Mechri, Beligh; Attia, Faouzi; Tekaya, Meriem; Cheheb, Hechmi; Hammami, Mohamed

2014-09-01

The influence of arbuscular mycorrhizal (AM) fungi colonization on photosynthesis, mineral nutrition, the amount of phospholipids and glycolipids in the leaves of olive (Olea europaea L.) trees was investigated. After six months of growth, the rate of photosynthesis, carboxylation efficiency, transpiration and stomatal conductance in mycorrhizal (M) plants was significantly higher than that of non-mycorrhizal (NM) plants. The inoculation treatment increased the foliar P and Mg but not N. The amount of glycolipids in the leaves of M plants was significantly higher than that of NM plants. However, the amount of phospholipids in the leaves of M plants was not significantly different to that in the leaves of NM plants. Also, we observed a significant increase in the level of α-linolenic acid (C18:3ω3) in glycolipids of M plants. This work supports the view that increased glycolipids level in the leaves of M plants could be involved, at least in part, in the beneficial effects of mycorrhizal colonization on photosynthesis performance of olive trees. To our knowledge, this is the first report on the effect of AM fungi on the amount of glycolipids in the leaves of mycorrhizal plants. Copyright © 2014 Elsevier GmbH. All rights reserved.

Spatial and taxonomical overlap of fungi on phylloplanes and invasive alien ladybirds with fungal infections in tree crowns of urban green spaces

DEFF Research Database (Denmark)

Howe, Andrew Gordon; Ravn, Hans Peter; Jensen, Annette Bruun

2016-01-01

Occurrence of entomopathogenic fungi on phylloplanes in Tilia x europaea crowns between 1 - 13m was assessed in urban parks. Prevalence of fungal infections in ladybirds (Coleoptera: Coccinellidae) collected from T. x europaea was assessed to determine whether fungi found on phylloplanes also occ...

Cooley’s Anemia Symposium (6th) Held in New York on 13-15 March 1990. Annals of the New York Academy of Sciences. Volume 612

Science.gov (United States)

1990-12-28

bIstituto di Ricerca sulle Talassemie e Anemie Mediterranee Consiglio Nazionale delle Ricerche Cagliari Italy dlstituto di Clinica e Biologia dell’Eta...Persistence of Fetal Hemoglobin S. OTTrOLENGHI,a S. NICOLIS, a C. BERTINI,a A. RONCHI, a S. CROTfA,a AND B. GIGLIONIb ’Dipartimento di Genetica e di Biologia ...TERESA TUVERI, b MARIA TERESA SCALAS,b GIOVANNI MONNI,d GIOVANNI OLLA,d AND RENZO GALANELLOb blstituto di Clinica e Biologia dell’Etti Evolutiva

Selection of greenery plants' group tolerant to mineralized human wastes for their inclusion into intrasystem mass exchange of BTLSS

Science.gov (United States)

Tikhomirova, Natalia; Tikhomirov, Alexander A.; Kalacheva, Galina; Ushakova, Sofya; Trifonov, Sergey V.; Pavlova, Anastasiya

2016-07-01

A possible way solving the inclusion problem of the human liquid wastes containing sodium chloride into intrasystem mass exchange of bio-technical life support system (BTLSS) is selection of such species of greenery plants that can utilize sodium chloride, be edible for a human and have rather a high productivity. Our previous works showed that salt-accumulating halophyte Salicornia europaea L. was a promising candidate for sodium chloride inclusion into BTLSS mass exchange. However, with the aim of creation of more various human diet possibilities a set of greenery plants cultivated by the water culture method was estimated. Based on preliminary experiments the plants Brassica juncea L., Nasturtium officinale R. Br., Lepidium sativum angustifolia L. and Salicornia europaea L. were chosen as the investigation objects. The nutrient solution for greenery plant's cultivation was obtained after harvesting the wheat plants grown on the solution with mineralized human wastes' addition. The results of the first stage of the investigations carried out showed that plants of Brassica juncea and Lepidium sativum angustifolia are unpromising for their inclusion into BTLSS because of a set of physiological characteristics. On the next stage of investigations, an experimental model of closed ecosystem was created. For that purpose the plants of Salicornia europaea and Nasturtium officinale were introduced in the phototroph unit structure. It was determined that there was deficiency of main macronutrients for Salicornia europaea and Nasturtium officinale including sodium for Salicornia europaea. The deficiency had an effect on plants productivity and on carry-over of sodium from solution by Salicornia europaea. Thus in the future experiment it is necessary to carry out desalinization of solution by Salicornia europaea plants. Nasturtium officinale, that is rich in essential fatty acids and contributes into variety of human vegetable diet is planned to be cultivated by the

Neuroprotection by Combined Administration with Maslinic Acid, a Natural Product from Olea europaea, and MK-801 in the Cerebral Ischemia Model

Directory of Open Access Journals (Sweden)

Yisong Qian

2016-08-01

Full Text Available Glutamate-mediated excitotoxicity is a major cause of ischemic brain damage. MK-801 confers neuroprotection by attenuating the activation of the N-methyl-d-aspartate (NMDA receptor, but it failed in clinical use due to the short therapeutic window. Here we aim to investigate the effects of maslinic acid, a natural product from Olea europaea, on the therapeutic time window and dose range for the neuroprotection of MK-801. Rats were administered with maslinic acid intracerebroventricularly and cerebral ischemia was induced by middle cerebral artery occlusion (MCAO followed by reperfusion. MK-801 was administered at 1 h, 2 h, 3 h and 4 h after ischemia, respectively. The cerebral infarct volume was determined by 2,3,5-Triphenyltetrazolium chloride (TTC staining, neuronal damage was assessed by Haematoxylin Eosin (H&E staining, and the expression of glial glutamate transporters and glial fibrillary acidic protein (GFAP was evaluated by immunohistochemistry and Western blot post-ischemia. Results showed that the presence of maslinic acid extended the therapeutic time window for MK-801 from 1 h to 3 h. Co-treatment of maslinic acid and MK-801 at a subthreshold dosage obviously induced neuroprotection after ischemia. The combination of these two compounds improved the outcome in ischemic rats. Moreover, maslinic acid treatment promoted the expression of GLT-1 and GFAP post-ischemia. These data suggest that the synergistic effect of maslinic acid on neurological protection might be associated with the improvement of glial function, especially with the increased expression of GLT-1. The combination therapy of maslinic acid and MK-801 may prove to be a potential strategy for treating acute ischemic stroke.

Neuroprotection by Combined Administration with Maslinic Acid, a Natural Product from Olea europaea, and MK-801 in the Cerebral Ischemia Model.

Science.gov (United States)

Qian, Yisong; Tang, Xuzhen; Guan, Teng; Li, Yunman; Sun, Hongbin

2016-08-19

Glutamate-mediated excitotoxicity is a major cause of ischemic brain damage. MK-801 confers neuroprotection by attenuating the activation of the N-methyl-d-aspartate (NMDA) receptor, but it failed in clinical use due to the short therapeutic window. Here we aim to investigate the effects of maslinic acid, a natural product from Olea europaea, on the therapeutic time window and dose range for the neuroprotection of MK-801. Rats were administered with maslinic acid intracerebroventricularly and cerebral ischemia was induced by middle cerebral artery occlusion (MCAO) followed by reperfusion. MK-801 was administered at 1 h, 2 h, 3 h and 4 h after ischemia, respectively. The cerebral infarct volume was determined by 2,3,5-Triphenyltetrazolium chloride (TTC) staining, neuronal damage was assessed by Haematoxylin Eosin (H&E) staining, and the expression of glial glutamate transporters and glial fibrillary acidic protein (GFAP) was evaluated by immunohistochemistry and Western blot post-ischemia. Results showed that the presence of maslinic acid extended the therapeutic time window for MK-801 from 1 h to 3 h. Co-treatment of maslinic acid and MK-801 at a subthreshold dosage obviously induced neuroprotection after ischemia. The combination of these two compounds improved the outcome in ischemic rats. Moreover, maslinic acid treatment promoted the expression of GLT-1 and GFAP post-ischemia. These data suggest that the synergistic effect of maslinic acid on neurological protection might be associated with the improvement of glial function, especially with the increased expression of GLT-1. The combination therapy of maslinic acid and MK-801 may prove to be a potential strategy for treating acute ischemic stroke.

Salt stress induces differential regulation of the phenylpropanoid pathway in Olea europaea cultivars Frantoio (salt-tolerant) and Leccino (salt-sensitive).

Science.gov (United States)

Rossi, Lorenzo; Borghi, Monica; Francini, Alessandra; Lin, Xiuli; Xie, De-Yu; Sebastiani, Luca

2016-10-01

Olive tree (Olea europaea L.) is an important crop in the Mediterranean Basin where drought and salinity are two of the main factors affecting plant productivity. Despite several studies have reported different responses of various olive tree cultivars to salt stress, the mechanisms that convey tolerance and sensitivity remain largely unknown. To investigate this issue, potted olive plants of Leccino (salt-sensitive) and Frantoio (salt-tolerant) cultivars were grown in a phytotron chamber and treated with 0, 60 and 120mM NaCl. After forty days of treatment, growth analysis was performed and the concentration of sodium in root, stem and leaves was measured by atomic absorption spectroscopy. Phenolic compounds were extracted using methanol, hydrolyzed with butanol-HCl, and quercetin and kaempferol quantified via high performance liquid-chromatography-electrospray-mass spectrometry (HPLC-ESI-MS) and HPLC-q-Time of Flight-MS analyses. In addition, the transcripts levels of five key genes of the phenylpropanoid pathway were measured by quantitative Real-Time PCR. The results of this study corroborate the previous observations, which showed that Frantoio and Leccino differ in allocating sodium in root and leaves. This study also revealed that phenolic compounds remain stable or are strongly depleted under long-time treatment with sodium in Leccino, despite a strong up-regulation of key genes of the phenylpropanoid pathway was observed. Frantoio instead, showed a less intense up-regulation of the phenylpropanoid genes but overall higher content of phenolic compounds. These data suggest that Frantoio copes with the toxicity imposed by elevated sodium not only with mechanisms of Na + exclusion, but also promptly allocating effective and adequate antioxidant compounds to more sensitive organs. Copyright © 2016 Elsevier GmbH. All rights reserved.

Specific Fluorescence in Situ Hybridization (FISH) Test to Highlight Colonization of Xylem Vessels by Xylella fastidiosa in Naturally Infected Olive Trees (Olea europaea L.)

Science.gov (United States)

Cardinale, Massimiliano; Luvisi, Andrea; Meyer, Joana B.; Sabella, Erika; De Bellis, Luigi; Cruz, Albert C.; Ampatzidis, Yiannis; Cherubini, Paolo

2018-01-01

The colonization behavior of the Xylella fastidiosa strain CoDiRO, the causal agent of olive quick decline syndrome (OQDS), within the xylem of Olea europaea L. is still quite controversial. As previous literature suggests, even if xylem vessel occlusions in naturally infected olive plants were observed, cell aggregation in the formation of occlusions had a minimal role. This observation left some open questions about the whole behavior of the CoDiRO strain and its actual role in OQDS pathogenesis. In order to evaluate the extent of bacterial infection in olive trees and the role of bacterial aggregates in vessel occlusions, we tested a specific fluorescence in situ hybridization (FISH) probe (KO 210) for X. fastidiosa and quantified the level of infection and vessel occlusion in both petioles and branches of naturally infected and non-infected olive trees. All symptomatic petioles showed colonization by X. fastidiosa, especially in the larger innermost vessels. In several cases, the vessels appeared completely occluded by a biofilm containing bacterial cells and extracellular matrix and the frequent colonization of adjacent vessels suggested a horizontal movement of the bacteria. Infected symptomatic trees had 21.6 ± 10.7% of petiole vessels colonized by the pathogen, indicating an irregular distribution in olive tree xylem. Thus, our observations point out the primary role of the pathogen in olive vessel occlusions. Furthermore, our findings indicate that the KO 210 FISH probe is suitable for the specific detection of X. fastidiosa. PMID:29681910

AOX1-Subfamily Gene Members in Olea europaea cv. "Galega Vulgar"-Gene Characterization and Expression of Transcripts during IBA-Induced in Vitro Adventitious Rooting.

Science.gov (United States)

Velada, Isabel; Grzebelus, Dariusz; Lousa, Diana; M Soares, Cláudio; Santos Macedo, Elisete; Peixe, Augusto; Arnholdt-Schmitt, Birgit; G Cardoso, Hélia

2018-02-17

Propagation of some Olea europaea L. cultivars is strongly limited due to recalcitrant behavior in adventitious root formation by semi-hardwood cuttings. One example is the cultivar "Galega vulgar". The formation of adventitious roots is considered a morphological response to stress. Alternative oxidase (AOX) is the terminal oxidase of the alternative pathway of the plant mitochondrial electron transport chain. This enzyme is well known to be induced in response to several biotic and abiotic stress situations. This work aimed to characterize the alternative oxidase 1 (AOX1)-subfamily in olive and to analyze the expression of transcripts during the indole-3-butyric acid (IBA)-induced in vitro adventitious rooting (AR) process. OeAOX1a (acc. no. MF410318) and OeAOX1d (acc. no. MF410319) were identified, as well as different transcript variants for both genes which resulted from alternative polyadenylation events. A correlation between transcript accumulation of both OeAOX1a and OeAOX1d transcripts and the three distinct phases (induction, initiation, and expression) of the AR process in olive was observed. Olive AOX1 genes seem to be associated with the induction and development of adventitious roots in IBA-treated explants. A better understanding of the molecular mechanisms underlying the stimulus needed for the induction of adventitious roots may help to develop more targeted and effective rooting induction protocols in order to improve the rooting ability of difficult-to-root cultivars.

A de novo transcriptomic approach to identify flavonoids and anthocyanins switch-off in olive (Olea europaea L. drupes at different stages of maturation

Directory of Open Access Journals (Sweden)

Domenico eIaria

2016-01-01

Full Text Available During ripening, the fruits of the olive tree (Olea europaea L. undergo a progressive chromatic change characterized by the formation of a red-brown spot which gradually extends on the epidermis and in the innermost part of the mesocarp. This event finds an exception in the Leucocarpa cultivar, in which we observe a destabilized equilibrium between the metabolisms of chlorophyll and other pigments, particularly the anthocyanins whose switch-off during maturation promotes the white coloration of fruits. Despite its importance, genomic information on the olive tree is still lacking. Different RNA-seq libraries were generated from drupes of ‘Leucocarpa’ and ‘Cassanese’ olive genotypes, sampled at 100 and 130 days after flowering (DAF, and were used in order to identify transcripts involved in the main phenotypic changes of fruits during maturation and their corresponding expression patterns. A total of 103,359 transcripts were obtained and 3792 and 3064 were differentially expressed in ‘Leucocarpa’ and ‘Cassanese’ genotypes, respectively, during 100-130 DAF transition. Among them flavonoid and anthocyanin related transcripts such as phenylalanine ammonia lyase (PAL, cinnamate 4-hydroxylase (C4H, 4-coumarate-CoA ligase (4CL, chalcone synthase (CHS, chalcone isomerase (CHI, flavanone 3-hydroxylase (F3H, flavonol 3’-hydrogenase (F3'H, flavonol 3’5’-hydrogenase (F3'5'H, flavonol synthase (FLS, dihydroflavonol 4-reductase (DFR, anthocyanidin synthase (ANS, UDP-glucose:anthocianidin:flavonoid glucosyltransferase (UFGT were identified.These results contribute to reducing the current gap in information regarding metabolic processes, including those linked to fruit pigmentation in the olive.

On the use of leaf spectral indices to assess water status and photosynthetic limitations in Olea europaea L. during water-stress and recovery.

Science.gov (United States)

Sun, Pengsen; Wahbi, Said; Tsonev, Tsonko; Haworth, Matthew; Liu, Shirong; Centritto, Mauro

2014-01-01

Diffusional limitations to photosynthesis, relative water content (RWC), pigment concentrations and their association with reflectance indices were studied in olive (Olea europaea) saplings subjected to water-stress and re-watering. RWC decreased sharply as drought progressed. Following rewatering, RWC gradually increased to pre-stress values. Photosynthesis (A), stomatal conductance (gs), mesophyll conductance (gm), total conductance (gt), photochemical reflectance index (PRI), water index (WI) and relative depth index (RDI) closely followed RWC. In contrast, carotenoid concentration, the carotenoid to chlorophyll ratio, water content reflectance index (WCRI) and structural independent pigment index (SIPI) showed an opposite trend to that of RWC. Photosynthesis scaled linearly with leaf conductance to CO2; however, A measured under non-photorespiratory conditions (A1%O2) was approximately two times greater than A measured at 21% [O2], indicating that photorespiration likely increased in response to drought. A1%O2 also significantly correlated with leaf conductance parameters. These relationships were apparent in saturation type curves, indicating that under non-photorespiratory conditions, CO2 conductance was not the major limitations to A. PRI was significant correlated with RWC. PRI was also very sensitive to pigment concentrations and photosynthesis, and significantly tracked all CO2 conductance parameters. WI, RDI and WCRI were all significantly correlated with RWC, and most notably to leaf transpiration. Overall, PRI correlated more closely with carotenoid concentration than SIPI; whereas WI tracked leaf transpiration more effectively than RDI and WCRI. This study clearly demonstrates that PRI and WI can be used for the fast detection of physiological traits of olive trees subjected to water-stress.

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_004572 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_005966 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_003116 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_006085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_004551 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_003112 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_006369 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_002488 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_002946 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_006368 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_003869 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

Assessing Animal Welfare Impacts in the Management of European Rabbits (Oryctolagus cuniculus), European Moles (Talpa europaea) and Carrion Crows (Corvus corone).

Science.gov (United States)

Baker, Sandra E; Sharp, Trudy M; Macdonald, David W

2016-01-01

Human-wildlife conflict is a global issue. Attempts to manage this conflict impact upon wild animal welfare, an issue receiving little attention until relatively recently. Where human activities harm animal welfare these effects should be minimised where possible. However, little is known about the welfare impacts of different wildlife management interventions, and opinions on impacts vary widely. Welfare impacts therefore need to be assessed objectively. Our objectives were to: 1) establish whether an existing welfare assessment model could differentiate and rank the impacts of different wildlife management interventions (for decision-making purposes); 2) identify and evaluate any additional benefits of making formal welfare assessments; and 3) illustrate issues raised by application of the model. We applied the welfare assessment model to interventions commonly used with rabbits (Oryctolagus cuniculus), moles (Talpa europaea) and crows (Corvus corone) in the UK. The model ranked interventions for rabbits (least impact first: fencing, head shot, chest shot) and crows (shooting, scaring, live trapping with cervical dislocation). For moles, managing molehills and tunnels scored least impact. Both spring trapping, and live trapping followed by translocation, scored greater impacts, but these could not be compared directly as they scored on different axes of the model. Some rankings appeared counter-intuitive, highlighting the need for objective formal welfare assessments. As well as ranking the humaneness of interventions, the model highlighted future research needs and how Standard Operating Procedures might be improved. The model is a milestone in assessing wildlife management welfare impacts, but our research revealed some limitations of the model and we discuss likely challenges in resolving these. In future, the model might be developed to improve its utility, e.g. by refining the time-scales. It might also be used to reach consensus among stakeholders about

Assessing Animal Welfare Impacts in the Management of European Rabbits (Oryctolagus cuniculus), European Moles (Talpa europaea) and Carrion Crows (Corvus corone)

Science.gov (United States)

Baker, Sandra E.; Sharp, Trudy M.; Macdonald, David W.

2016-01-01

Human-wildlife conflict is a global issue. Attempts to manage this conflict impact upon wild animal welfare, an issue receiving little attention until relatively recently. Where human activities harm animal welfare these effects should be minimised where possible. However, little is known about the welfare impacts of different wildlife management interventions, and opinions on impacts vary widely. Welfare impacts therefore need to be assessed objectively. Our objectives were to: 1) establish whether an existing welfare assessment model could differentiate and rank the impacts of different wildlife management interventions (for decision-making purposes); 2) identify and evaluate any additional benefits of making formal welfare assessments; and 3) illustrate issues raised by application of the model. We applied the welfare assessment model to interventions commonly used with rabbits (Oryctolagus cuniculus), moles (Talpa europaea) and crows (Corvus corone) in the UK. The model ranked interventions for rabbits (least impact first: fencing, head shot, chest shot) and crows (shooting, scaring, live trapping with cervical dislocation). For moles, managing molehills and tunnels scored least impact. Both spring trapping, and live trapping followed by translocation, scored greater impacts, but these could not be compared directly as they scored on different axes of the model. Some rankings appeared counter-intuitive, highlighting the need for objective formal welfare assessments. As well as ranking the humaneness of interventions, the model highlighted future research needs and how Standard Operating Procedures might be improved. The model is a milestone in assessing wildlife management welfare impacts, but our research revealed some limitations of the model and we discuss likely challenges in resolving these. In future, the model might be developed to improve its utility, e.g. by refining the time-scales. It might also be used to reach consensus among stakeholders about

Involvement of alternative oxidase (AOX) in adventitious rooting of Olea europaea L. microshoots is linked to adaptive phenylpropanoid and lignin metabolism.

Science.gov (United States)

Santos Macedo, E; Sircar, D; Cardoso, H G; Peixe, A; Arnholdt-Schmitt, B

2012-09-01

Alternative oxidase (AOX) has been proposed as a functional marker candidate in a number of events involving cell differentiation, including rooting efficiency in semi-hardwood shoot cuttings of olive (Olea europaea L.). To ascertain the general importance of AOX in olive rooting, the auxin-induced rooting process was studied in an in vitro system for microshoot propagation. Inhibition of AOX by salicylhydroxamic acid (SHAM) significantly reduced rooting efficiency. However, the inhibitor failed to exhibit any effect on the preceding calli stage. This makes the system appropriate for distinguishing dedifferentiation and de novo differentiation during root induction. Metabolite analyses of microshoots showed that total phenolics, total flavonoids and lignin contents were significantly reduced upon SHAM treatment. It was concluded that the influence of alternative respiration on root formation was associated to adaptive phenylpropanoid and lignin metabolism. Transcript profiles of two olive AOX genes (OeAOX1a and OeAOX2) were examined during the process of auxin-induced root induction. Both genes displayed stable transcript accumulation in semi-quantitative RT-PCR analysis during all experimental stages. In contrary, when the reverse primer for OeAOX2 was designed from the 3'-UTR instead of the ORF, differential transcript accumulation was observed suggesting posttranscriptional regulation of OeAOX2 during metabolic acclimation. This result confirms former observations in olive semi-hardwood shoot cuttings on differential OeAOX2 expression during root induction. It further points to the importance of future studies on the functional role of sequence and length polymorphisms in the 3'-UTR of this gene. The manuscript reports the general importance of AOX in olive adventitious rooting and the association of alternative respiration to adaptive phenylpropanoid and lignin metabolism.

Assessing Animal Welfare Impacts in the Management of European Rabbits (Oryctolagus cuniculus, European Moles (Talpa europaea and Carrion Crows (Corvus corone.

Directory of Open Access Journals (Sweden)

Sandra E Baker

Full Text Available Human-wildlife conflict is a global issue. Attempts to manage this conflict impact upon wild animal welfare, an issue receiving little attention until relatively recently. Where human activities harm animal welfare these effects should be minimised where possible. However, little is known about the welfare impacts of different wildlife management interventions, and opinions on impacts vary widely. Welfare impacts therefore need to be assessed objectively. Our objectives were to: 1 establish whether an existing welfare assessment model could differentiate and rank the impacts of different wildlife management interventions (for decision-making purposes; 2 identify and evaluate any additional benefits of making formal welfare assessments; and 3 illustrate issues raised by application of the model. We applied the welfare assessment model to interventions commonly used with rabbits (Oryctolagus cuniculus, moles (Talpa europaea and crows (Corvus corone in the UK. The model ranked interventions for rabbits (least impact first: fencing, head shot, chest shot and crows (shooting, scaring, live trapping with cervical dislocation. For moles, managing molehills and tunnels scored least impact. Both spring trapping, and live trapping followed by translocation, scored greater impacts, but these could not be compared directly as they scored on different axes of the model. Some rankings appeared counter-intuitive, highlighting the need for objective formal welfare assessments. As well as ranking the humaneness of interventions, the model highlighted future research needs and how Standard Operating Procedures might be improved. The model is a milestone in assessing wildlife management welfare impacts, but our research revealed some limitations of the model and we discuss likely challenges in resolving these. In future, the model might be developed to improve its utility, e.g. by refining the time-scales. It might also be used to reach consensus among

Essais de prolifération et d'enracinement de matériel issu de rajeunissement par bouturage d'oliviers adultes (Olea europaea L. et de germination in vitro : effets de cytokinine et d'auxines

Directory of Open Access Journals (Sweden)

Walali Loudiyi D

2005-01-01

Full Text Available Proliferation and rooting of juvenile and adult olive explants (Olea europaea L.: effects of cytokinin and auxins. The micropropagation trials conducted concerned juvenile and adult material from the ‘Moroccan Picholine’ olive cultivar. Zeatin, added to the proliferation medium, was tested at 0, 1, 5, 10 et 20 mg/l. Root induction was performed on media contaning IAA, IBA or NAA tested at 0, 0.5, 1, 2 et 4 mg/l. A significant (P<0.001 interaction exists between the explant type and the cytokinine concentration on one hand and the type and concentration of auxin on the other hand. The highest bud sprouting and shoot development were obtained on medium supplemented with 5 mg/l zeatin. For economical reasons, satisfying results can be obtained with only 1 mg/l. Rooting of microcuttings reached 100% when NAA, which proved to be the best auxin for root induction, was used at 1 mg/l. No rooting was observed in the case of adult plant material. Further investigations are being undertaken to improve the reactivity of this recalcitrant type of material.

RP-HPLC-DAD-ESI-QTOF-MS based metabolic profiling of the potential Olea europaea by-product "wood" and its comparison with leaf counterpart.

Science.gov (United States)

Ammar, Sonda; Contreras, Maria Del Mar; Gargouri, Boutheina; Segura-Carretero, Antonio; Bouaziz, Mohamed

2017-05-01

Olea europaea L. organs such as leaves, stems and roots have been associated with numerous in vivo and in vitro biological activities and used for traditional medicinal purposes. However, tree wood is an untapped resource with little information about their chemical composition. That is why, the objective of this study is to increase the knowledge about phytochemicals from 'Chemlali' olive wood by means of mass spectrometry-based analyses. Its comparison with by-products derived from leaves was also studied. Hydromethanol extracts from wood and leaves with stems of 'Chemlali' olive cultivar were analysed using reversed-phase (RP) high-performance liquid chromatography (HPLC) coupled to two detection systems: diode-array detection (DAD) and quadrupole time-of-flight (QTOF) mass spectrometry (MS) in negative ion mode. Tandem MS experiments were performed to establish the chemical structure of olive phytochemicals. A total of 85 compounds were characterised in the studied olive parts and classified as: sugars (3), organic acids (5), one phenolic aldehyde, simple phenolic acids (6), simple phenylethanoids (5), flavonoids (14), coumarins (3), caffeoyl phenylethanoid derivatives (6), iridoids (5), secoiridoids (32), and lignans (5). To our knowledge, the major part of these metabolites was not previously reported in olive tree wood, and 10 olive chemical constituents were identified for the first time in the Oleaceae family. The results presented here demonstrated the usefulness of the methodology proposed, based on RP-HPLC-DAD-ESI-QTOF-MS and MS/MS, to develop an exhaustive metabolic profiling and to recover new biologically active compounds in olive wood with pharmacologic and cosmetic potential. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

AOX1-Subfamily Gene Members in Olea europaea cv. “Galega Vulgar”—Gene Characterization and Expression of Transcripts during IBA-Induced in Vitro Adventitious Rooting

Science.gov (United States)

Lousa, Diana; M. Soares, Cláudio; Santos Macedo, Elisete; Arnholdt-Schmitt, Birgit

2018-01-01

Propagation of some Olea europaea L. cultivars is strongly limited due to recalcitrant behavior in adventitious root formation by semi-hardwood cuttings. One example is the cultivar ”Galega vulgar”. The formation of adventitious roots is considered a morphological response to stress. Alternative oxidase (AOX) is the terminal oxidase of the alternative pathway of the plant mitochondrial electron transport chain. This enzyme is well known to be induced in response to several biotic and abiotic stress situations. This work aimed to characterize the alternative oxidase 1 (AOX1)-subfamily in olive and to analyze the expression of transcripts during the indole-3-butyric acid (IBA)-induced in vitro adventitious rooting (AR) process. OeAOX1a (acc. no. MF410318) and OeAOX1d (acc. no. MF410319) were identified, as well as different transcript variants for both genes which resulted from alternative polyadenylation events. A correlation between transcript accumulation of both OeAOX1a and OeAOX1d transcripts and the three distinct phases (induction, initiation, and expression) of the AR process in olive was observed. Olive AOX1 genes seem to be associated with the induction and development of adventitious roots in IBA-treated explants. A better understanding of the molecular mechanisms underlying the stimulus needed for the induction of adventitious roots may help to develop more targeted and effective rooting induction protocols in order to improve the rooting ability of difficult-to-root cultivars. PMID:29462998

Investigation of cytochrome P450 inhibitory properties of maslinic acid, a bioactive compound from Olea europaea L., and its structure-activity relationship.

Science.gov (United States)

Sun, Min; Tang, Yu; Ding, Tonggui; Liu, Mingyao; Wang, Xin

2015-01-15

Maslinic acid (MA), the main pentacyclic triterpene of Olea europaea L. fruit, possesses a variety of pharmacological actions, including hypoglycemic, antioxidant, cardioprotective and antitumoral activities. Despite its importance, little is known about its effects on the cytochrome P450 (CYP) activity in both humans and animals. Therefore, the aim of this study was to investigate the effects of MA on the CYP 1A2, 2C9/11, 2D1/6, 2E1 and 3A2/4 activities by human and rat liver microsomes and specific CYP isoforms. In humans, MA only weakly inhibited CYP3A4 activity in human liver microsomes and specific CYP3A4 isoform with IC50 value at 46.1 and 62.3µM, respectively. In rats, MA also exhibited weak inhibition on CYP2C11, CYP2E1 and CYP3A2 activities with IC50 values more than 100µM. Enzyme kinetic studies showed that the MA was not only a competitive inhibitor of CYP3A4 in humans, but also a competitive inhibitor of CYP2C11 and 3A2 in rats, with Ki of 18.4, 98.7 and 66.3µM, respectively. Moreover, the presence of hydroxyl group at C-2 position of triterpenic acid in MA compared with oleanolic acid could magnify its competitive inhibition on human CYP3A4 activity. The relatively high Ki values of MA would have a low potential to cause the possible toxicity and drug interactions involving CYP enzymes, thus suggesting a sufficient safety for its putative use as a nutraceutical taken together with drugs. Copyright © 2014 Elsevier GmbH. All rights reserved.

Physiological Response of Common Glasswort (Salicornia europaea L. to Potassium Nano-Particles Grown in Saline Soils around the Lake Urmia

Directory of Open Access Journals (Sweden)

Alireza Pirzad

2016-06-01

Full Text Available To evaluate the effects of spraying potassium nano-particles on the osmolytes, photosynthetic pigments, total carotenoids and nutrients of aerial parts of common glasswort (Salicornia europaea L., a factorial experiment based on randomized complete block design with three replications was conducted at the marginal lands of Lake Urmia in 2012. The treatments consisted of application of potassium nano-particle concentrations at five levels (0, 1, 2, 3 and 4 g/l of K nano-particles applied, once, twice and three times. Results of analysis of variance (ANOVA showed that there were significant interaction between the levels and concentrations of potassium nano-particles sprayings on aerial parts with respect to their contents proline, total soluble carbohydrates, total chlorophyll, chlorophyll a and b, total carotenoids (xanthophyll and carotene and nutrients (nitrogen, phosphorus, potassium, calcium and sodium. The highest levels of proline (1.84 mg/g dry weight at one time spraying 4 g/l of K, total soluble carbohydrates (66.9 mg/g dry weight at three times spraying 4 g/l, total chlorophyll (26.23 mg/g fresh weight and chlorophyll b (22.85 mg/g fresh weight at two times of water spraying, and chlorophyll a (9.93 mg/g fresh weight at three times of 4g/l of potassium nano-particles sprayings were obtained. The highest nitrogen (0.95 % of aerial parts and phosphorus (2.99 g/kg dry weight of aerial parts contents were obtained from three times water spraying. However, the highest amounts of aerial plant part of potassium (65.08 g/kg dry weight and sodium (403 g/kg dry weight belonged to the two times, and calcium (29.23 g/kg dry weight to the three times spraying of 4 g/l nano-potassium. Despite of the high concentration of osmolytes by potassium spraying, the nutrient accumulations levels were not significantly different from each other.

Partial Root-Zone Drying of Olive (Olea europaea var. 'Chetoui' Induces Reduced Yield under Field Conditions.

Directory of Open Access Journals (Sweden)

Soumaya Dbara

Full Text Available The productivity of olive trees in arid and semi-arid environments is closely linked to irrigation. It is necessary to improve the efficiency of irrigation techniques to optimise the amount of olive fruit produced in relation to the volume of water used. Partial root-zone drying (PRD is a water saving irrigation technique that theoretically allows the production of a root-to-shoot signal that modifies the physiology of the above-ground parts of the plant; specifically reducing stomatal conductance (gs and improving water use efficiency (WUE. Partial root-zone drying has been successfully applied under field conditions to woody and non-woody crops; yet the few previous trials with olive trees have produced contrasting results. Thirty year-old olive trees (Olea europaea 'var. Chetoui' in a Tunisian grove were exposed to four treatments from May to October for three-years: 'control' plants received 100% of the potential evapotranspirative demand (ETc applied to the whole root-zone; 'PRD100' were supplied with an identical volume of water to the control plants alternated between halves of the root-zone every ten-days; 'PRD50' were given 50% of ETc to half of the root-system, and; 'rain-fed' plants received no supplementary irrigation. Allowing part of the root-zone to dry resulted in reduced vegetative growth and lower yield: PRD100 decreased yield by ~47% during productive years. During the less productive years of the alternate bearing cycle, irrigation had no effect on yield; this suggests that withholding of water during 'off-years' may enhance the effectiveness of irrigation over a two-year cycle. The amount and quality of oil within the olive fruit was unaffected by the irrigation treatment. Photosynthesis declined in the PRD50 and rain-fed trees due to greater diffusive limitations and reduced biochemical uptake of CO2. Stomatal conductance and the foliar concentration of abscisic acid (ABA were not altered by PRD100 irrigation, which may

Partial Root-Zone Drying of Olive (Olea europaea var. 'Chetoui') Induces Reduced Yield under Field Conditions.

Science.gov (United States)

Dbara, Soumaya; Haworth, Matthew; Emiliani, Giovani; Ben Mimoun, Mehdi; Gómez-Cadenas, Aurelio; Centritto, Mauro

2016-01-01

The productivity of olive trees in arid and semi-arid environments is closely linked to irrigation. It is necessary to improve the efficiency of irrigation techniques to optimise the amount of olive fruit produced in relation to the volume of water used. Partial root-zone drying (PRD) is a water saving irrigation technique that theoretically allows the production of a root-to-shoot signal that modifies the physiology of the above-ground parts of the plant; specifically reducing stomatal conductance (gs) and improving water use efficiency (WUE). Partial root-zone drying has been successfully applied under field conditions to woody and non-woody crops; yet the few previous trials with olive trees have produced contrasting results. Thirty year-old olive trees (Olea europaea 'var. Chetoui') in a Tunisian grove were exposed to four treatments from May to October for three-years: 'control' plants received 100% of the potential evapotranspirative demand (ETc) applied to the whole root-zone; 'PRD100' were supplied with an identical volume of water to the control plants alternated between halves of the root-zone every ten-days; 'PRD50' were given 50% of ETc to half of the root-system, and; 'rain-fed' plants received no supplementary irrigation. Allowing part of the root-zone to dry resulted in reduced vegetative growth and lower yield: PRD100 decreased yield by ~47% during productive years. During the less productive years of the alternate bearing cycle, irrigation had no effect on yield; this suggests that withholding of water during 'off-years' may enhance the effectiveness of irrigation over a two-year cycle. The amount and quality of oil within the olive fruit was unaffected by the irrigation treatment. Photosynthesis declined in the PRD50 and rain-fed trees due to greater diffusive limitations and reduced biochemical uptake of CO2. Stomatal conductance and the foliar concentration of abscisic acid (ABA) were not altered by PRD100 irrigation, which may indicate the

La Antracnosis del olivo y su efecto en la calidad del aceite

Directory of Open Access Journals (Sweden)

Moral, J.

2014-06-01

Full Text Available Olive (Olea europaea subsp. europaea var. europaea is one of the first domesticated and cultivated trees that is widely distributed in the Mediterranean regions. The Anthracnose, caused by the two complex fungal species Colletotrichum acutatum and C. gloeosporioides, is the most important disease adversely affecting the olive oil quality. Even so, the effect of Anthracnose on oil quality is largely unknown and many questions remain unanswered. This offers a unique opportunity to study how Colletotrichum species, cultivars, infection type (latent or visible and severity, and other factors that may affect different parameters of oil quality, such us acidity, peroxide value, K232, K270, phenolic compounds, or alkyl esters. This review focuses on the current knowledge of the biology, epidemiology, and management of Anthracnose and its effect on olive oil quality.El olivo (Olea europaea subsp. europaea var. europaea es uno de los primeros cultivos leñosos domesticados. Actualmente el olivo se encuentra ampliamente distribuido por todas las regiones de clima mediterráneo. La Antracnosis, causada por las especies complejas Colletotrichum acutatum y C. gloeosporioides, es la enfermedad del olivo que más afecta a la calidad del aceite. Aun así, el efecto de la Antracnosis en la calidad del aceite es ampliamente desconocido. Por lo que creemos esencial que se afronten estudios encaminados a dilucidar el efecto de las especies del patógeno, el cultivar de olivo y el tipo (latente o visible y severidad de las infecciones de la aceituna en los distintos parámetros de calidad del aceite como la acidez, índice de peróxidos, K232, K270, compuestos fenólicos o ésteres alquílicos. Esta revisión presenta los conocimientos actuales sobre la biología, epidemiología, control, y efecto en la calidad del aceite de la Antracnosis del olivo.

["Investigación Clínica": 50 years disseminating biomedical research].

Science.gov (United States)

Ryder, Elena

2010-06-01

INVESTIGACION CLINICA was founded by the initiative of Américo Negrette, who became its first editor, and it has been published uninterruptedly since July 1960, with a quarterly frequency. The first issues consisted mainly of a collection of reviews of seminars held at the now called Instituto de Investigaciones Clínicas "Dr. Américo Negrette", Facultad de Medicina, Universidad del Zulia, its publisher. Very soon, original research results from this institution were included in the novel journal. In the 60's, papers on results obtained during the outbreaks of Venezuelan Equine Encephalitis present in the area, were prominent. Originally, the journal published 3-4 papers, but due to the increased number of contributions, in 2001, its format changed from 1/16 to 1/8, and now each number includes 11 original articles. Currently, INVESTIGACION CLINICA publishes 44 papers a year, in Spanish or English on different biomedical topics, from contributors all around the world. Progressively it has been included in different renowned indexes, such as PubMed/MEDLINE, Science Citation Index Expanded, Excerpta Medica, Tropical Diseases Bulletin, Copernicus, Scopus, Periodica, and several others. Besides, it can be found in open access through www.Scielo.org.ve, www.freemedicaljournals.com and in our new Web page: https://sites. google.com/site/revistainvestigacionesclinicas/home. Most papers published in INVESTIGACION CLINICA have been cited in the regional or foreign literature accumulating more than 1200 citations by now. For this particular issue, to celebrate the 50th anniversary of INVESTIGACION CLINICA, we have invited some of our more recent referees or authors to contribute with Reviews in their respective areas of expertise.

Encyclopaedia Europaea

DEFF Research Database (Denmark)

Sørensen, Gert

Identity is a keyword in a number of academic fields as well as in public debate and in politics. During the last decades, references to identity have proliferated, yet there is no simple definition available that corresponds to the use of the notion in all contexts. The significance of the notion...

Evoluzioni psicoanalitiche e cambiamento in psicoterapia psicoanalitica

Directory of Open Access Journals (Sweden)

Rosario Di Sauro

2009-06-01

Full Text Available In questo articolo si prende in considerazione l’evoluzione teoretica della psicoanalisi, passando dal modello freudiano monadico ad un approccio di matrice relazionale.  Altresì  viene evidenziato il contributo della psicologia clinica come elemento costitutivo della psicoterapia psicoanalitica, come espressività del continuum psicologia clinica-psicoterapia. Tutto ciò rappresenta, inoltre, la conditio sine qua non per il cambiamento terapeutico. Se ne evidenziano, infatti gli elementi caratteristici per una buona riuscita del processo terapeutico. L’Autore inoltre, mette in rilievo il ruolo della psicocorporeità nel trattamento psicoanalitico, sia come comunicazione del ‘non verbale’ sia come costrutto epistemologico di un nuovo apporto alla scienza psicoanalitica.

Vorkommen und Soziologie der Cuscuta-Arten in der Ufervegetation des Niederrheins

OpenAIRE

Schmitz, Ulf; Lösch, Rainer

2016-01-01

Um den Stand der gegenwärtigen Verbreitung der drei in der Ufervegetation des Niederrheins vorkommenden Cuscuta-Arten C. lupuliformis KROCKER, C. europaea L. und C. gronovii WILLD. festzustellen, wurde eine Kartierung beider Rheinufer zwischen Monheim-Baumberg (Kr. Mettmann) und der niederländischen Grenze durchgeführt. Cuscuta europaea und Cuscuta lupuliformis sind im gesamten Rheinverlauf häufig zu finden, wobei letztere Art die Prallufer des Rheins bevorzugt. Die seltenere Art Cuscuta gron...

Eesti nimekaim ilukirurg jagab enesekindlust / Peep Pree ; intevjueerinud Priit Pullerits

Index Scriptorium Estoniae

Pree, Peep, 1958-

2006-01-01

Vestlus Tartu esteetilise kirurgia erakliiniku Clinica juhatajaga tööst, vastutustundest, ebaõnnestumistest. Kommenteerivad Tartu linnapea Laine Jänes ja Tartu Ülikooli arstiteaduskonna emeriitprofessor Ennu Sepp

Analysis of oilseed of Halophytic species

Directory of Open Access Journals (Sweden)

Parto Roshandel

2015-07-01

Full Text Available Seeds of Atriplex griffithii, Haloxylon ammodendron, Salicornia europaea and Salsola yazdiana were analyzed to determine their potential as sources of edible oil. The quantity of total oil varied from 13.8% in Atriplex griffithii to 20.9% in H. ammodendron. The proportion of unsaturated fatty acids were higher (62-73.8%, with the highest values of α-linoleic acid (18.6%, linoleic acid (28.6% and oleic acid (19.7% in the seeds of A. griffithii, H. ammodendron and S. europaea, respectively. Results of physicochemical evaluation of the extracted oils ranged as follows: iodine values, 99.8-106.5 (g I2/100 g; saponification value, 188-283 (mg KOH/1g of oil; peroxide value, 9-13 (meq./kg and refractive index, 1.4750- 1.4761. Amongst these oilseeds, S. europaea (containing 73.8% unsaturated fatty acids but not erucic acid was the highest in quality for human consumption followed by H. ammodendron.

Effect of water deficit on leaf phenolic composition, gas exchange, oxidative damage and antioxidant activity of four Greek olive (Olea europaea L.) cultivars.

Science.gov (United States)

Petridis, Antonios; Therios, Ioannis; Samouris, Georgios; Koundouras, Stefanos; Giannakoula, Anastasia

2012-11-01

The olive tree (Olea europaea L.) is often exposed to severe water stress during the summer season. In this study, we determined the changes in total phenol content, oleuropein and hydroxytyrosol in the leaves of four olive cultivars ('Gaidourelia', 'Kalamon', 'Koroneiki' and 'Megaritiki') grown under water deficit conditions for two months. Furthermore, we investigated the photosynthetic performance in terms of gas exchange and chlorophyll a fluorescence, as well as malondialdehyde content and antioxidant activity. One-year-old self-rooted plants were subjected to three irrigation treatments that received a water amount equivalent to 100% (Control, C), 66% (Field Capacity 66%, FC(66)) and 33% (Field Capacity 33%, FC(33)) of field capacity. Measurements were conducted 30 and 60 days after the initiation of the experiment. Net CO(2) assimilation rate, stomatal conductance and F(v)/F(m) ratio decreased only in FC(33) plants. Photosynthetic rate was reduced mainly due to stomatal closure, but damage to PSII also contributed to this decrease. Water stress induced the accumulation of phenolic compounds, especially oleuropein, suggesting their role as antioxidants. Total phenol content increased in FC(33) treatment and oleuropein presented a slight increase in FC(66) and a sharper one in FC(33) treatment. Hydroxytyrosol showed a gradual decrease as water stress progressed. Malondialdehyde (MDA) content increased due to water stress, mostly after 60 days, while antioxidant activity increased for all cultivars in the FC(33) treatment. 'Gaidourelia' could be considered as the most tolerant among the tested cultivars, showing higher phenolic concentration and antioxidant activity and lower lipid peroxidation and photochemical damage after two months of water stress. The results indicated that water stress affected olive tree physiological and biochemical parameters and magnitude of this effect depended on genotype, the degree of water limitation and duration of treatment

Differential Contribution of Endoplasmic Reticulum and Chloroplast ω-3 Fatty Acid Desaturase Genes to the Linolenic Acid Content of Olive (Olea europaea) Fruit.

Science.gov (United States)

Hernández, M Luisa; Sicardo, M Dolores; Martínez-Rivas, José M

2016-01-01

Linolenic acid is a polyunsaturated fatty acid present in plant lipids, which plays key roles in plant metabolism as a structural component of storage and membrane lipids, and as a precursor of signaling molecules. The synthesis of linolenic acid is catalyzed by two different ω-3 fatty acid desaturases, which correspond to microsomal- (FAD3) and chloroplast- (FAD7 and FAD8) localized enzymes. We have investigated the specific contribution of each enzyme to the linolenic acid content in olive fruit. With that aim, we isolated two different cDNA clones encoding two ω-3 fatty acid desaturases from olive (Olea europaea cv. Picual). Sequence analysis indicates that they code for microsomal (OepFAD3B) and chloroplast (OepFAD7-2) ω-3 fatty acid desaturase enzymes, different from the previously characterized OekFAD3A and OekFAD7-1 genes. Functional expression in yeast of the corresponding OepFAD3A and OepFAD3B cDNAs confirmed that they encode microsomal ω-3 fatty acid desaturases. The linolenic acid content and transcript levels of olive FAD3 and FAD7 genes were measured in different tissues of Picual and Arbequina cultivars, including mesocarp and seed during development and ripening of olive fruit. Gene expression and lipid analysis indicate that FAD3A is the gene mainly responsible for the linolenic acid present in the seed, while FAD7-1 and FAD7-2 contribute mostly to the linolenic acid present in the mesocarp and, therefore, in the olive oil. These results also indicate the relevance of lipid trafficking between the endoplasmic reticulum and chloroplast in determining the linolenic acid content of membrane and storage lipids in oil-accumulating photosynthetic tissues. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Validation of reference genes for gene expression analysis in olive (Olea europaea) mesocarp tissue by quantitative real-time RT-PCR

Science.gov (United States)

2014-01-01

Background Gene expression analysis using quantitative reverse transcription PCR (qRT-PCR) is a robust method wherein the expression levels of target genes are normalised using internal control genes, known as reference genes, to derive changes in gene expression levels. Although reference genes have recently been suggested for olive tissues, combined/independent analysis on different cultivars has not yet been tested. Therefore, an assessment of reference genes was required to validate the recent findings and select stably expressed genes across different olive cultivars. Results A total of eight candidate reference genes [glyceraldehyde 3-phosphate dehydrogenase (GAPDH), serine/threonine-protein phosphatase catalytic subunit (PP2A), elongation factor 1 alpha (EF1-alpha), polyubiquitin (OUB2), aquaporin tonoplast intrinsic protein (TIP2), tubulin alpha (TUBA), 60S ribosomal protein L18-3 (60S RBP L18-3) and polypyrimidine tract-binding protein homolog 3 (PTB)] were chosen based on their stability in olive tissues as well as in other plants. Expression stability was examined by qRT-PCR across 12 biological samples, representing mesocarp tissues at various developmental stages in three different olive cultivars, Barnea, Frantoio and Picual, independently and together during the 2009 season with two software programs, GeNorm and BestKeeper. Both software packages identified GAPDH, EF1-alpha and PP2A as the three most stable reference genes across the three cultivars and in the cultivar, Barnea. GAPDH, EF1-alpha and 60S RBP L18-3 were found to be most stable reference genes in the cultivar Frantoio while 60S RBP L18-3, OUB2 and PP2A were found to be most stable reference genes in the cultivar Picual. Conclusions The analyses of expression stability of reference genes using qRT-PCR revealed that GAPDH, EF1-alpha, PP2A, 60S RBP L18-3 and OUB2 are suitable reference genes for expression analysis in developing Olea europaea mesocarp tissues, displaying the highest level

[The preparation and characterization of fine dusts carried out in the Clinica del Lavoro di Milano in support of experimental studies].

Science.gov (United States)

Occella, E; Maddalon, G; Peruzzo, G F; Foà, V

1999-01-01

This paper aims to illustrate the conditions selected at the Clinica del Lavoro of the University of Milan to prepare and analyze a large number of fine dust samples produced over a period of about 50 years, that were initially used for studies within the Clinic performed in its own facilities, and since 1956 were sent to other Italian and overseas laboratories (Luxembourg, UK, Germany, Norway, Sweden, South Korea, USA). The total quantity of material distributed (with maximum size 7-10 microns) was about 2 kg and consisted of the following mineral and artificial compounds: quartz, HF-treated quartz, tridymite, HF-treated tridymite, cristobalite, chromite, anthracite, quartz sand for foundry moulds, sand from the Lybian desert, vitreous silica, pumice, cement, as well small quantities of metallic oxides, organic resins, chrysotile, crocidolite, fibres (vitreous, cotton and polyamidic). About half of the entire quantity of dusts produced consisted of partially HF-treated tridymite. Initially, research on the etiology of silicosis used quartz dust samples, simply sieved or ventilated (consisting of classes finer than 0.04 mm, containing a 15-20% respirable fraction). From 1956 to 1960 the dusts were produced by manual grinding in an agate mortar, below about 10 microns, starting from quartz from Quincinetto (near Ivrea, Province of Turin), containing about 99.5% quartz: particle size and composition were checked using an optical-petrographic technique, with identification of the free and total silica content. Subsequently, the dusts used for biological research were obtained by grinding coarse material with a cast iron pestle and planetary mills, agate and corundum jars. The grinding products were sized by means of centrifugal classification, using the selector developed by N. Zurlo, ensuring control of dust size both optically and by means of wet levigators and hydraulic classifiers (in cooperation with the Institute of Mines of Turin Polytechnic School). After 1990

Whole-tree water balance and indicators for short-term drought stress in non-bearing 'Barnea' olives

NARCIS (Netherlands)

Ben-Gal, A.; Kool, D.; Agam, N.; Halsema, van G.E.; Yermiyahu, U.; Yafe, A.; Presnov, E.; Erel, R.; Majdop, A.; Zipori, I.; Segal, E.; Rüger, S.; Zimmermann, U.; Cohen, Y.; Alchanatis, V.; Dag, A.

2010-01-01

Drainage-weighing lysimetersallowedmonitoringofwaterbalancecomponentsofnon-bearingolive (Olea europaea cv Barnea)treesovera3-monthperiodincludingshort-termeventsofcontrolledbut severe waterstress.Theobjectiveofthestudywastoevaluateavarietyofsoilandplant-basedwater status

Feasible way of Human Solid and Liquid Wastes' Inclusion Into Intersystem Mass Exchange of Biological-Technical Life Support Systems

Science.gov (United States)

Ushakova, Sofya; Tikhomirov, Alexander A.; Tikhomirova, Natalia; Kudenko, Yurii; Griboskaya, Illiada; Gros, Jean-Bernard; Lasseur, Christophe

The basic objective arising at use of mineralized human solid and liquid wastes serving as the source of mineral elements for plants cultivation in biological-technical life support systems appears to be NaCl presence in them. The given work is aimed at feasibility study of mineralized human metabolites' utilization for nutrient solutions' preparation for their further employment at a long-term cultivation of uneven-aged wheat and Salicornia europaea L. cenosis in a conveyer regime. Human solid and liquid wastes were mineralized by the "wet incineration" method developed by Yu. Kudenko. On their base the solutions were prepared which were used for cultivation of 5-aged wheat conveyer with the time step-interval of 14 days. Wheat was cultivated by hydroponics method on expanded clay aggregate. For partial demineralization of nutrient solution every two weeks after regular wheat harvesting 12 L of solution was withdrawn from the wheat irrigation tank and used for Salicornia europaea cultivation by the water culture method in a conveyer regime. The Salicornia europaea conveyer was represented by 2 ages with the time step-interval of 14 days. Resulting from repeating withdrawal of the solution used for wheat cultivation, sodium concentration in the wheat irrigation solution did not exceed 400 mg/l, and mineral elements contained in the taken solution were used for Salicornia europaea cultivation. The experiment lasted 7 months. Total wheat biomass productivity averaged 30.1 g*m-2*day-1 at harvest index equal to 36.8The work was carried out under support of SB RAS grant 132 and INTAS 05-1000008-8010

Equipment for the extraction of 99sup(m)TcO4Na

International Nuclear Information System (INIS)

Pliego, O.H.; Fraga de Suarez, A.H.; Goncalvez, Maria de; Marques, Roberto; Guerrero, Gustavo; Mitta, A.E.A

1980-04-01

An equipment is described for the extraction of 99 sup(m)Tc by the liquid-liquid extraction method, installed at the Nuclear Medicine Center of theHospital de Clinicas ''Jose de San Martin''. (author) [es

Neonatal Malaria in the Gambia

African Journals Online (AJOL)

Uche

Inclusion Criteria. All consecutive ... these, 105 (26.5%) satisfied the inclusion criteria ..... Bulletin de la Societe de Pathologie Exotique 1991; ... Revista do Hospital das Clinicas; Faculdade de. Medicina Da Universidade de Sao Paulo. 1993 ...

Distribution and co-existence of the Macropis species and their cleptoparasite Epeoloides coecutiens (Fabr.) in NW Europe Hymenoptera: Apoidea, Melittidae and Apidae)

DEFF Research Database (Denmark)

Pekkarinen, Antti; Berg, Øistein; Calabuig, Isabel

2003-01-01

The Macropis species collect pollen and fatty oil secreted by flowers of loosestrifes (Lysimachia, Primulaceae) and are the only known oil-collecting bees in the Holarctic. In NW Europe, L. vulgaris is the main or (in large areas) sole pollen and oil source for M. europaea Warncke (labiata auct.......) and M. fulvipes (Fabr.). The species are largely sympatric in southern Finland and the Baltic countries, while in Scandinavia and most of Denmark only M. europaea has been recorded. The ranges of the Macropis species are restricted to the areas of common occurrence of L. vulgaris. Presumably, Epeoloides...

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Nitrosomonas europaea ATCC 19718] ... Length = 96 ... Query: 3 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDS...IDPGPAGFTGSLIV 62 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDS...IDPGPAGFTGSLIV Sbjct: 1 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDSIDPGPAGFTGSLIV 60 ...

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Nitrosomonas europaea ATCC 19718] ... Length = 75 ... Query: 1 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEH...QLELFEMLLSLSDHDLWNIIIGNT 60 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEHQLELFEM...LLSLSDHDLWNIIIGNT Sbjct: 1 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEHQLELFEMLLSLSDHDLWNIIIGNT 60 ...

Disease: H01580 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available l features and dietary history, and there is rapid resolution of signs and symptoms after vitamin C suppleme...because alcohol decreases the absorption of vitamin C. The diagnosis of scurvy is generally based on clinica

Indigenous Pseudomonas spp. Strains from the Olive (Olea europaea L.) Rhizosphere as Effective Biocontrol Agents against Verticillium dahliae: From the Host Roots to the Bacterial Genomes

Science.gov (United States)

Gómez-Lama Cabanás, Carmen; Legarda, Garikoitz; Ruano-Rosa, David; Pizarro-Tobías, Paloma; Valverde-Corredor, Antonio; Niqui, José L.; Triviño, Juan C.; Roca, Amalia; Mercado-Blanco, Jesús

2018-01-01

The use of biological control agents (BCA), alone or in combination with other management measures, has gained attention over the past decades, driven by the need to seek for sustainable and eco-friendly alternatives to confront plant pathogens. The rhizosphere of olive (Olea europaea L.) plants is a source of bacteria with potential as biocontrol tools against Verticillium wilt of olive (VWO) caused by Verticillium dahliae Kleb. A collection of bacterial isolates from healthy nursery-produced olive (cultivar Picual, susceptible to VWO) plants was generated based on morphological, biochemical and metabolic characteristics, chemical sensitivities, and on their in vitro antagonistic activity against several olive pathogens. Three strains (PIC25, PIC105, and PICF141) showing high in vitro inhibition ability of pathogens' growth, particularly against V. dahliae, were eventually selected. Their effectiveness against VWO caused by the defoliating pathotype of V. dahliae was also demonstrated, strain PICF141 being the rhizobacteria showing the best performance as BCA. Genotypic and phenotypic traits traditionally associated with plant growth promotion and/or biocontrol abilities were evaluated as well (e.g., phytase, xylanase, catalase, cellulase, chitinase, glucanase activities, and siderophore and HCN production). Multi-locus sequence analyses of conserved genes enabled the identification of these strains as Pseudomonas spp. Strain PICF141 was affiliated to the “Pseudomonas mandelii subgroup,” within the “Pseudomonas fluorescens group,” Pseudomonas lini being the closest species. Strains PIC25 and PIC105 were affiliated to the “Pseudomonas aeruginosa group,” Pseudomonas indica being the closest relative. Moreover, we identified P. indica (PIC105) for the first time as a BCA. Genome sequencing and in silico analyses allowed the identification of traits commonly associated with plant-bacteria interactions. Finally, the root colonization ability of these olive

Energetic evaluation of indigenous tree and shrub species in Basilicata, Southern Italy

Directory of Open Access Journals (Sweden)

Todaro L

2007-01-01

Full Text Available An evaluation of energetic characteristics such as high calorific value (on ash-free dry weight basis, ash, carbon, nitrogen, and moisture content of 12 indigenous tree and shrub species of Southern Italy (Basilicata Region was carried out. The studied species are the most abundant in this area: Quercus cerris L., Quercus pubescens Willd., Fraxinus ornus L., Populus canescens (Aiton Smith, Salix alba L., Alnus cordata L., Robinia pseudoacacia L., Olea europaea L., Spartium junceum L., Rubus hirtus W., Onopordum illirium L., Arundo donax L. For Q. cerris, Q. pubescens and O. europaea L., the energetic characteristics were measured by separating the wood components from the leaves. Q. cerris leaves contained the greatest high calorific value. F. ornus leaves had a greater ash content than the other samples while the lowest values were measured for S. junceum, Q. pubescens and R. pseudoacacia. The highest content of Carbon was in O. europaea leaves. A. donax and O. illirium had the lower level of high calorific value and Carbon than all the other species. The highest Nitrogen content was measured in Q. cerris leaves and the lowest one in F. ornus wood components.

Phase 1 dose-escalation study of the antiplacental growth factor monoclonal antibody RO5323441 combined with bevacizumab in patients with recurrent glioblastoma

DEFF Research Database (Denmark)

Lassen, Ulrik; Chinot, Olivier L; McBain, Catherine

2015-01-01

BACKGROUND: We conducted a phase 1 dose-escalation study of RO5323441, a novel antiplacental growth factor (PlGF) monoclonal antibody, to establish the recommended dose for use with bevacizumab and to investigate the pharmacokinetics, pharmacodynamics, safety/tolerability, and preliminary clinica...

MACVIA clinical decision algorithm in adolescents and adults with allergic rhinitis

DEFF Research Database (Denmark)

Bousquet, Jean; Schünemann, Holger J; Hellings, Peter W

2016-01-01

The selection of pharmacotherapy for patients with allergic rhinitis (AR) depends on several factors, including age, prominent symptoms, symptom severity, control of AR, patient preferences, and cost. Allergen exposure and the resulting symptoms vary, and treatment adjustment is required. Clinica...

A DXA Whole Body Composition Cross-Calibration Experience: Evaluation With Humans, Spine, and Whole Body Phantoms.

Science.gov (United States)

Krueger, Diane; Libber, Jessie; Sanfilippo, Jennifer; Yu, Hui Jing; Horvath, Blaine; Miller, Colin G; Binkley, Neil

2016-01-01

New densitometer installation requires cross-calibration for accurate longitudinal assessment. When replacing a unit with the same model, the International Society for Clinical Densitometry recommends cross-calibrating by scanning phantoms 10 times on each instrument and states that spine bone mineral density (BMD) should be within 1%, whereas total body lean, fat, and %fat mass should be within 2% of the prior instrument. However, there is limited validation that these recommendations provide adequate total body cross-calibration. Here, we report a total body cross-calibration experience with phantoms and humans. Cross-calibration between an existing and new Lunar iDXA was performed using 3 encapsulated spine phantoms (GE [GE Lunar, Madison, WI], BioClinica [BioClinica Inc, Princeton, NJ], and Hologic [Hologic Inc, Bedford, MA]), 1 total body composition phantom (BioClinica), and 30 human volunteers. Thirty scans of each phantom and a total body scan of human volunteers were obtained on each instrument. All spine phantom BMD means were similar (within 1%; g/cm2 bias) between the existing and new dual-energy X-ray absorptiometry unit. The BioClinica body composition phantom (BBCP) BMD and bone mineral content (BMC) values were within 2% with biases of 0.005 g/cm2 and -3.4 g. However, lean and fat mass and %fat differed by 4.6%-7.7% with biases of +463 g, -496 g, and -2.8%, respectively. In vivo comparison supported BBCP data; BMD and BMC were within ∼2%, but lean and fat mass and %fat differed from 1.6% to 4.9% with biases of +833 g, -860 g, and -1.1%. As all body composition comparisons exceeded the recommended 2%, the new densitometer was recalibrated. After recalibration, in vivo bias was lower (g, respectively. Similarly, BBCP lean and fat agreement improved. In conclusion, the BBCP behaves similarly, but not identical, to human in vivo measurements for densitometer cross-calibration. Spine phantoms, despite good BMD and BMC agreement, did not detect

Implementation of a radiology information system in an University Hospital

International Nuclear Information System (INIS)

Marques, Paulo Mazzoncini de Azevedo; Santos, Antonio Carlos; Elias Junior, Jorge; Trad, Clovis Simao; Goes, Wilson Moraes; Castro, Carlos Roberto de

2000-01-01

This paper describes a radiology information system (RIS) developed and in the process of implementation in an University Hospital (Hospital das Clinicas da Faculdade de Medicina de Ribeirao Preto - Universidade de Sao Paulo) which integrates a plan for a 'filmless' radiology facility. (author)

Control of Chaos: New Perspectives in Experimental and Theoretical Science. International Journal of Bifurcation and Chaos in Applied Sciences and Engineering. Theme Issue. Part 2, Volume 8, Number 9, September 1998.

Science.gov (United States)

1998-09-01

GARBO*, R. BALOCCHIt and S. CHILLEMI* *Istituto di Biofisica CNR, Via S. Lorenzo 26, 56127 Pisa, Italy tIstituto di Fisiologia Clinica CNR, Via...Publishing Company DIFFUSION PARAMETER CONTROL OF SPATIOTEMPORAL CHAOS RAUL MONTAGNE* Instituto de Fisica, Facultad de Ciencias & Facultad de Ingenieria

Vector competence of Culicoides sonorensis (Diptera: Ceratopogonidae) to epizootic hemorrhagic disease virus serotype 7

Science.gov (United States)

Background: Culicoides sonorensis (Diptera: Ceratopogonidae) is a vector of epizootic hemorrhagic disease virus (EHDV) serotypes 1 and 2 in North America, where these viruses are well-known pathogens of white-tailed deer (WTD) and other wild ruminants. Although historically rare, reports of clinica...

From Self-Organized to Extended Criticality

Science.gov (United States)

2012-04-26

Texas, Denton, TX, USA 2 Centro EXTREME, Scuola Superiore Sant’Anna, Pisa, Italy 3 Istituto di Fisiologia Clinica-CNR, Pisa, Italy 4 Department of Physics...Netherlands Klaus Linkenkaer-Hansen, Center for Neurogenomics and Cognitive Research, Netherlands *Correspondence: Paolo Allegrini , Istituto di Fisiologia

Composition, quality and oxidative stability of virgin olive oils from some selected wild olives (Olea europaea L. subsp. oleaster

Directory of Open Access Journals (Sweden)

Zarrouk, Mokhtar

2008-12-01

Full Text Available A study on the characterization of virgin olive oils from wild olives (Olea europaea L. subsp. oleaster was conducted in order to define new cultivars which are welladapted to the Tunisian environment and yield high quality oils. The study was done during the crop years 2003/04, 2004/05 and 2005/06. The main analytical parameters of the oils were evaluated: fatty acid compositions, chlorophylls, carotenoids, tocopherols and phenolic compounds as well as their relationship with oxidative stability. The fatty acid composition of all the wild olive trees tested produced virgin olive oil which complies with commercial standards, as well as for their appreciable amounts of tocopherols and phenolic compounds. Tocopherol analysis by HPLC revealed the presence of α, β, γ and δ tocopherols in all the studied olive oils. Total tocopherol content was significantly influenced by the varietal factor. It ranged from 310 (SB12 to 780 mg/kg (H3. As for total tocopherols, the amount of each tocopherol varied according to genotype. α tocopherol is the most prominent, whereas β, γ and δ tocopherols are less represented. Results showed a clear influence of total phenols and o-diphenols on virgin olive oil stability (R = 0.905, 0.963 P En este trabajo se han caracterizado los aceites obtenidos a partir de siete acebuches previamente seleccionados entre varias poblaciones de Olea europea L. Subsp. oleaster. El estudio se llevó a cabo durante las campañas de producción 2003/04, 2004/05 y 2005/06.Varios parámetros analíticos fueron evaluados: composiciones en ácidos grasos, pigmentos, tocoferoles, fenoles; así mismo, se investigó la relación de estos parámetros con la estabilidad de los aceites. Los resultados obtenidos mostraron que todas las muestras de frutos de acebuche produjeron aceites cuya composición de ácidos grasos, tocoferoles y compuestos fenólicos cumplió las normas comerciales para aceite de oliva virgen del Comit

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available MVPEMGDYYVPATQNNARILVRNENGIELLSNICRHRQATILEGRGSSRNIVCP 101 ... YVGHELMVPEMGDYYVPATQNNARILVRNENGIE...LLSNICRHRQATILEGRGSSRNIVCP Sbjct: 1 ... YVGHELMVPEMGDYYVPATQNNARILVRNENGIELLSNICRHRQATILEGRGSSRNIVCP 60 ... ...otein ... 2Fe-2S subunit [Nitrosomonas europaea ATCC 19718] ... Length = 99 ... Query: 42 ... YVGHEL

Browse Title Index

African Journals Online (AJOL)

Items 551 - 600 of 643 ... Samuel Adetunji Onasanwo, Gideon Nimedia Aitokhuehi, Opeyemi Temitayo Ajayi, Samuel Oluwaseun Faborode. Vol 4, No 3 (2001), the assessment of fasciola gigantica infection in the rabbit(Oryctolagus cuniculus) as a laboratory model parasite development - Clinica symptoms and liver pathology ...

The effects of salinity on nitrification using halophilic nitrifiers in a Sequencing Batch Reactor treating hypersaline wastewater.

Science.gov (United States)

Cui, You-Wei; Zhang, Hong-Yu; Ding, Jie-Ran; Peng, Yong-Zhen

2016-04-25

With annual increases in the generation and use of saline wastewater, the need to avoid environmental problems such as eutrophication is critical. A previous study identified ways to start up a halophilic sludge domesticated from estuarine sediments to remove nitrogen from wastewater with a salinity of 30 g/L. This investigation expands that work to explore the impact of salinity on nitrogen removal. This study demonstrated that the mixed halophilic consortia removed nitrogen from wastewater with a salinity of 30-85 g/L. A kinetic analysis showed that halophilic nitrifiers selected based on hypersalinity were characterized by low Ks, μmax and specific ammonium oxidization rates. This explains the decrease in ammonium removal efficiency in the high salinity operational phases. Salinity inhibited ammonia oxidizing bacteria (AOB) activity, as well as the number of dominant AOB, but did not significantly affect the AOB dominant species. Three most dominant AOB lineages in the halophilic sludge were Nitrosomonas marina, Nitrosomonas europaea, and Nitrosococcus mobilis. Nitrosomonas europaea and Nitrosococcus mobilis were mainly affected by salinity, while nitrite accumulation and ammonia loading played the key role in determining the abundance of Nitrosococcus mobilis and Nitrosococcus europaea. The study contributes insights about shifts in halophilic nitrifying bacterial populations.

Spanish Navy Up to Date Data in DCS

Science.gov (United States)

2001-06-01

therapeutic measures. Final results are similar to another world navies diving centres Bibliography: 1.- Pujante, A.; Inoriza, J; Viqueira, A. Estudio de 121... casos de enfermedad descompresiva Medicina Clinica, vol . 94, n` 7, 1990 2.- Rivera, J.C. Decompression sickness among divers: An analysis of 935

[The physiotherapic aspect of omeral epicondilitis (author's transl)].

Science.gov (United States)

Marenghi, P; Tella, G C

1976-01-01

The Authors describe history, etiopatogenesis, clinic, therapy of omeral epicondilitis, very frequent affection. Physiotherapic aspects are studied by different methods. The indications are different compared to clinical aspect, pain modality, relapse eventuality. They conclude with personal considerations based on what observed in Orthopedic Clinica of Parma University.

Human immunodeficiency virus (HIV) seropositivity and hepatitis B ...

African Journals Online (AJOL)

Method: A total of 130 donors comprising 120 commercial donors and 10 voluntary donors were tested for antibodies to human immunodeficiency virus and hepatitis B surface antigen in Benin city using Immunocomb HIV - 1 and 2 Biospot kit and Quimica Clinica Aplicada direct latex agglutination method respectively.

Sindrome de Lennox-Gastaut com inicio tardio: I - frequencia de casos com inicio anterior e ulterior aos 6 anos de idade, fatores etiologicos e nivel intelectual

Directory of Open Access Journals (Sweden)

Amilton Antunes Barreira

1980-12-01

Full Text Available De um grupo de 66 pacientes com sindrome de Lennox Gastaut, 15 apresentaram as primeiras manifestações clinicas após os 6 anos de idade. Desses, 12 foram acompanhados durante o período médio de 2 anos e 6 meses, com avaliações neurológicas a intervalos de cerca de 2 meses. A revisão das publicações pertinentes permitiu estabelecer que em 20% das casuisticas apreciadas a sindrome de Lennox-Gastaut se inicia após o 6° ano de vida. As avaliações clinicas permitiram verificar que nosos pacientes apresentaram incidência de lesões neurológicas graves precedendo a instalação da síndrome por vários anos. As avaliações psicométricas evidenciaram intenso comprometimento do nível intelectual em contraste com os dados da literatura sobre a síndrome de Lennox-Gastaut de início tardio.

Electronic Patient Reported Outcomes in Paediatric Oncology - Applying Mobile and Near Field Communication Technology.

Science.gov (United States)

Duregger, Katharina; Hayn, Dieter; Nitzlnader, Michael; Kropf, Martin; Falgenhauer, Markus; Ladenstein, Ruth; Schreier, Günter

2016-01-01

Electronic Patient Reported Outcomes (ePRO) gathered using telemonitoring solutions might be a valuable source of information in rare cancer research. The objective of this paper was to develop a concept and implement a prototype for introducing ePRO into the existing neuroblastoma research network by applying Near Field Communication and mobile technology. For physicians, an application was developed for registering patients within the research network and providing patients with an ID card and a PIN for authentication when transmitting telemonitoring data to the Electronic Data Capture system OpenClinica. For patients, a previously developed telemonitoring system was extended by a Simple Object Access Protocol (SOAP) interface for transmitting nine different health parameters and toxicities. The concept was fully implemented on the front-end side. The developed application for physicians was prototypically implemented and the mobile application of the telemonitoring system was successfully connected to OpenClinica. Future work will focus on the implementation of the back-end features.

Walter Charleton (1620 - 1707 e sua Teoria Atômica The atomic theory of walter charleton (1620 - 1707

Directory of Open Access Journals (Sweden)

Paulo Alves Porto

1997-06-01

Full Text Available Several authors in the 17th century used the atomic hypothesis to explain observable phenomena. This paper analyzes some ideas about chemical transformation proposed by the English physician Walter Charleton. In Physiologia Epicuro-Gassendo-Charltoniana (London, 1654, Charleton examined philosophical aspects of the atomic theory, and suggested that the best explanation for all natural phenomena would be only in terms of atoms and their motions. Sometimes, however, he had to attribute to the atoms some kind of "internal virtue", to explain more complex properties of the matter. His idea of "element", and the little use of experimentation and quantification, also limited the range of Charleton's theory.

Farmacos orales para el control quimico de las biopeliculas dentales (placa bacteriana

Directory of Open Access Journals (Sweden)

Rodrigo Abello Moreno

2013-12-01

Full Text Available La placa dentobacteriana o biopelicula es la responsable de patologias clinicas como la caries dental, gingivitis y enfermedad periodontal, por lo tanto productos con agentes germicidas actuan en la prevencion de la biopelicula dental cuando las medidas de higiene oral no son las mas apropiadas.

Influence of Progressive Central Hypovolemia on Multifractal Dimension of Cardiac Interbeat Intervals

Science.gov (United States)

2010-05-07

and 5 Istituto Fisiologia Clinica, CNR-Area Ricerca San Cataldo, Via Moruzzi 1, 56124-Pisa (Dated: May 7, 2010) Abstract We analyzed the heartbeat time...the research group of prof. B Ghe- larducci, Dipartimento di Fisiologia e Biochimica, Universitá di Pisa, and Dr. M. Varanini, Institute of Clinical

Glucósidos fenólicos amargos de las semillas del olivo (Olea europea

Directory of Open Access Journals (Sweden)

Maestro-Durán, R.

1994-10-01

Full Text Available From the seeds of Olea europaea, three known glucosides, salidroside (tyrosol-glucose, nüzhenide (glucose-elenolic acid-glucosetyrosol and nüzhenide-oleoside have been isolated as well as two new secoiridoid glucosides with tyrosol, elenolic acid and glucose moieties in unknown sequence.

Se han aislado de semillas de aceituna (Olea europaea tres glucósidos secoiridoides ya conocidos: salidrósido (tirosol-glucosa, nuzhenida (glucosa-ácido elenólico-glucosa-tirosol y nuzhenida-oleósido, así como otros dos glucósidos secoiridoides que también tienen en su molécula tirosol, ácido elenólico y glucosa cuyas secuencias no se han podido establecer.

Psychological changes in alcohol-dependent patients during a residential rehabilitation program

Directory of Open Access Journals (Sweden)

Giorgi I

2015-12-01

Full Text Available Ines Giorgi,1 Marcella Ottonello,2,3 Giovanni Vittadini,4 Giorgio Bertolotti5 1Psychology Unit, Salvatore Maugeri Foundation, Clinica del Lavoro e della Riabilitazione, IRCCS, Pavia, 2Department of Physical & Rehabilitation Medicine, Salvatore Maugeri Foundation, Clinica del Lavoro e della Riabilitazione, IRCCS, Genoa, 3Department of Medicine, PhD Program in Advanced Sciences and Technologies in Rehabilitation Medicine and Sport, Università di Tor Vergata, Rome, 4Alcohol Rehabilitation Unit, Salvatore Maugeri Foundation, Clinica del Lavoro e della Riabilitazione, IRCCS, Pavia, 5Psychology Unit, Salvatore Maugeri Foundation, Clinica del Lavoro e della Riabilitazione, IRCCS, Tradate, Italy Background: Alcohol-dependent patients usually experience negative affects under the influence of alcohol, and these affective symptoms have been shown to decrease as a result of alcohol-withdrawal treatment. A recent cognitive–affective model suggests an interaction between drug motivation and affective symptoms. The aim of this multicenter study was to evaluate the psychological changes in subjects undergoing a residential rehabilitation program specifically designed for alcohol addiction, and to identify at discharge patients with greater affective symptoms and therefore more at risk of relapse.Materials and methods: The sample included 560 subjects (mean age 46.91±10.2 years who completed 28-day rehabilitation programs for alcohol addiction, following a tailored routine characterized by short duration and high intensity of medical and psychotherapeutic treatment. The psychological clinical profiles of anxiety, depression, psychological distress, psychological well-being, and self-perception of a positive change were assessed using the Cognitive Behavioral Assessment – Outcome Evaluation questionnaire at the beginning and at the end of the program. The changes in the psychological variables of the questionnaire were identified and considered as outcome

Musicoterapia e improvisaciòn libre

DEFF Research Database (Denmark)

Bergstrøm-Nielsen, Carl

2003-01-01

Muchos de los métodos de trabajo que se utilizan en musicoterapia se basan en la improvisación. En la practica clinica se plantean numerosas situaciones en las que el musicoterapeuta necesita contar con habilidades avanzadas de improvisación. Este articulo presenta algunas ideas y sugerencias prá...

Os sentidos de theologia physica para os antiqui: Tomás de Aquino leitor de Agostinho [The senses of theologia physica for the antiqui: Thomas Aquinas reads Augustine

Directory of Open Access Journals (Sweden)

Evaniel Brás dos Santos

2017-05-01

Full Text Available Explicito neste artigo que a expressão “theologia physica” atribuída aos antigos (antiqui possui dois sentidos na ST, IIa-IIae, q. 94, a. 1, resp., de Tomás de Aquino. O primeiro, atribuído a Varrão, denota um estudo restrito, uma physiologia ou mecânica na qual deus é entendido como a força imanente no mundo, locomovendo-o. O segundo, por sua vez, pertence aos platônicos (platonici e denota um estudo geral, pois aborda, além de entidades imateriais, um criador. Ambas as teologias físicas, conforme Tomás, institui filosoficamente a idolatria ao entenderem que a divindade é causa de locomoção. Embora se valha de Agostinho em sua leitura da expressão “theologia physica”, Tomás introduz discussões que estão além do texto agostiniano.  [In the article I clarify that the expression “theologia physica” attributed to the Ancients (antiqui has two senses in the ST, IIa-IIae, q. 94, a.1, resp., of Thomas Aquinas. The first, attributed to Varro, denotes a restrict study, a physiologia or mechanics in which god is understood as the immanent force in the world, moving it. The second, in turn, belongs to the Platonics (platonici and denotes a general study, for it approaches, besides immaterial entities, a creator. Both physical theologies, according to Aquinas, set up philosophically the idolatry since they understand that the divinity is cause for locomotion. Although Aquinas makes use of Augustine in his reading of the expression “theologia physica”, he introduces discussions that go beyond the Augustinian text.

Pathogenicity of Phytophthora species isolated from rhizosphere soil in the eastern United States

Science.gov (United States)

Y. Balci; S. Balci; W.L. MacDonald; K.W. Gottschalk

2008-01-01

Pathogenicity of seven Phytophthora species was assessed by inoculation of stem and foliar tissues of oak species (Quercus spp.) native to the eastern United States. Phytophthora cambivora, P. cinnamomi, P. citricola, P. europaea, P. quercina...

Temporal evolution of the environmental doce remaining in a clinical irradiation bunker after the cessation of irradiation

International Nuclear Information System (INIS)

Ruiz Egea, E.; Sanchez Carrascal, M.; Torres Pozas, S.; Monja Ray, P. de la; Perez Molina, J. L.; Madan Rodriguez, C.; Luque Japon, L.; Morera Molina, A.; Hernandez Perez, A.; Barquero Bravo, Y.; Morengo Pedagna, I.; Oliva Gordillo, M. C.; Martin Olivar, R.

2011-01-01

In this paper we try to quantify tite doce emitted by different radioactive processes that occur in the head of a clinica. Linear accelerator and the patient is irradiated, or wallc of the bunker, converted into tertiary sources of radiation trying to ectablish tite origin of the came in different parts of the bunker.

Monochloramine Cometabolism by Nitrifying Biofilm Relevant to Drinking Water

Science.gov (United States)

Recently, biological monochloramine removal (i.e., cometabolism) by a pure culture ammonia–oxidizing bacteria, Nitrosomonas europaea, and a nitrifying mixed–culture have been shown to increase monochloramine demand. Although important, these previous suspended culture batch kine...

Dicty_cDB: Contig-U11840-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AJ304826 |pid:none) Vombatus ursinus complete mitochon... 278 1e-72 AY083457_1(... AY083457 |pid:none) Roboastra europaea mitochondrion, ... 278 1e-72 EU877953_2( EU877953 |pid:none) Tetraph

Stoichiometric variation of halophytes in response to changes in soil salinity.

Science.gov (United States)

Sun, X; Gao, Y; Wang, D; Chen, J; Zhang, F; Zhou, J; Yan, X; Li, Y

2017-05-01

Variation in soil salt may change the stoichiometry of a halophyte by altering plant ecophysiology, and exert different influences on various plant organs, which has potentially important consequences for the nutrition of consumers as well as nutrient cycling in a saline ecosystem. Using a greenhouse pot experiment, we investigated the effect of salinity variability on the growth and stoichiometry of different organs of Suaeda glauca and Salicornia europaea - two dominant species of important ecological and economic value in the saline ecosystem. Our results showed that appropriate salt stimulated the growth of both species during the vigorous growth period, while high salt suppressed growth. Na significantly increased with increased salt in the culture, whereas concentrations of other measured elements and K:Na ratio for both species significantly decreased at low salt treatments, and became more gradual under higher salt conditions. Furthermore, with the change of salt in culture, variations in leaf (degenerated leaf for S. europaea, considered as young stem) stoichiometry, except N:P ratio, were large and less in stems (old stems for S. europaea) than in roots, reflecting physiological and biochemical reactions in the leaf in response to salt stress, supported by sharp changes in trends. These results suggest that appropriate saline conditions can enhance biological C fixation of halophytes; however, increasing salt could affect consumer health and decrease cycling of other nutrients in saline ecosystems. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.

Heavy metal accumulation in Melilotus officinalis under crown Olea ...

African Journals Online (AJOL)

STORAGESEVER

2008-11-05

Nov 5, 2008 ... crown Olea europaea L forest irrigated with wastewater. S. Seif Amiri1, H. ... mainly because they are non-biodegradable, non-thermo- ... Soils, as filters of ... transportation to the laboratory, soil samples were air dried, crush-.

Ethnomedicinal uses of plants among the Somali ethnic group ...

African Journals Online (AJOL)

user

Age, gender, educational status and occupation were identified as important determinants for the use of herbal medicine. Conclusion: .... P.S.Green. (AI-35) ... coffee. Olea europaea L. subsp. cuspidate. (WalL.exG.Don) Cif. (AI-16). Oleaceae.

EJST V9N2

African Journals Online (AJOL)

The effects of land use types and soil depth on soil properties of Agedit watershed, Northwest. Ethiopia ... are the most widely practiced activities in Ethiopia. (Eyayu Molla et al., .... are Olea europaea L. subsp cuspidata, Cordia africana Lam.

Seed production, seed dispersal and seedling establishment of two afromontane tree species in and around a church forest: implications for forest restoration

Directory of Open Access Journals (Sweden)

Abrham Abiyu

2016-07-01

Full Text Available Background Seed production, seed dispersal and seedling establishment are relevant life phases of plants. Understanding these processes and their patterns is essential to recognize vegetation dynamics and to apply it to forest restoration. Methods For Olea europaea and Schefflera abyssinica, fecundity was estimated using randomized branch sampling. Seed dispersal and seedling establishment were monitored using spatially explicit seed traps and plots. Dispersal functions were calibrated applying inverse modeling. Results O. europaea produced more seeds and had longer dispersal distances compared to S. abyssinica. Correlations between observed and predicted number of recruits were statistically significant. Seedlings of the two species showed different niche requirements. Conclusions The studied species were recruitment-limited due to low dispersal activity or lack of suitable microsites. Restoration relying on natural regeneration should overcome these limitations by increasing disperser visitation and reducing biotic and abiotic stresses.

African Journal of Biotechnology - Vol 9, No 4 (2010)

African Journals Online (AJOL)

Comparative molecular analysis of old olive (Olea europaea L.) genotypes from Eastern Mediterranean Region of Turkey · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C Durgac, Y Kiyga, M Ulas ...

Ruolo ed organizzazione della microbiologia clinica di domani

Directory of Open Access Journals (Sweden)

Giorgio Mucignat

2006-12-01

Full Text Available Infectious diseases continue to represent an important preventive and clinical problem especially in the light of the emergence of new pathogens, of the return of infrequent pathogens and of the increased risk of infective pathologies associated with migratory flow. Another critical point is represented by the possible insurgence of infections due to agents used in bioterrorism. More than ever it is indispensable for our country to define a network of structures able to give an organized response to these relevant problems both in terms of prevention and assistance. It is therefore important to define a protocol for clinical microbiology on a national basis that responds to different levels of activity. Keeping in mind that the fundamental objectives of microbiology are: - diagnosis of infective diseases - determination of resistance to antimicrobic drugs as a valid instrument to allow the clinician to proceed with specific treatment - control of infection spreading in the sanitary structures (hospital infections - to develop front line defence in new infections and bioterrorism, in collaboration with the department of prevention - to be a reference centre for specific training The principals on which one must base the reorganization are essentially three: 1. to configurate the microbiology service on the basis of real needs of the local population 2. to give qualitatively optimal results in real time 3. supporting “good clinical practice” to assure adequate patient results and acceptable costs for the regionale sanitary system (SSR The organization of microbiology should therefore foresee a microbiology department, structured on a provincial basis or a vast area including a structured centralized complex with peripheral structures (even simplified. This must integrate actively with the department of prevention in regard to the dynamics of infectious diseases in the territory and with the Division of Infectious Diseases (where this exists. In parallel an active interaction with research structures (IRCCS and University present in the territory to enable the coordinated implementation of the guidelines of research and its relapse on diagnostic exams. Keeping in mind that the quality of diagnostic performance is closely linked to the professional experience of the operators it is good practice centralizing some diagnostic procedures by identifying a reference centre. In a regional network organized in this way it is important to include a coordinating structure, since it is necessary to activate a complete level of communication, information exchange, activity planning, and complete problem solving.

Come pesci nell’acqua. Elementi di etnopsicologia clinica

Directory of Open Access Journals (Sweden)

Wanda Ielasi

2007-03-01

Full Text Available Starting from her clinical experience with migrant people, the author summarizes the theoretical and operational instruments in ethno-psychological field with a critical review of some key concepts: psyche and body, health and suffering, culture, ethnic group and race, diagnosis and treatment, individual and collective dimension. Especially, culture becomes most relevant when psychological competences are involved in cultural contexts which are different from our own: both when we work with foreign people in our country and when we are involved in mental health projects abroad. Transcultural clinic, ethnopsychiatry, critical medical anthropology and anthropology of contemporaneousness constitute the disciplinary horizon of therapeutic communications capable of managing caregiver’s and client’s cultural aspects.

Preliminary assay on the radical scavenging activity of olive wood extracts

NARCIS (Netherlands)

Altarejos, J.; Salido, S.; Pérez-Bonilla, M.; Linares-Palomino, P.J.; Beek, van T.A.; Nogueras, M.; Sánchez, A.

2005-01-01

The dichloromethane and ethanol extracts of Olea europaea wood (picual olive cultivar) were screened for antioxidant activity, determined by the DPPH free radical scavenging assay. The ethanol extract displayed potent antioxidant activity. (c) 2005 Elsevier B.V. All rights reserved.

Fauna Europaea: Mollusca – Bivalvia

Directory of Open Access Journals (Sweden)

Rafael Araujo

2015-07-01

European freshwater bivalves belong to the Orders Unionoida and Cardiida. All the European unionoids are included in the superfamily Unionoidea, the freshwater mussels or naiads. The European cardiids belong to the following three superfamilies: Cardioidea, Cyrenoidea and Dreissenoidea. Among the Unionoidea there are the most imperilled animal groups on the planet while the Cardioidea includes the cosmopolitan genus Pisidium, the Cyrenoidea the Asiatic clam (Corbicula fluminea and the Dreissenoidea the famous invasive zebra mussel (Dreissena polymorpha. Basic information is summarized on their taxonomy and biology. Tabulations include a complete list of the current estimated families, genera and species.

European Conference on Visual Perception (6th).

Science.gov (United States)

1983-11-30

Institut fuer Verhaltenswissenschaft, ETH- Zentrum, 8092 Zuerich - Switzerland W. GERBINO: Istituto di Psicologia , Universitk di Padova, Piazza Capitaniato...fuer medizinische Psychologie, Schillerstrasse 42 - 8000 Muenchen 2, West Germany L. JANEZ ESCALADA: Psicologia Matem&tica, Facultad de Psicologla...Norway P. MANCINI: Istituto di Fisiologia clinica del C.N.R., Via Bonanno Pisano - 56100 Pisa, Italy C.A. MARZI: Istituto di Psicologia . Universit

Executive functions in mono- and bilingual children with language impairment - issues for speech-language pathology.

OpenAIRE

Sandgren, Olof; Holmström, Ketty

2015-01-01

The clinical assessment of language impairment (LI) in bilingual children imposes challenges for speech-language pathology services. Assessment tools standardized for monolingual populations increase the risk of misinterpreting bilingualism as language impairment. This Perspective article summarizes recent studies on the assessment of bilingual LI and presents new results on including nonlinguistic measures of executive functions in the diagnostic assessment. Executive functions shows clinica...

Use of oral contraceptives in the management of acne

OpenAIRE

Melis, Gian; Paoletti,Anna Maria; ORRU' ,; MAROTTO ,; PILLONI,; PERSEU,; Lello,Stefano

2011-01-01

Gian Benedetto Melis, Marisa Orrù, Maria Francesca Marotto, Monica Pilloni, Mariagrazia Perseu, Stefano Lello, Anna Maria PaolettiClinica Ginecologica Ostetrica e di Fisiopatologia della Riproduzione Umana, Universita' di Cagliari, Azienda Ospedaliero Universitaria di Cagliari, Cagliari, ItalyAbstract: The pathogenesis of acne (the most common disorder involving the sebaceous gland) originates from increased sebum production by the sebaceous gland followed by colonization o...

Muistsed jumalad ühiskonna teenistuses : pseudomütoloogia Eesti avalikkuses 19. ja 20. sajandil / Ants Viires

Index Scriptorium Estoniae

Viires, Ants, 1918-2015

2001-01-01

Bibl. viidetes, lk. 519-520. Varem ilmunud: Ethnologia Europaea, 1991, nr. 21. Pealk.: Pseudomythology in Estonian publicity in the 19th and 20th century. Pseudomütoloogiliste kangelaste laiem levik algas Fr. R. Kreutzwaldi "Kalevipoja" ja Fr. R. Faehlmanni muistendite avaldamisega

Antithrombotic effect of repeated doses of the ethanolic extract of ...

African Journals Online (AJOL)

2013-05-22

May 22, 2013 ... extract of local olive (Olea europaea L.) leaves in rabbits. Abdallah M. ... olives have focused on olive oil and a few on olive leaves (OLEs). In this study .... thrombus was carefully removed, blotted on filter paper, and weighed ...

Effect of Extraction Conditions on the Antioxidant Activity of Olive Wood Extracts

NARCIS (Netherlands)

Pérez-Bonilla, M.; Salido, S.; Sánchez, A.; Beek, van T.A.; Altarejos, J.

2013-01-01

An investigation to optimize the extraction yield and the radical scavenging activity from the agricultural by-product olive tree wood (Olea europaea L., cultivar Picual) using six different extraction protocols was carried out. Four olive wood samples from different geographical origin, and

Penetration of UV-A, UV-B and blue light through the leaf trichome layers of two xeromorphic plants, olive and oak, measured by optical fibre microprobes

International Nuclear Information System (INIS)

Karabourniotis, G.; Bornman, J.F.

1999-01-01

Quartz fibre-optic microprobes were used to monitor the light microenvironment beneath trichome layers of the xeromorphic leaves of two Mediterranean evergreen sclerophylls, Olea europaea and Quercus ilex. Young developing leaves of both plants were densely pubescent on both surfaces of the lamina, whereas the mature leaves were pubescent only on the abaxial side. Trichome layers of young as well as of mature leaves of both plants attenuated almost all incident ultraviolet (UV)-B (310 nm) and UV-A (360 nm) radiation and a considerable portion of blue light (430 nm). Abaxial trichome layers of young leaves were more effective in screening out the incident radiation compared to the adaxial ones of the same leaves and also compared to the abaxial layer of the mature leaves. The abaxial epidermis of dehaired mature leaves of O. europaea was ineffective in absorbing most of the incident UV-B and UV-A radiation. UV and visible spectra beneath trichome layers of O. europaea in mature leaves confirmed that the light microenvironment on the epidermis was deprived in the UV-B, UV-A and partly in the blue spectral regions. It is proposed that the occurrence of a dense trichome layer, especially in young leaves, may play a protective role against not only UV-B radiation damage, but also against high visible irradiance. This function is performed irrespective of the differing anatomy of individual hairs of both plants. The protection provided by the trichomes could afford advantages under stress conditions, especially during leaf development. (author)

Oxidation of hydroxylamine by cytochrome P-460 of the obligate methylotroph Methylococcus capsulatus Bath.

Science.gov (United States)

Zahn, J A; Duncan, C; DiSpirito, A A

1994-01-01

An enzyme capable of the oxidation of hydroxylamine to nitrite was isolated from the obligate methylotroph Methylococcus capsulatus Bath. The absorption spectra in cell extracts, electron paramagnetic resonance spectra, molecular weight, covalent attachment of heme group to polypeptide, and enzymatic activities suggest that the enzyme is similar to cytochrome P-460, a novel iron-containing protein previously observed only in Nitrosomonas europaea. The native and subunit molecular masses of the M. capsulatus Bath protein were 38,900 and 16,390 Da, respectively; the isoelectric point was 6.98. The enzyme has approximately one iron and one copper atom per subunit. The electron paramagnetic resonance spectrum of the protein showed evidence for a high-spin ferric heme. In contrast to the enzyme from N. europaea, a 13-nm blue shift in the soret band of the ferrocytochrome (463 nm in cell extracts to 450 nm in the final sample) occurred during purification. The amino acid composition and N-terminal amino acid sequence of the enzyme from M. capsulatus Bath was similar but not identical to those of cytochrome P-460 of N. europaea. In cell extracts, the identity of the biological electron acceptor is as yet unestablished. Cytochrome c-555 is able to accept electrons from cytochrome P-460, although the purified enzyme required phenazine methosulfate for maximum hydroxylamine oxidation activity (specific activity, 366 mol of O2 per s per mol of enzyme). Hydroxylamine oxidation rates were stimulated approximately 2-fold by 1 mM cyanide and 1.5-fold by 0.1 mM 8-hydroxyquinoline. Images PMID:7928947

Fruit load governs transpiration of olive trees

NARCIS (Netherlands)

Bustan, Amnon; Dag, Arnon; Yermiyahu, Uri; Erel, Ran; Presnov, Eugene; Agam, Nurit; Kool, Dilia; Iwema, Joost; Zipori, Isaac; Ben-Gal, Alon

2016-01-01

We tested the hypothesis that whole-tree water consumption of olives (Olea europaea L.) is fruit load-dependent and investigated the driving physiological mechanisms. Fruit load was manipulated in mature olives grown in weighing-drainage lysimeters. Fruit was thinned or entirely removed from

Phytotherapy for children's nocturnal enuresis | Ahmadipour ...

African Journals Online (AJOL)

Results have shown that Zingiber officinale, Valeriana officinalis, Alcea rosea, Elettaria cardamomum, Cinnamomum verum, Ribes uva-crispa, Cornus mas, Juglans regia, Vitis vinifera, Sinapis spp., Olea europaea, and Prunus cerasus are a number of important plants that are effective on nocturnal enuresis in traditional ...

Populations of Bactrocera oleae (Diptera: Tephritidae) and Its Parasitoids in Himalayan Asia

Science.gov (United States)

For a biological control program against olive fruit fly, Bactrocera oleae Rossi, olives were collected in the Himalayan foothills (China, Nepal, India, and Pakistan) to discover new natural enemies. Wild olives, Olea europaea ssp. cuspidata (Wall ex. G. Don), were sparsely distributed and fly-infes...

Molecular characterization of olive cultivars grown in Iraq using ...

African Journals Online (AJOL)

husam

database for Iraqi olive cultivars, in breeding strategies and in correct cultivar identification. Key words: Olea europaea, genetic diversity ... cultivated fruit tree species in the Mediterranean basin. It is a predominant allogamous species .... carried out using an automatic DNA analyzer (Model 3100 Prism;. Applied Biosystems).

歯科基礎医学の教育について

OpenAIRE

SUZUKI, KAZUO

1993-01-01

For convenience in comparative rating the basic science subjects were considered separately general and oral anatomy, general and oral histology, embryology, general and oral physiology, biochemistry, and oral biochemistry, microbiology, and oral microbiology, dental pharmacology, general and oral pathology, dental material, and general and oral hygiene, oral pathology, dental materials, dental pharmacology, and hygiene while better classified as the clinical science, was committed to clinica...

Atenção, memória e funções executivas em crianças e adolescentes de 6 a 12 anos avaliados pelo CANTAB

OpenAIRE

Daniela Tsubota Roque

2013-01-01

A neuropsicologia infantil e uma area distinta dentro da neuropsicologia clinica e o seu surgimento e uma consequencia do reconhecimento de que as relacoes cerebrocomportamento na crianca diferem significativamente dessas relacoes no adulto. Diversos testes neuropsicologicos tem sido desenvolvidos especialmente para administracao em computador, incluindo a bateria CANTAB que tem sido amplamente utilizada em pesquisas com diferentes grupos de idade e patologias. Em relacao ao desenvolvimento, ...

A first experience with digital complete overdentures

OpenAIRE

Bajunaid, Salwa Omar

2016-01-01

The development of computer-aided design/computer-aided manufacturing systems for dentistry in the 1980s resulted in the successful fabrication of crowns, fixed dental prostheses, and superstructures for both natural teeth and dental implants. Today, this technology is available for constructing digitally designed and milled, completely removable dental prostheses. The procedure uses clinical and laboratory protocols that allow fabrication of completely removable prostheses within two clinica...

Molecular characterization of olive cultivars grown in Iraq using ...

African Journals Online (AJOL)

The results of this research confirmed AFLP and SSR to be useful tools in genetic relationships among olive cultivars, in creating a molecular database for Iraqi olive cultivars, in breeding strategies and in correct cultivar identification. Keywords: Olea europaea, genetic diversity, amplified fragment length polymorphism ...

Ammonium and hydroxylamine uptake and accumulation in Nitrosomonas

NARCIS (Netherlands)

Schmidt, I.; Look, C.; Bock, E.; Jetten, M.S.M.

2004-01-01

Starved cells of Nitrosomonas europaea and further ammonia oxidizers were able to rapidly accumulate ammonium and hydroxylamine to an internal concentration of about 1 and 0.8 M, respectively. In kinetic studies, the uptake/accumulation rates for ammonium [3.1 mmol (g protein)(-1) min(-1)] and

Arbuscular mycorrhizal fungi improve the growth of olive trees and ...

African Journals Online (AJOL)

Two native Algerian mycorrhizal fungi (Glomus mosseae and Glomus intraradices) were tested for their effect on the growth of micropropagated olive tree (Olea europaea L.). The effect of inoculation of plantlets with G. mosseae was also compared with chemical fertilization using osmocote. Specific molecular techniques ...

A decade of experience with the European Company

NARCIS (Netherlands)

Cremers, J.; Stollt, M.; Vitols, S.

2013-01-01

A little more than a decade ago one of the most significant developments in European company law and worker participation occurred: the European Union passed a Regulation and Directive on the European Company (or Societas Europaea, hereafter SE). This legislation is a major innovation in that it

Near-infrared spectroscopy for detection of hailstorm damage on olive fruit

Science.gov (United States)

A rapid, robust, unbiased and inexpensive discriminant method capable of classifying olive fruit (Olea europaea L.) on the basis of the presence of hailstorm damage is economically important to the olive oil milling industry. Thus, in the present study, the feasibility of Near-Infrared (NIR) spectro...

Syringa oblata Lindl var. alba as a source of oleuropein and related compounds

NARCIS (Netherlands)

Nenadis, N.; Vervoort, J.J.M.; Boeren, J.A.; Tsimidou, M.Z.

2007-01-01

The leaf methanol extract of Syringa oblata Lindl var. alba was investigated as a source of oleuropein and related compounds. The extract had a high total phenol content and a radical scavenging activity similar to that of the respective extract from Olea europaea leaves. HPLC-DAD characterisation

Genome sequence and genetic diversity of European ash trees

DEFF Research Database (Denmark)

Sollars, Elizabeth S A; Harper, Andrea L; Kelly, Laura J

2017-01-01

-heterozygosity Fraxinus excelsior tree from Gloucestershire, UK, annotating 38,852 protein-coding genes of which 25% appear ash specific when compared with the genomes of ten other plant species. Analyses of paralogous genes suggest a whole-genome duplication shared with olive (Olea europaea, Oleaceae). We also re...

Preparation, characterization and antibacterial effects of eco-friendly ...

African Journals Online (AJOL)

Purpose: To synthesize and characterize eco-friendly gold nanorods (Au-NRs) and to assess their effects against two bacterial strains. Methods: Synthesis of eco-friendly gold nanorods was done from an aqueous solution of chloroauric acid and cetyltrimethylammonium bromide by mixing Olea europaea fruit and Acacia ...

How does corporate mobility affect lawmaking? A comparative analysis

NARCIS (Netherlands)

Bratton, W.W.; McCahery, J.A.; Vermeulen, E.P.M.

2008-01-01

This paper examines the impact of increased corporate mobility on corporate lawmaking in the European Union (EU). More specifically, we seek an answer to a simple question: Has the increased mobility which arose from the implementation of the Societas Europaea (SE) and the path-breaking decisions of

How does corporate mobility affect lawmaking?: a comparative analysis

NARCIS (Netherlands)

Bratton, W.W.; McCahery, J.A.; Vermeulen, E.P.M.

2009-01-01

This paper examines the impact of increased corporate mobility on corporate lawmaking in the European Union (EU). More specifically, what is the answer to a simple question: has the increased mobility which arose from the implementation of the Societas Europaea (SE) and the path-breaking decisions

Daily variation patterns of airborne allergenic pollen in southwestern Spain.

Science.gov (United States)

González Minero, F J; Candau, P; Tomás, C; Morales, J

1998-01-01

The study was carried out using a Burkard sampler installed on the roof terrace of the School of Pharmacy, Seville, for two years (1995 and 1996). Eight pollen types described in the literature as having allergenic activity were chosen. They were Poaceae, Olea europaea, Chenopodiaceae/Amaranthaceae, Plantago, Rumex, Urticaceae (including Parietaria), Cupressaceae, and Platanus hispanica. The types were grouped according to the similarity of their pattern of intradiurnal variation in pollen concentration. The following associations were established by multivariate analysis: Urticaceae and Chenopodiaceae/Amaranthaceae (appearing mainly between 11:00 and 20:00), Olea europaea and Plantago (12:00 to 19:00), Poaceae and Rumex (appearing throughout the day), and Cupressaceae and Platanus hispanica (8:00 to 14:00). The patterns of intradiurnal variation were similar both years for each type, despite the fact that the two years were climatologically different (1995 was dry and 1996 wet). We conclude that these behavior patterns are endogenous to the plants, and are hardly affected by meteorological parameters.

Halophytic plants as a component of a bioregenerative life support system for recycling of NaCl contained in human liquid waste.

Science.gov (United States)

Balnokin, Yurii; Balnokin, Yurii; Myasoedov, Nikolay; Popova, Larissa; Tikhomirov, Alexander A.; Ushakova, Sofya; Tikhomirova, Natalia; Lasseur, Christophe; Gros, Jean-Bernard

europaea was selected from seven halophytic plant candidates, preliminary chosen from observations in their natural habitats, from our previous investigations and literature data. Characterization of the plant performance was obtained in the experiments on plants grown in water culture in a cultivation chamber under controlled conditions. A model nutrient solution simulating mineralized urine was used for halophyte growing. Under the experimental conditions, S.europaea exhibited high productivity and accumulated Na+ and Cl- in the shoots in high quantities. It has been shown that above-ground organs of S.europaea exhibit high nutritive value, the proteins are enriched with the essential amino acids and displayed high abundance of leucine, aspartic and glutamic acids. The results demonstrate that it is feasible to put into practice permanent Na+ and Cl- recycling in BLSS by a various-aged S.europaea conveyor. Relying on data on distribution of Na+ and Cl- between the plant and growth medium, parameters of the conveyor for permanent ion turnover in the system humans - exometabolites - nutrient solution - S.europaea - humans have been evaluated.

Author Details

African Journals Online (AJOL)

Herb yield and chemical composition of basil (Ocimum basilicum L) essential oil in relation to the different harvest period and cultivation conditions. Abstract PDF · Vol 13, No 2 (2016) - Articles Relationship between total phenolic, total flavonoid and oleuropein in different aged olive (Olea europaea l.) Cultivar leaves

The significance of spatial and temporal patterns of algal mat deposition in structuring salt-marsh vegetation

NARCIS (Netherlands)

Van Soelen, J.; Herman, P.M.J.; Bouma, T.J.

2006-01-01

Question: Are there hot spots of algal mat deposition in space and time at the marsh scale and, if so, how does this affect the coexistence of a dominant (Spartina anglica) and gap dependent (Salicornia europaea) species? Location: The Rattekaai salt marsh in the Scheldt estuary in the southwestern

Comparative evaluations of individual radiation doses at hospital environment in two decades 73-82 and 86-95

International Nuclear Information System (INIS)

Carreira, Mauricio Costa; Almeida, Adelaide de; Santos, Maria Concepta P.S.

1996-01-01

Individual radiation doses in two decades of Hospital das Clinicas, Ribeirao Preto, Sao Paulo State, Brazil, are analysed. The annual values are studied according to the hospital service and specific worker categories. The workers are classified in categories A or B as recommended by ICRP 35. Three types of individual monitors (film badges, Ca So 4 and Li F + Ca So 4 ) supplied by three distinct laboratories are compared

Red wine and cardiovascular health the "French Paradox" revisited

OpenAIRE

Giuseppe Lippi; Massimo Franchini; Gian Cesare Guidi

2010-01-01

Giuseppe Lippi1, Massimo Franchini2, Gian Cesare Guidi31U.O. di Diagnostica Ematochimica, 2Servizio di Immunoematologia e Trasfusione, Dipartimento di Patologia e Medicina di Laboratorio, Azienda Ospedaliero, Universitaria di Parma, Parma, Italy; 3Sezione di Chimica Clinica, Dipartimento di Scienze Morfologico-Biomediche, Università degli Studi di Verona, Verona, ItalyAbstract: The healthful and nutritive properties of wine have been acknowledged for thousands of years, but the obs...

pulse2percept: A Python-based simulation framework for bionic vision

OpenAIRE

Boynton, Geoffrey; Beyeler, Michael; Rokem, Ariel; Fine, Ione

2017-01-01

By 2020 roughly 200 million people worldwide will suffer from photoreceptor diseases such as retinitis pigmentosa and age-related macular degeneration, and a variety of retinal sight restoration technologies are being developed to target these diseases. One technology, analogous to cochlear implants, uses a grid of electrodes to stimulate remaining retinal cells. Two brands of retinal prostheses are currently approved for implantation in patients with late stage photoreceptor disease. Clinica...

Analysis of Activity Patterns and Performance in Polio Survivors

Science.gov (United States)

2006-10-01

correlations ( clustering ) from multiple observations on the same subject. Multivariable mixed models with random intercepts or both random...0.001 (0.001) (0.59) (ɘ.001) * The top p values compared the means between the three groups in using unpaired t tests, taking clustering of...May 2004. Talaty M. Models for Gait Analysis. 5th SIAMOC (Societa Italiana Di Analisi Del Movimento in Clinica) Congress, Loano, Italy November

Osteopetrosis - Albers-Schoenberg disease: a case report

International Nuclear Information System (INIS)

Jeronymo, J.R.B.; Borba, L.A.N.

1989-01-01

The authors present a brief review of the literature and report a case of osteopetrosis tardo which was diagnosed by chance at the Hospital de Clinicas - Universidade Federal do Parana. This patient had no clinical manifestation of the disease. The radiological findings were characteristic of osteopetrosis and the absence of clinical signs confirm the tardo form of this rare disease, with the patient been well at 74 years of age. (author)

Historia clinica de un caso de endocrinología

Directory of Open Access Journals (Sweden)

Max Olaya Restrepo

1951-09-01

de la Distrofia adiposo-genital de Babinsky-Frolich. Consiste en un sujeto, hombre o mujer, estadísticamente es más frecuente en los hombres, que presenta algunas de las modalidades características del Síndrome de Frolich, tan conocido y estudiado por, todos los investigadores. Sobre esta base endocrina, se injertan tres, distintivos somáticos que le dan cierta individualidad al Síndrome de Lawrence. Son ellos: LA POLIDACTILIA, LA RETINITIS PIGMENTARIA Y EL BOCIO. Se presentan a continuación los dos casos anteriormente descritos entre nosotros, que aparecen publicados ambos, en el BOLETIN CLINICO, Organo de la Facultad de Medicina y Ciencias Naturales de la Universidad de Antioquia.

Antithrombotic effect of repeated doses of the ethanolic extract of ...

African Journals Online (AJOL)

Antithrombotic effect of repeated doses of the ethanolic extract of local olive ( Olea europaea L.) leaves in rabbits. ... The incidence of thromboembolic diseases is increasing, and they are a major cause of mortality and morbidity worldwide. Mediterranean diet is known for its high content of olive products, especially olive oil, ...

Komise pro dějiny a vývoj evropského zemědělství SIEF a česká etnografie v 60.-80. letech 20. století

Czech Academy of Sciences Publication Activity Database

Woitsch, Jiří

2017-01-01

Roč. 34, č. 1 (2017), s. 48-76 ISSN 1211-8117 R&D Projects: GA ČR GA15-03754S Institutional support: RVO:68378076 Keywords : SIEF * Commission for History and Development of European Agriculture * Ethnologia Europaea * agriculture * international projects Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

Author Details

African Journals Online (AJOL)

Sghir, F. Vol 61 (2013) - Articles Mycorrhizal status of Olea europaea spp. oleaster in Morocco Abstract PDF · Vol 64 (2013) - Articles Diversity of arbuscular mycorrhizal fungi in the rhizosphere of Coffea arabica in the Republic of Yemen Abstract PDF. ISSN: 1997-5902. AJOL African Journals Online. HOW TO USE AJOL.

Environmental impact from mountainous olive orchards under different soil-management systems (SE Spain)

NARCIS (Netherlands)

Francia-Martinez, J.R.; Duran Zuazo, V.H.; Martinez-Raya, A.

2006-01-01

Soil erosion, runoff and nutrient-loss patterns over a two-year period (1999¿2000) were monitored in erosion plots on a mountainside with olive (Olea europaea cv. Picual) trees under three different types of soil management: (1) non-tillage with barley (Hordeum vulgare) strips of 4 m width (BS); (2)

New chorological data and floristic notes for Albania

DEFF Research Database (Denmark)

Shuka, L.; Malo, Sadik; Tan, Kit

2011-01-01

Twelve taxa belonging to fi ve families are reported based on fi eldwork in Albania from 2007 to 2010. Eleven have not been recorded for the country in the relevant volumes of Flora Europaea, Flora of Albania or the Med-Checklist. Notes on ecology and distribution are provided and all the taxa ar...

AcEST: DK944957 [AcEST

Lifescience Database Archive (English)

Full Text Available ant alignments: (bits) Value sp|Q82Y15|ORN_NITEU Oligoribonuclease OS=Nitrosomonas europaea G... 31 1.7 sp|Q9JLC8|SACS_MOUSE Sacsi...LVVTDAQLNTLAEAPVLVVHQPDDI 54 >sp|Q9JLC8|SACS_MOUSE Sacsin OS=Mus musculus GN=Sacs PE=1 SV=2 Length = 4582 Sc

Clinical Photoscintillography: Technique and Applications; Photoscintigraphie Clinique: Methode et Applications; Klinicheskaya fotostsintillografiya: metodika i primenenie; Fotocentelleografia Clinica: Tecnicas y Aplicaciones

Energy Technology Data Exchange (ETDEWEB)

Ephraim, K. H. [Rotterdamsch Radio-Therapeutisch Instituut, Rotterdam (Netherlands)

1964-10-15

' de exploracion. La intensidad luminosa y la frecuencia de los destellos de esta ultima varian con el indice de recuento, obteniendose asi una respuesta no lineal sin introducir la inercia de un circuito integrador. Los destellos 'secundarios' se registran sobre pelicula. Para impedir la perdida de datos debido a su registro en la region de saturacion de la curva de sensibilidad de la pe licu la, se utiliza una amplificacion de contraste moderada y la pelicula se examina en un circuito de television industrial. El autor subraya la necesidad de adaptar las condiciones de colimacion al problema clinico que haya de resolverse. En la memoria se examinan las aplicaciones clinicas de esta tecnica al estudio de enfermedades tiroideas, renales, hepaticas y oseas. (author) [Russian] Pri primenenii fotoscintillografii v klinike ogromnoe znachenie imejut kollimacija, u si l e nie kontrastnosti i nakoplenie dannyh. Dlja obnaruzhenija ogranichennyh uchastkov porazhenija v takih plotnyh organah, kak pechen' i mozg , byl razrabotan special'nyj 36-kanal'nyj mnogofokusnyj kollimator. Demonstrirujutsja izochuvstvitel'nye linii jet o go kollimator a . E go chuv stvitel'nost' malo m en ja et sja ot poverhnosti do glubiny, ravnoj naibol'shej tolshhine pecheni. Byl postr oen special'nyj usilitel' kontrastnosti: nebol'shaja ''pervichnaja'' lampa nakalivanija, soedinennaja cherez impul'snyj usilitel' na vyhode odnokanal'nogo an a l i za t or a upravlja etsja s pomoshh'ju za vi sim o go ot svetareostata (ZSR). Soprotovlenie 3 SR izmenja etsja v zavisimosti ot sk or o sti . Posledovatel'no po otnosheniju k ZSR s o edinena skennirujushhaja ''vtorichnaja'' lampa nakalivanija. Jarkost', a takzhe chastota vspyshek poslednej zavisit ot skorosti scheta i tem samym nelinejnaja chuvstviteltnost' dostigaetsja b e z vvedenija inercionnogo k on tura. ''Vtorichnye'' vspyshki re gi str i rujut sja na p lenk e. S cel'ju predotvrashhenija poteri informacii pri registracii v oblasti nasyshhenija krivoj chuv

Minimally invasive aesthetic procedures in young adults

OpenAIRE

Wollina, Uwe; Goldman, Alberto

2011-01-01

Uwe Wollina1, Alberto Goldman21Department of Dermatology and Allergology, Academic Teaching Hospital Dresden-Friedrichstadt, Dresden, Germany; 2Clinica Goldman, Porto Alegre, Rio Grande du Sul, BrazilAbstract: Age is a significant factor in modifying specific needs when it comes to medical aesthetic procedures. In this review we will focus on young adults in their third decade of life and review minimally invasive aesthetic procedures other than cosmetics and cosmeceuticals. Correction of asy...

Ricerca clinico-epidemiologica sullo stato di salute del cavo orale nei pazienti tossicodipendenti

OpenAIRE

Bromo, Francesco

2010-01-01

Obiettivo: Lo scopo della ricerca è stato quello di mettere in evidenza la presenza di patologie del cavo orale in soggetti tossicodipendenti Materiali e Metodi: Sono stati reclutati 71 pazienti in terapia di recupero presso la Comunità Incontro di Amelia. I soggetti sono stati sottoposti a visite clinico-anamnestiche adottando una cartella clinica da noi stessi costruita. Risultati: Dei 71 soggetti tossicodipendenti, 42 facevano uso di eroina e 39 assumevano droghe per v...

Performance of a sample of patients with Mild Cognitive Impairment (MCI), Alzheimer's Disease (AD) and healthy elderly on a lexical decision test (LDT) as a measure of pre-morbid intelligence

OpenAIRE

Serrao, Valéria Trunkl; Brucki, Sônia Maria Dozzi; Campanholo, Kenia Repiso; Mansur, Letícia Lessa; Nitrini, Ricardo; Miotto, Eliane Correa

2015-01-01

Objective: The objective of this study was to describe the performance of healthy elderly patients with aging-related pathologies (MCI) and patients with AD on a lexical decision test. Methods: The study included 38 healthy elderly subjects, 61 MCI and 26 AD patients from the Neurology Department of the Hospital das Clinicas, Behavioral and Cognitive Neurology Group. The neuropsychological instruments included the episodic memory test (RAVLT), subtests from the WAIS-III (Matrix Reasoning and...

Outering the Self through the mirror : physiological and experiential correlates of the Enfacement Illusion phenomenon in schizophrenia

OpenAIRE

Pietrangelo, Brigitte

2017-01-01

Introduzione: Negli ultimi anni, lo studio dei prodromi della Schizofrenia ha riconosciuto i Disturbi del Sè (SD) come una componente clinica fondamentale di questa patologia psichiatrica. I SD si definiscono come anomalie soggettive dell’esperienza che precedono la fase conclamata della malattia e che includono, ad esempio, la scarsa distinzione tra Sé-Altro ed anomalie sensoriali del corpo. Il concetto di SD si allaccia alla concettualizzazione del senso di consapevolezza corporea (Body-aw...

Growth in serum-free medium improves isolation of Chlamydia pneumoniae.

OpenAIRE

Maass, M; Essig, A; Marre, R; Henkel, W

1993-01-01

Infectivity titers were determined for eight Chlamydia pneumoniae strains simultaneously grown in serum-free and serum-supplemented cell culture media. Use of serum-free medium resulted in a 10- to 50-fold increase in the susceptibility of HL cells to chlamydial infection. Comparative primary isolation of a wild-type strain also produced higher inclusion counts in a serum-free environment. Serum-free cultivation is recommended to increase the efficiency of C. pneumoniae isolation from clinica...

Analysis of HLA-A, HLA-B, HLA-DRB1 allelic, genotypic, and haplotypic frequencies in colombian population

OpenAIRE

Yazmin Rocío Árias-Murillo; Miguel Ángel Castro-Jiménez; María Fernanda Ríos-Espinosa; Juan Javier López-Rivera; Sandra Johanna Echeverry-Coral; Oscar Martínez-Nieto

2010-01-01

Introduction: The high polymorphism of the HLA system allows its typification to be used as valuable tool in establishing association to various illnesses, immune and genetic profiles; it also provides a guide to identifying compatibility among donors and receptors of organs transplants. Objective: To establish HLA-A, HLA-B, and HLA.DRB1 allele, genotype and haplotype frequencies among patients treated at Clinica Colsanitas SA. Methods: 561 patients coming from different regions in Col...

T2 Mapping of Articular Cartilage of Glenohumeral Joint with Routine MRI Correlation—Initial Experience

OpenAIRE

Maizlin, Zeev V.; Clement, Jason J.; Patola, Wayne B.; Fenton, David M.; Gillies, Jean H.; Vos, Patrick M.; Jacobson, Jon A.

2009-01-01

The evaluation of articular cartilage currently relies primarily on the identification of morphological alterations of the articular cartilage. Unlike anatomic imaging, T2 mapping is sensitive to changes in the chemical composition and structure of the cartilage. Clinical evaluation of T2 mapping of the glenohumeral joint has not been previously reported. The objectives of this study were to evaluate the feasibility of magnetic resonance T2 mapping of the glenohumeral joint in routine clinica...

Sustitutos e injertos de piel desarrollados por ingeniería de tejidos

OpenAIRE

Chaves-Rodríguez, María Inés; Calvo-Castro, Laura A.; Alvarado-Meza, Ricardo; Madrigal-Monge, Olman; Ulloa-Fernández, Andrea; Centeno-Cerdas, Carolina

2015-01-01

Tissue Engineering strategies for tissue and organ regeneration have allowed the fabrication and commercialization of diverse skin substitutes, which have been applied in different parts of the world on human patients over the course of the last 30 years. These grafts have been developed using biodegradable materials (of natural or synthetic origin) as scaffolds for the adhesion and proliferation of cells that may be of different origins (autologous, allogenic and xenogenic). The main clinica...

La función de lo imaginario en el juego.

OpenAIRE

Cruz Aponasenko, Alexander

2012-01-01

Recibido: Agosto.2012 Aceptado: Septiembre.2012 Este trabajo revisa la influencia de los factores imaginarios del juego en la estructuración subjetiva y la conformación del fantasma en los niños a partir del juego. Se propone ampliar la concepción de juego que se tiene en la clinica de niños y poner en tensión la primacia de los simbolico frente a lo imaginario.

Negative response of photosynthesis to natural and projected high seawater temperatures estimated by pulse amplitude modulation fluorometry in a temperate coral.

Science.gov (United States)

Caroselli, Erik; Falini, Giuseppe; Goffredo, Stefano; Dubinsky, Zvy; Levy, Oren

2015-01-01

Balanophyllia europaea is a shallow water solitary zooxanthellate coral, endemic to the Mediterranean Sea. Extensive field studies across a latitudinal temperature gradient highlight detrimental effects of rising temperatures on its growth, demography, and skeletal characteristics, suggesting that depression of photosynthesis at high temperatures might cause these negative effects. Here we test this hypothesis by analyzing, by means of pulse amplitude modulation fluorometry, the photosynthetic efficiency of B. europaea specimens exposed in aquaria to the annual range of temperatures experienced in the field (13, 18, and 28°C), and two extreme temperatures expected for 2100 as a consequence of global warming (29 and 32°C). The indicators of photosynthetic performance analyzed (maximum and effective quantum yield) showed that maximum efficiency was reached at 20.0-21.6°C, slightly higher than the annual mean temperature in the field (18°C). Photosynthetic efficiency decreased from 20.0 to 13°C and even more strongly from 21.6 to 32°C. An unusual form of bleaching was observed, with a maximum zooxanthellae density at 18°C that strongly decreased from 18 to 32°C. Chlorophyll a concentration per zooxanthellae cell showed an opposite trend as it was minimal at 18°C and increased from 18 to 32°C. Since the areal chlorophyll concentration is the product of the zooxanthellae density and its cellular content, these trends resulted in a homogeneous chlorophyll concentration per coral surface across temperature treatments. This confirms that B. europaea photosynthesis is progressively depressed at temperatures >21.6°C, supporting previous hypotheses raised by the studies on growth and demography of this species. This study also confirms the threats posed to this species by the ongoing seawater warming.

Negative response of photosynthesis to natural and projected high seawater temperatures estimated by pulse amplitude modulation fluorometry in a temperate coral

Directory of Open Access Journals (Sweden)

Erik eCaroselli

2015-11-01

Full Text Available Balanophyllia europaea is a shallow water solitary zooxanthellate coral, endemic to the Mediterranean Sea. Extensive field studies across a latitudinal temperature gradient highlight detrimental effects of rising temperatures on its growth, demography and skeletal characteristics, suggesting that depression of photosynthesis at high temperatures might cause these negative effects. Here we test this hypothesis by analyzing, by means of pulse amplitude modulation fluorometry, the photosynthetic efficiency of B. europaea specimens exposed in aquaria to the annual range of temperatures experienced in the field (13°C, 18°C, and 28°C, and two extreme temperatures expected for 2100 as a consequence of global warming (29°C and 32°C. The indicators of photosynthetic performance analyzed (maximum and effective quantum yield showed that maximum efficiency was reached at 20.0-21.6°C, slightly higher than the annual mean temperature in the field (18°C. Photosynthetic efficiency decreased from 20.0°C to 13°C and even more strongly from 21.6°C to 32°C. An unusual form of bleaching was observed, with a maximum zooxanthellae density at 18°C that strongly decreased from 18°C to 32°C. Chlorophyll a concentration per zooxanthellae cell showed an opposite trend as it was minimal at 18°C and increased from 18°C to 32°C. Since the areal chlorophyll concentration is the product of the zooxanthellae density and its cellular content, these trends resulted in a homogeneous chlorophyll concentration per coral surface across temperature treatments. This confirms that B. europaea photosynthesis is progressively depressed at temperatures >21.6°C, supporting previous hypotheses raised by the studies on growth and demography of this species. This study also confirms the threats posed to this species by the ongoing seawater warming.

Mining olive genome through library sequencing and bioinformatics ...

African Journals Online (AJOL)

As one of the initial steps of olive (Olea europaea L.) genome analysis, a small insert genomic DNA library was constructed (digesting olive genomic DNA with SmaI and cloning the digestion products into pUC19 vector) and randomly picked 83 colonies were sequenced. Analysis of the insert sequences revealed 12 clones ...

Growth rates of important East African montane forest trees, with ...

African Journals Online (AJOL)

These trees showed growth rates at least twice as high as those of the primary species. Juniperus procera was found to be the fastest growing species in the cedar forest, underlining its success in forming dense stands after a fire. Only young Podocarpus latifolius showed a similar fast growth. Olea europaea ssp. cuspidata, ...

Trade-off between light availability and soil fertility determine refugial conditions for the relict light-demanding species in lowland forests

Science.gov (United States)

Kiedrzyński, Marcin; Kurowski, Józef Krzysztof; Kiedrzyńska, Edyta

2017-11-01

Identifying potential refugial habitats in the face of rapid environmental change is a challenge faced by scientists and nature conservation managers. Relict populations and refugial habitats are the model objects in those studies. Based on the example of Actaea europaea from Central Poland, we analyse the habitat factors influencing relict populations of continental, light-demanding species in lowland forests and examine which habitats of studied species corresponding most closely to ancient vegetation. Our results indicate that the current refugial habitats of Actaea europaea include not only communities which are very similar to ancient open forest but also forests with a closed canopy. Although the populations are influenced by nitrogen and light availability, the co-occurrence of these two factors in forest communities is limited by dense canopy formation by hornbeam and beech trees on fertile soils and in more humid conditions. Our findings indicate that the future survival of relict, light-demanding communities in lowland forests requires low-intensity disturbances to be performed in tree-stands, according to techniques, which imitate traditional forests management.

High helmintic infection of the European grass snake, Natrix natrix and the dice snake, Natrix tessellate (Serpentes: Colubridae from Iran

Directory of Open Access Journals (Sweden)

Mohammad Reza Yossefi

2014-02-01

Full Text Available Objective: To determine the helminth parasites of Natrix natrix Linnaeus, 1758 (N. natrix and Natrix tessellata Laurenti, 1768 (N. tessellate in north of Iran. Methods: Eighteen snakes including nine N. natrix and nine N. tessellata from Mazandaran Province, north of Iran were collected and examined during March 2011 to October 2011 for helminth parasites. The collected specimens were fixed and preserved in 70% ethanol. Results: All of the examined snakes (100% were infected with parasitic helminth. The list of extracted helminths both in N. natrix and N. tessellata includes one Nematode: Rhabdias fuscovenosa (larva, one Digenea: Telorchis assula and one Cestoda: Ophiotaenia europaea. The infection rate of Ophiotaenia europaea, Telorchis assula and Rhabdias fuscovenosa (larva from collected snakes were 100%, 83.3% and 61.1%, respectively. Moreover, in the current investigation the morphological characteristics of the collected helminths were described elaborately. Conclusions: This is the first survey on helminth parasites from N. tessellata in Iran and the helminthes are reported for the first time from this host in Iran.

A dehydrin gene isolated from feral olive enhances drought tolelance

Directory of Open Access Journals (Sweden)

Adriana eChiappetta

2015-06-01

Full Text Available Dehydrins belong to a protein family whose expression may be induced or enhanced by developmental process and environmental stresses that lead to cell dehydratation. A dehydrin gene named OesDHN was isolated and characterized from oleaster (Olea europaea L. subsp. europaea, var. sylvestris, the wild form of olive.To elucidate the contribution of OesDHN in the development of drought tolerance, its expression levels were investigated in oleaster plants during development and under drought stress condition. The involvement of OesDHN in plant stress response was also evaluated in Arabidopsis transgenic lines, engineered to overexpress this gene, and exposed to a controlled mild osmotic stress. OesDHN expression was found to be modulated during development and induced under mild drought stress in oleaster plants. In addition, the Arabidopsis transgenic plants showed a better tolerance to osmotic stress than wild-type plants. The results demonstrated that OesDHN expression is induced by drought stress and is able to confer osmotic stress tolerance. We suggest a role for OesDHN, as a putative functional marker of plant stress tolerance.

Proceedings of the Fourth Annual Deep Brain Stimulation Think Tank: A Review of Emerging Issues and Technologies

OpenAIRE

Deeb, Wissam; Giordano, James J.; Rossi, Peter J.; Mogilner, Alon Y.; Gunduz, Aysegul; Judy, Jack W.; Klassen, Bryan T.; Butson, Christopher R.; Van Horne, Craig; Deny, Damiaan; Dougherty, Darin D.; Rowell, David; Gerhardt, Greg A.; Smith, Gwenn S.; Ponce, Francisco A.

2016-01-01

This paper provides an overview of current progress in the technological advances and the use of deep brain stimulation (DBS) to treat neurological and neuropsychiatric disorders, as presented by participants of the Fourth Annual DBS Think Tank, which was convened in March 2016 in conjunction with the Center for Movement Disorders and Neurorestoration at the University of Florida, Gainesveille FL, USA. The Think Tank discussions first focused on policy and advocacy in DBS research and clinica...

Association between Urine Fluoride and Dental Fluorosis as a Toxicity Factor in a Rural Community in the State of San Luis Potosi

OpenAIRE

Jarquín-Yañez, Lizet; Mejía-Saavedra, José de Jesús; Molina-Frechero, Nelly; Gaona, Enrique; Rocha-Amador, Diana Olivia; López-Guzmán, Olga Dania; Bologna-Molina, Ronell

2015-01-01

Objective. The aim of this study is to investigate urine fluoride concentration as a toxicity factor in a rural community in the state of San Luis Potosi, Mexico. Materials and Methods. A sample of 111 children exposed to high concentrations of fluoride in drinking water (4.13?mg/L) was evaluated. Fluoride exposure was determined by measuring urine fluoride concentration using the potentiometric method with an ion selective electrode. The diagnosis of dental fluorosis was performed by clinica...

Gender Dependence in Mouth Opening Dimensions in Normal Adult Malaysians Population

OpenAIRE

Shaari, Ramizu; Hwa, Teoh Eng; Rahman, Shaifulizan Abdul

2011-01-01

While measurement of mouth opening is an important clinica examination in diagnosis and management of oral disease, data on non-Western populations are limited. This study was therefore conducted to determine the range of mouth opening in normal Malaysian male and female adults. A total of 34 dental students of Universiti Sains Malaysia (USM) were chosen randomly and their maximum mouth opening was measured after being asked to open their mouth sufficiently to accommodate three fingers. Measu...

The impact of oral health on the quality of life of nursing home residents

OpenAIRE

Porter, Jessie; Ntouva, Antiopi; Read, Andrew; Murdoch, Mandy; Ola, Dennis; Tsakos, Georgios

2015-01-01

Background Good oral health in older residents of nursing homes is important for general health and quality of life. Very few studies have assessed how oral symptoms affect residents? quality of life. Objective To assess the clinical and subjective oral health, including oral health related quality of life (OHRQoL), and the association of oral symptoms with OHRQoL in older people residing in nursing homes in Islington, London. Method Overall, 325 residents from nine nursing homes were clinica...

Generation of electric power through wind-diesel hybrid system for a hospital; Geracao de energia eletrica atraves de sistema hibrido diesel-eolico para um hospital

Energy Technology Data Exchange (ETDEWEB)

Almeida, Silvio Carlos Anibal de; Freire, Raphael Lopes [Universidade Federal do Rio de Janeiro (DEM/UFRJ), RJ (Brazil). Dept. de Engenharia Mecanica], e-mail: silvioa@gmail.com, e-mail: raphaellfreire@gmail.com

2008-07-01

This paper presents a wind-diesel hybrid power simulation using the software Homer. The model is applied to the case study of Hospital das Clinicas da UNICAMP Analysis of several alternative energy facilities like wind, photovoltaic (PV), and connection of the isolated system with the grid is done. The costs used in the simulation indicated that the best results were obtained with the wind-diesel system. The payback period for the investment in the system is 8 years. (author)

Egg introduction: differential allergic responses

OpenAIRE

Dosanjh, Amrita

2017-01-01

Amrita Dosanjh Medical Center, Rady Childrens Hospital, San Diego, CA, USA Abstract: The use of egg protein preparations in clinical trials to reduce the incidence of egg allergy among infants includes a number of preparations of egg. These include whole egg, egg white protein, and egg yolk preparations. The study of the differential immune responses to these allergenic proteins in comparison is suggested as a future research area of investigation. Keywords: food allergy, egg allergy, clinica...

Efectos de Bisfosfonatos sobre el hueso y su repercusión sobre el movimiento Ortodóncico: Revisión de la literatura

OpenAIRE

Villoria, Carmen

2004-01-01

En esta revision de la literatua, se obtuvo informaion acerca de los bisfosfonatos sobre el hueso y las aplicaciones clinicas que tienen durante el movimiento de los dientes en ortodoncia los bisfosfonatos son una familia de drogas usadas atualmente en medicina para combatir afecciones oseas como: Osteoporosis, metastasis oseas, osteolosis, en mielomas, enfermedad de paget, etc. en odontologia, el efecto mas notable entre otros es el de anclaje a nivel local durante el movimiento ortodoncio d...

Compact device for the extraction of sup(99m)TcO4Na

International Nuclear Information System (INIS)

Pliego, O.H.; Mitta, A.E.A.

1982-01-01

A non automatic device for the extraction of sup(99m)TcO 4 Na by liquid-liquid extraction method is described. It has been developed at the Laboratory of Labelled Molecules of the CNEA and was installed at the Nuclear Medicine Centre of the Hospital de Clinicas Jose de San Martin. The solutions of sup(99m)TcO 4 Na are used for the labelling of radiopharmaceuticals and also for making radiodiagnosis. (author) [es

Cornice epistemologica e metodologica del modello sistemico pluralista

Directory of Open Access Journals (Sweden)

Cecilia Edelstein

2013-12-01

Full Text Available L’articolo illustra il modello di lavoro che si è sviluppato negli ultimi trent’anni, attraverso l’intreccio tra ricerca, formazione, clinica e lavori di comunità, e che ha dato spazio all’approccio sistemico pluralista in ambito interculturale. Quest’ultimo ha sviluppato una cornice che comprende lo sviluppo di nuovi concetti, metodologie di lavoro e tecniche specifiche che attingono a teorie diverse. L’articolo, quindi, offre un quadro epistemologico, ma anche metodologico e concettuale.

EFECTO ANALGESICO DEL LASER EN PUNTOS ASHI, EN PACIENTES GERIATRICOS CON GONOARTROSIS, EVALUANDO EL DOLOR CON ESCALA VISUAL ANALOGA. PREVIA APERTURA DE CANALES TENDINOMUSCULARES

OpenAIRE

LUENGAS CRUCES, SARA ELIZABETH

2010-01-01

LA GONOARTROSIS, ES EL PADECIMIENTO MAS FRECUENTE EN LA PRACTICA CLINICA REUMATOLOGICA. TIENE UNA PREVALENCIA ALTA EN PERSONAS MAYORES DE 30 ANOS, POR LO QUE YA CONSTITUYE UN PROBLEMA DE SALUD Y FORMA PARTE DE UNA PANDEMIA DE ENFERMEDADES CRONICO-DEGENERATIVAS (VAZQUEZ MARTINEZ F Y ORTIZ ALVAREZ O. LA INVESTIGACION LATINOAMERICANA SOBRE OSTEOARTROSIS. GAC.MED. VOL. IV,1990 PG. 131)EN LOS REPORTES ESTADISTICOS DEL INEGI Y EN LOS SERVICIOS DE CONSULTA EXTERNA DE ESPECIALIDADES DEL IMSS LA PREVA...

Humility Through Humiliation in Continuity Clinic.

Science.gov (United States)

Lelkes, Efrat

2016-01-01

For freshly minted MDs, residency represents a period of transition from being a medical student to becoming a physician. This evolution is often fraught. Continuity clinic-a mandatory component of pediatric residency training-can be a battleground for this tribulation. This essay explores the author's journey from the first days of her continuity clinic to the last. The author recounts her struggles, her fears, her certainty of being an imposter, and her steps towards becoming a pediatrician.

A rare case of anasarca caused by infiltration of the pituitary gland by diffuse large B-cell lymphoma

OpenAIRE

Kumabe, Ayako; Kenzaka, Tsuneaki; Nishimura, Yoshioki; Aikawa, Masaki; Mori, Masaki; Matsumura, Masami

2015-01-01

Background Anasarca in patients with lymphoma is a rare symptom. We report a patient with DLBCL associated with pituitary gland infiltration that was diagnosed based on significant anasarca. Case presentation A 72-year-old woman with a 10-year history of hypertension visited a local hospital presenting with anasarca and 15-kg weight gain in the past 3?months. we clinically diagnosed central hypothyroidism caused by pituitary gland infiltration of diffuse large B-cell lymphoma (DLBCL) (clinica...

Risks and Benefits of Commonly used Herbal Medicines in México

OpenAIRE

Rodriguez-Fragoso, Lourdes; Reyes-Esparza, Jorge; Burchiel, Scott; Herrera-Ruiz, Dea; Torres, Eliseo

2007-01-01

In Mexico, local empirical knowledge about medicinal properties of plants is the basis for their use as home remedies. It is generally accepted by many people in Mexico and elsewhere in the world that beneficial medicinal effects can be obtained by ingesting plant products. In this review, we focus on the potential pharmacologic bases for herbal plant efficacy, but we also raise concerns about the safety of these agents, which have not been fully assessed. Although numerous randomized clinica...

[Scientific productivity, collaboration and research areas in Enfermedades Infecciosas y Microbiología Clínica (2003-2007)].

Science.gov (United States)

González-Alcaide, Gregorio; Valderrama-Zurián, Juan Carlos; Ramos-Rincón, José Manuel

2010-10-01

Collaboration is essential for biomedical research. The Carlos III Health Institute (the Spanish national public organization responsible for promoting biomedical research) has encouraged scientific collaboration by promoting Thematic Networks and Cooperative Research Centres. Scientific collaboration in Enfermedades Infecciosas y Microbiología Clinica journal is investigated. Papers published in Enfermedades Infecciosas y Microbiología Clinica in the period 2002-2007 have been identified. Bibliometrics and Social Network Analysis methods have been carried out in order to quantify and characterise scientific collaboration and research areas. A total of 805 papers generated by 2,289 authors and 326 institutions have been analysed. There were 36 research groups involving 138 authors identified. The Collaboration Index for articles was 5.5. Institutional collaboration was determined in 75% of articles. The collaboration between departments or units of the same institution prevails (43%), followed by intra-regional domestic collaboration (41%) and inter-regional domestic collaboration (14%). Hospital centres were the main institutional sector responsible of research (88% of papers), with 68% of articles cited. Sida/VIH (AIDS/HIV) is the main research area (n=114), followed by Staphylococcal Infections (n=33). Notable collaboration and citation rates have been observed. Research is focused on diseases with the highest mortality rates caused by infectious diseases in Spain. Copyright © 2009 Elsevier España, S.L. All rights reserved.

Multiplicação in vitro de oliveira (Olea europaea L. Olive (Olea europaea L. in vitro multiplication

Directory of Open Access Journals (Sweden)

Leonardo Ferreira Dutra

2004-02-01

Full Text Available Com o objetivo de induzir a multiplicação em explantes de oliveira, segmentos nodais oriundos de plântulas mantidas in vitro foram excisados e inoculados em tubos de ensaio contendo meio de cultura MS suplementado com 2 g L-1 de carvão ativado, BAP (0, 1, 2 e 4 mg L-1 e ANA (0; 0,01; 0,1 e 1 mg L-1, solidificado com 6 g L-1 de ágar e pH ajustado para 5,8. Durante 100 dias, os explantes foram mantidos em sala de crescimento a 25±1ºC, intensidade luminosa de 32 µmoles.m-2.s-1 e fotoperíodo de 16 horas. Não houve indução de brotações nos segmentos nodais. O maior comprimento da parte aérea foi obtido com 0,1 mg L-1 de ANA na ausência de BAP. O meio de cultura sem BAP proporcionou maior peso de matéria fresca da parte aérea.This work had the objective to induce olive multiplication. Nodal segments from in vitro plantlets were excised and inoculated in test tubes containing MS culture medium supplemented with activated charcoal (2 g L-1, BAP (0, 1, 2 and 4 mg L-1, NAA (0; 0.01; 0.1 and 1 mg L-1, agar (6 g L-1 and pH adjusted to 5.8. The explant were maintained in growth room to 25±1°C, 32 µmoles.m-2.s-1 light intensity and 16 hours photoperiod for 100 days. There was not shoots induction in the nodal segments. Larger length of aerial part were obtained with ANA 0.1 mg L-1 in the BAP absence. Culture medium without BAP provides larger weight of fresh matter of the aerial part.

Muscular cysticercosis: Case report and imaging findings

Energy Technology Data Exchange (ETDEWEB)

Olmo, Neide Regina Simoes; Fiorio, Ulysses Ferreira; Clemente, Marcel Andreazza, E-mail: neideolmo@yahoo.com.br [Clinica Mult Imagem, Santos, SP (Brazil); Bastos, Eder Amaral [Universidade Metropolitana de Santos (UNIMES), Santos, SP (Brazil); Mendes, Gustavo Gomes [AC Camargo Cancer Center, Sao Paulo, SP (Brazil)

2016-11-15

Cysticercosis is a parasitic disease caused by a worm of the Cestoda class. The most prevalent form affects the nervous system. This case report is from a 78-year old female patient evaluated at Clinica Mult Imagem, in the city of Santos, Brazil, who presented a form of the disease that differed from the classic neurocysticercosis, in this case muscular cysticercosis. This and other forms of manifestation justify further studies to ensure adequate recognition, diagnosis and treatment of this parasitic disease. (author)

Lupic nephropathy: a case control study in Medellín, Colombia Nefropatía lúpica: estudio de 156 casos

OpenAIRE

Fernando Zambrano; Javier Molina; Carmen E. Cerón

1989-01-01

By means of a case-control study we analyzed the cllnlcal histories of 297 patients with systemic erythematous lupus, that were seen at the out-patient section of the Rheumatology Service, Hospital Universitario San Vicente de Paúl, in Medellín, Colombia, between 1970 and 1987. Renal involvement was documented in 156 (52.5%) cases while in 94 (31.6%) there were alterations in the urinary sediment without clinica...

Construcao de subconjuntos terminologicos: contribuicoes a pratica clinica do enfermeiro

Directory of Open Access Journals (Sweden)

Jorge Wilker Bezerra Clares

2013-08-01

Full Text Available A Classificação Internacional para a Prática de Enfermagem (CIPE® é um sistema de classificação unificador dos elementos da prática de enfermagem (diagnósticos, resultados e intervenções, que possibilita elucidar elementos da linguagem própria da Enfermagem por meio da construção de subconjuntos terminológicos. Neste ensaio reflexivo, destacam-se aspectos relevantes para a construção de subconjuntos terminológicos CIPE®, bem como suas contribuições para a prática clínica do enfermeiro. Discute-se a elaboração de subconjuntos como ferramenta que contribui para a universalização da linguagem da Enfermagem, facilita o processo comunicativo, bem como o avanço científico e tecnológico da profissão. Portanto, incentiva-se seu uso por enfermeiros de todo o mundo.

Factors Affecting Resident Satisfaction in Continuity Clinic-a Systematic Review.

Science.gov (United States)

Stepczynski, J; Holt, S R; Ellman, M S; Tobin, D; Doolittle, Benjamin R

2018-05-07

In recent years, with an increasing emphasis on time spent in ambulatory training, educators have focused attention on improving the residents' experience in continuity clinic. The authors sought to review the factors associated with physician trainee satisfaction with outpatient ambulatory training. A systematic literature review was conducted for all English language articles published between January 1980 and December 2016 in relevant databases, including Medline (medicine), CINAHL (nursing), PSYCHinfo (psychology), and the Cochrane Central Register of Controlled Clinical Trials. Search terms included internship and residency, satisfaction, quality of life, continuity of care, ambulatory care, and medical education. We included studies that directly addressed resident satisfaction in the ambulatory setting through interventions that we considered reproducible. Three hundred fifty-seven studies were reviewed; 346 studies were removed based on exclusion criteria with 11 papers included in the final review. Seven studies emphasized aspects of organizational structure such as block schedules, working in teams, and impact on resident-patient continuity (continuity between resident provider and patient as viewed from the provider's perspective). Four studies emphasized the importance of a dedicated faculty for satisfaction. The heterogeneity of the studies precluded aggregate analysis. Clinic structures that limit inpatient and outpatient conflict and enhance continuity, along with a dedicated outpatient faculty, are associated with greater resident satisfaction. Implications for further research are discussed.

Estudo de produção enzimatica da dextrana clinica

OpenAIRE

Juan Heraldo Viloche Bazan

1993-01-01

Resumo: Este trabalho consiste na obtenção "in vitro" de dextrana clínica a partir da sacarose utilizando a enzima dextrana-sacarase obtida pela fermentação do Leuconostoc mesenteroides linhagem NRRL B512-F. A dextrana clínica, de peso molecular médio 40.000 daltons, tem sua aplicação consagrada como expansor volumétrico de sangue humano. A enzima foi produzida por fermentação e purificada usando ultrafiltração, separada com o uso de polietilenoglicol de peso molecular 1500 daltons e estocada...

Final Treatability Study in Support of Remediation by Natural Attenuation Site FT-1 at Fairchild Air Force Base, Spokane, Washington

Science.gov (United States)

1997-10-01

aquifer: Ground Water Monitoring Review, Winter, 1987, p. 64-71. Bartha , R., 1986, Biotechnology of petroleum pollutant biodegradation: Microbial Ecology ...trichloroethylene by the ammonia-oxidizing bacterium Nitrosomonas europaea: Biochem. Biophys. Res. Commun., vol. 159, p. 640-643. Atlas , R.M., 1981, Microbial ...role of electron donor for microbial metabolism and are completely degraded or detoxified (Bouwer, 1992). Electron acceptors are elements or

Antifungal activity of olive cake extracts

OpenAIRE

Ghandi H. Anfoka; Khalil I. Al-Mughrabi; Talal A. Aburaj; Wesam Shahrour

2001-01-01

Powdered, dried olive (Olea europaea) cake was extracted with hexane, methanol and butanol. Six phenolic compounds, coumaric acid, ferulic acid, oleuropein, caffeic acid, protocatechuic acid and cinnamic acid, were isolated from these extracts after fractionation. The fractions were tested for their antifungal activity against Verticillium sp., Fusarium oxysporum, Rhizopus sp., Penicillium italicum, Rhizoctonia solani, Stemphylium solani, Cladosporium sp., Mucor sp., Colletotrichu...

PRESENCE OF THE MEDITERRANEAN FRUIT FLY(Ceratitis capitata Wied. IN SELECTED OLIVE ORCHARDS OF CENTRAL DALMATIA

Directory of Open Access Journals (Sweden)

M. Bjeliš

2007-12-01

Full Text Available Mediterranean fruit fly (Ceratitis capitata Wiedemann is a regular pest of large number of cultivated and wild host plants in Dalmatia. However, this pest does not develop either inside fruits of cultivated olive - Olea europaea sativa or wild olive „ mastrinka“ - Olea europaea oleaster. The main objective of this research was to prove regular presence, time of appearance and flight duration of the Mediterranean fruit fly inside selected orchards of central Dalmatia. During the four years of research, from 2001 to 2004 by using of traps and parapheromone trimedlure, the regular presence of the Mediterranean fruit fly was proved inside four selected orchards on the area of cities of Split and Kaštela, with differences in adult caught between localities and years. During the 2001 year, on the three locations in the area of city of Kaštela, the highest capture during the total research period was recorded, while on the locations in Split, the highest capture was recorded during 2003 year, but also significant during 2001 year. The lowest number of adult, less than 5 flies/trap was captured on all four locations during 2002 year.

THE GENESIS OF PHOTOSYNTHESIS TYPES AS THE BASIS OF ECOLOGICAL EXPANSION OF HALOPHYTIC PLANTS

Directory of Open Access Journals (Sweden)

Pyurko O.Ye.

2011-12-01

Full Text Available The C3, C4, and CAM photosynthesis types are considerably differed by CO2 absorption intensity, its biochemistry, saturation level, water productivity, biological productivity, and other different features, which secure the plants survival at stress and extreme conditions. The aim of current research was to discover the photosynthesis peculiarities at halophytic plants species (Salicornia europaea L., Halimione pedunculata, Artemisia santonica L., Plantago lanceolata L. by salinity at model and natural conditions, and to generalize data in historical aspect. It was constituted that S. europaea L. was characterized by C3 photosynthesis passage which was switched on CAM CO2 fixation under soil salinity conditions till 4-4,5 %, but glycophyte A.santonica was immanent C4assimilation way of aspartate type.Analysis of literature data and own research allows to find out that in majority the C3photosynthesis dependence from environmental factors described by determinate curve with matched mathematical expression. It was suggested to generalize the data by Lagrange polynomial. The obtained results proved that the pattern of photosynthesis evolution is: C3 → C4 → CAM with commute possibilities: C3 → CAM; C4 → CAM.

Olea europaea Linn (Oleaceae) Fruit Pulp Exhibits ...

African Journals Online (AJOL)

Methods: Sprague–Dawley rats were fed with a normal diet, a high-cholesterol diet or high- .... HPLC finger print analysis of OFP-EA extract ... protein levels were quantified using western ..... Cook NC, Samman S. Flavonoids-chemistry,.

Interstitial brachytherapy with 192-IR in treatment of recurrent malignant primary brain tumors. Braquiterapia intersticial con iridio-192 en el tratamiento de recidivas de tumores cerebrales tras cirugia y radioterapia

Energy Technology Data Exchange (ETDEWEB)

Cardenes, R.; Martinez, R.; Victoria, C.; Nuez, L.; Clavo, B.; Sancedo, G. (Clinica Puerta de Hierro. Madrid (Spain))

1994-01-01

Seven patients with recurrent malignant primary brain tumors after surgery and radiation therapy were treated at the Clinica Puerta de Hierro (Madrid) by interstitial brachytherapy with 192-Ir sources. Implantations were performed using computerized tomography and dose prescription were determined following the Paris system rules for interstitial implants. The means dose deliberated was 50 to 65 Gy to the reference isodoses. At the last follow-up all patients except for one are alive and without evidence of progression of the disease. (Author) 35 refs.

Iliosacral screw fixations of posterior pelvic ring injuries guided by TAC scan

International Nuclear Information System (INIS)

Olarte Salazar, Carlos Mario; Pasantez Hoyos, Rodrigo; Fonseca, Alejandra

2004-01-01

An observational and descriptive study of a series was conducted between February 2001 and November 2002 at the departments of orthopedics and traumatology of the hospital de San Jose, Clinica Palermo and Fundacion Santa Fe de Bogota. 10 patients (12 fractures) with unstable lesions of the pelvic ring, on whom TAC guided percutaneous fixation of the posterior portion of the pelvic ring was performed. Six of the patients were female (60%) and four were male (40%) and average age 33.4 years (16 to 54 years)

Using a voucher system to extend health services to migrant farmworkers.

OpenAIRE

Slesinger, D P; Ofstead, C

1996-01-01

FAMILY HEALTH/LA CLINICA de los Campesinos, Inc., is a federally funded migrant health clinic in the heart of Wisconsin's farmland that has offered outpatient health care since 1973 and an accompanying "voucher" program since 1988. The charges for outpatient care are based on the ability to pay. The clinic issues vouchers not only to migrant workers living and working in remote parts of the State but also to patients needing services the clinic does not offer. Between 1 April 1992 and 30 Marc...

Interstitial brachytherapy with 192-IR in treatment of recurrent malignant primary brain tumors

International Nuclear Information System (INIS)

Cardenes, R.; Martinez, R.; Victoria, C.; Nunez, L.; Clavo, B.; Sancedo, G.

1994-01-01

Seven patients with recurrent malignant primary brain tumors after surgery and radiation therapy were treated at the Clinica Puerta de Hierro (Madrid) by interstitial brachytherapy with 192-Ir sources. Implantations were performed using computerized tomography and dose prescription were determined following the Paris system rules for interstitial implants. The means dose deliberated was 50 to 65 Gy to the reference isodoses. At the last follow-up all patients except for one are alive and without evidence of progression of the disease. (Author) 35 refs

United States Air Force Research Initiation Program. 1984 Research Reports. Volume 2.

Science.gov (United States)

1986-05-01

differential determination of adrenaline and noradrenaline in plasma." Clinica Chemica Acta. Vol. 30, pp. 373-376, 1970. 37. Stegemann, J., U. Meier, W...34%" . 1. Agh-anian, G. K. and R. Y. Wang. Physiology and Pharma - coloay cf central serotonergic neurons. In: Psych ph cl . j aGe tion A of P M...34, AIAA Journal, Vol. 18, No. 1, January 1980,"[ ’ "<. .’ip p . 1 1 - 1 5 . 39. Rotta, J.C., "Temperaturverteilungen in der Turbulenten Grenzschicht an

Elaboración de una guía de práctica clínica con enfoque homeopático para el manejo de la enfermedad diarreica aguda infantil, con la utilización de la herramienta adapte 2.0 / Development of a practical guide to clinical management homeopathic approaches to acute diarrhea in children with the use of the tool adapte 2.0

OpenAIRE

Chamorro Rojas, Juliana

2011-01-01

La homeopatia es un sistema medico usado en el manejo de pacientes pediatricos cuya demanda ha sido creciente en los ultimos anos, al igual que la aloptia esta sujeta a los requirimientos legales para su practica clinica. En el anexo tecnico 01 de la Resolución N°. 1043 de 3 de abril de 2006 la ley colombiana establece las condiciones de los prestadores de salud para la habilitacion de servicios y fija los requerimientos minimos para la practica medica. Dentro de las condiciones contempla la ...

El Uso de Servicios de Salud Mexicanos por Ciudadanos Estadounidenses en Tijuana

OpenAIRE

Arredondo, Jorge

2008-01-01

El desarrollo del sector servtctos ha modificado el espectro no solo de Ia planeaci6n econ6mica de una ciudad sino tambien de Ia planeaci6n fisica. Tal es el caso de Ia ciudad fronteriza mexicana de Tijuana que presenta un notable incremento en actividades relacionadas con Ia salud por ciudadanos de los Estados Unidos de America, generando un incremento en Ia cantidad de clinicas y hospitales en zonas especificas de dicha ciudad, misma que no cuenta con los requerimientos necesarios de equipa...

La ricerca narrativa in psicologia: in fondamento per la formazione

Directory of Open Access Journals (Sweden)

Santo Di Nuovo

2005-09-01

Full Text Available Proprio le metodologie qualitative di verifica del lavoro clinico, quelle narrative in particolare [...] offrono un potente strumento di mediazione tra il rigore scientifico e la possibilità di condividere principi e criteri nella comunità dei ricercatori, e l’accettazione di una complessità di approccio al lavoro clinico che solo metodologie olistiche e non riduttive possono garantire. Le scuole di formazione alla psicologia clinica possono ampiamente avvalersi di queste metodologie, con sicuro beneficio sulla qualità complessiva della formazione stessa.

[Increasing difficulties for scientific publication in Venezuela].

Science.gov (United States)

Ryder, Elena

2014-03-01

A very important increase in the costs of the edition of scientific journals has taken place in Venezuela, due to difficulties in obtaining imported free acid paper and other materials used for handling documents. Like other journals, Investigaci6n Clinica has been considering switching completely to a digital publication format; however there are several reasons that prevent us to doing it at this time: the journal is distributed in printed form to many national institutions, which do not have immediate access to digital information. In addition, there exists a commitment of shipment of printed issues for some international indices and in exchange with other national and foreign journals, whose printed format we receive. Another important aspect is that our University maintains a weak technological platform that makes difficult the immediacy required for the interchange with authors and consulted referees of received papers; and there is a latent danger of limitations in the use of digital technologies, due to current national politic problems. Consequently, we need to continue with the printed format, but must reduce the amount of printed issues, so as not to limit the number of papers published in each edition. Nevertheless, there is an ever increasing number of contributions from foreign researches and Investigaci6n Clinica has been recently included in two new international indices, the SEIIC from Argentina and the Infobase Index from India, reasons that obligate us to maintain our levels of excellence and commitment to our authors and readers.

Kepler's theory of force and his medical sources.

Science.gov (United States)

Regier, Jonathan

2014-01-01

Johannes Kepler (1571-1630) makes extensive use of souls and spiritus in his natural philosophy. Recent studies have highlighted their importance in his accounts of celestial generation and astrology. In this study, I would like to address two pressing issues. The first is Kepler's context. The biological side of his natural philosophy is not naively Aristotelian. Instead, he is up to date with contemporary discussions in medically flavored natural philosophy. I will examine his relationship to Melanchthon's anatomical-theological Liber de anima (1552) and to Jean Femel's very popular Physiologia (1567), two Galenic sources with a noticeable impact on how he understands the functions of life. The other issue that will direct my article is force at a distance. Medical ideas deeply inform Kepler's theories of light and solar force (virtus motrix). It will become clear that they are not a hindrance even to the hardcore of his celestial physics. Instead, he makes use of soul and spiritus in order to develop a fully mathematized dynamics.

An improved method and data analysis for ultrasound acoustic emissions and xylem vulnerability in conifer wood.

Science.gov (United States)

Wolkerstorfer, Silviya V; Rosner, Sabine; Hietz, Peter

2012-10-01

The vulnerability of the xylem to cavitation is an important trait in plant drought resistance and has been quantified by several methods. We present a modified method for the simultaneous measurement of cavitations, recorded as ultrasound acoustic emissions (UAEs), and the water potential, measured with a thermocouple psychrometer, in small samples of conifer wood. Analyzing the amplitude of the individual signals showed that a first phase, during which the mean amplitude increased, was followed by a second phase with distinctly lower signal amplitudes. We provide a method to separate the two groups of signals and show that for many samples plausible vulnerability curves require rejecting late low-energy UAEs. These very likely do not result from cavitations. This method was used to analyze the differences between juvenile wood, and early and late mature wood in Picea abies (L.) Karst. Juvenile earlywood was more resistant to cavitation than mature earlywood or latewood, which we relate to the tracheid anatomy of the samples. Copyright © Physiologia Plantarum 2012.

Estudo clínico epidemiológico de quistos e tumores odontogénicos numa população hospitalar

OpenAIRE

Santiago, Ana Catarina de Almeida

2014-01-01

Os quistos e tumores maxilares, em particular os odontogénicos, representam um conjunto de patologias que surgem na cavidade oral sob variadas manifestações clinicas e imagiológicas. Podem conduzir a graves sequelas, desde deformações faciais até transformação maligna. O estudo retrospetivo realizado estudou as características clinico epidemiológicas dos Quistos e Tumores Odontogénicos e o impacto dos queratoquistos nos Tumores Odontogénicos, segundo a classificação da OMS de 2005. Selecionar...

Da lesão à disfunção: um caso invulgar de hipertensão renovascular

OpenAIRE

Pimentel, Ana; Cabrita, Ana; Jeronimo, Teresa; Ministro, Augusto; Bernardo, Idalecio; Neves, Pedro Leao

2014-01-01

A hipertensão arterial resistente e uma condição clinica que carece de investigação etiológica, cujo objectivo e identificar causas secundarias passiveis de serem corrigidas. Os autores descrevem uma apresentação rara de hipertensão secundaria. O caso consiste num doente que e seguido em consulta externa desde Janeiro de 2012 por insuficiência renal e hipertensão diagnosticadas ha um ano. Foi realizado um estudo etiológico no qual constou um estudo endocrinológico que demonstrou um hiperaldos...

As terapias de imagens mentais como recurso terapêutico complementar na tireoidite de Hashimoto: um estudo bibliográfico

OpenAIRE

Hilel, Alexandre Santana

2008-01-01

Esta pesquisa enfoca um estudo bibliográfico das Terapias de Imagens Mentais como uma proposta terapêutica para abordagem da Tireoidite de Hashimoto. Teve sua origem através da observação empírica de resultados da atuação clinica do pesquisador, usando-se a imaginação dirigida na diminuição da contagem laboratorial de auto-anticorpos presentes na tireoidite. O presente trabalho é organizado em um capítulo de apresentação da Tireoidite de Hashimoto em seus aspectos prevalência, ...

Clinical and ECG investigations in subjects with acute carbon monoxide poisoning

Energy Technology Data Exchange (ETDEWEB)

Capellini, A; Tomasini, M; Limonta, A

1974-01-01

Research carried out on more than 100 workers hospitalized for acute CO poisoning at the Milan Clinica del Lavoro and some 50 subjects undergoing treatment at the Milan polyclinic. The purpose of the research was to investigate the incidence and frequency of myocardial and coronary impairment in cases of acute CO poisoning. The authors concluded from their clinical and ECG findings that myocardial and coronary impairment in subjects suffering from acute CO poisoning was rarely serious or irreversible unless there was preexistent coronary disease. (CIS Abstr. Vol. 2)

IBUPROFEN AS A MEDICATION FOR A CORRECTION OF SYMPTOMS OF NORMAL VACCINAL PROCESS IN CHILDREN

Directory of Open Access Journals (Sweden)

T.A. Chebotareva

2008-01-01

Full Text Available The pathogenetic approach to treatment of symptoms of normal vaccinal process in children after standard vaccination, based on the results of application of anti9inflammatory medications — ibuprofen (nurofen for children and paracetamol is presented in this article. Clinical activity of ibuprofen was established on the basis of clinica catamnestic observation of 856 vaccinated children aged from 3 months to 3 years. recommendations for application of these medications as a treatment for a correction of vaccinal reactions are given.Key words: children, ibuprofen, paracetamol, vaccination.

[Construction and implementation of two quality indicators in nursing services].

Science.gov (United States)

de Moura, Gisela Maria Schebela Souto; Juchem, Beatriz Cavalcanti; Falk, Maria Lucia Rodrigues; de Magalhães, Ana Maria Muller; Suzuki, Lyliam Midori

2009-03-01

Indicators monitor the quality of services and improve the attention offered to the patients. Hospital de Clinicas de Porto Alegre, Rio Grande do Sul, Brazil, has been developing strategies to assess its services according to its institutional management policy of quality The present study aims to report the experience at this university hospital with the construction and implementation of quality indicators in its nursing services. In 2006, four indicators were established: incidence of pressure ulcer, with a goal of quality of nursing services, for this is a large hospital.

Il romanzo paterno in adolescenza: Laio dimenticato dalla psicoanalisi

Directory of Open Access Journals (Sweden)

Arturo Casoni

2015-12-01

Full Text Available Il Complesso di Edipo ha ricevuto dal movimento psicoanalitico, sempre o quasi, una declinazione che sceglieva come attori principali il figlio maschio e la madre, con l’intervento successivo del padre. Si è così costruita una sorta di mitologia eterosessuale di quel triangolo, lasciando aperto il lato che collega il figlio al padre. Si tenta qui di saldare la parte mancante, a partire dalla narrazione del mito e arrivando alle dinamiche psichiche che caratterizzano le famiglie contemporanee, con particolare attenzione alla clinica dell’adolescenza contemporanea. 

Industrial democracy from a European perspective : the example of SEs

OpenAIRE

Keller, Berndt; Werner, Frank

2010-01-01

The article deals with the forthcoming challenges to the German system of co-determination (Mitbestimmung ) arising from the Europeanization of industrial relations (IR) in general and the European Company (Societas Europaea — SE) in particular. After some short remarks on co-determination’s national history and present challenges, recent political controversies are discussed. Then the most important European regulations on employee involvement are analysed from a German perspective. The main...

Clinical applications of cells labelling; Aplicaciones clinicas del marcado de celulas

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, B M [Instituto Nacional de Pediatria (Mexico)

1994-12-31

Blood cells labelled with radionuclides are reviewed and main applications are described. Red blood cell labelling by both random and specific principle. A table with most important clinical uses, 99mTc labelling of RBC are described pre tinning and in vivo reduction of Tc, in vitro labelling and administration of labelled RBC and in vivo modified technique. Labelled leucocytes with several 99mTc-complex radiopharmaceuticals by in vitro technique and specific monoclonal s for white cells(neutrofiles). Labelled platelets for clinical use and research by in vitro technique and in vivo labelling.

Guías clinicas de RCP y SRI enfermería

OpenAIRE

Donis Mulero, Elena

2015-01-01

La reanimación cardiopulmonar (RCP) es un procedimiento de emergencia para salvar vidas que se lleva a cabo cuando una persona se encuentra en parada cardiorrespiratoria (PCR). Tanto la técnica de RCP como la de intubación, son aspectos olvidados por los profesionales de la salud. Recopilar las últimas recomendaciones sobre RCP para poder elaborar un programa sencillo enfocado a la enfermería. Elaborar una guía sencilla de secuencia rápida de intubación (SRI). Revisión bibliográfica en la que...

[Food status peculiarities, anthropometric, clinica and biochemical indices at professional sportsmen].

Science.gov (United States)

Gapparova, K M; Nikitiuk, D B; Zaĭnudinov, Z M; Tserekh, A A; Chekhonina, Iu G; Golubeva, A A; Sil'vestrova, G A; Rusakova, D S; Grigor'ian, O N

2011-01-01

Under steady state conditions in 66 athletes involved in weightlifting, bodybuilding, judo and taekwondo have studied features of the metabolic status. Data on matter-of-fact nutrition, body weight content within the inter-competition period, energy exchange, clinical and biochemical indices and physical acceptability indices were analyzed. As a result, the decrease indexes of metabolism at all the sportsmen and high-level caloric value at sportsmen who are engaged in weightlifting, which corresponds their energy expenditures, was revealed.

Inhibition of bacterial ammonia oxidation by organohydrazines in soil microcosms

Directory of Open Access Journals (Sweden)

Yucheng eWu

2012-01-01

Full Text Available Hydroxylamine oxidation by hydroxylamine oxidoreductase (HAO is a key step for energy-yielding in support of the growth of ammonia-oxidizing bacteria (AOB. Organohydrazines have been shown to inactivate HAO from Nitrosomonas europaea, and may serve as selective inhibitors to differentiate bacterial from archaeal ammonia oxidation due to the absence of bacterial HAO gene homologue in known ammonia-oxidizing archaea (AOA. In this study, the effects of three organohydrazines on activity, abundance and composition of AOB and AOA were evaluated in soil microcosms. The results indicate that phenylhydrazine and methylhydrazine at the concentration of 100 mol per gram dry weight soil completely suppressed the activity of soil nitrification. DGGE fingerprinting and sequencing analysis of bacterial ammonia monooxygenase subunit A gene (amoA clearly demonstrated that nitrification activity change is well paralleled with the growth of Nitrosomonas europaea-like AOB in soil microcosms. No significant correlation between AOA community structure and nitrification activity was observed among all treatments during the incubation period, although incomplete inhibition of nitrification activity occurred in 2-hydroxyethylhydrazine-amended soil microcosms. These findings show that the HAO-targeted organohydrazines can effectively inhibit bacterial nitrification in soil, and the mechanism of organohydrazine affecting AOA remains unclear.

Growth and demography of the solitary scleractinian coral Leptopsammia pruvoti along a sea surface temperature gradient in the Mediterranean Sea.

Directory of Open Access Journals (Sweden)

Erik Caroselli

Full Text Available The demographic traits of the solitary azooxanthellate scleractinian Leptopsammia pruvoti were determined in six populations on a sea surface temperature (SST gradient along the western Italian coasts. This is the first investigation of the growth and demography characteristics of an azooxanthellate scleractinian along a natural SST gradient. Growth rate was homogeneous across all populations, which spanned 7 degrees of latitude. Population age structures differed between populations, but none of the considered demographic parameters correlated with SST, indicating possible effects of local environmental conditions. Compared to another Mediterranean solitary scleractinian, Balanophyllia europaea, zooxanthellate and whose growth, demography and calcification have been studied in the same sites, L. pruvoti seems more tolerant to temperature increase. The higher tolerance of L. pruvoti, relative to B. europaea, may rely on the absence of symbionts, and thus the lack of an inhibition of host physiological processes by the heat-stressed zooxanthellae. However, the comparison between the two species must be taken cautiously, due to the likely temperature differences between the two sampling depths. Increasing research effort on determining the effects of temperature on the poorly studied azooxanthellate scleractinians may shed light on the possible species assemblage shifts that are likely to occur during the current century as a consequence of global climatic change.

Phenological differences among selected residents and long-distance migrant bird species in central Europe

Science.gov (United States)

Bartošová, Lenka; Trnka, Miroslav; Bauer, Zdeněk; Možný, Martin; Štěpánek, Petr; Žalud, Zdeněk

2014-07-01

The phenological responses to climate of residents and migrants (short- and long-distance) differ. Although few previous studies have focussed on this topic, the agree that changes in phenology are more apparent for residents than for long-distance migrants. We analysed the breeding times of two selected residents ( Sitta europaea, Parus major) and one long-distance migrant ( Ficedula albicollis) from 1961 to 2007 in central Europe. The timing of the phenophases of all three bird species showed a significant advance to earlier times. Nevertheless, the most marked shift was observed for the long-distance migrant (1.9 days per decade on average in mean laying date with linearity at the 99.9 % confidence level). In contrast, the shifts shown by the residents were smaller (1.6 days for S. europaea and 1.5 days for P. major also on average in mean laying date for both, with linearity at the 95 % confidence level). Spearman rank correlation coefficients calculated for pairs of phenophases of given bird species in 20-year subsamples (e.g. 1961-1980, 1962-1981) showed higher phenological separation between the residents and the migrant. This separation is most apparent after the 1980s. Thus, our results indicate that the interconnections between the studied phenological stages of the three bird species are becoming weaker.

Can nitrification bring us to Mars? The role of microbial interactions on nitrogen recovery in life support systems

Science.gov (United States)

Christiaens, Marlies E. R.; Lasseur, Christophe; Clauwaert, Peter; Boon, Nico; Ilgrande, Chiara; Vlaeminck, Siegfried

2016-07-01

Human habitation in space requires artificial environment recirculating fundamental elements to enable the highest degree of autonomy . The European Space Agency, supported by a large consortoium of European organisationsdevelop the Micro-Ecological Life Support System (MELiSSA) to transform the mission wastes waste (a.o. organic fibers, CO2, and urine) into water, oxygen, and food (Lasseur et al., 2010). Among these wastes, astronauts' urine has a high potential to provide nitrogen as a fertilizer for food production. As higher plant growth in space is typically proposed to be performed in hydroponics, liquid fertilizer containing nitrates is preferred. An Additional Unit for Water Treatment is developed for urine nitrification by means of a synthetic microbial community. The key players in this consortium are ureolytic bacteria to hydrolyse the main nitrogen source in urine, urea, to ammonium and carbon dioxide as well as oxidation of organic compounds present in urine, ammonium oxidizing bacteria (AOB) to convert ammonium to nitrite (nitritation), and the nitrate oxidizing bacteria (NOB) to produce nitrate (nitratation). Pure AOB strains Nitrosomonas ureae Nm10 and Nitrosomonas europaea ATCC 19718, pure NOB strains Nitrobacter winogradskyi Nb-255 and Nitrobacter vulgaris Z, and interactions within synthetic consortia of one AOB and one NOB or all together were tested. As the initial salinity of fresh urine can be as high as 30 mS/cm, the functionality of selected pure strains and synthetic consortia was evaluated by means of the nitritation and nitratation activity at varying NaCl salinities (5, 10, and 30 mS/cm). The nitritation activity of pure AOB strains was compared with the synthetic consortia. Both N. ureae and Ns. europaea benefit from the presence of Nb. winogradskyi as the ammonium oxidation rates of 1.7 ± 0.7 and 6.4 ± 0.6 mg N/L.d at 5 mS/cm, respectively, doubled. These results are in line with the findings of Perez et al (2015) observing a lower

Integration of a clinical trial database with a PACS

International Nuclear Information System (INIS)

Van Herk, M

2014-01-01

Many clinical trials use Electronic Case Report Forms (ECRF), e.g., from OpenClinica. Trial data is augmented if DICOM scans, dose cubes, etc. from the Picture Archiving and Communication System (PACS) are included for data mining. Unfortunately, there is as yet no structured way to collect DICOM objects in trial databases. In this paper, we obtain a tight integration of ECRF and PACS using open source software. Methods: DICOM identifiers for selected images/series/studies are stored in associated ECRF events (e.g., baseline) as follows: 1) JavaScript added to OpenClinica communicates using HTML with a gateway server inside the hospitals firewall; 2) On this gateway, an open source DICOM server runs scripts to query and select the data, returning anonymized identifiers; 3) The scripts then collects, anonymizes, zips and transmits selected data to a central trial server; 4) Here data is stored in a DICOM archive which allows authorized ECRF users to view and download the anonymous images associated with each event. Results: All integration scripts are open source. The PACS administrator configures the anonymization script and decides to use the gateway in passive (receiving) mode or in an active mode going out to the PACS to gather data. Our ECRF centric approach supports automatic data mining by iterating over the cases in the ECRF database, providing the identifiers to load images and the clinical data to correlate with image analysis results. Conclusions: Using open source software and web technology, a tight integration has been achieved between PACS and ECRF.

Using Pure Cultures to Define the Site Preference of Nitrous Oxide Produced by Microbial Nitrification and Denitrification

Science.gov (United States)

Sutka, R. L.; Breznak, J. A.; Ostrom, N. E.; Ostrom, P. H.; Gandhi, H.

2004-12-01

Defining the site preference of nitrous oxide (N2O) produced in pure culture studies is crucial to interpreting field data. We have previously demonstrated that the intramolecular distribution of nitrogen isotopes (isotopomers) can be used to differentiate N2O produced by nitrifier denitrification and nitrification in cultures of Nitrosomonas europaea. Here, we have expanded on our initial results and evaluated the isotopomeric composition of N2O produced during nitrification and nitrifier denitrification with cultures of Nitrosospira multiformis. In addition, we have analyzed N2O produced during methanotrophic nitrification, denitrification, and fungal denitrification. To evaluate N2O production during nitrification and nitrifier denitrification, we compared the site preference of N2O formed as a result of nitrite reduction and hydroxylamine oxidation with Nitrosomonas europaea and Nitrosospira multiformis. The average site preference of N2O produced by hydroxylamine oxidation was similar for Nitrosomonas europaea (33.0 ± 3.5 ‰ ) and Nitrosospira multiformis (33.1 ± 4.2 ‰ ). Nitrous oxide produced by nitrifier-denitrification by Nitrosomonas europaea and Nitrosospira multiformis had a similar site preference of - 1.4 ± 4.4 ‰ and - 1.1 ± 2.6 ‰ respectively. The results indicate that it is possible to differentiate between N2O produced by nitrite reduction and hydroxylamine oxidation by ammonia oxidizing bacteria. Methanotrophic nitrification was evaluated by analyzing the N2O produced during hydroxylamine oxidation in concentrated cell suspensions of two methane oxidizing bacteria. The site preference of N2O produced by the two methane oxidizers, Methylococcus capsulatus Bath and Methylosinus trichosporium was 31.8 ± 4.7 ‰ and 33.0 ± 4.5 ‰ respectively. The results indicate that a site preference of 33 ‰ is applicable for nitrification regardless of whether a methane oxidizer or ammonia oxidizer is involved in the reaction. To determine the site

Crianças e adolescentes que convivem com diabetes e doença celíaca

OpenAIRE

Brancaglioni, Bianca de Cássia Alvarez; Rodrigues, Grasiele Caroline; Damião, Elaine Buchhorn Cintra; Queiroz, Márcia Silva; Nery, Márcia

2016-01-01

RESUMO Objetivo Compreender a experiência de crianças e adolescentes que convivem com diabetes mellitus tipo 1 e doença celíaca. Método Estudo qualitativo, exploratório e descritivo. A coleta de dados ocorreu entre janeiro e setembro de 2012, com 3 crianças e 2 adolescentes, em um ambulatório de diabetes do Hospital das Clinicas da FMUSP ou na residência dos participantes na cidade de São Paulo, por meio de entrevistas semiestruturadas. Utilizou-se a Análise de Conteúdo como método de tra...

Evaluación de la calidad de los registros de enfermería en la historia clínica por medio de la auditoría

OpenAIRE

Setz, Vanessa Grespan; D'Innocenzo, Maria

2009-01-01

OBJETIVO: Desse modo o objetivo deste estudo foi avaliar por meio da auditoria, a qualidade dos registros de enfermagem nos prontuários de pacientes atendidos em unidades de um hospital universitário do município de São Paulo. MÉTODOS: O estudo é descritivo, retrospectivo e o método foi pesquisa documental. Dos 424 prontuários analisados entre novembro de 2006 a janeiro de 2007, em diferentes unidades clinicas e cirúrgicas de um hospital universitário, 43,9% se referiam a óbitos e 56,1% a alt...

A sindrome da tensão pre-menstrual : uma abordagem psicanalitica

OpenAIRE

Vera Aparecida de Carvalho Zoldan

2001-01-01

Resumo: O interesse por esta pesquisa orienta-se sobre as questões surgidas na clinica psicanalítica a partir do atendimento de pacientes vítimas da Síndrome da Tensão Pré-Menstrual (STPM) e suas manifestações sintomáticas, não somente físicas, mas predominantemente psíquicas. Embora seja considerada pela Medicina como uma doença resultante das próprias alterações orgânicas e hormonais associadas ao ciclo reprodutor feminino, a análise psicanalítica revela a existência de relações particularm...

Escala clínica para prever a adesão ao tratamento: transtorno bipolar do humor

OpenAIRE

Marchi, Renato

2008-01-01

O Transtorno Bipolar do Humor (TBH) está associado a altas taxas de desajustes psicossociais e familiares, mortalidade e prejuízos econômicos. O tratamento visa o controle de episódios agudos e prevenção de novos episódios. As taxas de não - adesão ao tratamento são altas em TBH. Este trabalho teve por objetivo elaborar e validar uma escala de avaliação clinica , capaz de indicar a probabilidade de adesão ao tratamento medico clinico dos pacientes bipolares de ambos os gêneros. O procedimento...

Revisión sistemática sobre el efecto analgésico de la crioterapia en el manejo del dolor de origen músculo esquelético Systematic review of the analgesic effect of cryotherapy in the management of musculoskeletal pain

OpenAIRE

H.J. Gutiérrez Espinoza; I.P. Lavado Bustamante; S.J. Méndez Pérez

2010-01-01

Introducción: La Crioterapia es una modalidad de Termoterapia Superficial que se basa en la aplicación del frío como agente terapéutico, si bien es cierto, es ampliamente utilizada para el alivio del dolor, su indicación clinica tradicionalmente se ha sustentado en mecanismos de acción indirectos, sin una base científica o estudios clínicos que avalen su efectividad, se realizará una síntesis de la evidencia relativa a la efectividad de la crioterapia a través de una revisión sistemática de e...

Seasonal and species-specific response of VOC emissions by Mediterranean woody plant to elevated ozone concentrations

Energy Technology Data Exchange (ETDEWEB)

Llusia, J.; Penuelas, J. [Universitat Autonoma de Barcelona (Spain). Unitat Ecofisiologia CSIC-CEAB-CREAF; Gimeno, R.S. [CIEMAT, Madrid (Spain). Ecotoxicologia de la Contaminacion Atmosferica

2002-08-01

Although certain factors controlling plant emission rates of volatile organic compounds (VOCs) are reasonably well understood, the influence of elevated ozone concentrations as abiotic stress is mostly unknown. Therefore, we studied the effects of ozone concentrations on seasonal biogenic volatile organic compound (BVOC) emissions by different Mediterranean plant species in open top chambers (OTC). Three ozone treatments were established: filtered air (F), non-filtered air (NF), and fumigated air (NF+) adding 40 nl l{sup -1} of ozone over NF. We studied the response of VOC emission in saplings of four Mediterranean woody plant species and subspecies: Ceratonia siliqua L., Olea europaea L., Quercus ilex spp. ilex L., and Quercus ilex spp. rotundifolia L. as representative of natural Mediterranean vegetation. No visible symptoms were detected on the leaves. No significant effect was found on net photosynthetic rates or stomatal conductance except for an increase in net photosynthetic rates in Quercus ilex ilex in spring and summer and an overall slight increase in Quercus ilex rotundifolia. Emissions of the total VOCs from Ceratonia siliqua in summer, and from Olea europaea and Quercus ilex rotundifolia in spring increased in ozone fumigated OTC in comparison with F or NF OTC. Decreased emissions were found in Quercus ilex rotundifolia in summer. There were no significant differences between ozone fumigation treatments for the other plant species and seasons. When considering particular VOCs, the results were also variable among species and time of the year. While {alpha}-pinene emissions decreased with ozone fumigation in Olea europaea, {alpha}-pinene and limonene emissions increased in Quercus ilex ilex. The responses of these particular VOCs did not always match the responses of total VOCs. In spite of this strong variability, when considering overall annual data for all species and seasons, there were increased net photosynthetic rates (37%) and limonene (95

Seasonal and species-specific response of VOC emissions by Mediterranean woody plant to elevated ozone concentrations

Science.gov (United States)

Llusià, J.; Peñuelas, J.; Gimeno, B. S.

Although certain factors controlling plant emission rates of volatile organic compounds (VOCs) are reasonably well understood, the influence of elevated ozone concentrations as abiotic stress is mostly unknown. Therefore, we studied the effects of ozone concentrations on seasonal biogenic volatile organic compound (BVOC) emissions by different Mediterranean plant species in open top chambers (OTC). Three ozone treatments were established: filtered air (F), non-filtered air (NF), and fumigated air (NF+) adding 40 nl l -1 of ozone over NF. We studied the response of VOC emission in saplings of four Mediterranean woody plant species and subspecies: Ceratonia siliqua L., Olea europaea L., Quercus ilex spp. ilex L., and Quercus ilex spp. rotundifolia L. as representative of natural Mediterranean vegetation. No visible symptoms were detected on the leaves. No significant effect was found on net photosynthetic rates or stomatal conductance except for an increase in net photosynthetic rates in Quercus ilex ilex in spring and summer and an overall slight increase in Quercus ilex rotundifolia. Emissions of the total VOCs from Ceratonia siliqua in summer, and from Olea europaea and Quercus ilex rotundifolia in spring increased in ozone fumigated OTC in comparison with F or NF OTC. Decreased emissions were found in Quercus ilex rotundifolia in summer. There were no significant differences between ozone fumigation treatments for the other plant species and seasons. When considering particular VOCs, the results were also variable among species and time of the year. While α-pinene emissions decreased with ozone fumigation in Olea europaea, α-pinene and limonene emissions increased in Quercus ilex ilex. The responses of these particular VOCs did not always match the responses of total VOCs. In spite of this strong variability, when considering overall annual data for all species and seasons, there were increased net photosynthetic rates (37%) and limonene (95%) and total VOC (45

Podnikání ve formě evropské společnosti

OpenAIRE

Keprdová, Šárka

2014-01-01

This bachelor thesis is focused on business in the form of European Company (Societas Europaea). Primarily the basic principles of European Company are described. This type of business entity is interesting because it is an international company based on European Union law. The thesis deals with a European Company analysis and compares it with a Czech joint-stock company, and eventually points out advantages and disadvantages of both of them. It also describes conditions and requirements rega...

Morphological and molecular identification of Phytophthora species isolated from the rhizosphere of declining oak trees in Krotoszyn Plateau

Directory of Open Access Journals (Sweden)

Tkaczyk Miłosz

2017-01-01

Full Text Available The following paper presents the results on the determination of the diversity of species from the Phytophthora genus occurring in the declining oak stands in Krotoszyn Plateau in Poland. From the 50s of the last century, significant deterioration of oak health was observed in these stands, and Phytophthora species were suggested as one of the factors of the decline. In order to determine the presence of pathogenic organisms from the Phytophthora genus in these stands, 180 rhizosphere soil samples from three forest districts throughout the Krotoszyn Plateau were collected and subjected to the isolation method. Phytophthora species were consistently isolated from all the sampled stands, and 194 isolates from 111 positive samples were obtained. However, 150 (77% and 44 (23% isolates originated from the samples taken under the symptomatic and asymptomatic trees, respectively. All the obtained isolates were morphologically classified using the light and scanning electron microscopy and divided into morphological groups. Genomic DNA was isolated from selected isolates representing each group, ITS regions were amplified and sequence analyses were performed. In total, four different Phytophthora species were detected, including P. cactorum, P. plurivora, P. quercina and P. europaea. The most often isolated species were P. cactorum and P. plurivora. This is the first report of P. europaea in oak stands in Poland.

The importance of pollen counts in the air: an example

Directory of Open Access Journals (Sweden)

Francisco José González Minero

2016-06-01

Full Text Available The Bay of Cádiz in general and Sanlúcar de Barrameda in particular were pioneering places for aerobiological analysis in Spain. This study presents unpublished pollen data collected with a Hirst spore trap during a year. Results are structured in pollen calendar form which is easy to interpret by health professionals. This article also intends to pay tribute to those medical pioneers who began their studies in Sanlúcar de Barrameda. On this subject, we discuss the data obtained in 1941 and we relate them with data collected in 2009. The Mediterranean climate and the geographical location of Sanlúcar de Barrameda bring about an archetypical pollen calendar of the towns of the Iberian Peninsula’s southern coast. A total of 21 pollen types are quanti ed, Olea europaea L. (25.1%, Quercus (17.5%, Pinaceae (12.3%, Poaceae (10.2% and Cupressaceae (8.1% being the more abundant types . The months of highest pollen concentration are April and May. The maximum daily concentration was reached on May 13 with 825 grains/m3 of Olea europaea L. pollen. Daily concentrations of grass pollen and other herbaceous plants are not exceptionally high, but they do have a continued presence throughout the year, so the risk of pollen allergies cannot be con ned to spring.

Morphometry of eyes, antennae and wings in three species of Siagona (Coleoptera, Carabidae

Directory of Open Access Journals (Sweden)

Federica Talarico

2011-05-01

Full Text Available In carabid beetles, physiological and behavioural characteristics reflect specific habitat demands and there is a strong correlation between body form and habit in species with different life style. In this study, we compared the morphometry and compound eye characteristics of three species of the genus Siagona: S. jenissoni, S. dejeani and S. europaea. These carabids have a stenotopic lifestyle in Mediterranean clayey soils, inhabiting the ground fissure system formed during the dry season. All species have a Mediterranean distribution and are nocturnal olfactory hunters, and are strict ant predators. For morphometric measurements, we considered body length (mm, wing length (mm, antenna length (mm, head width (mm, trochanter length (mm, number of ommatidia, eye surface area (mm2, ommatidia density (number of ommatidia/mm2 of eye surface area, head height (mm, thorax height (mm and abdomen height (mm. The data revealed intersexual and interspecific differences. The three species differ in relative length of the antennae, density and number of ommatidia and relative trochanter length. Significant differences occurred in wing sizes, which are well developed in S. europaea, the only species capable of flight. When eye size is compared with other ground beetles of various lifestyles, Siagona shows pronounced “microphthalmy” an adaptation to subterranean life in clayey crevices of tropical and subtropical climates with a marked dry season.

Legionnaires' disease in the renal transplant unit of "Hospital das Clinicas, FMUSP": during a five year period (1988-1993 Doença dos legionários na Unidade de Transplante Renal (UTR do Hospital das Clínicas FMUSP, no período de 1988 a 1993

Directory of Open Access Journals (Sweden)

Neusa Augusta de Oliveira Mazieri

1994-06-01

Full Text Available Several reports have related Legionella pneumophila with pneumonia in renal transplant patients, however this association has not been systematically documented in Brazil. Therefore this paper reports the incidence, by serologycal assays, of Legionella pneumophila serogroup 1 in these patients during a five year period. For this purpose sera from blood samples of 70 hospitalized patients with pneumonia from the Renal Transplant Unit of Hospital das Clinicas, FMUSP collected at the acute and convalescent phase of infection were submitted to indirect immunofluorescence assay (IFA to demonstrate anti-Legionella pneumophila serogroup 1 antibodies. Of these 70 patients studied during the period of 1988 to 1993,18 (25.71 % had significant rises in specific antibody titers for Legionella pneumophila serogroup 1. Incidence was interrupted following Hospital water decontamination procedures, with recurrence of infections after treatment interruption. In this study, the high susceptibility (25.71% of immunodepressed renal transplant patients to Legionella pneumophila serogroup 1 nosocomial infections is documented. The importance of the implementation and maintenance of water decontamination measures for prophylaxis of the infection is also clearly evident.Embora vários trabalhos tem mostrado a presença de Legionella pneumophila associado a pneumopatias infecciosas em transplantados renais, tal associação não fora antes realizado de maneira sistemática no Brasil. Os autores julgaram oportuno a determinação da incidência por comprovação sorológica da Legionella pneumophila sorogrupo 1 em transplantados renais num período de 5 anos. Para tanto amostras de soros de 70 pacientes com pneumopatia infecciosa internados na UTR do HC-FMUSP, colhidos na fase aguda e convalescente da infecção, foram submetidas à reação de imunofluo-rescência indireta para pesquisa de anticorpos anti-Legionella pneumophila sorogrupo 1. Dos 70 pacientes

A transnational and holistic breeding approach is needed for sustainable wheat production in the Baltic Sea region.

Science.gov (United States)

Chawade, Aakash; Armoniené, Rita; Berg, Gunilla; Brazauskas, Gintaras; Frostgård, Gunilla; Geleta, Mulatu; Gorash, Andrii; Henriksson, Tina; Himanen, Kristiina; Ingver, Anne; Johansson, Eva; Jørgensen, Lise Nistrup; Koppel, Mati; Koppel, Reine; Makela, Pirjo; Ortiz, Rodomiro; Podyma, Wieslaw; Roitsch, Thomas; Ronis, Antanas; Svensson, Jan T; Vallenback, Pernilla; Weih, Martin

2018-03-14

The Baltic Sea is one of the largest brackish water bodies in the world. Eutrophication is a major concern in the Baltic Sea due to the leakage of nutrients to the sea with agriculture being the primary source. Wheat (Triticum aestivum L.) is the most widely grown crop in the countries surrounding the Baltic Sea and thus promoting sustainable agriculture practices for wheat cultivation will have a major impact on reducing pollution in the Baltic Sea. This approach requires identifying and addressing key challenges for sustainable wheat production in the region. Implementing new technologies for climate-friendly breeding and digital farming across all surrounding countries should promote sustainable intensification of agriculture in the region. In this review, we highlight major challenges for wheat cultivation in the Baltic Sea region and discuss various solutions integrating transnational collaboration for pre-breeding and technology sharing to accelerate development of low input wheat cultivars with improved host plant resistance to pathogen and enhanced adaptability to the changing climate. © 2018 The Authors. Physiologia Plantarum published by John Wiley & Sons Ltd on behalf of Scandinavian Plant Physiology Society.

CONSENTIMIENTO INFORMADO EN LA PRÁCTICA CLINICA: RETOS DEL PERSONAL DE SALUD

Directory of Open Access Journals (Sweden)

Francisco Javier Bonilla Escobar

2013-08-01

Full Text Available El consentimiento informado es una herramienta cotidiana en la práctica clínica; para comprenderlo se requiere de un proceso formativo y académico que genere las actitudes para proponer consentimientos informados éticamente aceptables y que estos abarquen la perspectiva del paciente. El consentimiento requiere de un uso adecuado y de su entendimiento por parte del paciente como del profesional de salud que lo administra, siendo de utilidad ética y legal, motivo por el cual no debe ser subestimado. Es importante que dicho conocimiento implique en forma clara el reconocimiento tanto del médico como del paciente de la(s intervención(es, de las posibles consecuencias y situaciones a las que pudiera estar expuesto. Este artículo es una revisión al respecto del consentimiento informado, partiendo de su historia, evolución e implicaciones para el personal de la salud en general, con el objetivo de orientar e informar sobre su uso y evolución en la práctica clínica. El área bioética y los temas concernientes al consentimiento informado son necesidades de difusión e investigación en Latinoamérica para la protección del paciente y la buena práctica del personal de salud.

CONSENTIMIENTO INFORMADO EN LA PRÁCTICA CLINICA: RETOS DEL PERSONAL DE SALUD

Directory of Open Access Journals (Sweden)

Francisco Javier Bonilla Escobar

2012-01-01

Full Text Available El consentimiento informado es una herramienta cotidiana en la práctica clínica; para comprenderlo se requiere de un proceso formativo y acadé- mico que genere las actitudes para proponer consentimientos informados éticamente aceptables y que estos abarquen la perspectiva del paciente. El consentimiento requiere de un uso adecuado y de su entendimiento por parte del paciente como del profesional de salud que lo administra, siendo de utilidad ética y legal, motivo por el cual no debe ser subestimado. Es importante que dicho conocimiento implique en forma clara el reconoci- miento tanto del médico como del paciente de la(s intervención(es, de las posibles consecuencias y situaciones a las que pudiera estar expuesto. Este artículo es una revisión al respecto del consentimiento informado, partiendo de su historia, evolución e implicaciones para el personal de la salud en general, con el objetivo de orientar e informar sobre su uso y evolución en la práctica clínica. El área bioética y los temas concernientes al consentimiento informado son necesidades de difusión e investigación en Latinoamérica para la protección del paciente y la buena práctica del personal de salud.

A clinica como pratica arborifica e rizomorfica do trabalho em enfermagem cirurgica

Directory of Open Access Journals (Sweden)

Lenice Dutra de Sousa

2013-12-01

Full Text Available Foi realizada uma pesquisa qualitativa e exploratória, na forma de um estudo de caso, em uma unidade de internação cirúrgica de um hospital universitário, que objetivou analisar o trabalho do enfermeiro sob a ótica da produção de cuidados em saúde e do exercício da clínica. Os sujeitos do estudo foram seis enfermeiros e foram realizadas observações não participantes, pesquisa documental e entrevistas em profundidade com posterior análise textual discursiva. Verificou-se que o trabalho da enfermagem é organizado segundo duas perspectivas interconectadas e interdependentes: a do modelo clínico, que compõe a estrutura-mestre de sua prática, e uma estrutura composta por elementos múltiplos e heterogêneos. O modelo clínico de assistência organiza-se como uma estrutura centrada que possibilita a resolutividade das necessidades biológicas e atua como base para a conexão de outros saberes e práticas que expandem o fazer do enfermeiro por meio de interligações com o ambiente.

Comparação de azeites obtidos da cultivar portuguesa Galega Vulgar utilizando dois métodos de extracção Comparison of olive oil from Portuguese cultivar Galega Vulgar with two different methods of oil extraction

Directory of Open Access Journals (Sweden)

L. Torres Vaz-Freire

2007-01-01

Full Text Available A produção do azeite é uma das actividades agrícolas mais características da região mediterrânea e de importância relevante para a sua economia. O objectivo do trabalho foi o estudo da influência dos métodos da extracção na qualidade do azeite obtido. Incidiu principalmente sobre uma das cultivares recomendadas para os azeites de denominação origem protegida (DOP no Alentejo. Foi extraída azeite da variedade portuguesa, Galega Vulgar (Olea europaea L. subsp. europaea, colhida na região de Elvas nas campanhas de 2001 a 2004. Utilizou-se uma prensa hidráulica (extracção descontínua, Vieirinox, Portugal; e um “decanter” centrífugo de duas fases (extracção contínua, Oliomio, Itália. Nas azeitonas determinou-se o índice de maturação, fez-se o controle de pragas e avaliou-se o Índice de gordura (RMN. No azeite para além das análises químicas de controlo foi realizada a análise Sensorial com painel treinado e uma detecção electrónica de aromas (Alpha Mos Fox 3000. Os resultados preliminares mostram haver diferenças significativas para alguns dos parâmetros analisados no caso dos azeites. De todos os parâmetros em que se detectaram diferenças significativas apenas a acidez demonstrou alterações suficientes para classificar o azeite em outra categoria considerando a classificação estabelecida pelo Regulamento (CE N.º 1989/2003 de 6 de Novembro. Estudos como este são importantes na adaptação da tecnologia à variedade com o intuito de aumentar a eficiência de determinado processo tecnológico.Olive oil production is one of the important agricultural activities on the Mediterranean region and has a real impact on local economies. The objective of this work was the study of extraction methods impact on olive oil final quality. The variety studied is one of the varieties allowed for olive oil with Protected Origin Denomination (DOP production in Alentejo. The Portuguese variety extracted was Galega Vulgar

Guía de Patología Autópsica

OpenAIRE

Arce Mateos, Félix Pablo; Fernández Fernández, Fidel Ángel; Fernández Vega, Iván; Galtés, Ignasi; Guerra Merino, Isabel; Lucena, Joaquín; Mayorga Fernández, Marta María; Regojo, Rita María; Suárez, María Paz; Terán Villagrá, Nuria

2015-01-01

El trabajo que aquí se publica se trata de la Guía Clinica de Consenso redactada por el Club de Autopsias de la Sociedad Española de Anatomía Patológica para el Libro Blanco de la Anatomía Patológica presentado en el XXVIII Congreso Nacional de la SEAP-IAP, XXII Congreso Nacional Sociedad Española de Citología y III Congreso Nacional Sociedad Española de Patología Forense, en mayo de 2015 en la ciudad de Santander. En palabras de su presidente, el Dr. M.A. Piris, “el papel de estas guías doce...

High dose rate endobronchial brachytherapy - treatment technique

International Nuclear Information System (INIS)

Carvalho, Heloisa de Andrade; Aisen, Salim; Haddad, Cecilia Maria Kalil; Nadalin, Wladimir; Pedreira Junior, Wilson Leite; Chavantes, Maria Cristina

1998-01-01

High dose rate endobronchial brachytherapy is efficient in symptom relief due to obstructive endobronchial malignancies. However, it's role in survival improvement for patients with lung cancer is not yet established. The use of this treatment in increasing, specially in the developing countries. The purpose of this paper is to present the treatment technique used in the Radiotherapy Department of the Hospital da Clinicas, University of Sao Paulo, based on an experience of 60 cases treated with 180 procedures. Some practical suggestions and rules adopted in the Department are described. The severe complications rate is 6.7%, demonstrating an adequate patient selection associated with the technique utilized. (author)

Studio di prevalenza delle polmoniti in un'Azienda opsedaliera di Bologna

Directory of Open Access Journals (Sweden)

E. Leoni

2003-05-01

Full Text Available

Obiettivi: nell’ambito di un progetto di sorveglianza attiva dei casi di polmonite da legionella, è stata studiata la prevalenza di tutti i casi di polmonite ricoverati in un ospedale di Bologna, allo scopo di definirne la distribuzione per origine (comunitaria o nosocomiale, eziologia, caratteristiche individuali e di confrontarle con le polmoniti da legionella.

Metodi: per ogni caso con diagnosi clinica e/o radiologica di polmonite è stato compilato un questionario, raccogliendo le informazioni dalle cartelle cliniche. Tutti i casi di polmonite non specificata sono stati inoltre sottoposti al test per la ricerca dell’antigene di legionella nelle urine.

Echocardiography in the adult's congenital cardiopaties

International Nuclear Information System (INIS)

Escobar Q, Carlos I; Jaramillo U, Mario; Tenorio, Luis F; Molina V, Claudia; Saldarriaga A, Marcela; Arango, Angela M

2003-01-01

The number of adults with congenital heart disease is steadily increasing in the course of time. We ignore the prevalence and the most frequent diagnoses in our environment. A descriptive prospective study is presented. Between November 1 1999 and July 31 2001, 8871 Tran-thoracic and Tran-esophageal echocardiographies were performed in the Clinica Cardiovascular Santa Maria's echocardiography service. We found 143 congenital cardiopathies (1.6%) in 74 men and 69 women with a mean age of 37.7 +/- 18.4 years. the most frequent diagnoses were bicuspid aortic valve, atrial septal defect, ventricular septal defect, patent ductus arteriosus and Ebstein's anomaly. these findings agree with world wide data

Estudo das vias biliares extrahepáticas em pacientes portadores de "megas" chagásieos

Directory of Open Access Journals (Sweden)

Donald Huggins

1972-06-01

Full Text Available Em 22 pacientes internados no Hospital das Clinicas da F. M. U. F. Pe e portadores de "megas" chagásicos. cuja etiologia foi comprovada através de pesquisas epidemiológicas, clínicas e laboratoriais, realizamos a colecisto-colangiografia intravenosa. Verificamos em 21 enfermos a vesícula e o colédoco com topografia, morfologia e dmãmica normais. Em apenas um doente encontramos a vesícula bastante aumentada de volume e o coledoco de calibre dilatado, sem imagem de cálculo no seu interior. O tempo de esvaziamento colédoco-duodeno muito prolongado, sugeriu alterações motoras.

A importância da 1ª refeição do dia

OpenAIRE

Antunes, Cláudia de Jesus Pontes

2013-01-01

Trabalho final de mestrado integrado em Medicina área científica de Nutrição Clinica, apresentado á Faculdade de Medicina da Universidade de Coimbra Introdução: o pequeno-almoço tem sido sinónimo de uma alimentação saudável, sendo comummente aceite como a refeição mais importante, pois dele depende o equilíbrio alimentar do dia, constituindo um fator relevante a nível da performance cognitiva, da redução do risco de doenças crónicas, entre as quais se destacam a obesidade, diabetes e doenç...

Isolation of Pseudomonas aeruginosa strains from dental office environments and units in Barretos, state of São Paulo, Brazil, and analysis of their susceptibility to antimicrobial drugs Isolamento de cepas de Pseudomonas aeruginosa provenientes do meio ambiente e de equipos dentarios em clinicas dentarias em Barretos, São Paulo, Brasil; analises da susceptibilidade das cepas a drogas antimicrobianas

Directory of Open Access Journals (Sweden)

Ana Claudia de Oliveira

2008-09-01

Full Text Available A wide variety of opportunistic pathogens has been detected in the tubing supplying water to odontological equipment, in special in the biofilm lining of these tubes. Among these pathogens, Pseudomonas aeruginosa, one of the leading causes of nosocomial infections, is frequently found in water lines supplying dental units. In the present work, 160 samples of water, and 200 fomite samples from forty dental units were collected in the city of Barretos, State of São Paulo, Brazil and evaluated between January and July, 2005. Seventy-six P. aeruginosa strains, isolated from the dental environment (5 strains and water system (71 strains, were tested for susceptibility to six antimicrobial drugs most frequently used against P. aeruginosa infections. Susceptibility to ciprofloxacin, followed by meropenem was the predominant profile. The need for effective means of reducing the microbial burden within dental unit water lines is emphasized, and the risk of exposure and cross-infection in dental practice, in special when caused by opportunistic pathogens like P. aeruginosa, are highlighted.Uma ampla variedade de patógenos oportunistas tem sido detectadas nos tubos de alimentação de água dos equipos odontológicos, particularmente no biofilme formado na superfície do tubo. Entre os patógenos oportunistas encontrados nos tubos de água, Pseudomonas aeruginosa é reconhecida como uma das principais causadoras de infecções nosocomiais. Foram coletadas 160 amostras de água e 200 amostras de fomites em quarenta clinicas odontológicas na cidade de Barretos, São Paulo, Brasil, durante o período de Janeiro a Julho de 2005. Setenta e seis cepas de P. aeruginosa, isoladas a partir dos fomites (5 cepas e das amostras de água (71 cepas, foram analisadas quanto à susceptibilidade à seis drogas antimicrobianas freqüentemente utilizadas para o tratamento de infecções provocadas por P. aeruginosa. As principais suscetibilidades observadas foram para a

Hydrolysis of Oleuropein by Lactobacillus plantarum Strains Associated with Olive Fermentation

OpenAIRE

Ciafardini, G.; Marsilio, V.; Lanza, B.; Pozzi, N.

1994-01-01

Oleuropein (Chemical Abstracts Service registry number 32619-42-4), a bitter-tasting secoiridoid glucoside commonly found in leaves of the olive tree as well as in olives (Olea europaea L.), was found to be hydrolyzed by the β-glucosidase (EC 3.2.1.2.1) produced by oleuropeinolytic Lactobacillus plantarum-type strains. Three strains, designated B17, B20, and B21, were isolated from the brine of naturally ripe olives not treated with alkali. These strains were rod-shaped forms, grown at a pH 3...

Neofusicoccum luteum associated with leaf necrosis and fruit rot of olives in New South Wales, Australia

Directory of Open Access Journals (Sweden)

V. Sergeeva

2009-09-01

Full Text Available Neofusicoccum luteum is reported for the first time from olives (Olea europaea, causing fruit rot and leaf necrosis. Affected fruits initially became brown with pycnidia developing on the surface, later drying out and becoming mummified. The fungus was shown to be pathogenic on both fruits and leaves. The association of Botryosphaeriaceae with rotting olive fruits in Mediterranean regions and in New South Wales, Australia indicates that these fungi play a significant role in fruit rots of olives and deserve greater attention.

Firewood and timber in the Argaric site of Barranco de la Viuda (Lorca, Murcia

Directory of Open Access Journals (Sweden)

María Soledad GARCÍA MARTÍNEZ

2011-10-01

Full Text Available This paper presents the analysis of wood charcoals associated to combustion structures and building materials from the Argaric site of Barranco de la Viuda. The results suggest that wood fuel was collected in nearby pine forest, noting especially Pinus halepensis, together with Rosmarinus officinalis, Olea europaea, Pistacia lentiscus and Monocotyledoneae. Opportunistic exploitation prevailed on all types of firing activities. Pinus halepensis was also the most commonly wood used as timber. Remarkable is the limited use of the riparian vegetation on firing and building activities.

Salicornia, Sarcocornia ve Arthrocnemum cinslerinin (Chenopodiaceae) Türkiye taksonomik revizyonu

OpenAIRE

YAPRAK, Ahmet Emre

2008-01-01

Bu çalışmada Türkiye’de bulunan Salicornia L., Sarcocornia A. J. Scott ve Arthrocnemum Moq. cinslerine ait türlerin morfolojik, karyolojik, biyocoğrafik özelliklerinin ve filogenetik ilişkilerinin tanımlanması amaçlanmıştır. Araştırmalar sonucunda Türkiye Florasında verilen Salicornia fragilis P. W. Ball & Tutin, Salicornia europaea L. ve Sarcocornia fruticosa &l...