WorldWideScience

Sample records for europaea physiologiae clinicae

  1. Fauna Europaea

    DEFF Research Database (Denmark)

    Pape, Thomas; Beuk, Paul; Pont, Adrian Charles

    2015-01-01

    density, and the more fertile habitats are extensively cultivated. This has undoubtedly increased the extinction risk for numerous species of brachyceran flies, yet with the recent re-discovery of Thyreophoracynophila (Panzer), there are no known cases of extinction at a European level. However, few......Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all extant multicellular European terrestrial and freshwater animals and their geographical distribution at the level of countries and major islands (east of the Urals and excluding...

  2. La filosofia clinica di Wittgenstein

    Directory of Open Access Journals (Sweden)

    Lorenzo Ghirelli

    2017-01-01

    Full Text Available Intento del presente saggio è quello di tracciare le linee principali della filosofia di Wittgenstein definendone l’orizzonte operativo e la strategia d’azione. Seguiremo inizialmente i cambiamenti nella concezione del linguaggio e del significato del filosofo austriaco utilizzandoli come traccia per registrare le corrispondenti revisioni degli obiettivi, delle tecniche e delle forme del far filosofia da lui proposte. Cercheremo poi di analizzare la pratica filosofica prospettata dal Wittgenstein maturo evidenziandone alcuni aspetti che ci consentiranno di qualificarla come clinica.

  3. Fauna Europaea - Orthopteroid orders

    NARCIS (Netherlands)

    Heller, K.-G.; Bohn, H.; Haas, F.; Willemse, F.; de Jong, Y.

    2016-01-01

    Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all extant European terrestrial and freshwater animals, their geographical distribution at the level of countries and major islands (west of the Urals and excluding the Caucasus region),

  4. Fauna Europaea: Helminths (Animal Parasitic)

    Czech Academy of Sciences Publication Activity Database

    Gibson, D. I.; Bray, R. A.; Hunt, D.; Georgiev, B. B.; Scholz, Tomáš; Harris, P.D.; Bakke, T.A.; Pomajska, T.; Niewiadomska, K.; Kostadinova, Aneta; Tkach, V.; Bain, O.; Durette-Desset, M.-C.; Gibbons, L.; Moravec, František; Petter, A.; Dimitrova, Z.M.; Buchmann, K.; Valtonen, E. T.; de Jong, Y.

    -, č. 2 (2014), e1060 ISSN 1314-2828 Institutional support: RVO:60077344 Keywords : Acanthocephala * Biodiversity * Biodiversity Informatics * Cestoda * Fauna Europaea * Helminth * Monogenea * Nematoda * Parasite * Taxonomic indexing * Taxonomy * Trematoda * Zoology Subject RIV: EB - Genetics ; Molecular Biology

  5. Fauna Europaea: Helminths (Animal Parasitic)

    NARCIS (Netherlands)

    Gibson, D.I.; Bray, R.A.; Hunt, D.; Georgiev, B.B.; Scholz, T.; Harris, P.D.; Bakke, T.A.; Pojmanska, T.; Niewiadomska, K.; Kostadinova, A.; Tkach, V.; Bain, O.; Durette-Desset, M.C.; Gibbons, L.; Moravec, F.; Petter, A.; Dimitrova, Z.M.; Buchmann, K.; Valtonen, E.T.; de Jong, Y.

    2014-01-01

    Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all living European land and freshwater animals, their geographical distribution at country level (up to the Urals, excluding the Caucasus region), and some additional information. The

  6. Fauna Europaea: Hymenoptera: Symphyta & Ichneumonoidea

    NARCIS (Netherlands)

    Achterberg, van K.; Taeger, A.; Blank, S.M.; Zwakhals, K.; Viitasaari, M.; Sick Ki Yu, D.; Jong, de Y.

    2017-01-01

    Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all extant European terrestrial and freshwater animals, their geographical distribution at the level of countries and major islands (west of the Urals and excluding the Caucasus region),

  7. Fauna Europaea: Helminths (Animal Parasitic

    Directory of Open Access Journals (Sweden)

    David Gibson

    2014-09-01

    Full Text Available Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms of all living European land and freshwater animals, their geographical distribution at country level (up to the Urals, excluding the Caucasus region, and some additional information. The Fauna Europaea project covers about 230,000 taxonomic names, including 130,000 accepted species and 14,000 accepted subspecies, which is much more than the originally projected number of 100,000 species. This represents a huge effort by more than 400 contributing specialists throughout Europe and is a unique (standard reference suitable for many users in science, government, industry, nature conservation and education. Helminths parasitic in animals represent a large assemblage of worms, representing three phyla, with more than 200 families and almost 4,000 species of parasites from all major vertebrate and many invertebrate groups. A general introduction is given for each of the major groups of parasitic worms, i.e. the Acanthocephala, Monogenea, Trematoda (Aspidogastrea and Digenea, Cestoda and Nematoda. Basic information for each group includes its size, host-range, distribution, morphological features, life-cycle, classification, identification and recent key-works. Tabulations include a complete list of families dealt with, the number of species in each and the name of the specialist responsible for data acquisition, a list of additional specialists who helped with particular groups, and a list of higher taxa dealt with down to the family level. A compilation of useful references is appended.

  8. Fauna Europaea - all European animal species on the web

    DEFF Research Database (Denmark)

    de Jong, Yde; Verbeek, Melina; Michelsen, Verner

    2014-01-01

    Abstract Fauna Europaea is Europe's main zoological taxonomic index, making the scientific names and distributions of all living, currently known, multicellular, European land and freshwater animals species integrally available in one authoritative database. Fauna Europaea covers about 260...

  9. Book review. Semeiologia Clinica Veterinaria. (a cura di Paolo Ciaramella

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-09-01

    Full Text Available Il grado di specializzazione raggiunto nel settore clinico veterinario non è dissimile da quello presente in campo umano, soprattutto se si pensa agli animali d'affezione che sono oramai considerati parte integrante di una società moderna e civile in cui anche il fattore benessere animale ha acquisito importanza non secondaria, in particolare nell'allevamento degli animali da reddito. In questo contesto è sempre più richiesta la figura di uno specialista competente e aggiornato, in grado di risolvere in modo adeguato le problematiche che gli vengono proposte, in un mercato in concorrenza che non contempla imperizia, inesperienza e ignoranza professionale. Lo studio della semeiologia clinica è uno dei primi passi di questo lungo e affascinate cammino che permette di apprendere un metodo di analisi sistematico, affidabile, efficiente e accurato per educare il futuro medico veterinario verso le procedure della buona pratica clinica. La semeiotica insegna ad allenare i propri sensi: a guardare attraverso l'osservazione diretta e indiretta, a sentire ascoltando suoni o rumori, a percepire sensazioni tattili e, non da ultimo, a saper discernere con cognizione e competenza quando ricorrere alle indagini strumentali e di laboratorio; sempre e comunque nella consapevolezza che non possono in nessun modo sostituire l'esame fisico diretto del paziente. Paolo Ciaramella, professore ordinario di Clinica Medica Veterinaria all'Università Federico II di Napoli, presenta così il volume che ha curato: "L'idea di questo libro ha preso forma durante un simposio di medicina interna tenutosi a Torino nel 2008. Con alcuni colleghi presenti si pensò alla possibilità di elaborare un nuovo testo di Semeiotica Medica che potesse ampliare e aggiornare il glorioso Messieri e Moretti, non tanto perché esso avesse perduto il suo valore intrinseco, quanto piuttosto perché nel corso degli anni sono cambiate la patologia animale e con essa la semeiotica e la clinica

  10. Proteome Regulation during Olea europaea Fruit Development

    DEFF Research Database (Denmark)

    Bianco, Linda; Alagna, Fiammetta; Baldoni, Luciana

    2013-01-01

    Background: Widespread in the Mediterranean basin, Olea europaea trees are gaining worldwide popularity for the nutritional and cancer-protective properties of the oil, mechanically extracted from ripe fruits. Fruit development is a physiological process with remarkable impact on the modulation...

  11. Olea europaea Linn (Oleaceae) Fruit Pulp Exhibits ...

    African Journals Online (AJOL)

    such as total cholesterol (TC), triglycerides (TG), high-density lipoprotein (HDL) and low-density ... Keywords: Olea europaea, cholesterol, Hypercholesterolemia, Lipid metabolism, Peroxisome .... ethanol (EtOH) at 1:10 ratio (w/v) for 2 h in a.

  12. Fauna Europaea: Hymenoptera – Symphyta & Ichneumonoidea

    NARCIS (Netherlands)

    van Achterberg, K.; Taeger, A.; Blank, S.M.; Zwakhals, K.; Viitasaari, M.; Yu, D.S.K.; de Jong, Y.

    2017-01-01

    Fauna Europaea provides a public web-service with an index of scientific names (including important synonyms) of all extant European terrestrial and freshwater animals, their geographical distribution at the level of countries and major islands (west of the Urals and excluding the Caucasus region),

  13. [Analysis of utilization of information in the journal Medicina Clinica].

    Science.gov (United States)

    Aleixandre, R; Giménez Sánchez, J V; Terrada, M L; López Piñero, J M

    1994-09-10

    Scientific communication knowledge is specifically based in the analysis of the bibliographic references inside the publications. Pattern and laws determining the information consumption in the items of the journal Medicina Clinica are investigated in the present study as its own aim. An analysis was performed on the 13,286 references downloaded from 618 papers published by the journal in 1990. With dBASE IV was generated a database for the management of the information; data was distributed in several tables through criteria of age, documentary types, countries, journals and Bradford zones. The analysed references belong to 1,241 different journals, 110 from Spain. Being two thirds of the total sum, the publications from United States and United Kingdom have received more citations than those from Spain. The publications from european countries, like France, Germany and Italy, are scarcely present. Bradford core is constituted by the journals Medicina Clinica and The Lancet. The analysis of the bibliographic references available from the articles in this journal is able to produce knowledge on the information consumption by the practitioners; its usefulness as a complementary utility to the Indice de Citas e Indicadores Bibliométricos de Revistas Españolas de Medicina Interna y sus especialidades 1990 must be considered.

  14. Transformations of Aromatic Compounds by Nitrosomonas europaea

    OpenAIRE

    Keener, William K.; Arp, Daniel J.

    1994-01-01

    Benzene and a variety of substituted benzenes inhibited ammonia oxidation by intact cells of Nitrosomonas europaea. In most cases, the inhibition was accompanied by transformation of the aromatic compound to a more oxidized product or products. All products detected were aromatic, and substituents were often oxidized but were not separated from the benzene ring. Most transformations were enhanced by (NH4)2SO4 (12.5 mM) and were prevented by C2H2, a mechanism-based inactivator of ammonia monoo...

  15. Somatic Embryogenesis in Olive (Olea europaea L. subsp. europaea var. sativa and var. sylvestris).

    Science.gov (United States)

    Rugini, Eddo; Silvestri, Cristian

    2016-01-01

    Protocols for olive somatic embryogenesis from zygotic embryos and mature tissues have been described for both Olea europaea sub. europaea var. sativa and var. sylvestris. Immature zygotic embryos (no more than 75 days old), used after fruit collection or stored at 12-14 °C for 2-3 months, are the best responsive explants and very slightly genotype dependent, and one single protocol can be effective for a wide range of genotypes. On the contrary, protocols for mature zygotic embryos and for mature tissue of cultivars are often genotype specific, so that they may require many adjustments according to genotypes. The use of thidiazuron and cefotaxime seems to be an important trigger for induction phase particularly for tissues derived from cultivars. Up to now, however, the application of this technique for large-scale propagation is hampered also by the low rate of embryo germination; it proves nonetheless very useful for genetic improvement.

  16. Olea europaea Linn (Oleaceae) Fruit Pulp Extract Exhibits Potent ...

    African Journals Online (AJOL)

    HP

    Alzheimer's disease (AD) and Huntington's disease [1, 2]. Activation ... Olea europaea Linn. (family, Oleaceae), commonly ... Although the health beneficial effects of olive fruit and leaf oils have ..... are up-regulated in the brains of patients with.

  17. Pier Diego Siccardi (1880-1917) and the "Clinica del Lavoro" in the trench warfare.

    Science.gov (United States)

    Riva, Michele Augusto; Caramella, Michela; Turato, Massimo; Cesana, Giancarlo

    2017-12-14

    The year 2017 marks the centenary of the death of the Italian scientist Pier Diego Siccardi (1880-1917), one of Luigi Devoto's assistants at the "Clinica del Lavoro" in Milan. To commemorate Siccardi and to describe the activities of the physicians of the "Clinica del Lavoro" during World War I. A comprehensive analysis was conducted on scientific papers written by Pier Diego Siccardi and by other physicians belonging to the Clinica del Lavoro, in the period 1915-1918. During the Great War, the Clinica del Lavoro became a military hospital, even though it indirectly maintained a role in Occupational Health, assisting women who had started to work to replace the men sent to the front. Devoto and his assistants were drafted as Army doctors, but continued their research activities while at the front; focusing on the diseases that affected the soldiers, mainly infections. Bleeding fevers and jaundice were endemic among Italian troops, but their etiology was unknown. Pier Diego Siccardi identified this syndrome as an infection caused by a spirochete, and was the first one to isolate the infectious agent. Siccardi prematurely died of the same disease as a consequence of a laboratory accident, which provided further confirmation for his research. The heroic life of Siccardi and his tragic death testify the important activities of the scientists of the "Clinica del Lavoro" in the years of the Great War.

  18. Oncology patients hospitalized in the Clinicas Hospital Dr. Manuel Quintela

    International Nuclear Information System (INIS)

    Arostegui, M.; Borba, M.; Caldarelli, D.; Eguiia, A.; Fernandez, E.; Peleteiro, M.; Pereira, C.; Vico, M.

    2004-01-01

    This work was carried out by a nursery licensed group in the Clinicas Hospital - Dr. Manuel Quintela.The nature and functioning of Services and the allocation of resources, are essential for the analysis of the Survey of the hospitalized oncology patients in the Institution. To develop a model of care that constitutes a health care as well as teaching and research in the country regarding the quality of care was defined the following topics: lower risks for the patient, safer care, personal trained and specialized to promote relationship between the offering and the person receiving the service. The assessment and management performance of the services involved in the operation are the result of the degree of user satisfaction. Objective: To determine the human and material necessary for the care of cancer resources users, considering their number, treatment, complications and nursing care derived from each pathology and stage of disease. Methodology: A comparative descriptive study of the same population was conducted in two transverse sections in relation to two different times which are based on the design of a form that allowed hospitalized to collect information on users 6/12/03 and 6/16/04. Other instruments used were the clinical history and the daily census staff Patients and Nursing Division. Results and conclusions: A comparative descriptive analysis already mentioned are: increased internships and cancer patients; between 50 and 64 is the highest number of patients; diagnoses Face and Neck and maintain the Digestive System more cases; the number of patients doubles and Hematology Neurological from one to another period. Chemotherapy is the treatment choice and there is a decrease in the surgical and medical; more patients in the study; in the origin, Montevideo has the largest number of patients followed by Canelones. Line of nursing intervention will be carried out in short, medium and long term

  19. Cuscuta europaea plastid apparatus in various developmental stages

    Science.gov (United States)

    Švubová, Renáta; Ovečka, Miroslav; Pavlovič, Andrej; Slováková, Ľudmila; Blehová, Alžbeta

    2013-01-01

    It was generally accepted that Cuscuta europaea is mostly adapted to a parasitic lifestyle with no detectable levels of chlorophylls. We found out relatively high level of chlorophylls (Chls a+b) in young developmental stages of dodder. Significant lowering of Chls (a+b) content and increase of carotenoid concentration was typical only for ontogenetically more developed stages. Lower content of photosynthesis-related proteins involved in Chls biosynthesis and in photosystem formation as well as low photochemical activity of PSII indicate that photosynthesis is not the main activity of C. europaea plastids. Previously, it has been shown in other species that the Thylakoid Formation Protein 1 (THF1) is involved in thylakoid membrane differentiation, plant-fungal and plant-bacterial interactions and in sugar signaling with its preferential localization to plastids. Our immunofluorescence localization studies and analyses of haustorial plasma membrane fractions revealed that in addition to plastids, the THF1 protein localizes also to the plasma membrane and plasmodesmata in developing C. europaea haustorium, most abundantly in the digitate cells of the endophyte primordium. These results are supported by western blot analysis, documenting the highest levels of the THF1 protein in “get together” tissues of dodder and tobacco. Based on the fact that photosynthesis is not a typical process in the C. europaea haustorium and on the extra-plastidial localization pattern of the THF1, our data support rather other functions of this protein in the complex relationship between C. europaea and its host. PMID:23438585

  20. Traditional Uses, Phytochemistry, and Pharmacology of Olea europaea (Olive

    Directory of Open Access Journals (Sweden)

    Muhammad Ali Hashmi

    2015-01-01

    Full Text Available Aim of the Review. To grasp the fragmented information available on the botany, traditional uses, phytochemistry, pharmacology, and toxicology of Olea europaea to explore its therapeutic potential and future research opportunities. Material and Methods. All the available information on O. europaea was collected via electronic search (using Pubmed, Scirus, Google Scholar, and Web of Science and a library search. Results. Ethnomedical uses of O. europaea are recorded throughout the world where it has been used to treat various ailments. Phytochemical research had led to the isolation of flavonoids, secoiridoids, iridoids, flavanones, biophenols, triterpenes, benzoic acid derivatives, isochromans, and other classes of secondary metabolites from O. europaea. The plant materials and isolated components have shown a wide spectrum of in vitro and in vivo pharmacological activities like antidiabetic, anticonvulsant, antioxidant, anti-inflammatory, immunomodulatory, analgesic, antimicrobial, antiviral, antihypertensive, anticancer, antihyperglycemic, antinociceptive, gastroprotective, and wound healing activities. Conclusions. O. europaea emerged as a good source of traditional medicine for the treatment of various ailments. The outcomes of phytochemical and pharmacological studies reported in this review will further expand its existing therapeutic potential and provide a convincing support to its future clinical use in modern medicine.

  1. Traditional Uses, Phytochemistry, and Pharmacology of Olea europaea (Olive)

    Science.gov (United States)

    Hashmi, Muhammad Ali; Khan, Afsar; Hanif, Muhammad; Farooq, Umar; Perveen, Shagufta

    2015-01-01

    Aim of the Review. To grasp the fragmented information available on the botany, traditional uses, phytochemistry, pharmacology, and toxicology of Olea europaea to explore its therapeutic potential and future research opportunities. Material and Methods. All the available information on O. europaea was collected via electronic search (using Pubmed, Scirus, Google Scholar, and Web of Science) and a library search. Results. Ethnomedical uses of O. europaea are recorded throughout the world where it has been used to treat various ailments. Phytochemical research had led to the isolation of flavonoids, secoiridoids, iridoids, flavanones, biophenols, triterpenes, benzoic acid derivatives, isochromans, and other classes of secondary metabolites from O. europaea. The plant materials and isolated components have shown a wide spectrum of in vitro and in vivo pharmacological activities like antidiabetic, anticonvulsant, antioxidant, anti-inflammatory, immunomodulatory, analgesic, antimicrobial, antiviral, antihypertensive, anticancer, antihyperglycemic, antinociceptive, gastroprotective, and wound healing activities. Conclusions. O. europaea emerged as a good source of traditional medicine for the treatment of various ailments. The outcomes of phytochemical and pharmacological studies reported in this review will further expand its existing therapeutic potential and provide a convincing support to its future clinical use in modern medicine. PMID:25802541

  2. OC ToGo: bed site image integration into OpenClinica with mobile devices

    Science.gov (United States)

    Haak, Daniel; Gehlen, Johan; Jonas, Stephan; Deserno, Thomas M.

    2014-03-01

    Imaging and image-based measurements nowadays play an essential role in controlled clinical trials, but electronic data capture (EDC) systems insufficiently support integration of captured images by mobile devices (e.g. smartphones and tablets). The web application OpenClinica has established as one of the world's leading EDC systems and is used to collect, manage and store data of clinical trials in electronic case report forms (eCRFs). In this paper, we present a mobile application for instantaneous integration of images into OpenClinica directly during examination on patient's bed site. The communication between the Android application and OpenClinica is based on the simple object access protocol (SOAP) and representational state transfer (REST) web services for metadata, and secure file transfer protocol (SFTP) for image transfer, respectively. OpenClinica's web services are used to query context information (e.g. existing studies, events and subjects) and to import data into the eCRF, as well as export of eCRF metadata and structural information. A stable image transfer is ensured and progress information (e.g. remaining time) visualized to the user. The workflow is demonstrated for a European multi-center registry, where patients with calciphylaxis disease are included. Our approach improves the EDC workflow, saves time, and reduces costs. Furthermore, data privacy is enhanced, since storage of private health data on the imaging devices becomes obsolete.

  3. Proteome regulation during Olea europaea fruit development.

    Directory of Open Access Journals (Sweden)

    Linda Bianco

    Full Text Available Widespread in the Mediterranean basin, Olea europaea trees are gaining worldwide popularity for the nutritional and cancer-protective properties of the oil, mechanically extracted from ripe fruits. Fruit development is a physiological process with remarkable impact on the modulation of the biosynthesis of compounds affecting the quality of the drupes as well as the final composition of the olive oil. Proteomics offers the possibility to dig deeper into the major changes during fruit development, including the important phase of ripening, and to classify temporal patterns of protein accumulation occurring during these complex physiological processes.In this work, we started monitoring the proteome variations associated with olive fruit development by using comparative proteomics coupled to mass spectrometry. Proteins extracted from drupes at three different developmental stages were separated on 2-DE and subjected to image analysis. 247 protein spots were revealed as differentially accumulated. Proteins were identified from a total of 121 spots and discussed in relation to olive drupe metabolic changes occurring during fruit development. In order to evaluate if changes observed at the protein level were consistent with changes of mRNAs, proteomic data produced in the present work were compared with transcriptomic data elaborated during previous studies.This study identifies a number of proteins responsible for quality traits of cv. Coratina, with particular regard to proteins associated to the metabolism of fatty acids, phenolic and aroma compounds. Proteins involved in fruit photosynthesis have been also identified and their pivotal contribution in oleogenesis has been discussed. To date, this study represents the first characterization of the olive fruit proteome during development, providing new insights into fruit metabolism and oil accumulation process.

  4. Proteome regulation during Olea europaea fruit development.

    Science.gov (United States)

    Bianco, Linda; Alagna, Fiammetta; Baldoni, Luciana; Finnie, Christine; Svensson, Birte; Perrotta, Gaetano

    2013-01-01

    Widespread in the Mediterranean basin, Olea europaea trees are gaining worldwide popularity for the nutritional and cancer-protective properties of the oil, mechanically extracted from ripe fruits. Fruit development is a physiological process with remarkable impact on the modulation of the biosynthesis of compounds affecting the quality of the drupes as well as the final composition of the olive oil. Proteomics offers the possibility to dig deeper into the major changes during fruit development, including the important phase of ripening, and to classify temporal patterns of protein accumulation occurring during these complex physiological processes. In this work, we started monitoring the proteome variations associated with olive fruit development by using comparative proteomics coupled to mass spectrometry. Proteins extracted from drupes at three different developmental stages were separated on 2-DE and subjected to image analysis. 247 protein spots were revealed as differentially accumulated. Proteins were identified from a total of 121 spots and discussed in relation to olive drupe metabolic changes occurring during fruit development. In order to evaluate if changes observed at the protein level were consistent with changes of mRNAs, proteomic data produced in the present work were compared with transcriptomic data elaborated during previous studies. This study identifies a number of proteins responsible for quality traits of cv. Coratina, with particular regard to proteins associated to the metabolism of fatty acids, phenolic and aroma compounds. Proteins involved in fruit photosynthesis have been also identified and their pivotal contribution in oleogenesis has been discussed. To date, this study represents the first characterization of the olive fruit proteome during development, providing new insights into fruit metabolism and oil accumulation process.

  5. Prevalence of Toxoplasma gondii in common moles (Talpa europaea)

    NARCIS (Netherlands)

    Krijger, I.M.; Cornelissen, J.B.W.J.; Wisselink, H.J.; Meerburg, B.G.

    2014-01-01

    Background The prevalence of Toxoplasma gondii in common moles, Talpa europaea, was investigated in order to determine whether moles can serve as an indicator species for T. gondii infections in livestock. Findings In total, 86 moles were caught from 25 different sites in the Netherlands. Five

  6. Nitrite as a stimulus for ammonia-starved Nitrosomonas europaea

    NARCIS (Netherlands)

    Laanbroek, H.J.; Bär-Gilissen, M.J.; Hoogveld, H.L.

    2002-01-01

    Ammonia-starved cells of Nitrosomonas europaea are able to preserve a high level of ammonia-oxidizing activity in the absence of ammonium. However, when the nitrite-oxidizing cells that form part of the natural nitrifying community do not keep pace with the ammonia-oxidizing cells, nitrite

  7. Genome sequence of the olive tree, Olea europaea.

    Science.gov (United States)

    Cruz, Fernando; Julca, Irene; Gómez-Garrido, Jèssica; Loska, Damian; Marcet-Houben, Marina; Cano, Emilio; Galán, Beatriz; Frias, Leonor; Ribeca, Paolo; Derdak, Sophia; Gut, Marta; Sánchez-Fernández, Manuel; García, Jose Luis; Gut, Ivo G; Vargas, Pablo; Alioto, Tyler S; Gabaldón, Toni

    2016-06-27

    The Mediterranean olive tree (Olea europaea subsp. europaea) was one of the first trees to be domesticated and is currently of major agricultural importance in the Mediterranean region as the source of olive oil. The molecular bases underlying the phenotypic differences among domesticated cultivars, or between domesticated olive trees and their wild relatives, remain poorly understood. Both wild and cultivated olive trees have 46 chromosomes (2n). A total of 543 Gb of raw DNA sequence from whole genome shotgun sequencing, and a fosmid library containing 155,000 clones from a 1,000+ year-old olive tree (cv. Farga) were generated by Illumina sequencing using different combinations of mate-pair and pair-end libraries. Assembly gave a final genome with a scaffold N50 of 443 kb, and a total length of 1.31 Gb, which represents 95 % of the estimated genome length (1.38 Gb). In addition, the associated fungus Aureobasidium pullulans was partially sequenced. Genome annotation, assisted by RNA sequencing from leaf, root, and fruit tissues at various stages, resulted in 56,349 unique protein coding genes, suggesting recent genomic expansion. Genome completeness, as estimated using the CEGMA pipeline, reached 98.79 %. The assembled draft genome of O. europaea will provide a valuable resource for the study of the evolution and domestication processes of this important tree, and allow determination of the genetic bases of key phenotypic traits. Moreover, it will enhance breeding programs and the formation of new varieties.

  8. Nonsterol Triterpenoids as Major Constituents of Olea europaea

    Science.gov (United States)

    Stiti, Naïm; Hartmann, Marie-Andrée

    2012-01-01

    Plant triterpenoids represent a large and structurally diverse class of natural products. A growing interest has been focused on triterpenoids over the past decade due to their beneficial effects on human health. We show here that these bioactive compounds are major constituents of several aerial parts (floral bud, leaf bud, stem, and leaf) of olive tree, a crop exploited so far almost exclusively for its fruit and oil. O. europaea callus cultures were analyzed as well. Twenty sterols and twenty-nine nonsteroidal tetra- and pentacyclic triterpenoids belonging to seven types of carbon skeletons (oleanane, ursane, lupane, taraxerane, taraxastane, euphane, and lanostane) were identified and quantified by GC and GC-MS as free and esterified compounds. The oleanane-type compounds, oleanolic acid and maslinic acid, were largely predominant in all the organs tested, whereas they are practically absent in olive oil. In floral buds, they represented as much as 2.7% of dry matter. In callus cultures, lanostane-type compounds were the most abundant triterpenoids. In all the tissues analyzed, free and esterified triterpene alcohols exhibited different distribution patterns of their carbon skeletons. Taken together, these data provide new insights into largely unknown triterpene secondary metabolism of Olea europaea. PMID:22523691

  9. Evaluation of skin entry kerma in radiological examinations at the Hospital de Clinicas, Parana, Brazil

    International Nuclear Information System (INIS)

    Porto, Lorena E.; Schelin, Hugo R.; Santos, Amanda C. dos; Bunick, Ana Paula; Paschuk, Sergei; Denyak, Valeriy; Tilly Junior, Joao G.; Khoury, Helen J.

    2011-01-01

    This paper evaluates the skin entry dose of pediatric and adults patients when submitted to radiological examinations at the Hospital de Clinicas do Parana, Brazil, as part integrate of the data assessment of International Atomic Energy Agency (IAEA) for Latin America. It was performed measurements of dose for evaluation of skin entry kerma in pediatric patients in thorax AP/PA examinations, adults of thorax in AP/PA, cranio caudal mammography and median lateral and patients of computerized tomography in examination of head, thorax and abdomen. The obtained data demonstrate the necessity of verification of diagnostic analysis standards. The great value amplitudes demonstrate the incompatibility of examination executions with those recommended by the literature. The dose values presented partially inside the range recommended and the other over the expected for the due examination when compared with the literature

  10. Pollen-mediated gene flow and fine-scale spatial genetic structure in Olea europaea subsp. europaea var. sylvestris.

    Science.gov (United States)

    Beghè, D; Piotti, A; Satovic, Z; de la Rosa, R; Belaj, A

    2017-03-01

    Wild olive ( Olea europaea subsp. europaea var. sylvestris ) is important from an economic and ecological point of view. The effects of anthropogenic activities may lead to the genetic erosion of its genetic patrimony, which has high value for breeding programmes. In particular, the consequences of the introgression from cultivated stands are strongly dependent on the extent of gene flow and therefore this work aims at quantitatively describing contemporary gene flow patterns in wild olive natural populations. The studied wild population is located in an undisturbed forest, in southern Spain, considered one of the few extant hotspots of true oleaster diversity. A total of 225 potential father trees and seeds issued from five mother trees were genotyped by eight microsatellite markers. Levels of contemporary pollen flow, in terms of both pollen immigration rates and within-population dynamics, were measured through paternity analyses. Moreover, the extent of fine-scale spatial genetic structure (SGS) was studied to assess the relative importance of seed and pollen dispersal in shaping the spatial distribution of genetic variation. The results showed that the population under study is characterized by a high genetic diversity, a relatively high pollen immigration rate (0·57), an average within-population pollen dispersal of about 107 m and weak but significant SGS up to 40 m. The population is a mosaic of several intermingled genetic clusters that is likely to be generated by spatially restricted seed dispersal. Moreover, wild oleasters were found to be self-incompatible and preferential mating between some genotypes was revealed. Knowledge of the within-population genetic structure and gene flow dynamics will lead to identifying possible strategies aimed at limiting the effect of anthropogenic activities and improving breeding programmes for the conservation of olive tree forest genetic resources. © The Author 2016. Published by Oxford University Press on behalf

  11. Cuscuta europaea plastid apparatus in various developmental stages: localization of THF1 protein.

    Science.gov (United States)

    Švubová, Renáta; Ovečka, Miroslav; Pavlovič, Andrej; Slováková, L'udmila; Blehová, Alžbeta

    2013-05-01

    It was generally accepted that Cuscuta europaea is mostly adapted to a parasitic lifestyle with no detectable levels of chlorophylls. We found out relatively high level of chlorophylls (Chls a+b) in young developmental stages of dodder. Significant lowering of Chls (a+b) content and increase of carotenoid concentration was typical only for ontogenetically more developed stages. Lower content of photosynthesis-related proteins involved in Chls biosynthesis and in photosystem formation as well as low photochemical activity of PSII indicate that photosynthesis is not the main activity of C. europaea plastids. Previously, it has been shown in other species that the Thylakoid Formation Protein 1 (THF1) is involved in thylakoid membrane differentiation, plant-fungal and plant-bacterial interactions and in sugar signaling with its preferential localization to plastids. Our immunofluorescence localization studies and analyses of haustorial plasma membrane fractions revealed that in addition to plastids, the THF1 protein localizes also to the plasma membrane and plasmodesmata in developing C. europaea haustorium, most abundantly in the digitate cells of the endophyte primordium. These results are supported by western blot analysis, documenting the highest levels of the THF1 protein in "get together" tissues of dodder and tobacco. Based on the fact that photosynthesis is not a typical process in the C. europaea haustorium and on the extra-plastidial localization pattern of the THF1, our data support rather other functions of this protein in the complex relationship between C. europaea and its host.

  12. THE EUROPEAN COMPANY (SOCIETAS EUROPAEA ON RIND SIGHT

    Directory of Open Access Journals (Sweden)

    Liviana Andreea Niminet

    2016-07-01

    Full Text Available The article deals with the rind aspects of European Company (also known by its Latin name Societas Europaea or SE, a “type of public limited-liability company regulated under European Union law”. Although this form of company was proposed more than 40 years ago, it was only in 2001 when the Council issued Regulation (EC No 2157/2001 of 8 October 2001 on the Statute for a European company defining the European company (SE as “a legal structure that permits a company to operate in different European Union (EU countries under a single statute”, as determined by the law of the Union and common to all EU countries. Being a new legal form, the SE coexists with the corporate forms that already were in each Member Statebeing governed by both European Regulation and national law. As it follows we address the rules, classification, conditions for settling an SE, organization structures, tax harmonization, employee involvement in the SE, advantages and disadvantages of SEs, as well as the opportunity of SPEs.

  13. Olive plants (Olea europaea L.) as a bioindicator for pollution.

    Science.gov (United States)

    Eliwa, Amal Mohamed; Kamel, Ehab Abdel-Razik

    2013-06-15

    In the present work, olive plant (Olea europaea L.) was used as a biological indicator for pollution in which, molecular and physiological parameters were studied. Olive plants were collected from polluted and non-polluted areas in Jeddah - Saudi Arabia, traffic area as an air polluted area, sewage treatment station as water polluted area, industrial area as solid waste polluted, costal area as marine polluted area and an area without a direct source of pollution far away from the city center, which was used as control. These changes conducted with nucleic acid content, minerals content, pigments and some growth parameters. Results showed significant reductions in DNA and RNA contents under all polluted sites. Mineral contents were varied widely depending on the different pollutants and locations of olive plant. Generally, micro-elements varied (increase/decrease) significantly within collected samples and the source of pollution. All growth parameters were decreased significantly within the studied samples of all pollutant areas except the relative water content was increased. The content of chlorophyll a has decreased highly significantly in all polluted leaves. While the content of chlorophyll b has increased significantly in all polluted leaves especially in air polluted leaves. The total content of carotenoid pigments has decreased highly significantly in all polluted leaves. It was concluded that olive plant can be used as a biological indicator to the environmental pollutants.

  14. Molecular studies in olive (Olea europaea L.): overview on DNA markers applications and recent advances in genome analysis.

    Science.gov (United States)

    Bracci, T; Busconi, M; Fogher, C; Sebastiani, L

    2011-04-01

    Olive (Olea europaea L.) is one of the oldest agricultural tree crops worldwide and is an important source of oil with beneficial properties for human health. This emblematic tree crop of the Mediterranean Basin, which has conserved a very wide germplasm estimated in more than 1,200 cultivars, is a diploid species (2n = 2x = 46) that is present in two forms, namely wild (Olea europaea subsp. europaea var. sylvestris) and cultivated (Olea europaea subsp. europaea var. europaea). In spite of its economic and nutritional importance, there are few data about the genetic of olive if compared with other fruit crops. Available molecular data are especially related to the application of molecular markers to the analysis of genetic variability in Olea europaea complex and to develop efficient molecular tools for the olive oil origin traceability. With regard to genomic research, in the last years efforts are made for the identification of expressed sequence tag, with particular interest in those sequences expressed during fruit development and in pollen allergens. Very recently the sequencing of chloroplast genome provided new information on the olive nucleotide sequence, opening the olive genomic era. In this article, we provide an overview of the most relevant results in olive molecular studies. A particular attention was given to DNA markers and their application that constitute the most part of published researches. The first important results in genome analysis were reported.

  15. In Vitro Culture Conditions and OeARF and OeH3 Expressions Modulate Adventitious Root Formation from Oleaster (Olea europaea L. subsp. europaea var. sylvestris) Cuttings

    Science.gov (United States)

    Gagliardi, Cinzia; Bruno, Leonardo; Bitonti, Maria Beatrice

    2014-01-01

    Olea europaea L. subsp. europaea var. sylvestris, also named oleaster, is the wild form of olive and it is used as rootstock and pollen donor for many cultivated varieties. An efficient procedure for in vitro propagation of oleaster was established in this study. A zeatin concentration of 2.5 mg/L was effective to induce an appreciable vegetative growth. Also high rooting efficiency was obtained by using a short IBA pulse, followed by two different IBA concentrations in the culture medium. With the aim to enlarge knowledge on the molecular aspects of adventitious rooting, we also evaluated the transcriptional modulation of an ARFs member and HISTONE H3 genes, involved in auxin signaling and cell replication, respectively, during the root induction phase of cuttings. The obtained results suggest that the selected genes, as markers of the induction phase, could be very useful for setting up efficient culture conditions along the rooting process, thus increasing micropropagation efficiency. PMID:24587768

  16. In vitro culture conditions and OeARF and OeH3 expressions modulate adventitious root formation from oleaster (Olea europaea L. subsp. europaea var. sylvestris) cuttings.

    Science.gov (United States)

    Chiappetta, Adriana; Gagliardi, Cinzia; Bruno, Leonardo; Bitonti, Maria Beatrice

    2014-01-01

    Olea europaea L. subsp. europaea var. sylvestris, also named oleaster, is the wild form of olive and it is used as rootstock and pollen donor for many cultivated varieties. An efficient procedure for in vitro propagation of oleaster was established in this study. A zeatin concentration of 2.5 mg/L was effective to induce an appreciable vegetative growth. Also high rooting efficiency was obtained by using a short IBA pulse, followed by two different IBA concentrations in the culture medium. With the aim to enlarge knowledge on the molecular aspects of adventitious rooting, we also evaluated the transcriptional modulation of an ARFs member and HISTONE H3 genes, involved in auxin signaling and cell replication, respectively, during the root induction phase of cuttings. The obtained results suggest that the selected genes, as markers of the induction phase, could be very useful for setting up efficient culture conditions along the rooting process, thus increasing micropropagation efficiency.

  17. Degradation of halogenated aliphatic compounds by the ammonia- oxidizing bacterium Nitrosomonas europaea.

    OpenAIRE

    Vannelli, T; Logan, M; Arciero, D M; Hooper, A B

    1990-01-01

    Suspensions of Nitrosomonas europaea catalyzed the ammonia-stimulated aerobic transformation of the halogenated aliphatic compounds dichloromethane, dibromomethane, trichloromethane (chloroform), bromoethane, 1,2-dibromoethane (ethylene dibromide), 1,1,2-trichloroethane, 1,1,1-trichloroethane, monochloroethylene (vinyl chloride), gem-dichloroethylene, cis- and trans-dichloroethylene, cis-dibromoethylene, trichloroethylene, and 1,2,3-trichloropropane, Tetrachloromethane (carbon tetrachloride),...

  18. THE BIOENERGETICS OF AMMONIA AND HYDROXYLAMINE OXIDATION IN NITROSOMONAS-EUROPAEA AT ACID AND ALKALINE PH

    NARCIS (Netherlands)

    FRIJLINK, MJ; ABEE, T; LAANBROEK, HJ; DEBOER, W; KONINGS, WN

    Autotrophic ammonia oxidizers depend on alkaline or neutral conditions for optimal activity. Below pH 7 growth and metabolic activity decrease dramatically. Actively oxidizing cells of Nitrosomonas europaea do not maintain a constant internal pH when the external pH is varied from 5 to 8. Studies of

  19. Comparative proteomic analysis of differentially expressed proteins in shoots of Salicornia europaea under different salinity.

    Science.gov (United States)

    Wang, Xuchu; Fan, Pengxiang; Song, Hongmiao; Chen, Xianyang; Li, Xiaofang; Li, Yinxin

    2009-07-01

    Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is a succulent annual euhalophyte and one of the most salt tolerant plant species. The elucidation of its salt tolerance mechanism is of significance for generating salt-tolerant crops. In this study, we provided high resolution of proteome reference maps of S. europaea shoot and obtained evidence on the salt tolerance mechanism by analyzing the proteomic responses of this plant to high salinity. Our results demonstrated significant variations existed in 196 out of 1880 protein spots detected on CBB stained 2-DE gels. Of these, 111 proteins were identified by mass spectrometry. Among them, the majority was energy production and conversion related proteins, followed by photosynthesis and carbohydrate metabolism associated enzymes. Analysis of protein expression patters revealed that energy production and ion homeostasis associated proteins played important roles for this plant salt tolerance ability. Hierarchical clustering results revealed many proteins were involved in S. europaea salt tolerance mechanism as a dynamic network. Finally, based on our proteomic results, we brought forward a possible schematic representation of mechanism associated with the systematic salt tolerance phenotype in S. europaea.

  20. Yeast functional screen to identify genes conferring salt stress tolerance in Salicornia europaea.

    Science.gov (United States)

    Nakahara, Yoshiki; Sawabe, Shogo; Kainuma, Kenta; Katsuhara, Maki; Shibasaka, Mineo; Suzuki, Masanori; Yamamoto, Kosuke; Oguri, Suguru; Sakamoto, Hikaru

    2015-01-01

    Salinity is a critical environmental factor that adversely affects crop productivity. Halophytes have evolved various mechanisms to adapt to saline environments. Salicornia europaea L. is one of the most salt-tolerant plant species. It does not have special salt-secreting structures like a salt gland or salt bladder, and is therefore a good model for studying the common mechanisms underlying plant salt tolerance. To identify candidate genes encoding key proteins in the mediation of salt tolerance in S. europaea, we performed a functional screen of a cDNA library in yeast. The library was screened for genes that allowed the yeast to grow in the presence of 1.3 M NaCl. We obtained three full-length S. europaea genes that confer salt tolerance. The genes are predicted to encode (1) a novel protein highly homologous to thaumatin-like proteins, (2) a novel coiled-coil protein of unknown function, and (3) a novel short peptide of 32 residues. Exogenous application of a synthetic peptide corresponding to the 32 residues improved salt tolerance of Arabidopsis. The approach described in this report provides a rapid assay system for large-scale screening of S. europaea genes involved in salt stress tolerance and supports the identification of genes responsible for such mechanisms. These genes may be useful candidates for improving crop salt tolerance by genetic transformation.

  1. Polyploidy in the olive complex (Olea europaea): Evidence from flow cytometry and nuclear microsatellite analyses

    DEFF Research Database (Denmark)

    Besnard, G.; Garcia-Verdugo, C.; Rubio de Casas, R.

    2008-01-01

    Background: Phylogenetic and phylogeographic investigations have been previously performed to study the evolution of the olive tree complex (Olea europaea). A particularly high genomic diversity has been found in north-west Africa. However, to date no exhaustive study has been addressed to infer...

  2. Isolation and identification of radical scavengers in olive tree (Olea europaea) wood

    NARCIS (Netherlands)

    Pérez-Bonilla, M.; Salido, S.; Beek, van T.A.; Linares-Palomino, P.J.; Altarejos, J.; Nogueras, M.; Sánchez, A.

    2006-01-01

    Several extracts of Olea europaea wood (Picual olive cultivar) were obtained with solvents of different polarity and their antioxidant activities determined. The active compounds were detected in fractions of an ethyl acetate extract using HPLC with on-line radical scavenging detection. After

  3. Yeast functional screen to identify genes conferring salt stress tolerance in Salicornia europaea

    Directory of Open Access Journals (Sweden)

    Yoshiki eNakahara

    2015-10-01

    Full Text Available Salinity is a critical environmental factor that adversely affects crop productivity. Halophytes have evolved various mechanisms to adapt to saline environments. Salicornia europaea L. is one of the most salt-tolerant plant species. It does not have special salt-secreting structures like a salt gland or salt bladder, and is therefore a good model for studying the common mechanisms underlying plant salt tolerance. To identify candidate genes encoding key proteins in the mediation of salt tolerance in S. europaea, we performed a functional screen of a cDNA library in yeast. The library was screened for genes that allowed the yeast to grow in the presence of 1.3 M NaCl. We obtained three full-length S. europaea genes that confer salt tolerance. The genes are predicted to encode (1 a novel protein highly homologous to thaumatin-like proteins, (2 a novel coiled-coil protein of unknown function, and (3 a novel short peptide of 32 residues. Exogenous application of a synthetic peptide corresponding to the 32 residues improved salt tolerance of Arabidopsis. The approach described in this report provides a rapid assay system for large-scale screening of S. europaea genes involved in salt stress tolerance and supports the identification of genes responsible for such mechanisms. These genes may be useful candidates for improving crop salt tolerance by genetic transformation.

  4. Evaluation of skin entry kerma in radiological examinations at the Hospital de Clinicas, Parana, Brazil; Avaliacao de kerma de entrada na pele em exames radiologicos no Hospital de Clinicas do Parana, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Porto, Lorena E.; Schelin, Hugo R.; Santos, Amanda C. dos; Bunick, Ana Paula; Paschuk, Sergei; Denyak, Valeriy [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Tilly Junior, Joao G. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Hospital de Clinicas; Khoury, Helen J., E-mail: khoury@ufpe.b [Universidade Federal de Pernambuco (UFPE/DEN), Recife, PE (Brazil). Dept. de Energia Nuclear

    2011-10-26

    This paper evaluates the skin entry dose of pediatric and adults patients when submitted to radiological examinations at the Hospital de Clinicas do Parana, Brazil, as part integrate of the data assessment of International Atomic Energy Agency (IAEA) for Latin America. It was performed measurements of dose for evaluation of skin entry kerma in pediatric patients in thorax AP/PA examinations, adults of thorax in AP/PA, cranio caudal mammography and median lateral and patients of computerized tomography in examination of head, thorax and abdomen. The obtained data demonstrate the necessity of verification of diagnostic analysis standards. The great value amplitudes demonstrate the incompatibility of examination executions with those recommended by the literature. The dose values presented partially inside the range recommended and the other over the expected for the due examination when compared with the literature

  5. AAU-Specific RNA Cleavage Mediated by MazF Toxin Endoribonuclease Conserved in Nitrosomonas europaea

    Directory of Open Access Journals (Sweden)

    Tatsuki Miyamoto

    2016-06-01

    Full Text Available Nitrosomonas europaea carries numerous toxin-antitoxin systems. However, despite the abundant representation in its chromosome, studies have not surveyed the underlying molecular functions in detail, and their biological roles remain enigmatic. In the present study, we found that a chromosomally-encoded MazF family member, predicted at the locus NE1181, is a functional toxin endoribonuclease, and constitutes a toxin-antitoxin system, together with its cognate antitoxin, MazE. Massive parallel sequencing provided strong evidence that this toxin endoribonuclease exhibits RNA cleavage activity, primarily against the AAU triplet. This sequence-specificity was supported by the results of fluorometric assays. Our results indicate that N. europaea alters the translation profile and regulates its growth using the MazF family of endoribonuclease under certain stressful conditions.

  6. Proteomic platform for the identification of proteins in olive (Olea europaea) pulp.

    Science.gov (United States)

    Capriotti, Anna Laura; Cavaliere, Chiara; Foglia, Patrizia; Piovesana, Susy; Samperi, Roberto; Stampachiacchiere, Serena; Laganà, Aldo

    2013-10-24

    The nutritional and cancer-protective properties of the oil extracted mechanically from the ripe fruits of Olea europaea trees are attracting constantly more attention worldwide. The preparation of high-quality protein samples from plant tissues for proteomic analysis poses many challenging problems. In this study we employed a proteomic platform based on two different extraction methods, SDS and CHAPS based protocols, followed by two precipitation protocols, TCA/acetone and MeOH precipitation, in order to increase the final number of identified proteins. The use of advanced MS techniques in combination with the Swissprot and NCBI Viridiplantae databases and TAIR10 Arabidopsis database allowed us to identify 1265 proteins, of which 22 belong to O. europaea. The application of this proteomic platform for protein extraction and identification will be useful also for other proteomic studies on recalcitrant plant/fruit tissues. Copyright © 2013. Published by Elsevier B.V.

  7. Polyphenols benefits of olive leaf (Olea europaea L) to human health.

    Science.gov (United States)

    Vogel, Patrícia; Kasper Machado, Isabel; Garavaglia, Juliano; Zani, Valdeni Terezinha; de Souza, Daiana; Morelo Dal Bosco, Simone

    2014-12-17

    The phenolic compounds present in olive leaves (Olea europaea L.) confer benefits to the human health. To review the scientific literature about the benefits of the polyphenols of olive leaves to human health. Literature review in the LILACS-BIREME, SciELO and MEDLINE databases for publications in English, Portuguese and Spanish with the descriptors "Olea europaea", "olive leaves", "olive leaf", "olive leaves extracts", "olive leaf extracts", "phenolic compounds", "polyphenols", "oleuropein", "chemical composition", and "health". There were identified 92 articles, but only 38 related to the objectives of the study and 9 articles cited in the works were included due to their relevance. The phenolic compounds present in olive leaves, especially the oleuropein, are associated to antioxidant, antihypertensive, hypoglycemic, hypocholesterolemic and cardioprotective activity. Furthermore, studies associate the oleuropein to an anti-inflammatory effect in trauma of the bone marrow and as a support in the treatment of obesity. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  8. Degradation of halogenated aliphatic compounds by the ammonia- oxidizing bacterium Nitrosomonas europaea.

    Science.gov (United States)

    Vannelli, T; Logan, M; Arciero, D M; Hooper, A B

    1990-01-01

    Suspensions of Nitrosomonas europaea catalyzed the ammonia-stimulated aerobic transformation of the halogenated aliphatic compounds dichloromethane, dibromomethane, trichloromethane (chloroform), bromoethane, 1,2-dibromoethane (ethylene dibromide), 1,1,2-trichloroethane, 1,1,1-trichloroethane, monochloroethylene (vinyl chloride), gem-dichloroethylene, cis- and trans-dichloroethylene, cis-dibromoethylene, trichloroethylene, and 1,2,3-trichloropropane, Tetrachloromethane (carbon tetrachloride), tetrachloroethylene (perchloroethylene), and trans-dibromoethylene were not degraded. PMID:2339874

  9. Characteristics, Phytochemical Analysis and Biological Activities of Extracts from Tunisian Chetoui Olea europaea Variety

    OpenAIRE

    Ines Khlif; Karim Jellali; Thomas Michel; Maria Halabalaki; Alexios Leandros Skaltsounis; Noureddine Allouche

    2015-01-01

    This study selected 10 extracts from Tunisian chetoui O. europaea variety for their total phenolics, flavonoids, and phytochemical analyses as well as for their antioxidant and antimicrobial activities determination. The in vitro antioxidant property was investigated using DPPH, ferric reducing antioxidant capacity (FRAP), oxygen reducing antioxidant capacity (ORAC), and β-carotene-linoleic acid bleaching assays while antimicrobial activity was evaluated using macrodilutions method. For all o...

  10. Global metabolomic responses of Nitrosomonas europaea 19718 to cold stress and altered ammonia feeding patterns

    KAUST Repository

    Lu, Huijie

    2015-11-05

    © 2015 Springer-Verlag Berlin Heidelberg The model ammonia-oxidizing bacterium Nitrosomonas europaea represents one of the environmentally and biotechnologically significant microorganisms. Genome-based studies over the last decade have led to many intriguing discoveries about its cellular biochemistry and physiology. However, knowledge regarding the regulation of overall metabolic routes in response to various environmental stresses is limited due to a lack of comprehensive, time-resolved metabolomic analyses. In this study, gas chromatography–mass spectrometry (GC-MS)-based metabolic profiling was performed to characterize the temporal variations of N. europaea 19718 intercellular metabolites in response to varied temperature (23 and 10 °C) and ammonia feeding patterns (shock loading and continuous feeding of 20 mg N/L). Approximately 87 metabolites were successfully identified and mapped to the existing pathways of N. europaea 19718, allowing interpretation of the influence of temperature and feeding pattern on metabolite levels. In general, varied temperature had a more profound influence on the overall metabolism than varied feeding patterns. Total extracellular metabolite concentrations (relative to internal standards and normalized to biomass weight) were lower under cold stress and shock loading conditions compared with the control (continuous feeding at 23 °C). Cold stress caused the widespread downregulation of metabolites involved in central carbon metabolism, amino acid, and lipid synthesis (e.g., malonic acid, succinic acid, putrescine, and phosphonolpyruvate). Metabolites that showed differences under varied feeding patterns were mainly involved in nucleotide acid, amino acid, and lipid metabolism (e.g., adenine, uracil, and spermidine). This study highlighted the roles of central carbon and nitrogen metabolism in countering cold stress and altered ammonia availability. In addition, transcriptomic, proteomic, and metabolomic data from three

  11. Global metabolomic responses of Nitrosomonas europaea 19718 to cold stress and altered ammonia feeding patterns

    KAUST Repository

    Lu, Huijie; Ulanov, Alexander V.; Nobu, Masaru; Liu, Wen-Tso

    2015-01-01

    © 2015 Springer-Verlag Berlin Heidelberg The model ammonia-oxidizing bacterium Nitrosomonas europaea represents one of the environmentally and biotechnologically significant microorganisms. Genome-based studies over the last decade have led to many intriguing discoveries about its cellular biochemistry and physiology. However, knowledge regarding the regulation of overall metabolic routes in response to various environmental stresses is limited due to a lack of comprehensive, time-resolved metabolomic analyses. In this study, gas chromatography–mass spectrometry (GC-MS)-based metabolic profiling was performed to characterize the temporal variations of N. europaea 19718 intercellular metabolites in response to varied temperature (23 and 10 °C) and ammonia feeding patterns (shock loading and continuous feeding of 20 mg N/L). Approximately 87 metabolites were successfully identified and mapped to the existing pathways of N. europaea 19718, allowing interpretation of the influence of temperature and feeding pattern on metabolite levels. In general, varied temperature had a more profound influence on the overall metabolism than varied feeding patterns. Total extracellular metabolite concentrations (relative to internal standards and normalized to biomass weight) were lower under cold stress and shock loading conditions compared with the control (continuous feeding at 23 °C). Cold stress caused the widespread downregulation of metabolites involved in central carbon metabolism, amino acid, and lipid synthesis (e.g., malonic acid, succinic acid, putrescine, and phosphonolpyruvate). Metabolites that showed differences under varied feeding patterns were mainly involved in nucleotide acid, amino acid, and lipid metabolism (e.g., adenine, uracil, and spermidine). This study highlighted the roles of central carbon and nitrogen metabolism in countering cold stress and altered ammonia availability. In addition, transcriptomic, proteomic, and metabolomic data from three

  12. Global metabolomic responses of Nitrosomonas europaea 19718 to cold stress and altered ammonia feeding patterns.

    Science.gov (United States)

    Lu, Huijie; Ulanov, Alexander V; Nobu, Masaru; Liu, Wen-Tso

    2016-02-01

    The model ammonia-oxidizing bacterium Nitrosomonas europaea represents one of the environmentally and biotechnologically significant microorganisms. Genome-based studies over the last decade have led to many intriguing discoveries about its cellular biochemistry and physiology. However, knowledge regarding the regulation of overall metabolic routes in response to various environmental stresses is limited due to a lack of comprehensive, time-resolved metabolomic analyses. In this study, gas chromatography-mass spectrometry (GC-MS)-based metabolic profiling was performed to characterize the temporal variations of N. europaea 19718 intercellular metabolites in response to varied temperature (23 and 10 °C) and ammonia feeding patterns (shock loading and continuous feeding of 20 mg N/L). Approximately 87 metabolites were successfully identified and mapped to the existing pathways of N. europaea 19718, allowing interpretation of the influence of temperature and feeding pattern on metabolite levels. In general, varied temperature had a more profound influence on the overall metabolism than varied feeding patterns. Total extracellular metabolite concentrations (relative to internal standards and normalized to biomass weight) were lower under cold stress and shock loading conditions compared with the control (continuous feeding at 23 °C). Cold stress caused the widespread downregulation of metabolites involved in central carbon metabolism, amino acid, and lipid synthesis (e.g., malonic acid, succinic acid, putrescine, and phosphonolpyruvate). Metabolites that showed differences under varied feeding patterns were mainly involved in nucleotide acid, amino acid, and lipid metabolism (e.g., adenine, uracil, and spermidine). This study highlighted the roles of central carbon and nitrogen metabolism in countering cold stress and altered ammonia availability. In addition, transcriptomic, proteomic, and metabolomic data from three studies on N. europaea were compared to achieve a

  13. Know your audience: analysis of chief complaints at clinica esperanza, a student-run free clinic in memphis, tennessee.

    Science.gov (United States)

    Cesari, Whitney A; Vaikunth, Sumeet S; Lewis, Jim B; Panda, Mukta

    2012-10-01

    To identify the chief complaints and demographics at Clinica Esperanza, a student-run free clinic for an underserved Hispanic population. A retrospective chart review of patient files from 2005 through 2010 was undertaken, as approved by the University of Tennessee Health Science Center's Institutional Review Board. From 2005 through 2010, Clinica Esperanza fielded 2551 patient visits, consisting of 951 unique patients, 609 females and 342 males. Mean age was 34 years, and 60% of patients presented once, while 13% followed up for 1 year, 9% for 2 years, 6% for 3, 6% for 4, and 4% for 5. "Pap smear," "abdominal pain," and "follow-up lab results" ranked, in order, as the 3 top chief complaints. Resulting data have led to several improvements. The clinic has remained open weekly to improve patient continuity. With the top 10 chief complaints identified, they are better addressed. More funding is allocated for speculums and proper training of Pap smear technique. Systematic reporting of lab results is being implemented. Physical therapists and pharmacists now participate to address musculoskeletal and medication-based needs, respectively. A volunteer gastroenterologist has been recruited to provide specialized care for abdominal pain. An electrocardiogram machine is now used to evaluate chest pain. To improve student-patient communication, online language learning modules have been created. Based on these data, improvements in health care services have been made, including better continuity, emphasis on top chief complaints, and provider education in medical Spanish. Future plans include on-site pharmacy, smoother referrals, and similar clinics on the University of Tennessee Health Science Center's other campuses.

  14. Implementation of radioactive wastes management system in nuclear medicine service of Hospital das Clinicas of Universidade de Campinas - UNICAMP, in Sao Paulo State, Brazil

    International Nuclear Information System (INIS)

    Rinaldi Neto, A.; Coelho, R.F.; Brunetto, S.Q.

    2001-01-01

    This work reports the experience acquired at the Servico de Medicina Nuclear of the Hospital de Clinicas/UNICAMP (SMN/HC) in planning and implementing the management system of radioactive waste. This system respects the Comissao Nacional de Energia Nuclear' (CNEN) standards and has been of relatively easy and simple performance, without disturbing the SMN/HC's routine. It has also proof to keep its quality along the time. (author)

  15. 15N Kinetic Analysis of N2O Production by Nitrosomonas europaea: an Examination of Nitrifier Denitrification

    OpenAIRE

    Poth, Mark; Focht, Dennis D.

    1985-01-01

    A series of 15N isotope tracer experiments showed that Nitrosomonas europaea produces nitrous oxide only under oxygen-limiting conditions and that the labeled N from nitrite, but not nitrate, is incorporated into nitrous oxide, indicating the presence of the “denitrifying enzyme” nitrite reductase. A kinetic analysis of the m/z 44, 45, and 46 nitrous oxide produced by washed cell suspensions of N. europaea when incubated with 4 mM ammonium (99% 14N) and 0.4 mM nitrite (99% 15N) was performed....

  16. Global transcriptome profiling of Salicornia europaea L. shoots under NaCl treatment.

    Science.gov (United States)

    Ma, Jinbiao; Zhang, Meiru; Xiao, Xinlong; You, Jinjin; Wang, Junru; Wang, Tao; Yao, Yinan; Tian, Changyan

    2013-01-01

    Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is well adapted to extreme saline environments with more than 1,000 mM NaCl in the soil, so it could serve as an important model species for studying halophilic mechanisms in euhalophytes. To obtain insights into the molecular basis of salt tolerance, we present here the first extensive transcriptome analysis of this species using the Illumina HiSeq™ 2000. A total of 41 and 39 million clean reads from the salt-treated (Se200S) and salt-free (SeCKS) tissues of S. europaea shoots were obtained, and de novo assembly produced 97,865 and 101,751 unigenes, respectively. Upon further assembly with EST data from both Se200S and SeCKS, 109,712 high-quality non-redundant unigenes were generated with a mean unigene size of 639 bp. Additionally, a total of 3,979 differentially expressed genes (DEGs) were detected between the Se200S and SeCKS libraries, with 348 unigenes solely expressed in Se200S and 460 unigenes solely expressed in SeCKS. Furthermore, we identified a large number of genes that are involved in ion homeostasis and osmotic adjustment, including cation transporters and proteins for the synthesis of low-molecular compounds. All unigenes were functionally annotated within the COG, GO and KEGG pathways, and 10 genes were validated by qRT-PCR. Our data contains the extensive sequencing and gene-annotation analysis of S. europaea. This genetic knowledge will be very useful for future studies on the molecular adaptation to abiotic stress in euhalophytes and will facilitate the genetic manipulation of other economically important crops.

  17. Global transcriptome profiling of Salicornia europaea L. shoots under NaCl treatment.

    Directory of Open Access Journals (Sweden)

    Jinbiao Ma

    Full Text Available Soil salinity is a major abiotic stress that limits agriculture productivity worldwide. Salicornia europaea is well adapted to extreme saline environments with more than 1,000 mM NaCl in the soil, so it could serve as an important model species for studying halophilic mechanisms in euhalophytes. To obtain insights into the molecular basis of salt tolerance, we present here the first extensive transcriptome analysis of this species using the Illumina HiSeq™ 2000.A total of 41 and 39 million clean reads from the salt-treated (Se200S and salt-free (SeCKS tissues of S. europaea shoots were obtained, and de novo assembly produced 97,865 and 101,751 unigenes, respectively. Upon further assembly with EST data from both Se200S and SeCKS, 109,712 high-quality non-redundant unigenes were generated with a mean unigene size of 639 bp. Additionally, a total of 3,979 differentially expressed genes (DEGs were detected between the Se200S and SeCKS libraries, with 348 unigenes solely expressed in Se200S and 460 unigenes solely expressed in SeCKS. Furthermore, we identified a large number of genes that are involved in ion homeostasis and osmotic adjustment, including cation transporters and proteins for the synthesis of low-molecular compounds. All unigenes were functionally annotated within the COG, GO and KEGG pathways, and 10 genes were validated by qRT-PCR.Our data contains the extensive sequencing and gene-annotation analysis of S. europaea. This genetic knowledge will be very useful for future studies on the molecular adaptation to abiotic stress in euhalophytes and will facilitate the genetic manipulation of other economically important crops.

  18. Polyploidy in the Olive Complex (Olea europaea): Evidence from Flow Cytometry and Nuclear Microsatellite Analyses

    Science.gov (United States)

    Besnard, G.; Garcia-Verdugo, C.; Rubio De Casas, R.; Treier, U. A.; Galland, N.; Vargas, P.

    2008-01-01

    Background Phylogenetic and phylogeographic investigations have been previously performed to study the evolution of the olive tree complex (Olea europaea). A particularly high genomic diversity has been found in north-west Africa. However, to date no exhaustive study has been addressed to infer putative polyploidization events and their evolutionary significance in the diversification of the olive tree and its relatives. Methods Representatives of the six olive subspecies were investigated using (a) flow cytometry to estimate genome content, and (b) six highly variable nuclear microsatellites to assess the presence of multiple alleles at co-dominant loci. In addition, nine individuals from a controlled cross between two individuals of O. europaea subsp. maroccana were characterized with microsatellites to check for chromosome inheritance. Key Results Based on flow cytometry and genetic analyses, strong evidence for polyploidy was obtained in subspp. cerasiformis (tetraploid) and maroccana (hexaploid), whereas the other subspecies appeared to be diploids. Agreement between flow cytometry and genetic analyses gives an alternative approach to chromosome counting to determine ploidy level of trees. Lastly, abnormalities in chromosomes inheritance leading to aneuploid formation were revealed using microsatellite analyses in the offspring from the controlled cross in subsp. maroccana. Conclusions This study constitutes the first report for multiple polyploidy in olive tree relatives. Formation of tetraploids and hexaploids may have played a major role in the diversification of the olive complex in north-west Africa. The fact that polyploidy is found in narrow endemic subspecies from Madeira (subsp. cerasiformis) and the Agadir Mountains (subsp. maroccana) suggests that polyploidization has been favoured to overcome inbreeding depression. Lastly, based on previous phylogenetic analyses, we hypothesize that subsp. cerasiformis resulted from hybridization between ancestors

  19. Permanent draft genomes of the two Rhodopirellula europaea strains 6C and SH398.

    Science.gov (United States)

    Richter-Heitmann, Tim; Richter, Michael; Klindworth, Anna; Wegner, Carl-Eric; Frank, Carsten S; Glöckner, Frank Oliver; Harder, Jens

    2014-02-01

    The genomes of two Rhodopirellula europaea strains were sequenced as permanent drafts to study the genomic diversity within this genus, especially in comparison with the closed genome of the type strain Rhodopirellula baltica SH1(T). The isolates are part of a larger study to infer the biogeography of Rhodopirellula species in European marine waters, as well as to amend the genus description of R. baltica. This genomics resource article is the second of a series of five publications describing a total of eight new permanent daft genomes of Rhodopirellula species. Copyright © 2013 Elsevier B.V. All rights reserved.

  20. [Mobbing and its effects on health. the experience of the "Clinica del Lavoro Luigi Devoto" in Milan].

    Science.gov (United States)

    Punzi, Silvia; Cassitto, Maria Grazia; Castellini, Giovanna; Costa, G; Gilioli, R

    2007-01-01

    There is increasing interest in research, prevention and management of mobbing in the field of occupational psychosocial risks. To describe mobbing and its health effects by analysis of the cases examined from 1997 to 2003 at the Department of Occupational Health "Clinica del Lavoro Luigi Devoto" in Milan. A total of 226 clinical records of patients who reported a mobbing situation when undergoing medical examination were selected out of 2455 patients examined for stress-related disorders. The percentage of women was higher (53.1%) than in men (46.9%) with a prevalent age range of 35-54 years. There was a great variety of jobs, especially white-collars and workers in large service companies. In one third of the cases, mobbing occurred within 4 years from beginning of employment and mostly after company reorganization and management changes. The most frequent negative acts included social isolation and demotion. The most frequent symptoms were exhaustion, sleep, mood and sexual disorders. The number of symptoms was not related to the duration of mobbing but to the number and frequency of negative actions. 61.1% of the subjects took psychotropic drugs. Occupational health physicians play an essential role in primary prevention (information on occupational risks) and in early diagnosis and rehabilitation and could act as mediators between workers and enterprises.

  1. Investigation on the anti- inflammatory and analgesic effects of Olea europaea L. metanolic extract on male NMRI mouse

    Directory of Open Access Journals (Sweden)

    Elaheh Tekye

    2012-04-01

    Full Text Available Background: Different mediators are involved in pain and edema induction during different stages of inflammation. Then, treatment of them encounters some difficulties. Medicinal plants are an important source of substances which are claimed to induce anti-inflammatory effects. This study was aimed to investigate anti-inflammatory and analgesic effects of Olea europaea L.methanolic extract on male NMRI mouse. Methods: Methanolic extraction was done for leaf of Olea europaea L. and different doses (200, 300 and 400 mg/kg were intraperitoneally (i.p. adminstered to male NMRI mice. Analgesic and anti-inflammatory effects of extract was measured during both phases of Formalin test, Acetic acid induced visceral pain and xylene inflammation tests. A standard analgesic and anti-inflammatory drug such as indomethacin, dexamethasone and morphine were administered in positive control groups where appropriates. Results: Results indicated significant dose-dependent analgesic and anti-inflammatory effects of methanolic extract of Olea europaea L. leaf on pain which induced by formalin (both phase and acetic acid, and inflammation caused by xylene. Conclusion: Our findings Showed that administration of methanolic extract of Olea europaea L.leaf can suppress pain and inflammation dose dependently which, may mediate via different components of extract. However, more investigations need to be done.

  2. High-throughput deep sequencing reveals that microRNAs play important roles in salt tolerance of euhalophyte Salicornia europaea.

    Science.gov (United States)

    Feng, Juanjuan; Wang, Jinhui; Fan, Pengxiang; Jia, Weitao; Nie, Lingling; Jiang, Ping; Chen, Xianyang; Lv, Sulian; Wan, Lichuan; Chang, Sandra; Li, Shizhong; Li, Yinxin

    2015-02-26

    microRNAs (miRNAs) are implicated in plant development processes and play pivotal roles in plant adaptation to environmental stresses. Salicornia europaea, a salt mash euhalophyte, is a suitable model plant to study salt adaptation mechanisms. S. europaea is also a vegetable, forage, and oilseed that can be used for saline land reclamation and biofuel precursor production on marginal lands. Despite its importance, no miRNA has been identified from S. europaea thus far. Deep sequencing was performed to investigate small RNA transcriptome of S. europaea. Two hundred and ten conserved miRNAs comprising 51 families and 31 novel miRNAs (including seven miRNA star sequences) belonging to 30 families were identified. About half (13 out of 31) of the novel miRNAs were only detected in salt-treated samples. The expression of 43 conserved and 13 novel miRNAs significantly changed in response to salinity. In addition, 53 conserved and 13 novel miRNAs were differentially expressed between the shoots and roots. Furthermore, 306 and 195 S. europaea unigenes were predicted to be targets of 41 conserved and 29 novel miRNA families, respectively. These targets encoded a wide range of proteins, and genes involved in transcription regulation constituted the largest category. Four of these genes encoding laccase, F-box family protein, SAC3/GANP family protein, and NADPH cytochrome P-450 reductase were validated using 5'-RACE. Our results indicate that specific miRNAs are tightly regulated by salinity in the shoots and/or roots of S. europaea, which may play important roles in salt tolerance of this euhalophyte. The S. europaea salt-responsive miRNAs and miRNAs that target transcription factors, nucleotide binding site-leucine-rich repeat proteins and enzymes involved in lignin biosynthesis as well as carbon and nitrogen metabolism may be applied in genetic engineering of crops with high stress tolerance, and genetic modification of biofuel crops with high biomass and regulatable

  3. Rapid and sensitive Nitrosomonas europaea biosensor assay for quantification of bioavailable ammonium sensu strictu in soil.

    Science.gov (United States)

    Nguyen, Minh Dong; Risgaard-Petersen, Nils; Sørensen, Jan; Brandt, Kristian K

    2011-02-01

    Knowledge on bioavailable ammonium sensu strictu (i.e., immediately available for cellular uptake) in soil is required to understand nutrient uptake processes in microorganisms and thus of vital importance for plant production. We here present a novel ammonium biosensor approach based on the lithoautotrophic ammonia-oxidizing bacterium Nitrosomonas europaea transformed with a luxAB sensor plasmid. Bioluminescence-based ammonium detection was achieved within 10 min with a quantification limit in liquid samples of ∼20 μM and a linear response range up to 400 μM. Biosensor and conventional chemical quantification of ammonium in soil solutions agreed well across a range of sample and assay conditions. The biosensor was subsequently applied for a solid phase-contact assay allowing for direct interaction of biosensor cells with soil particle-associated (i.e., exchangeable plus fixed) ammonium. The assay successfully quantified bioavailable ammonium even in unfertilized soil and demonstrated markedly higher ratios of bioavailable ammonium to water- or 2 M KCl-exchangeable ammonium in anoxic soil than in corresponding oxic soil. Particle-associated ammonium contributed by at least 74% and 93% of the total bioavailable pool in oxic and anoxic soil, respectively. The N. europaea biosensor should have broad relevance for environmental monitoring of bioavailable ammonium and processes depending on ammonium bioavailability.

  4. Genetic Diversity Among Historical Olive (Olea europaea L.) Genotypes from Southern Anatolia Based on SSR Markers.

    Science.gov (United States)

    Sakar, Ebru; Unver, Hulya; Ercisli, Sezai

    2016-12-01

    Olive (Olea europaea) is an ancient and important crop in both olive oil production and table use. It is important to identify the genetic diversity of olive genetic resources for cultivar development and evaluation of olive germplasm. In the study, 14 microsatellite markers (UDO4, UDO8, UDO9, UDO11, UDO12, UDO22, UDO24, UDO26, UDO28, DCA9, DCA11, DCA13, DCA15, and DCA18) were used to assess the genetic variation on 76 olive (Olea europaea L.) genotypes from Mardin province together with 6 well-known Turkish and 4 well-known foreign reference cultivars. All microsatellite markers showed polymorphism and the number of alleles varied between 9 and 22, with an average of 14.57. The most informative loci were DCA 11 (22 alleles) and DCA 9 (21 alleles). Dendrogram based on genetic distances was constructed for the 86 olive genotypes/cultivars, which revealed the existence of different clusters. The high genetic similarity was evident between Bakırkire2 and Zinnar5 (0.74) genotypes, while the most genetically divergent genotypes were Gürmeşe5 and Yedikardeşler2 (0.19). It was concluded that there was abundant SSR polymorphism in olive germplasm in southern Anatolia in Turkey and could be important for future breeding activities.

  5. Antimicrobial potential of green synthesized CeO2 nanoparticles from Olea europaea leaf extract.

    Science.gov (United States)

    Maqbool, Qaisar; Nazar, Mudassar; Naz, Sania; Hussain, Talib; Jabeen, Nyla; Kausar, Rizwan; Anwaar, Sadaf; Abbas, Fazal; Jan, Tariq

    This article reports the green fabrication of cerium oxide nanoparticles (CeO 2 NPs) using Olea europaea leaf extract and their applications as effective antimicrobial agents. O. europaea leaf extract functions as a chelating agent for reduction of cerium nitrate. The resulting CeO 2 NPs exhibit pure single-face cubic structure, which is examined by X-ray diffraction, with a uniform spherical shape and a mean size 24 nm observed through scanning electron microscopy and transmission electron microscopy. Ultraviolet-visible spectroscopy confirms the characteristic absorption peak of CeO 2 NPs at 315 nm. Fourier transform infrared spectroscopy reflects stretching frequencies at 459 cm -1 , showing utilization of natural components for the production of NPs. Thermal gravimetric analysis predicts the successful capping of CeO 2 NPs by bioactive molecules present in the plant extract. The antimicrobial studies show significant zone of inhibition against bacterial and fungal strains. The higher activities shown by the green synthesized NPs than the plant extract lead to the conclusion that they can be effectively used in biomedical application. Furthermore, reduction of cerium salt by plant extract will reduce environmental impact over chemical synthesis.

  6. Green fabricated CuO nanobullets via Olea europaea leaf extract shows auspicious antimicrobial potential.

    Science.gov (United States)

    Maqbool, Qaisar; Iftikhar, Sidra; Nazar, Mudassar; Abbas, Fazal; Saleem, Asif; Hussain, Talib; Kausar, Rizwan; Anwaar, Sadaf; Jabeen, Nyla

    2017-06-01

    In present investigation, copper oxide (CuO) nanostructures have been prepared via green chemistry. Olea europaea leaf extract act as strong chelating agent for tailoring physical as well as bio-medical characteristics of CuO at the nano-size. Physical characterisation such as scanning electron microscope analysis depicts the formation of homogenised spherical shape nanoparticles (NPs) with average size of 42 nm. X-ray diffraction and Fourier transform infrared spectroscopy further confirmed the crystalline pure phase and monoclinic structure. High performance liquid chromatography (HPLC) testing is performed to evaluate the relative concentration of bioactive molecules in the O. europaea leaf extract. From HPLC results capping action of organic molecules around CuO-NPs is hypothesised. The antimicrobial potency of biosynthesised CuO-NPs have been evaluated using colony forming unit (CFU) counting assay and disc diffusion method which shows a significant zone of inhibition against bacterial and fungal strains may be highly potential for future antimicrobial pharmaceutics. Furthermore, reduction of various precursors by plant extract will reduce environmental impact over chemical synthesis.

  7. Virtual-reality-based attention assessment of ADHD: ClinicaVR: Classroom-CPT versus a traditional continuous performance test.

    Science.gov (United States)

    Neguț, Alexandra; Jurma, Anda Maria; David, Daniel

    2017-08-01

    Virtual-reality-based assessment may be a good alternative to classical or computerized neuropsychological assessment due to increased ecological validity. ClinicaVR: Classroom-CPT (VC) is a neuropsychological test embedded in virtual reality that is designed to assess attention deficits in children with attention deficit hyperactivity disorder (ADHD) or other conditions associated with impaired attention. The present study aimed to (1) investigate the diagnostic validity of VC in comparison to a traditional continuous performance test (CPT), (2) explore the task difficulty of VC, (3) address the effect of distractors on the performance of ADHD participants and typically-developing (TD) controls, and (4) compare the two measures on cognitive absorption. A total of 33 children diagnosed with ADHD and 42 TD children, aged between 7 and 13 years, participated in the study and were tested with a traditional CPT or with VC, along with several cognitive measures and an adapted version of the Cognitive Absorption Scale. A mixed multivariate analysis of covariance (MANCOVA) revealed that the children with ADHD performed worse on correct responses had more commissions and omissions errors than the TD children, as well as slower target reaction times . The results showed significant differences between performance in the virtual environment and the traditional computerized one, with longer reaction times in virtual reality. The data analysis highlighted the negative influence of auditory distractors on attention performance in the case of the children with ADHD, but not for the TD children. Finally, the two measures did not differ on the cognitive absorption perceived by the children.

  8. Evaluation of the effects of Olea europaea L. subsp. africana (Mill.) P.S. Green (Oleaceae) leaf methanol extract against castor oil-induced diarrhoea in mice.

    Science.gov (United States)

    Amabeoku, George J; Bamuamba, Kapinga

    2010-03-01

    Olea europaea L. subsp. africana (Mill.) P.S. Green is widely used in South Africa by traditional medicine practitioners to treat diarrhoea. However, little is known scientifically about this South African species in the treatment of diarrhoea. The main aim of the study therefore was to investigate the antidiarrhoeal effect of the leaf methanol extract of the plant species in mice. The antidiarrhoeal activity of the leaf methanol extract of O. europaea subsp. africana was studied using a castor oil-induced diarrhoeal test. The antipropulsive activity of the plant extract was also investigated using the charcoal meal transit test. Standard methods were used to investigate the acute toxicity and effect of O. europaea subsp. africana on castor oil-induced intraluminal fluid accumulation. Leaf methanol extract of O. europaea subsp. africana and loperamide, a standard antidiarrhoeal drug, significantly reduced the number of diarrhoeal episodes induced by castor oil, significantly decreased the stool mass, significantly delayed the onset of the diarrhoea and protected the animals against castor oil-induced diarrhoea. Both O. europaea subsp. africana and loperamide significantly decreased the gastrointestinal transit of charcoal meal and castor oil-induced intraluminal fluid accumulation in mice. The LD50 value was found to be 3475 mg/kg (p.o.). The results obtained suggest that the leaf methanol extract of O. europaea subsp. africana has an antidiarrhoeal property and that, given orally, it may be non-toxic and/or safe in mice.

  9. MELiSSA third compartment: Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures in bioreactors

    Science.gov (United States)

    Cruvellier, Nelly; Lasseur, Christophe; Poughon, Laurent; Creuly, Catherine; Dussap, Gilles

    Nitrogen is a key element for the life and its balance on Earth is regulated by the nitrogen cycle. This loop includes several steps among which nitrification that permits the transformation of the ammonium into nitrate. The MELiSSA loop is an artificial ecosystem designed for life support systems (LSS). It is based on the carbon and nitrogen cycles and the recycling of the non-edible part of the higher plants and the waste produced by the crew. In this order, all the wastes are collected in the first compartment to degrade them into organic acids and CO2. These compounds are joining the second compartment which is a photoheterotrophic compartment where at the outlet an organic-free medium containing ammonium is produced. This solution will be the substrate of the third compartment where nitrification is done. This compartment has to oxidize the ammonium into nitrate, and this biological reaction needs two steps. In the MELiSSA loop, the nitrification is carried out by two bacteria: Nitrosomonas europaea ATCC® 19718™ which is oxidizing ammonia into nitrite and Nitrobacter winogradskyi ATCC® 25391™ which is producing nitrate from nitrite in the third compartment. These two bacteria are growing in axenic conditions on a fixed bed bioreactor filled with Biostyr® beads. The nitrogen compounds are controlled by Ionic Chromatography and colorimetric titration for each sample. The work presented here deals with the culture of both bacteria in pure cultures and mixed cultures in stirred and aerated bioreactors of different volumes. The first aim of our work is the characterization of the bacteria growth in bioreactors and in the nitrifying fixed-bed column. The experimental results confirm that the growth is slow; the maximal growth rate in suspended cultures is 0.054h-1 for Nitrosomonas europaea and 0.022h-1 for Nitrobacter winogradskyi. Mixed cultures are difficult to control and operate but one could be done for more than 500 hours. The characterization of the

  10. Fifty years of mapping the Balkan flora for Atlas Florae Europaeae

    Directory of Open Access Journals (Sweden)

    Uotila Pertti

    2017-10-01

    Full Text Available Atlas Florae Europaeae (AFE, a programme for mapping the distribution of vascular plants in Europe, was launched in 1965 as a collaborative effort between European botanists. A historical review of the mapping for AFE in the Balkan countries, cited in the last volume (16 from 2013 as Albania, Bosnia and Herzegovina, Bulgaria, Croatia, Former Yugoslav Republic (F. Y. R. of Macedonia, Greece, Kosovo, Montenegro, Serbia, Slovenia, and Turkey (European part, is presented and achievements and problems discussed. The special challenges facing mapping of the Balkan area during the past 50 years include the extremely rich flora, diverse and mountainous relief, political and economic difficulties, inaccessibility of available data, and scarcity of botanists contributing and collecting data for mapping.

  11. Identification and characterization of the iridoid synthase involved in oleuropein biosynthesis in olive (Olea europaea) fruits

    DEFF Research Database (Denmark)

    Alagna, Fiammetta; Geu-Flores, Fernando; Kries, Hajo

    2016-01-01

    The secoiridoids are the main class of specialized metabolites present in olive (Olea europaea L.) fruit. In particular, the secoiridoid oleuropein strongly influences olive oil quality because of its bitterness, which is a desirable trait. In addition, oleuropein possesses a wide range...... of pharmacological properties, including antioxidant, anti-inflammatory, and anti-cancer activities. In accordance, obtaining high oleuropein varieties is a main goal of molecular breeding programs. Here we use a transcriptomic approach to identify candidate genes belonging to the secoiridoid pathway in olive. From...... these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive...

  12. Genetic Markers Analyses and Bioinformatic Approaches to Distinguish Between Olive Tree (Olea europaea L.) Cultivars.

    Science.gov (United States)

    Ben Ayed, Rayda; Ben Hassen, Hanen; Ennouri, Karim; Rebai, Ahmed

    2016-12-01

    The genetic diversity of 22 olive tree cultivars (Olea europaea L.) sampled from different Mediterranean countries was assessed using 5 SNP markers (FAD2.1; FAD2.3; CALC; SOD and ANTHO3) located in four different genes. The genotyping analysis of the 22 cultivars with 5 SNP loci revealed 11 alleles (average 2.2 per allele). The dendrogram based on cultivar genotypes revealed three clusters consistent with the cultivars classification. Besides, the results obtained with the five SNPs were compared to those obtained with the SSR markers using bioinformatic analyses and by computing a cophenetic correlation coefficient, indicating the usefulness of the UPGMA method for clustering plant genotypes. Based on principal coordinate analysis using a similarity matrix, the first two coordinates, revealed 54.94 % of the total variance. This work provides a more comprehensive explanation of the diversity available in Tunisia olive cultivars, and an important contribution for olive breeding and olive oil authenticity.

  13. Feeding and Development of Emerald Ash Borer (Coleoptera: Buprestidae) on Cultivated Olive, Olea europaea.

    Science.gov (United States)

    Cipollini, Don; Rigsby, Chad M; Peterson, Donnie L

    2017-08-01

    We examined the suitability of cultivated olive, Olea europaea L., as a host for emerald ash borer, Agrilus planipennis Fairmaire. In a bioassay using cut stems from a field-grown olive tree (cv. 'Manzanilla') we found that 45% of larvae that had emerged from eggs used to inoculate stems, were recovered alive, many as larvae or prepupae, during periodic debarking of a subset of stems. Three intact stems that 19 larvae successfully entered were exposed to a simulated overwintering treatment. Four live adults emerged afterwards, and an additional pupa and several prepupae were discovered after debarking these stems. Cultivated olive joins white fringetree as one of the two species outside of the genus Fraxinus capable of supporting the development of emerald ash borer from neonate to adult. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. Early performance of Olea europaea cv. Arbequina, Picual and Frantoio in the southern Atacama Desert

    Directory of Open Access Journals (Sweden)

    Freddy Mora

    2008-01-01

    Full Text Available The cultivars Arbequina, Picual and Frantoio of Olea europaea are cultivated in severalMediterranean countries. In 1999, these cultivars were planted at three locations in the region of Coquimbo,an arid, Mediterranean-like area in Chile. A generalized linear modeling approach was used in view of thenon-normal distribution of the agronomic data sets. Fruit yield (harvests of 2002-2003, precocity (2002 andtree survival (after four growing seasons differed significantly between the cultivars. Arbequina and Picualhad a positive effect on the yield. Picual was the earliest cultivar at two sites. The survival rate of Frantoio washigh at the three sites (90-100%, as opposed to Picual (56-83%. The approach of Generalized Linear Modelswas particularly useful where the assumption of normality was not satisfied. The selection of cultivars ispromising in this arid region of Chile, while the success will depend on the selection of well-adapted genotypesto a particular location.

  15. A Comprehensive Toxicological Safety Assessment of an Extract of Olea Europaea L. Leaves (Bonolive™).

    Science.gov (United States)

    Clewell, Amy E; Béres, Erzsébet; Vértesi, Adél; Glávits, Róbert; Hirka, Gábor; Endres, John R; Murbach, Timothy S; Szakonyiné, Ilona Pasics

    2016-01-01

    A battery of toxicological studies was conducted to investigate the genotoxicity and repeated-dose oral toxicity of Bonolive™, a proprietary water-soluble extract of the leaves of the olive tree (Olea europaea L.), in accordance with internationally accepted protocols. There was no evidence of mutagenicity in a bacterial reverse mutation test and in an vitro mammalian chromosomal aberration test nor was any genotoxic activity observed in an in vivo mouse micronucleus test at concentrations up to the limit dose of 2000 mg/kg bw/d. Bonolive™ did not cause mortality or toxic effects in Crl:(WI)BR Wistar rats in a 90-day repeated-dose oral toxicity study at doses of 360, 600, and 1000 mg/kg bw/d. The no observed adverse effect level in the 90-day study was 1000 mg/kg bw/d for both male and female rats, the highest dose tested. © The Author(s) 2015.

  16. Intra-specific genetic diversity in wild olives (Olea europaea ssp cuspidata) in Hormozgan Province, Iran.

    Science.gov (United States)

    Noormohammadi, Z; Samadi-Molayousefi, H; Sheidai, M

    2012-03-19

    Wild olive (O. europaea ssp cuspidata) plants grow in various regions of Iran and are expected to have considerable genetic diversity due to adaptation to the various environmental conditions. We examined the genetic diversity of four populations of wild olive growing in Hormozgan Province located in southern Iran by using 30 RAPDs and 10 ISSR markers. The mean value of polymorphism for RAPD loci was 73.71%, while the value for ISSR loci was 81.74%. The Keshar population had the highest value of intra-population polymorphism for both RAPD and ISSR loci (66.86 and 62.71%, respectively), while the Tudar population had the lowest values (20.35 and 28.81%, respectively). Similarly, the highest and lowest number of effective alleles, Shannon index and Nei's genetic diversity were also found for these two populations. The highest value of H(pop)/H(sp) within population genetic diversity for RAPD and ISSR loci was found for the Keshar population (H(pop) = 0.85 and H(sp) = 0.90). OPA04-750, OPA13-650 and OPA02-350 RAPD bands were specific for Tudar, Bondon and Keshar populations, respectively, while no specific ISSR bands were observed. Analysis of molecular variance as well as the pairwise F(ST) test showed significant differences for RAPD and ISSR markers among the populations. The NJ and UPGMA trees also separated the wild olive populations from each other, indicating their genetic distinctness. UPGMA clustering of the four wild olive populations placed the Tudar population far from the other populations; Keshar and Bokhoon population samples revealed more similarity and were grouped together. We conclude that there is high genetic diversity among O. europaea ssp cuspidata populations located in southern Iran. We also found RAPD and ISSR markers to be useful molecular tools to discriminate and evaluate genetic variations in wild olive trees.

  17. Antimicrobial potential of green synthesized CeO2 nanoparticles from Olea europaea leaf extract

    Directory of Open Access Journals (Sweden)

    Maqbool Q

    2016-10-01

    Full Text Available Qaisar Maqbool,1 Mudassar Nazar,1 Sania Naz,2 Talib Hussain,3 Nyla Jabeen,4 Rizwan Kausar,5 Sadaf Anwaar,4 Fazal Abbas,6,7 Tariq Jan6 1Department of Biotechnology, Virtual University of Pakistan, Lahore, Pakistan; 2Department of Biotechnology, Quaid-i-Azam University, Islamabad, Pakistan; 3National Institute of Vacuum Science and Technology (NINVAST, Islamabad, Pakistan; 4Department of Biotechnology and Bioinformatics Lab., International Islamic University, Islamabad, Pakistan; 5Department of Chemistry, University of Sargodha, Sargodha, Pakistan; 6Department of Physics, International Islamic University, Islamabad, Pakistan; 7Interdisciplinary Research Organization, University of Chakwal (UOC, Chakwal, Pakistan Abstract: This article reports the green fabrication of cerium oxide nanoparticles (CeO2 NPs using Olea europaea leaf extract and their applications as effective antimicrobial agents. O. europaea leaf extract functions as a chelating agent for reduction of cerium nitrate. The resulting CeO2 NPs exhibit pure single-face cubic structure, which is examined by X-ray diffraction, with a uniform spherical shape and a mean size 24 nm observed through scanning electron microscopy and transmission electron microscopy. Ultraviolet-visible spectroscopy confirms the characteristic absorption peak of CeO2 NPs at 315 nm. Fourier transform infrared spectroscopy reflects stretching frequencies at 459 cm-1, showing utilization of natural components for the production of NPs. Thermal gravimetric analysis predicts the successful capping of CeO2 NPs by bioactive molecules present in the plant extract. The antimicrobial studies show significant zone of inhibition against bacterial and fungal strains. The higher activities shown by the green synthesized NPs than the plant extract lead to the conclusion that they can be effectively used in biomedical application. Furthermore, reduction of cerium salt by plant extract will reduce environmental impact over

  18. Community structure variability of Uropodina mites (Acari: Mesostigmata) in nests of the common mole, Talpa europaea, in Central Europe

    OpenAIRE

    Napiera?a, Agnieszka; M?dra, Anna; Leszczy?ska-Deja, Kornelia; Gwiazdowicz, Dariusz J.; Go?dyn, Bart?omiej; B?oszyk, Jerzy

    2016-01-01

    Underground nests of Talpa europaea, known as the common mole, are very specific microhabitats, which are also quite often inhabited by various groups of arthropods. Mites from the suborder Uropodina (Acari: Mesostigmata) are only one of them. One could expect that mole nests that are closely located are inhabited by communities of arthropods with similar species composition and structure. However, results of empirical studies clearly show that even nests which are close to each other can be ...

  19. Heavy metal bioaccumulation by the important food plant, Olea europaea L., in an ancient metalliferous polluted area of Cyprus.

    Science.gov (United States)

    Wilson, B; Pyatt, F B

    2007-05-01

    Aspects of the bioaccumulation of heavy metals are reviewed and possible evidence of homeostasis is highlighted. Examination and analysis of olive (Olea europaea L.) trees growing in close proximity to a copper dominated spoil tip dating from at least 2000 years BP, on the island of Cyprus, revealed both bioaccumulation and partitioning of copper, lead and zinc in various parts of the tree. A factor to quantify the degree of accumulation is illustrated and a possible seed protective mechanism suggested.

  20. Heavy metal bioaccumulation by the important food plant, olea europaea L., in an ancient metalliferous polluted area of Cyprus

    OpenAIRE

    Wilson, B; Pyatt, FB

    2007-01-01

    Aspects of the bioaccumulation of heavy metals are reviewed and possible evidence of homeostasis is highlighted. Examination and analysis of olive (Olea europaea L.) trees growing in close proximity to a copper dominated spoil tip dating from at least 2000 years BP, on the island of Cyprus, revealed both bioaccumulation and partitioning of copper, lead and zinc in various parts of the tree. A factor to quantify the degree of accumulation is illustrated and a possible seed protective mechanism...

  1. 15N kinetic analysis of N2O production by Nitrosomonas europaea: an examination of nitrifier denitrification

    International Nuclear Information System (INIS)

    Poth, M.; Focht, D.D.

    1985-01-01

    A series of 15 N isotope tracer experiments showed that Nitrosomonas europaea produces nitrous oxide only under oxygen-limiting conditions and that the labeled N from nitrite, but not nitrate, is incorporated into nitrous oxide, indicating the presence of the denitrifying enzyme nitrite reductase. A kinetic analysis of the m/z 44, 45, and 46 nitrous oxide produced by washed cell suspensions of N. europaea when incubated with 4 mM ammonium (99% 14 N) and 0.4 mM nitrite (99% 15 N) was performed. No labeled nitirte was reduced to ammonium. All labeled material added was accounted for as either nitrite or nitrous oxide. The hypothesis that nitrous oxide is produced directly from nitrification was rejected since (i) it does not allow for the large amounts of double-labeled (m/z 46) nitrous oxide observed; (ii) the observed patterns of m/z 44, 45, 46 nitrous oxide were completely consistent with a kinetic analysis based on denitrification as the sole mechanism of nitrous oxide production but not with a kinetic analysis based on both mechanisms; (iii) the asymptotic ratio of m/z 45 to m/z 46 nitrous oxide was consistent with denitrification kinetics but inconsistent with nitrification kinetics, which predicted no limit to m/z 45 production. It is concluded that N. europaea is a denitrifier which, under conditions of oxygen stress, uses nitrite as a terminal electron acceptor and produces nitrous oxide

  2. Encyclopaedia Europaea

    DEFF Research Database (Denmark)

    Sørensen, Gert

    Identity is a keyword in a number of academic fields as well as in public debate and in politics. During the last decades, references to identity have proliferated, yet there is no simple definition available that corresponds to the use of the notion in all contexts. The significance of the notion...

  3. Activity-Based Protein Profiling of Ammonia Monooxygenase in Nitrosomonas europaea

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, Kristen; Sadler, Natalie C.; Wright, Aaron T.; Yeager, Chris; Hyman, Michael R.; Löffler, F. E.

    2016-01-29

    Nitrosomonas europaeais an aerobic nitrifying bacterium that oxidizes ammonia (NH3) to nitrite (NO2) through the sequential activities of ammonia monooxygenase (AMO) and hydroxylamine dehydrogenase (HAO). Many alkynes are mechanism-based inactivators of AMO, and here we describe an activity-based protein profiling method for this enzyme using 1,7-octadiyne (17OD) as a probe. Inactivation of NH4+-dependent O2uptake byN. europaeaby 17OD was time- and concentration-dependent. The effects of 17OD were specific for ammonia-oxidizing activity, andde novoprotein synthesis was required to reestablish this activity after cells were exposed to 17OD. Cells were reacted with Alexa Fluor 647 azide using a copper-catalyzed azide-alkyne cycloaddition (CuAAC) (click) reaction, solubilized, and analyzed by SDS-PAGE and infrared (IR) scanning. A fluorescent 28-kDa polypeptide was observed for cells previously exposed to 17OD but not for cells treated with either allylthiourea or acetylene prior to exposure to 17OD or for cells not previously exposed to 17OD. The fluorescent polypeptide was membrane associated and aggregated when heated with β-mercaptoethanol and SDS. The fluorescent polypeptide was also detected in cells pretreated with other diynes, but not in cells pretreated with structural homologs containing a single ethynyl functional group. The membrane fraction from 17OD-treated cells was conjugated with biotin-azide and solubilized in SDS. Streptavidin affinity-purified polypeptides were on-bead trypsin-digested, and amino acid sequences of the peptide fragments were determined by liquid chromatography-mass spectrometry (LC-MS) analysis. Peptide fragments from AmoA were the predominant peptides detected in 17OD-treated samples. In-gel digestion and

  4. La clinica parapsicologica

    Directory of Open Access Journals (Sweden)

    Evrard Renaud

    2007-09-01

    Full Text Available Gli ultimi due decenni hanno visto nascere una disciplina nuova: l'accoglienza e il sostegno psicologico delle persone che vivono esperienze eccezionali. Avere l'impressione di vivere in una casa abitata, testimoniare l’apparizione di OVNI, interrogarsi sulle possibilità di influenze telepatiche o anche conservare per sé la sensazione irreale di uscire “fuori dal corpo”, sono alcuni esempi di ciò che provano queste persone. L'eterogeneità di queste testimonianze le classifica spesso nella categoria delle "esperienze vissute come paranormali". Se tali resoconti sono sempre pervenuti agli esperti, si deve ai recenti lavori di ripristino dell'ascolto di queste persone.

  5. Profundization of acetabular cup uncemented in total substitution of hip in-patient with acetabular dysplasia - Experience university hospital - Clinica San Rafael

    International Nuclear Information System (INIS)

    Dimian Mayorga, Omar David; Sandoval Daza, Alejandro; Vargas Turriago, Marcela; Perez Torres, Javier

    2005-01-01

    14 patients with acetabular dysplasia were treated at Hospital Universitario Clinica San Rafael with total hip arthroplasty with uncemented cup internization. According to Crowe classification, one was type 1, eight were type 2 and five were type 3. The average follow up was twenty-four months. The Harris hip score was used for the clinical evaluation with a pre operative average of 35 points and 37 points post operative. The average cup internization was four millimeters, with an average cup protrutio of 47% and an average of cup coverage of 81%. The average internization of the femoral head's center was 26mm. screws for cup fixation were used in 3 patients. We did not have complications nor implant revision at the time of follow up

  6. Soil fluoride spiking effects on olive trees (Olea europaea L. cv. Chemlali).

    Science.gov (United States)

    Zouari, M; Ben Ahmed, C; Fourati, R; Delmail, D; Ben Rouina, B; Labrousse, P; Ben Abdallah, F

    2014-10-01

    A pot experiment under open air conditions was carried out to investigate the uptake, accumulation and toxicity effects of fluoride in olive trees (Olea europaea L.) grown in a soil spiked with inorganic sodium fluoride (NaF). Six different levels (0, 20, 40, 60, 80 and 100mM NaF) of soil spiking were applied through NaF to irrigation water. At the end of the experiment, total fluoride content in soil was 20 and 1770mgFkg(-1) soil in control and 100mM NaF treatments, respectively. The comparative distribution of fluoride partitioning among the different olive tree parts showed that the roots accumulated the most fluoride and olive fruits were minimally affected by soil NaF spiking as they had the lowest fluoride content. In fact, total fluoride concentration varied between 12 and 1070µgFg(-1) in roots, between 9 and 570µgFg(-1) in shoots, between 12 and 290µgFg(-1) in leaves, and between 10 and 29µgFg(-1) in fruits, respectively for control and 100mM NaF treatments. Indeed, the fluoride accumulation pattern showed the following distribution: roots>shoots>leaves>fruits. On the other hand, fluoride toxicity symptoms such as leaf necrosis and leaf drop appeared only in highly spiked soils (60, 80 and 100mM NaF). Copyright © 2014 Elsevier Inc. All rights reserved.

  7. In vitro propagation of olive (Olea europaea L.) by nodal segmentation of elongated shoots.

    Science.gov (United States)

    Lambardi, Maurizio; Ozudogru, Elif Aylin; Roncasaglia, Romano

    2013-01-01

    Olive (Olea europaea L.), long-living, ever-green fruit tree of the Old World, has been part of a traditional landscape in the Mediterranean area for centuries. Both the fruits consumed after processing and the oil extracted from the fruits are among the main components of the Mediterranean diet, widely used for salads and cooking, as well as for preserving other food. Documentations show that the ancient use of this beautiful tree also includes lamp fuel production, wool treatment, soap production, medicine, and cosmetics. However, unlike the majority of the fruit species, olive propagation is still a laborious practice. As regards traditional propagation, rooting of cuttings and grafting stem segments onto rootstocks are possible, former being achieved only when the cuttings are collected in specific periods (spring or beginning of autumn), and latter only when skilled grafters are available. In both the cases, performance of the cultivars varies considerably. The regeneration of whole plants from ovules, on the other hand, is used only occasionally. Micropropagation of olive is not easy mainly due to explant oxidation, difficulties in explant disinfection, and labor-oriented establishment of in vitro shoot cultures. However today, the progress in micropropagation technology has made available the complete protocols for several Mediterranean cultivars. This chapter describes a micropropagation protocol based on the segmentation of nodal segments obtained from elongated shoots.

  8. Characterisation of chlorophyll oxidation mediated by peroxidative activity in olives (Olea europaea L.) cv. Hojiblanca.

    Science.gov (United States)

    Vergara-Domínguez, Honorio; Roca, María; Gandul-Rojas, Beatriz

    2013-08-15

    The oxidation of chlorophyll a (chl a) catalysed by peroxidase (POD) from mesocarp of the olive fruit (Olea europaea L., cv Hojiblanca) in the presence of H2O2 and 2,4-dichlorophenol (2,4-DCP), is characterised via the individualised quantification of the products of the enzymatic reaction using a new methodology of HPLC-UV spectrometry. This innovation has allowed the discovery that, in addition to 13(2) OH chl a and 15(1) OH lactone chl a, which are the first products of POD on chl a, the reaction process sequentially creates another series of oxidised chlorophyll derivatives which have not been previously described. Their origins have been linked to POD activity in the presence of 2,4-DCP. Likewise, a study of the effect of the concentration of the various cosubstrates on the POD reaction rate demonstrated that the correct establishment of the relative concentrations of the same ([H2O2]/[2,4-DCP]/[Chl]=1:3:0.02) is crucial to explaining inhibition effects by substrates and carrying out optimum measurements. Therefore, new essential parameters for the determination of POD activity on a chlorophyll substrate are established. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. Identification and Characterization of the Iridoid Synthase Involved in Oleuropein Biosynthesis in Olive (Olea europaea) Fruits*

    Science.gov (United States)

    Kries, Hajo; Panara, Francesco; Baldoni, Luciana; O'Connor, Sarah E.; Osbourn, Anne

    2016-01-01

    The secoiridoids are the main class of specialized metabolites present in olive (Olea europaea L.) fruit. In particular, the secoiridoid oleuropein strongly influences olive oil quality because of its bitterness, which is a desirable trait. In addition, oleuropein possesses a wide range of pharmacological properties, including antioxidant, anti-inflammatory, and anti-cancer activities. In accordance, obtaining high oleuropein varieties is a main goal of molecular breeding programs. Here we use a transcriptomic approach to identify candidate genes belonging to the secoiridoid pathway in olive. From these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive fruits. OeISY, the first pathway gene characterized for this type of secoiridoid, is a potential target for breeding programs in a high value secoiridoid-accumulating species. PMID:26709230

  10. Genetic improvement of olive (Olea europaea L.) by conventional and in vitro biotechnology methods.

    Science.gov (United States)

    Rugini, E; Cristofori, V; Silvestri, C

    2016-01-01

    In olive (Olea europaea L.) traditional methods of genetic improvement have up to now produced limited results. Intensification of olive growing requires appropriate new cultivars for fully mechanized groves, but among the large number of the traditional varieties very few are suitable. High-density and super high-density hedge row orchards require genotypes with reduced size, reduced apical dominance, a semi-erect growth habit, easy to propagate, resistant to abiotic and biotic stresses, with reliably high productivity and quality of both fruits and oil. Innovative strategies supported by molecular and biotechnological techniques are required to speed up novel hybridisation methods. Among traditional approaches the Gene Pool Method seems a reasonable option, but it requires availability of widely diverse germplasm from both cultivated and wild genotypes, supported by a detailed knowledge of their genetic relationships. The practice of "gene therapy" for the most important existing cultivars, combined with conventional methods, could accelerate achievement of the main goals, but efforts to overcome some technical and ideological obstacles are needed. The present review describes the benefits that olive and its products may obtain from genetic improvement using state of the art of conventional and unconventional methods, and includes progress made in the field of in vitro techniques. The uses of both traditional and modern technologies are discussed with recommendations. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Observation of eight ancient olive trees (Olea europaea L.) growing in the Garden of Gethsemane.

    Science.gov (United States)

    Petruccelli, Raffaella; Giordano, Cristiana; Salvatici, Maria Cristina; Capozzoli, Laura; Ciaccheri, Leonardo; Pazzini, Massimo; Lain, Orietta; Testolin, Raffaele; Cimato, Antonio

    2014-05-01

    For thousands of years, olive trees (Olea europaea L.) have been a significant presence and a symbol in the Garden of Gethsemane, a place located at the foot of the Mount of Olives, Jerusalem, remembered for the agony of Jesus Christ before his arrest. This investigation comprises the first morphological and genetic characterization of eight olive trees in the Garden of Gethsemane. Pomological traits, morphometric, and ultrastructural observations as well as SSR (Simple Sequence Repeat) analysis were performed to identify the olive trees. Statistical analyses were conducted to evaluate their morphological variability. The study revealed a low morphological variability and minimal dissimilarity among the olive trees. According to molecular analysis, these trees showed the same allelic profile at all microsatellite loci analyzed. Combining the results of the different analyses carried out in the frame of the present work, we could conclude that the eight olive trees of the Gethsemane Garden have been propagated from a single genotype. Copyright © 2014. Published by Elsevier SAS.

  12. Characterization of antioxidant enzymes and peroxisomes of olive (Olea europaea L.) fruits.

    Science.gov (United States)

    Lopez-Huertas, Eduardo; del Río, Luis A

    2014-10-15

    The presence of peroxisomes in olive (Olea europaea L.) fruits and different antioxidant enzymes occurring in this plant tissue is reported for the first time. Ultrastructural analysis showed that olive cells were characterized by the presence of large vacuoles and lipid drops. Plastids, mitochondria and peroxisomes were placed near the cell wall, showing some type of association with it. Olive fruit peroxisomes were purified by sucrose density-gradient centrifugation, and catalase, glutathione reductase and ascorbate peroxidase were found in peroxisomes. In olive fruit tissue the presence of a battery of antioxidant enzymes was demonstrated, including catalase, four superoxide dismutase isozymes (mainly an Fe-SOD plus 2 Cu,Zn-SOD and a Mn-SOD), all the enzymes of the ascorbate-glutathione cycle, reduced and oxidized glutathione, ascorbate, and four NADPH-recycling dehydrogenases. The knowledge of the full composition of antioxidants (enzymatic and non-enzymatic) in olive fruits is crucial to be able to understand the processes regulating the antioxidant composition of olive oil. Copyright © 2014 Elsevier GmbH. All rights reserved.

  13. Identification and Characterization of the Iridoid Synthase Involved in Oleuropein Biosynthesis in Olive (Olea europaea) Fruits.

    Science.gov (United States)

    Alagna, Fiammetta; Geu-Flores, Fernando; Kries, Hajo; Panara, Francesco; Baldoni, Luciana; O'Connor, Sarah E; Osbourn, Anne

    2016-03-11

    The secoiridoids are the main class of specialized metabolites present in olive (Olea europaea L.) fruit. In particular, the secoiridoid oleuropein strongly influences olive oil quality because of its bitterness, which is a desirable trait. In addition, oleuropein possesses a wide range of pharmacological properties, including antioxidant, anti-inflammatory, and anti-cancer activities. In accordance, obtaining high oleuropein varieties is a main goal of molecular breeding programs. Here we use a transcriptomic approach to identify candidate genes belonging to the secoiridoid pathway in olive. From these candidates, we have functionally characterized the olive homologue of iridoid synthase (OeISY), an unusual terpene cyclase that couples an NAD (P)H-dependent 1,4-reduction step with a subsequent cyclization, and we provide evidence that OeISY likely generates the monoterpene scaffold of oleuropein in olive fruits. OeISY, the first pathway gene characterized for this type of secoiridoid, is a potential target for breeding programs in a high value secoiridoid-accumulating species. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. Chemical Composition and Water Permeability of Fruit and Leaf Cuticles of Olea europaea L.

    Science.gov (United States)

    Huang, Hua; Burghardt, Markus; Schuster, Ann-Christin; Leide, Jana; Lara, Isabel; Riederer, Markus

    2017-10-11

    The plant cuticle, protecting against uncontrolled water loss, covers olive (Olea europaea) fruits and leaves. The present study describes the organ-specific chemical composition of the cuticular waxes and the cutin and compares three developmental stages of fruits (green, turning, and black) with the leaf surface. Numerous organ-specific differences, such as the total coverage of cutin monomeric components (1034.4 μg cm -2 and 630.5 μg cm -2 ) and the cuticular waxes (201.6 μg cm -2 and 320.4 μg cm -2 ) among all three fruit stages and leaves, respectively, were detected. Water permeability as the main cuticular function was 5-fold lower in adaxial leaf cuticles (2.1 × 10 -5 m s -1 ) in comparison to all three fruit stages (9.5 × 10 -5 m s -1 ). The three fruit developmental stages have the same cuticular water permeability. It is hypothesized that a higher weighted average chain length of the acyclic cuticular components leads to a considerably lower permeability of the leaf as compared to the fruit cuticle.

  15. 454 Pyrosequencing of Olive (Olea europaea L.) Transcriptome in Response to Salinity.

    Science.gov (United States)

    Bazakos, Christos; Manioudaki, Maria E; Sarropoulou, Elena; Spano, Thodhoraq; Kalaitzis, Panagiotis

    2015-01-01

    Olive (Olea europaea L.) is one of the most important crops in the Mediterranean region. The expansion of cultivation in areas irrigated with low quality and saline water has negative effects on growth and productivity however the investigation of the molecular basis of salt tolerance in olive trees has been only recently initiated. To this end, we investigated the molecular response of cultivar Kalamon to salinity stress using next-generation sequencing technology to explore the transcriptome profile of olive leaves and roots and identify differentially expressed genes that are related to salt tolerance response. Out of 291,958 obtained trimmed reads, 28,270 unique transcripts were identified of which 35% are annotated, a percentage that is comparable to similar reports on non-model plants. Among the 1,624 clusters in roots that comprise more than one read, 24 were differentially expressed comprising 9 down- and 15 up-regulated genes. Respectively, inleaves, among the 2,642 clusters, 70 were identified as differentially expressed, with 14 down- and 56 up-regulated genes. Using next-generation sequencing technology we were able to identify salt-response-related transcripts. Furthermore we provide an annotated transcriptome of olive as well as expression data, which are both significant tools for further molecular studies in olive.

  16. The peculiar landscape of repetitive sequences in the olive (Olea europaea L.) genome.

    Science.gov (United States)

    Barghini, Elena; Natali, Lucia; Cossu, Rosa Maria; Giordani, Tommaso; Pindo, Massimo; Cattonaro, Federica; Scalabrin, Simone; Velasco, Riccardo; Morgante, Michele; Cavallini, Andrea

    2014-04-01

    Analyzing genome structure in different species allows to gain an insight into the evolution of plant genome size. Olive (Olea europaea L.) has a medium-sized haploid genome of 1.4 Gb, whose structure is largely uncharacterized, despite the growing importance of this tree as oil crop. Next-generation sequencing technologies and different computational procedures have been used to study the composition of the olive genome and its repetitive fraction. A total of 2.03 and 2.3 genome equivalents of Illumina and 454 reads from genomic DNA, respectively, were assembled following different procedures, which produced more than 200,000 differently redundant contigs, with mean length higher than 1,000 nt. Mapping Illumina reads onto the assembled sequences was used to estimate their redundancy. The genome data set was subdivided into highly and medium redundant and nonredundant contigs. By combining identification and mapping of repeated sequences, it was established that tandem repeats represent a very large portion of the olive genome (∼31% of the whole genome), consisting of six main families of different length, two of which were first discovered in these experiments. The other large redundant class in the olive genome is represented by transposable elements (especially long terminal repeat-retrotransposons). On the whole, the results of our analyses show the peculiar landscape of the olive genome, related to the massive amplification of tandem repeats, more than that reported for any other sequenced plant genome.

  17. Epicuticular Wax in Developing Olives (Olea europaea) Is Highly Dependent upon Cultivar and Fruit Ripeness.

    Science.gov (United States)

    Vichi, Stefania; Cortés-Francisco, Nuria; Caixach, Josep; Barrios, Gonçal; Mateu, Jordi; Ninot, Antonia; Romero, Agustí

    2016-08-03

    The epicuticular wax (EW) layer is located on the surface of most plant organs. It provides the cuticle with most of its properties and is the primary barrier against biotic and abiotic stress. Despite the importance of Olea europaea cultivation, few studies have characterized the EW covering leaves and olives, which could be involved in resistance to both infection and environmental conditions. In the present study, wide-ranging screening was carried out using direct-injection electrospray ionization coupled to high-resolution mass spectrometry to analyze EW in developing olives of nine varieties. The proportions of EW fractions [wax esters (WEs), diacylglycerols, triacylglycerols (TAGs), triterpenic acids, and aldehydes] strongly depended upon the olive cultivar and, in only a few cases, were influenced by the sampling date. The specific compositions of the major fractions, WEs and TAGs, were strictly related to the cultivar, while the degree of unsaturation and chain length of the WEs evolved throughout the 4 weeks prior to the olive turning color.

  18. Assessment of Olea europaea L. fruit extracts: Phytochemical characterization and anticancer pathway investigation.

    Science.gov (United States)

    Maalej, Amina; Bouallagui, Zouhaier; Hadrich, Fatma; Isoda, Hiroko; Sayadi, Sami

    2017-06-01

    Olea europaea L. has been widely used as an advantageous rich source of bioactive compounds of high economic value leading to its use in pharmaceutical, cosmetic, and agriculture industries. Ethanolic extracts of olive fruits from three different cultivars (OFE) were studied for their phytochemical contents and were investigated for antioxidant activities and anticancer potential. Major polyphenols detected in these extracts were tyrosol, hydroxytyrosol, oleuropein, rutin, quercetin and glucoside forms of luteolin and apigenin. All these compounds have shown to significantly contribute to the antioxidant activity of OFE, which was evaluated by DPPH and ABTS assays. Proliferation of hepatic and colon cancer cells, HepG2 and Caco-2, were shown to be sensitive to OFE with IC 50 less than 1.6mg/ml for all tested extracts. Moreover, flow cytometry analysis showed that OFE induced cell cycle arrest in the S-phase within both HepG2 and Caco-2 cells. This has triggered a cell death mechanism as shown by DNA fragmentation, expression of p53 and phosphorylation level of Akt and Erk proteins. Interestingly, these extracts could be further used as a potential source of natural compounds with both antioxidant and anticancer effects. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  19. Volatile constituents of commercial imported and domestic black-ripe table olives (Olea europaea).

    Science.gov (United States)

    Sansone-Land, Angelina; Takeoka, Gary R; Shoemaker, Charles F

    2014-04-15

    Volatile constituents of commercial black-ripe table olives (Olea europaea) from the United States, Spain, Egypt and Morocco were analysed by gas chromatography and gas chromatography-mass spectrometry (GC-MS). Dynamic headspace sampling was used to isolate a variety of aldehydes, alcohols, esters, ketones, phenols, terpenes, norisoprenoids, and pyridines. Odour unit values, calculated from concentration and odour threshold data, indicate that the following compounds are major contributors to black-ripe table olive aroma: β-damascenone, nonanal, (E)-dec-2-enal, 3-methylbutanal, ethyl benzoate, octanal, 2-methoxyphenol, 2-methylbutanal and 2-methoxy-4-methylphenol. Imported olives contained a variety of fermentation derived volatiles that were not detected in domestic olives. Constituents such as ethyl 2-methylbutanoate, ethyl 3-methylbutanoate, 3-methylbutyl acetate, oct-1-en-3-one, ethyl hexanoate, (Z)-hex-3-enyl acetate, hexyl acetate, ethyl cyclohexanecarboxylate, benzyl acetate and 4-ethylphenol contributed to the odour of imported olives but were not detected in domestic olives. Published by Elsevier Ltd.

  20. High-throughput sequencing of RNA silencing-associated small RNAs in olive (Olea europaea L..

    Directory of Open Access Journals (Sweden)

    Livia Donaire

    Full Text Available Small RNAs (sRNAs of 20 to 25 nucleotides (nt in length maintain genome integrity and control gene expression in a multitude of developmental and physiological processes. Despite RNA silencing has been primarily studied in model plants, the advent of high-throughput sequencing technologies has enabled profiling of the sRNA component of more than 40 plant species. Here, we used deep sequencing and molecular methods to report the first inventory of sRNAs in olive (Olea europaea L.. sRNA libraries prepared from juvenile and adult shoots revealed that the 24-nt class dominates the sRNA transcriptome and atypically accumulates to levels never seen in other plant species, suggesting an active role of heterochromatin silencing in the maintenance and integrity of its large genome. A total of 18 known miRNA families were identified in the libraries. Also, 5 other sRNAs derived from potential hairpin-like precursors remain as plausible miRNA candidates. RNA blots confirmed miRNA expression and suggested tissue- and/or developmental-specific expression patterns. Target mRNAs of conserved miRNAs were computationally predicted among the olive cDNA collection and experimentally validated through endonucleolytic cleavage assays. Finally, we use expression data to uncover genetic components of the miR156, miR172 and miR390/TAS3-derived trans-acting small interfering RNA (tasiRNA regulatory nodes, suggesting that these interactive networks controlling developmental transitions are fully operational in olive.

  1. Identification and characterisation of Short Interspersed Nuclear Elements in the olive tree (Olea europaea L.) genome.

    Science.gov (United States)

    Barghini, Elena; Mascagni, Flavia; Natali, Lucia; Giordani, Tommaso; Cavallini, Andrea

    2017-02-01

    Short Interspersed Nuclear Elements (SINEs) are nonautonomous retrotransposons in the genome of most eukaryotic species. While SINEs have been intensively investigated in humans and other animal systems, SINE identification has been carried out only in a limited number of plant species. This lack of information is apparent especially in non-model plants whose genome has not been sequenced yet. The aim of this work was to produce a specific bioinformatics pipeline for analysing second generation sequence reads of a non-model species and identifying SINEs. We have identified, for the first time, 227 putative SINEs of the olive tree (Olea europaea), that constitute one of the few sets of such sequences in dicotyledonous species. The identified SINEs ranged from 140 to 362 bp in length and were characterised with regard to the occurrence of the tRNA domain in their sequence. The majority of identified elements resulted in single copy or very lowly repeated, often in association with genic sequences. Analysis of sequence similarity allowed us to identify two major groups of SINEs showing different abundances in the olive tree genome, the former with sequence similarity to SINEs of Scrophulariaceae and Solanaceae and the latter to SINEs of Salicaceae. A comparison of sequence conservation between olive SINEs and LTR retrotransposon families suggested that SINE expansion in the genome occurred especially in very ancient times, before LTR retrotransposon expansion, and presumably before the separation of the rosids (to which Oleaceae belong) from the Asterids. Besides providing data on olive SINEs, our results demonstrate the suitability of the pipeline employed for SINE identification. Applying this pipeline will favour further structural and functional analyses on these relatively unknown elements to be performed also in other plant species, even in the absence of a reference genome, and will allow establishing general evolutionary patterns for this kind of repeats in

  2. Profiling and functional classification of esterases in olive (Olea europaea) pollen during germination.

    Science.gov (United States)

    Rejón, Juan D; Zienkiewicz, Agnieszka; Rodríguez-García, María Isabel; Castro, Antonio J

    2012-10-01

    A pollen grain contains a number of esterases, many of which are released upon contact with the stigma surface. However, the identity and function of most of these esterases remain unknown. In this work, esterases from olive pollen during its germination were identifided and functionally characterized. The esterolytic capacity of olive (Olea europaea) pollen was examined using in vitro and in-gel enzymatic assays with different enzyme substrates. The functional analysis of pollen esterases was achieved by inhibition assays by using specific inhibitors. The cellular localization of esterase activities was performed using histochemical methods. Olive pollen showed high levels of non-specific esterase activity, which remained steady after hydration and germination. Up to 20 esterolytic bands were identified on polyacrylamide gels. All the inhibitors decreased pollen germinability, but only diisopropyl fluorophosphate (DIFP) hampered pollen tube growth. Non-specific esterase activity is localized on the surface of oil bodies (OBs) and small vesicles, in the pollen intine and in the callose layer of the pollen tube wall. Acetylcholinesterase (AChE) activity was mostly observed in the apertures, exine and pollen coat, and attached to the pollen tube wall surface and to small cytoplasmic vesicles. In this work, for the first time a systematic functional characterization of esterase enzymes in pollen from a plant species with wet stigma has been carried out. Olive pollen esterases belong to four different functional groups: carboxylesterases, acetylesterases, AChEs and lipases. The cellular localization of esterase activity indicates that the intine is a putative storage site for esterolytic enzymes in olive pollen. Based on inhibition assays and cellular localization of enzymatic activities, it can be concluded that these enzymes are likely to be involved in pollen germination, and pollen tube growth and penetration of the stigma.

  3. Influence of Soil Based Growing Media on Vegetative Propagation of Selected Cultivars of Olea Europaea

    International Nuclear Information System (INIS)

    Ahmed, M. I.; Ashraf, M. I.; Malik, S. U.; Husaain, Q.

    2016-01-01

    Pothwar region of Pakistan is a natural habitat of Olea spp. There is a high demand of certified olive plants to establish olive orchids in the region, because native wild species are non-fruit bearing. Plants of certified fruit bearing olive (Olea europaea L.) cultivars are rarely available. Vegetative propagation of olive is highly responsive to texture of soil based growing media. This study examined the effect of growing media composition (soil texture and nutrients) on vegetative propagation of five cultivars of olive. The experiment was carried out in randomized complete block design (RCBD) with two factors factorial having 25 repeats of each four treatments. Plant growth and survival data were collected and analyzed for the influence of soil attributes. In sandy loam soil, cv. Bari-1 had 82 percent plant survival, highest number of roots per plant (3.5), and longest root length (13.01 cm). Highest number of shoots per plant (4.25) and maximum shoot length (15.64 cm) were also recorded for Bari-1 with sandy loam growing media. Silt loam soil is least suitable growing media for vegetative propagation of olive. In the silt loam soil, plants survival rate was 59 percent for cv. Gemlik, number of roots per plant was 1.5 for cv. Ottobrattica, minimum root length 5.65 cm, minimum number of shoots per plant one, and minimum shoot length 7.42 cm were recorded for cv. Pendolino with silt loam soil. Results suggested that sandy loam growing media is better than the others for vegetative propagation of olive. Cultivar Bari-1 performed better than the others examined in this study by indicating highest (1) survival percentage, (2) root and shoot length, and (3) number of roots and shoots produced within a specific period of time. (author)

  4. Metabarcoding Analysis of Fungal Diversity in the Phyllosphere and Carposphere of Olive (Olea europaea).

    Science.gov (United States)

    Abdelfattah, Ahmed; Li Destri Nicosia, Maria Giulia; Cacciola, Santa Olga; Droby, Samir; Schena, Leonardo

    2015-01-01

    The fungal diversity associated with leaves, flowers and fruits of olive (Olea europaea) was investigated in different phenological stages (May, June, October and December) using an implemented metabarcoding approach. It consisted of the 454 pyrosequencing of the fungal ITS2 region and the subsequent phylogenetic analysis of relevant genera along with validated reference sequences. Most sequences were identified up to the species level or were associated with a restricted number of related taxa enabling supported speculations regarding their biological role. Analyses revealed a rich fungal community with 195 different OTUs. Ascomycota was the dominating phyla representing 93.6% of the total number of detected sequences followed by unidentified fungi (3.6%) and Basidiomycota (2.8%). A higher level of diversity was revealed for leaves compared to flowers and fruits. Among plant pathogens the genus Colletotrichum represented by three species (C. godetiae syn. C. clavatum, C. acutatum s.s and C. karstii) was the most abundant on ripe fruits but it was also detected in other organs. Pseudocercospora cladosporioides was detected with a high frequency in all leaf samples and to a less extent in ripe fruits. A much lower relative frequency was revealed for Spilocaea oleagina and for other putative pathogens including Fusarium spp., Neofusicoccum spp., and Alternaria spp. Among non-pathogen taxa, Aureobasidium pullulans, the species complex of Cladosporium cladosporioides and Devriesia spp. were the most represented. This study highlights the existence of a complex fungal consortium including both phytopathogenic and potentially antagonistic microorganisms that can have a significant impact on olive productions.

  5. Mannitol transport and mannitol dehydrogenase activities are coordinated in Olea europaea under salt and osmotic stresses.

    Science.gov (United States)

    Conde, Artur; Silva, Paulo; Agasse, Alice; Conde, Carlos; Gerós, Hernâni

    2011-10-01

    The intracellular accumulation of organic compatible solutes functioning as osmoprotectants, such as polyols, is an important response mechanism of several plants to drought and salinity. In Olea europaea a mannitol transport system (OeMaT1) was previously characterized as a key player in plant response to salinity. In the present study, heterotrophic sink models, such as olive cell suspensions and fruit tissues, and source leaves were used for analytical, biochemical and molecular studies. The kinetic parameters of mannitol dehydrogenase (MTD) determined in cells growing in mannitol, at 25°C and pH 9.0, were as follows: K(m), 54.5 mM mannitol; and V(max), 0.47 μmol h⁻¹ mg⁻¹ protein. The corresponding cDNA was cloned and named OeMTD1. OeMTD1 expression was correlated with MTD activity, OeMaT1 expression and carrier-mediated mannitol transport in mannitol- and sucrose-grown cells. Furthermore, sucrose-grown cells displayed only residual OeMTD activity, even though high levels of OeMTD1 transcription were observed. There is evidence that OeMTD is regulated at both transcriptional and post-transcriptional levels. MTD activity and OeMTD1 expression were repressed after Na+, K+ and polyethylene glycol (PEG) treatments, in both mannitol- and sucrose-grown cells. In contrast, salt and drought significantly increased mannitol transport activity and OeMaT1 expression. Taken together, these studies support that olive trees cope with salinity and drought by coordinating mannitol transport with intracellular metabolism.

  6. The skeletal organic matrix from Mediterranean coral Balanophyllia europaea influences calcium carbonate precipitation.

    Science.gov (United States)

    Goffredo, Stefano; Vergni, Patrizia; Reggi, Michela; Caroselli, Erik; Sparla, Francesca; Levy, Oren; Dubinsky, Zvy; Falini, Giuseppe

    2011-01-01

    Scleractinian coral skeletons are made mainly of calcium carbonate in the form of aragonite. The mineral deposition occurs in a biological confined environment, but it is still a theme of discussion to what extent the calcification occurs under biological or environmental control. Hence, the shape, size and organization of skeletal crystals from the cellular level through the colony architecture, were attributed to factors as diverse as mineral supersaturation levels and organic mediation of crystal growth. The skeleton contains an intra-skeletal organic matrix (OM) of which only the water soluble component was chemically and physically characterized. In this work that OM from the skeleton of the Balanophyllia europaea, a solitary scleractinian coral endemic to the Mediterranean Sea, is studied in vitro with the aim of understanding its role in the mineralization of calcium carbonate. Mineralization of calcium carbonate was conducted by overgrowth experiments on coral skeleton and in calcium chloride solutions containing different ratios of water soluble and/or insoluble OM and of magnesium ions. The precipitates were characterized by diffractometric, spectroscopic and microscopic techniques. The results showed that both soluble and insoluble OM components influence calcium carbonate precipitation and that the effect is enhanced by their co-presence. The role of magnesium ions is also affected by the presence of the OM components. Thus, in vitro, OM influences calcium carbonate crystal morphology, aggregation and polymorphism as a function of its composition and of the content of magnesium ions in the precipitation media. This research, although does not resolve the controversy between environmental or biological control on the deposition of calcium carbonate in corals, sheds a light on the role of OM, which appears mediated by the presence of magnesium ions.

  7. The Skeletal Organic Matrix from Mediterranean Coral Balanophyllia europaea Influences Calcium Carbonate Precipitation

    Science.gov (United States)

    Goffredo, Stefano; Vergni, Patrizia; Reggi, Michela; Caroselli, Erik; Sparla, Francesca; Levy, Oren; Dubinsky, Zvy; Falini, Giuseppe

    2011-01-01

    Scleractinian coral skeletons are made mainly of calcium carbonate in the form of aragonite. The mineral deposition occurs in a biological confined environment, but it is still a theme of discussion to what extent the calcification occurs under biological or environmental control. Hence, the shape, size and organization of skeletal crystals from the cellular level through the colony architecture, were attributed to factors as diverse as mineral supersaturation levels and organic mediation of crystal growth. The skeleton contains an intra-skeletal organic matrix (OM) of which only the water soluble component was chemically and physically characterized. In this work that OM from the skeleton of the Balanophyllia europaea, a solitary scleractinian coral endemic to the Mediterranean Sea, is studied in vitro with the aim of understanding its role in the mineralization of calcium carbonate. Mineralization of calcium carbonate was conducted by overgrowth experiments on coral skeleton and in calcium chloride solutions containing different ratios of water soluble and/or insoluble OM and of magnesium ions. The precipitates were characterized by diffractometric, spectroscopic and microscopic techniques. The results showed that both soluble and insoluble OM components influence calcium carbonate precipitation and that the effect is enhanced by their co-presence. The role of magnesium ions is also affected by the presence of the OM components. Thus, in vitro, OM influences calcium carbonate crystal morphology, aggregation and polymorphism as a function of its composition and of the content of magnesium ions in the precipitation media. This research, although does not resolve the controversy between environmental or biological control on the deposition of calcium carbonate in corals, sheds a light on the role of OM, which appears mediated by the presence of magnesium ions. PMID:21799830

  8. Isolation of antioxidative secoiridoids from olive wood (Olea europaea L.) guided by on-line HPLC-DAD-radical scavenging detection

    NARCIS (Netherlands)

    Pérez-Bonilla, M.; Salido, S.; Beek, van T.A.; Waard, de P.; Linares-Palomino, P.J.; Sánchez, A.; Altarejos, J.

    2011-01-01

    The woody portion of olive tree pruning is a source of natural antioxidants of potential interest for the food industry. This work deals with the isolation and identification of further antioxidants present in an ethyl acetate extract of olive (Olea europaea L.) wood. Thus, a new secoiridoid,

  9. Salt stress induces differential regulation of the phenylpropanoid pathway in Olea europaea cultivars Frantoio (salt-tolerant) and Leccino (salt-sensitive)

    NARCIS (Netherlands)

    Rossi, Lorenzo; Borghi, Monica; Francini, Alessandra; Lin, Xiuli; Xie, De Yu; Sebastiani, Luca

    2016-01-01

    Olive tree (Olea europaea L.) is an important crop in the Mediterranean Basin where drought and salinity are two of the main factors affecting plant productivity. Despite several studies have reported different responses of various olive tree cultivars to salt stress, the mechanisms that convey

  10. Crystallization and preliminary X-ray crystallographic analysis of a new crystal form of hydroxylamine oxidoreductase from Nitrosomonas europaea

    International Nuclear Information System (INIS)

    Cedervall, Peder E.; Hooper, Alan B.; Wilmot, Carrie M.

    2009-01-01

    A new crystal form of N. europaea hydroxylamine oxidoreductase (space group P2 1 2 1 2) diffracted to 2.25 Å resolution at a third-generation synchrotron X-ray source. Hydroxylamine oxidoreductase (HAO) from Nitrosomonas europaea is a homotrimeric protein that catalyzes the oxidation of hydroxylamine to nitrite. Each monomer, with a molecular weight of 67.1 kDa, contains seven c-type hemes and one heme P460, the porphyrin ring of which is covalently linked to a tyrosine residue from an adjacent subunit. HAO was first crystallized and structurally characterized at a resolution of 2.8 Å in 1997. The structure was solved in space group P6 3 and suffered from merohedral twinning. Here, a crystallization procedure is presented that yielded untwinned crystals belonging to space group P2 1 2 1 2, which diffracted to 2.25 Å resolution and contained one trimer in the asymmetric unit. The unit-cell parameters were a = 140.7, b = 142.6, c = 107.4 Å

  11. Comparative and evaluation of anti-leech (Limnatis Nilotica effect of Olive (Olea Europaea L. with Levamisol and Tiabendazole

    Directory of Open Access Journals (Sweden)

    Majid Gholami-Ahangaran

    2012-05-01

    Full Text Available Objective: Until now, there is no registered drug for treatment of complications with leech in the world. According to the available scientific evidence, Olive is an effective anti-parasitic plant. Hence, in the present experiment we studied the inhibitory and killing effect of Olive methanolic extract on Limnatis nilotica. Methods: In this study, 100 leeches (Limnatis nilotica were collected from some wells in western area of Iran (south region in Ilam province and evaluated the antileech effects of Olive methanolic extract (Olea europaea L. in comparison with levamisole and tinidazole. Results: The results indicated no effect of tinidasole and distilled water on killing or mortality rate of the leeches but Olea europaea L. plant and levamisole have more effect on the L. nilotica. The mean death time of leech for levamisole and Olive determined 10依0.98 and 210依 24.1 minutes, respectively. Conclusions: The results showed that treatments of Olive methanolic extract and levamisole have the most effects on leeches and could be used as natural anti-L. nilotica. However it is necessary to achieve further studies for confirm of this subject.

  12. Antimicrobial activity of Olea europaea Linné extracts and their applicability as natural food preservative agents.

    Science.gov (United States)

    Thielmann, J; Kohnen, S; Hauser, C

    2017-06-19

    The antimicrobial activity of phenolic compounds from Olea (O.) europaea Linné (L.) is part of the scientific discussion regarding the use of natural plant extracts as alternative food preservative agents. Although, the basic knowledge on the antimicrobial potential of certain molecules such as oleuropein, hydroxytyrosol or elenolic acid derivatives is given, there is still little information regarding their applicability for food preservation. This might be primarily due to the lack of information regarding the full antimicrobial spectrum of the compounds, their synergisms in natural or artificial combinations and their interaction with food ingredients. The present review accumulates available literature from the past 40 years, investigating the antimicrobial activity of O. europaea L. derived extracts and compounds in vitro and in food matrices, in order to evaluate their food applicability. In summary, defined extracts from olive fruit or leaves, containing the strongest antimicrobial compounds hydroxytyrosol, oleacein or oleacanthal in considerable concentrations, appear to be suitable for food preservation. Nonetheless there is still need for consequent research on the compounds activity in food matrices, their effect on the natural microbiota of certain foods and their influence on the sensorial properties of the targeted products. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. H(+) -pyrophosphatase from Salicornia europaea confers tolerance to simultaneously occurring salt stress and nitrogen deficiency in Arabidopsis and wheat.

    Science.gov (United States)

    Lv, Sulian; Jiang, Ping; Nie, Lingling; Chen, Xianyang; Tai, Fang; Wang, Duoliya; Fan, Pengxiang; Feng, Juanjuan; Bao, Hexigeduleng; Wang, Jinhui; Li, Yinxin

    2015-11-01

    High salinity and nitrogen (N) deficiency in soil are two key factors limiting crop productivity, and they usually occur simultaneously. Here we firstly found that H(+) -PPase is involved in salt-stimulated NO3 (-) uptake in the euhalophyte Salicornia europaea. Then, two genes (named SeVP1 and SeVP2) encoding H(+) -PPase from S. europaea were characterized. The expression of SeVP1 and SeVP2 was induced by salt stress and N starvation. Both SeVP1 or SeVP2 transgenic Arabidopsis and wheat plants outperformed the wild types (WTs) when high salt and low N occur simultaneously. The transgenic Arabidopsis plants maintained higher K(+) /Na(+) ratio in leaves and exhibited increased NO3 (-) uptake, inorganic pyrophosphate-dependent vacuolar nitrate efflux and assimilation capacity under this double stresses. Furthermore, they had more soluble sugars in shoots and roots and less starch accumulation in shoots than WT. These performances can be explained by the up-regulated expression of ion, nitrate and sugar transporter genes in transgenic plants. Taken together, our results suggest that up-regulation of H(+) -PPase favours the transport of photosynthates to root, which could promote root growth and integrate N and carbon metabolism in plant. This work provides potential strategies for improving crop yields challenged by increasing soil salinization and shrinking farmland. © 2015 John Wiley & Sons Ltd.

  14. Growth modelling of Nitrosomonas europaea ATCC® 19718 and Nitrobacter winogradskyi ATCC® 25391: A new online indicator of the partial nitrification.

    Science.gov (United States)

    Cruvellier, Nelly; Poughon, Laurent; Creuly, Catherine; Dussap, C-Gilles; Lasseur, Christophe

    2016-11-01

    The aim of the present work was to study the growth of two nitrifying bacteria. For modelling the nitrifying subsystem of the MELiSSA loop, Nitrosomonas europaea ATCC® 19718 and Nitrobacter winogradskyi ATCC® 25931 were grown separately and in cocultures. The kinetic parameters of a stoichiometric mass balanced Pirt model were identified: μmax=0.054h(-1), decay rate b=0.003h(-1) and maintenance rate m=0.135gN-NH4(+)·gX(-1)·h(-1) for Nitrosomonas europaea; μmax=0.024h(-1), b=0.001h(-1) and m=0.467gN-NO2(-)·gX(-1)·h(-1) for Nitrobacter winogradskyi. A predictive structured model of nitrification in co-culture was developed. The online evolution of the addition of KOH is correlated to the nitritation; the dissolved oxygen concentration is correlated to both nitritation and nitratation. The model suitably represents these two variables so that transient partial nitrification is assessed. This is a clue for avoiding partial nitrification by predictive functional control. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Olea europaea L. in the North Mediterranean Basin during the Pleniglacial and the Early-Middle Holocene

    Science.gov (United States)

    Carrión, Yolanda; Ntinou, Maria; Badal, Ernestina

    2010-04-01

    The paper aims to define the natural distribution of Olea europaea L. var. sylvestris (Miller) Lehr. in the North Mediterranean basin during the Pleniglacial and the Early-Middle Holocene by means of the identification of its wood-charcoal and/or wood at prehistoric sites. For this purpose we have reviewed the previously available information and we have combined it with new wood-charcoal analyses data. We have taken under consideration the presence and frequency of O. europaea L. in the available wood-charcoal sequences, the characteristics of the accompanying flora, the associated chrono-cultural contexts, the broader biogeographical context and the AMS dates provided by Olea wood-charcoal or endocarps. According to the available evidence, during the Middle and Late Pleniglacial (ca 59-11.5 ka cal. BP), Olea would have persisted in thermophilous refugia located in the southern areas of the North Mediterranean basin, the southern Levant and the north of Africa. The Last Glacial Maximum (ca 22-18 ka cal. BP) probably reduced the distribution area of Olea. During the Preboreal and the Boreal (ca 11 500-8800 cal. BP) the species started to expand in the thermomediterranean bioclimatic level. In the western Mediterranean, during the Atlantic period (ca 8800-5600 cal. BP), the species became very abundant or dominant in the thermophilous plant formations and expanded to favorable enclaves outside the limits of the thermomediterranean level.

  16. Phytochemical properties and anti-proliferative activity of Olea europaea L. leaf extracts against pancreatic cancer cells.

    Science.gov (United States)

    Goldsmith, Chloe D; Vuong, Quan V; Sadeqzadeh, Elham; Stathopoulos, Costas E; Roach, Paul D; Scarlett, Christopher J

    2015-07-17

    Olea europaea L. leaves are an agricultural waste product with a high concentration of phenolic compounds; especially oleuropein. Oleuropein has been shown to exhibit anti-proliferative activity against a number of cancer types. However, they have not been tested against pancreatic cancer, the fifth leading cause of cancer related death in Western countries. Therefore, water, 50% ethanol and 50% methanol extracts of Corregiola and Frantoio variety Olea europaea L. leaves were investigated for their total phenolic compounds, total flavonoids and oleuropein content, antioxidant capacity and anti-proliferative activity against MiaPaCa-2 pancreatic cancer cells. The extracts only had slight differences in their phytochemical properties, and at 100 and 200 μg/mL, all decreased the viability of the pancreatic cancer cells relative to controls. At 50 μg/mL, the water extract from the Corregiola leaves exhibited the highest anti-proliferative activity with the effect possibly due to early eluting HPLC peaks. For this reason, olive leaf extracts warrant further investigation into their potential anti-pancreatic cancer benefits.

  17. Clinical Photoscintillography: Technique and Applications; Photoscintigraphie Clinique: Methode et Applications; Klinicheskaya fotostsintillografiya: metodika i primenenie; Fotocentelleografia Clinica: Tecnicas y Aplicaciones

    Energy Technology Data Exchange (ETDEWEB)

    Ephraim, K. H. [Rotterdamsch Radio-Therapeutisch Instituut, Rotterdam (Netherlands)

    1964-10-15

    ' de exploracion. La intensidad luminosa y la frecuencia de los destellos de esta ultima varian con el indice de recuento, obteniendose asi una respuesta no lineal sin introducir la inercia de un circuito integrador. Los destellos 'secundarios' se registran sobre pelicula. Para impedir la perdida de datos debido a su registro en la region de saturacion de la curva de sensibilidad de la pe licu la, se utiliza una amplificacion de contraste moderada y la pelicula se examina en un circuito de television industrial. El autor subraya la necesidad de adaptar las condiciones de colimacion al problema clinico que haya de resolverse. En la memoria se examinan las aplicaciones clinicas de esta tecnica al estudio de enfermedades tiroideas, renales, hepaticas y oseas. (author) [Russian] Pri primenenii fotoscintillografii v klinike ogromnoe znachenie imejut kollimacija, u si l e nie kontrastnosti i nakoplenie dannyh. Dlja obnaruzhenija ogranichennyh uchastkov porazhenija v takih plotnyh organah, kak pechen' i mozg , byl razrabotan special'nyj 36-kanal'nyj mnogofokusnyj kollimator. Demonstrirujutsja izochuvstvitel'nye linii jet o go kollimator a . E go chuv stvitel'nost' malo m en ja et sja ot poverhnosti do glubiny, ravnoj naibol'shej tolshhine pecheni. Byl postr oen special'nyj usilitel' kontrastnosti: nebol'shaja ''pervichnaja'' lampa nakalivanija, soedinennaja cherez impul'snyj usilitel' na vyhode odnokanal'nogo an a l i za t or a upravlja etsja s pomoshh'ju za vi sim o go ot svetareostata (ZSR). Soprotovlenie 3 SR izmenja etsja v zavisimosti ot sk or o sti . Posledovatel'no po otnosheniju k ZSR s o edinena skennirujushhaja ''vtorichnaja'' lampa nakalivanija. Jarkost', a takzhe chastota vspyshek poslednej zavisit ot skorosti scheta i tem samym nelinejnaja chuvstviteltnost' dostigaetsja b e z vvedenija inercionnogo k on tura. ''Vtorichnye'' vspyshki re gi str i rujut sja na p lenk e. S cel'ju predotvrashhenija poteri informacii pri registracii v oblasti nasyshhenija krivoj chuv

  18. [The scientific progress of the "Clinica del Lavoro Luigi Devoto" as seen through the contents of the journal "La Medicina del Lavoro". ].

    Science.gov (United States)

    Foà, V; Camerino, Donatella

    2003-01-01

    On occasion of the Centenary of the "Clinica del Lavoro Luigi Devoto", its researchers suggested that awareness of its historical identity and scientific development should constitute the basis for the future of the Institution. The directors of the Institute who have succeeded one to the other over the years have left a vivid report of the vast amount of work developed in several research fields and also of the original results achieved with significant impact on the scientific community and on society. Content analysis of "La Medicina del Lavoro" allowed us to shed light on strong bonds existing between manufacturing techniques, work organization and health, in the different political and social periods in which they developed. Many actions have been defined and several research subjects have been renewed (according to current demands and new methodological possibilities) between the past and the present, nevertheless many new approaches need to be taken in the fields of epidemiology, indoor air quality, ergophthalmology, muskuloskeletal disorders, environmental and molecular toxicology, and further research will be undertaken thanks to the potential of this discipline for the future. The aim of this report is also to express our thanks to all the medical and non-medical staff who have made their contribution over 100 years of engagement.

  19. Synthesis of deuterium-labelled substrates for the study of oleuropein biosynthesis in Olea europaea callus cultures.

    Science.gov (United States)

    Serrilli, Anna Maria; Maggi, Agnese; Casagrande, Valentina; Bianco, Armandodoriano

    2016-01-01

    We propose the cell culture approach to investigate oleuropein (1) biogenesis in Olea europaea L. We suggest employing olive callus cultures to identify the iridoidic precursor of oleuropein. In fact, we confirmed that callus cells from olive shoot explants are able to produce key secoiridoid as 1. To enable this approach, we synthesised and characterised deuterium-labelled iridoidic precursors belonging both to the loganin and the 8-epiloganin series. These iridoids are [7,8-(2)H2]-7-deoxy-8-epi-loganin (2(D)), [8,10-(2)H2]-8-epi-loganin (4(D)) and [7,8-(2)H2]-7-deoxy-loganin (3(D)).

  20. Selective ultrasound-enhanced enzymatic hydrolysis of oleuropein to its aglycon in olive (Olea europaea L.) leaf extracts.

    Science.gov (United States)

    Delgado-Povedano, María Del Mar; Priego-Capote, Feliciano; Luque de Castro, María Dolores

    2017-04-01

    Hydrolysis of oleuropein, the main phenol in olive (Olea europaea L.) leaf extracts, to oleuropein aglycon and other subsequent products in the hydrolytic pathway can be catalyzed by different enzymes. Three of the most used hydrolases were assayed to catalyze the process, and β-glucosidase from Aspergillus niger was selected. Acceleration of the enzymatic hydrolysis by ultrasound (US) was studied using a Box-Behnken design (duty cycle, amplitude, cycle time) and an oleuropein standard, and the optimum US conditions for achieving maximum yield of oleuropein aglycon were 0.5s/s duty cycle, 50% amplitude and 45s cycle. The method was applied to obtain oleuropein aglycon from commercial and laboratory extracts from olive leaves, which may have a pharmacological use as deduced by its healthy properties. The kinetics of the US-assisted enzymatic hydrolysis was monitored by analysis of the target compounds using liquid chromatography-tandem mass spectrometry. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Antioxidant activity and chemical components as potential anticancer agents in the olive leaf (Olea europaea L. cv Leccino.) decoction.

    Science.gov (United States)

    De Marino, Simona; Festa, Carmen; Zollo, Franco; Nini, Antonella; Antenucci, Lina; Raimo, Gennaro; Iorizzi, Maria

    2014-01-01

    Epidemiological studies have shown that a reduced risk of chronic diseases such as cancer and cardiovascular diseases is correlated with a regular consumption of fruits and vegetable, many of which are rich in polyphenols. The additive and synergistic effect of phytochemicals in fruits and vegetables may reduce chronic diseases related to oxidative stress in human body. Olea europaea L. leaf are rich in phenolic components, which have been proposed to play a role in cancer prevention. The purpose of this study was to identify the main components in the Olea europaea L. leaf (cv. Leccino) preserved during the decoction preparation, in order to delineate the antioxidant activities of the crude extracts and its isolated compounds by using different in vitro assays including DPPH radicalscavenging capacity, total antioxidant capacity (TAC), xanthine oxidase (XO) inhibitory effect and the ability to delay the linoleic acid peroxidation process (ALP). The aqueous decoction was partitioned obtaining four extracts and the n-butanol extract showed the highest antioxidant activity and the highest total phenolic content. Phytochemical investigation leads to the isolation of thirteen secondary metabolites including simple phenolics, flavonoids, secoiridoids whose structures were elucidated by spectroscopic data (1D and 2D NMR) and spectrometric techniques. A significant free radical scavenging effect against DPPH has been evidenced in fraxamoside (1) (EC50 62.6 µM) and taxifolin (5) (EC50 50.0 µM), isolated for the first time from the water decoction. The most active compound in the TAC evaluation, was the 3,4 dihydro-phenyl glycol (8) (0.90 caffeic acid equiv.) while taxifolin and fraxamoside resulted as the most efficient inhibitors of XO activity (IC50 2.7 and 5.2 µM, respectively). Secoxyloganin (4), oleuropein (2) and tyrosol (6) showed the highest ALP activity. This study adds to the growing body of data supporting the bioactivities of phytochemicals and their

  2. The role of temperature in the onset of the Olea europaea L. pollen season in southwestern Spain

    Science.gov (United States)

    Galán, C.; García-Mozo, H.; Cariñanos, P.; Alcázar, P.; Domínguez-Vilches, E.

    Temperature is one of the main factors affecting the flowering of Mediterranean trees. In the case of Olea europaea L., a low-temperature period prior to bud development is essential to interrupt dormancy. After that, and once a base temperature is reached, the plant accumulates heat until flowering starts. Different methods of obtaining the best-forecast model for the onset date of the O. europaea pollen season, using temperature as the predictive parameter, are proposed in this paper. An 18-year pollen and climatic data series (1982-1999) from Cordoba (Spain) was used to perform the study. First a multiple-regression analysis using 15-day average temperatures from the period prior to flowering time was tested. Second, three heat-summation methods were used, determining the the quantities heat units (HU): accumulated daily mean temperature after deducting a threshold, growing degree-days (GDD): proposed by Snyder [J Agric Meteorol 35:353-358 (1985)] as a measure of physiological time, and accumulated maximum temperature. In the first two, the optimum base temperature selected for heat accumulation was 12.5°C. The multiple-regression equation for 1999 gives a 7-day delay from the observed date. The most accurate results were obtained with the GDD method, with a difference of only 4.7 days between predicted and observed dates. The average heat accumulation expressed as GDD was 209.9°C days. The HU method also gives good results, with no significant statistical differences between predictions and observations.

  3. Learning curve of sentinel lymph nodes in early breast cancer at the Teaching Hospital 'Hospital das Clinicas' in Belo Horizonte, MG

    International Nuclear Information System (INIS)

    Homma, L.A.H.; Campos, T.P.R.; Silva, S.Z.C.; Siqueira, C.F.; Lima, C.F.

    2007-01-01

    The research of the sentinel lymph node in early breast cancer, an already worldwide established method, was standardized at the teaching hospital 'Hospital das Clinicas' in Belo Horizonte (MG, Brazil). This standardization was carried out from December 2000 through December 2002, in which 39 patients were included in a learning curve and method validation. The applied methodology is based on the combination of a lymphoscintillography and the blue stain. A periareolar colloid 99m Tc injection was given 24 hours before the surgery. The blue dye was injected in the peritumoral region during the surgery. The sentinel lymph node was identified by the blue color pattern of the lymph node and by the use of a portable gamma probe detector. Radioactive contamination was evaluated before, during and after the surgery. The measurement of the radioactivity of the breast area was taken by using a GM detector and an ionization chamber on a humid piece of gauze (passed on the breast area), from which the radioactivity was recorded as well as the gloves used during the surgery, and the gauzes with contaminated blood. The sentinel lymph node identification rate was found to be 95%, there was a false negative rate of 4,8% and a predictive negative value (PNV) of 94%. The identification figures, the predictive negative value and the false negative rate were similar to the figures found in technical literature. The technique of the biopsy of the sentinel lymph node (BSL) is the method chosen for staging patients with invasive breast cancer and with clinically negative results for the armpit. The combined method using radio-colloid and the stain is the most indicated. There is a minimum radio isotopic contamination and there is scarcely any danger for the patient or the medical staff involved in the procedure. (author)

  4. Isolation of Endophytic Plant Growth-Promoting Bacteria Associated with the Halophyte Salicornia europaea and Evaluation of their Promoting Activity Under Salt Stress.

    Science.gov (United States)

    Zhao, Shuai; Zhou, Na; Zhao, Zheng-Yong; Zhang, Ke; Wu, Guo-Hua; Tian, Chang-Yan

    2016-10-01

    Several reports have highlighted that many plant growth-promoting endophytic bacteria (PGPE) can assist their host plants in coping with various biotic and abiotic stresses. However, information about the PGPE colonizing in the halophytes is still scarce. This study was designed to isolate and characterize PGPE from salt-accumulating halophyte Salicornia europaea grown under extreme salinity and to evaluate in vitro the bacterial mechanisms related to plant growth promotion. A total of 105 isolates were obtained from the surface-sterilized roots, stems, and assimilation twigs of S. europaea. Thirty-two isolates were initially selected for their ability to produce 1-aminocyclopropane-1-carboxylate deaminase as well as other properties such as production of indole-3-acetic acid and phosphate-solubilizing activities. The 16S rRNA gene-sequencing analysis revealed that these isolates belong to 13 different genera and 19 bacterial species. For these 32 strains, seed germination and seedling growth in axenically grown S. europaea seedlings at different NaCl concentrations (50-500 mM) were quantified. Five isolates possessing significant stimulation of the host plant growth were obtained. The five isolates were identified as Bacillus endophyticus, Bacillus tequilensis, Planococcus rifietoensis, Variovorax paradoxus, and Arthrobacter agilis. All the five strains could colonize and can be reisolated from the host plant interior tissues. These results demonstrate that habitat-adapted PGPE isolated from halophyte could enhance plant growth under saline stress conditions.

  5. Detection of Olea europaea subsp. cuspidata and Juniperus procera in the dry Afromontane forest of northern Ethiopia using subpixel analysis of Landsat imagery

    Science.gov (United States)

    Hishe, Hadgu; Giday, Kidane; Neka, Mulugeta; Soromessa, Teshome; Van Orshoven, Jos; Muys, Bart

    2015-01-01

    Comprehensive and less costly forest inventory approaches are required to monitor the spatiotemporal dynamics of key species in forest ecosystems. Subpixel analysis using the earth resources data analysis system imagine subpixel classification procedure was tested to extract Olea europaea subsp. cuspidata and Juniperus procera canopies from Landsat 7 enhanced thematic mapper plus imagery. Control points with various canopy area fractions of the target species were collected to develop signatures for each of the species. With these signatures, the imagine subpixel classification procedure was run for each species independently. The subpixel process enabled the detection of O. europaea subsp. cuspidata and J. procera trees in pure and mixed pixels. Total of 100 pixels each were field verified for both species. An overall accuracy of 85% was achieved for O. europaea subsp. cuspidata and 89% for J. procera. A high overall accuracy level of detecting species at a natural forest was achieved, which encourages using the algorithm for future species monitoring activities. We recommend that the algorithm has to be validated in similar environment to enrich the knowledge on its capability to ensure its wider usage.

  6. System precision assessment ExacTrac 6D® BrainLab of the Hospital das Clinicas da Faculdade de Medicina da USP; Avaliacao da precisao do sistema Exactrac 6D® BrainLab do Hospital das Clinicas da Faculdade de Medicina da USP

    Energy Technology Data Exchange (ETDEWEB)

    Maistro, Carlos E.B., E-mail: carloseduardo.bravinmaistro@gmail.com [Programa de Residencia Multiprofissional em Fisica Medica, Faculdade de Medicina de Sao Paulo, SP (Brazil); Nakandakari, Marcos V.N.; Ribeiro, Victor A.B.; Sales, Camila P. de; Rodrigues, Laura N. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Radiologia. Servico de Radioterapia. Hospital das Clinicas

    2015-08-15

    The goal of this study was to evaluate the precision of ExacTrac 6D® Brainlab system, installed at Hospital das Clinicas da Faculdade de Medicina da USP, in frameless radiosurgery treatments. Four sets of tests were performed for different purposes in order to assess the following parameters: the accuracy of location through infrared system; evaluation of the reproducibility of fusion algorithm; evaluation of the X-ray system; and the end-to-end test with the goal of assess the overall accuracy of the system. It was found that the infrared system showed a maximum deviation of 0.5 mm in terms of positioning and the X-ray system showed a precision of 0.15 mm and 0.6°. The reproducibility of fusion algorithms provided a maximum deviation in position which was less than 0.5 mm and 0.5° and the quantitative analysis of the results for end-to-end test showed an overall accuracy of the system better than 0.8 mm. (author)

  7. Conveyor Cultivation of the Halophytic Plant Salicornia europaea for the Recycling of NaCl from Human Liquid Waste in a Biological Life Support System.

    Science.gov (United States)

    Balnokin, Yurii; Myasoedov, Nikolay; Popova, Larissa; Tikhomirov, Alexander A.; Ushakova, Sofya; Tikhomirova, Natalia; Lasseur, Christophe; Gros, Jean-Bernard

    One problem in designing bioregenerative life support systems (BLSS) is developing technolo-gies to include human liquid and solid waste in intrasystem recycling. A specific task is recycling of NaCl excreted in urine by humans. We showed recently that this could be achieved through inclusion of the salt accumulating halophyte Salicornia europaea in the autotrophic compart-ment of the BLSS (Balnokin et al., ASR, 2010, in press). A model of NaCl circulation in BLSS with inclusion of S. europaea was based on the NaCl turnover in the human -urine -nutrient solution -S. europaea -human cycle. Mineralized urine was used as a basis for preparation of a nutrient solution for the halophyte cultivation. The shoots of the halophyte cultivated in the mineralized urine and containing NaCl could to be used by the BLSS inhabitants in their diets. In this report we describe cultivation of S. europaea which allows turnover of NaCl and produces daily shoot biomass containing Na+ and Cl- in quantities approximately equal to those excreted in daily human urine. The plants were grown in water culture in a climatic chamber under controlled conditions. A solution simulating mineralized urine (SSMU) was used as a basis for preparation of a nutri-ent solution for S. europaea cultivation. For continuous biomass production, seedlings of S. europaea, germinated preliminary in moist sand, were being transferred to the nutrient solu-tion at regular intervals (every two days). Duration of the conveyor operation was 112 days. During the first 56 days, the seedlings were being planted in SSMU diluted by a factor of 1.5 (2/3 SSMU). The same solution was introduced into the growth vessels as volumes of growth medium decreased due to plant transpiration. Starting from the 56th day as conveyor operation was initiated, the plants were being harvested every two days; the solutions from the discharged vessels were mixed with the fresh SSMU and the mixture was introduced into all other growth vessels of

  8. Short communication: Promotion of glucagon-like peptide-2 secretion in dairy calves with a bioactive extract from Olea europaea.

    Science.gov (United States)

    Morrison, S Y; Pastor, J J; Quintela, J C; Holst, J J; Hartmann, B; Drackley, J K; Ipharraguerre, I R

    2017-03-01

    Diarrhea episodes in dairy calves involve profound alterations in the mechanism controlling gut barrier function that ultimately compromise intestinal permeability to macromolecules, including pathogenic bacteria. Intestinal dysfunction models suggest that a key element of intestinal adaptation during the neonatal phase is the nutrient-induced secretion of glucagon-like peptide (GLP)-2 and associated effects on mucosal cell proliferation, barrier function, and inflammatory response. Bioactive molecules found in Olea europaea have been shown to induce the release of regulatory peptides from model enteroendocrine cells. The ability to enhance GLP-2 secretion via the feeding of putative GLP-2 secretagogues is untested in newborn calves. The objectives of this study were to determine whether feeding a bioactive extract from Olea europaea (OBE) mixed in the milk replacer (1) can stimulate GLP-2 secretion beyond the response elicited by enteral nutrients and, thereby, (2) improve intestinal permeability and animal growth as well as (3) reduce the incidence of diarrhea in preweaning dairy calves. Holstein heifer calves (n = 60) were purchased, transported to the research facility, and blocked by body weight and total serum protein and assigned to 1 of 3 treatments. Treatments were control (CON), standard milk replacer (MR) and ad libitum starter; CON plus OBE added into MR at 30 mg/kg of body weight (OBE30); and CON plus OBE added into MR at 60 mg/kg of body weight (OBE60). The concentration of GLP-2 was measured at the end of wk 2. Intestinal permeability was measured at the onset of the study and the end of wk 2 and 6, with lactulose and d-mannitol as markers. Treatments did not affect calf growth and starter intake. Compared with CON, administration of OBE60 increased the nutrient-induced response in GLP-2 by about 1 fold and reduced MR intake during the second week of study. Throughout the study, however, all calves had compromised intestinal permeability and a high

  9. Expression and purification of recombinant proteins in Escherichia coli tagged with a small metal-binding protein from Nitrosomonas europaea.

    Science.gov (United States)

    Vargas-Cortez, Teresa; Morones-Ramirez, Jose Ruben; Balderas-Renteria, Isaias; Zarate, Xristo

    2016-02-01

    Escherichia coli is still the preferred organism for large-scale production of recombinant proteins. The use of fusion proteins has helped considerably in enhancing the solubility of heterologous proteins and their purification with affinity chromatography. Here, the use of a small metal-binding protein (SmbP) from Nitrosomonas europaea is described as a new fusion protein for protein expression and purification in E. coli. Fluorescent proteins tagged at the N-terminal with SmbP showed high levels of solubility, compared with those of maltose-binding protein and glutathione S-transferase, and low formation of inclusion bodies. Using commercially available IMAC resins charged with Ni(II), highly pure recombinant proteins were obtained after just one chromatography step. Proteins may be purified from the periplasm of E. coli if SmbP contains the signal sequence at the N-terminal. After removal of the SmbP tag from the protein of interest, high-yields are obtained since SmbP is a protein of just 9.9 kDa. The results here obtained suggest that SmbP is a good alternative as a fusion protein/affinity tag for the production of soluble recombinant proteins in E. coli. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. Community structure variability of Uropodina mites (Acari: Mesostigmata) in nests of the common mole, Talpa europaea, in Central Europe.

    Science.gov (United States)

    Napierała, Agnieszka; Mądra, Anna; Leszczyńska-Deja, Kornelia; Gwiazdowicz, Dariusz J; Gołdyn, Bartłomiej; Błoszyk, Jerzy

    2016-04-01

    Underground nests of Talpa europaea, known as the common mole, are very specific microhabitats, which are also quite often inhabited by various groups of arthropods. Mites from the suborder Uropodina (Acari: Mesostigmata) are only one of them. One could expect that mole nests that are closely located are inhabited by communities of arthropods with similar species composition and structure. However, results of empirical studies clearly show that even nests which are close to each other can be different both in terms of the species composition and abundance of Uropodina communities. So far, little is known about the factors that can cause these differences. The major aim of this study was to identify factors determining species composition, abundance, and community structure of Uropodina communities in mole nests. The study is based on material collected during a long-term investigation conducted in western parts of Poland. The results indicate that the two most important factors influencing species composition and abundance of Uropodina communities in mole nests are nest-building material and depth at which nests are located. Composition of Uropodina communities in nests of moles was also compared with that of other microhabitats (e.g. rotten wood, forest litter, soil) based on data from 4421 samples collected in Poland. Communities of this habitat prove most similar to these of open areas, especially meadows, as well as some forest types.

  11. Salicornia europaea L. Na⁺/H⁺ antiporter gene improves salt tolerance in transgenic alfalfa (Medicago sativa L.).

    Science.gov (United States)

    Zhang, L Q; Niu, Y D; Huridu, H; Hao, J F; Qi, Z; Hasi, A

    2014-07-24

    In order to obtain a salt-tolerant perennial alfalfa (Medicago sativa L.), we transferred the halophyte Salicornia europaea L. Na(+)/H(+) antiporter gene, SeNHX1, to alfalfa by using the Agrobacterium-mediated transformation method. The transformants were confirmed by both PCR and RT-PCR analyses. Of 197 plants that were obtained after transformation, 36 were positive by PCR analysis using 2 primer pairs for the CaMV35S-SeNHX1 and SeNHX1-Nos fragments; 6 plants survived in a greenhouse. RT-PCR analysis revealed that SeNHX1 was expressed in 5 plants. The resultant transgenic alfalfa had better salt tolerance. After stress treatment for 21 days with 0.6% NaCl, the chlorophyll and MDA contents in transgenic plants were lower, but proline content and SOD, POD, and CAT activities were higher than those in wild-type plants. These results suggest that the salt tolerance of transgenic alfalfa was improved by the overexpression of the SeNHX1 gene.

  12. Sustainability, Innovation, and Green Chemistry in the Production and Valorization of Phenolic Extracts from Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Annalisa Romani

    2016-10-01

    Full Text Available This paper describes a circular economy process based on environmentally and economically sustainable procedures which was applied to the sector of olive oil processing on an industrial scale. Olea europaea L. tissues and by-products represent a renewable and low-cost source of polyphenols, in particular hydroxytyrosol (HTyr, a naturally occurring compound well known for its biological properties. Specifically, green leaves (GL, dried leaves (DL, and pitted olive pulp were treated with water in a pneumatic extractor to obtain the corresponding polyphenolic extracts. Three standardized fractions, named Soft Extract Olea GL, Soft Extract Olea DL, and Soft Extract Olea HTyr resulted after the following two steps: a separation process carried out by membrane technology, and a concentration step performed under reduced pressure and low temperature. The polyphenolic fractions showed antiradical activity and have potential industrial applications in the food, nutraceutical, pharmaceutical, feed, and agronomic fields. Novel functionalized extracts containing hydroxytyrosol methyl carbonate (HTyr-MC were obtained from Soft Extract Olea HTyr through an innovative approach based on green chemistry procedures, which appear to be a promising tool to increase the applications of the polyphenolic extracts.

  13. The use of phenological data to calculate chilling units in Olea europaea L. in relation to the onset of reproduction

    Science.gov (United States)

    Orlandi, F.; Fornaciari, M.; Romano, B.

    2002-02-01

    The aim of this study was to develop a practical method to evaluate the effective relationship between the amount of winter chilling and the response expressed as the spring reproductive re-starting dates in the olive ( Olea europaea L.). Two olive cultivars growing in a special olive orchard in Umbria (central Italy) were studied over a 3-year period (1998-2000): the cultivar Ascolana, typical of central Italy, and the cultivar Giarraffa, typical of southern Italy. The spring reproductive re-starts were assessed using data from detailed phenological observations made on 60 trees of each cultivar in an effort to establish the exact date of reproductive bud swelling. The chilling phenomenon was evaluated by using 341 functions derived from a formula developed by researchers at Utah State University to calculate chilling units. The mathematical functions are defined, and show the very close relationship between the amount of winter chilling and the spring reproductive response in the two cultivars in the orchard studied. The results can be used to define the relationship between local climate and plant development, and the mathematical approach can be used to draw maps that can show the suitability of different cultivars on the basis of local climatic conditions.

  14. De Novo Transcriptome Sequencing of Olea europaea L. to Identify Genes Involved in the Development of the Pollen Tube.

    Science.gov (United States)

    Iaria, Domenico; Chiappetta, Adriana; Muzzalupo, Innocenzo

    2016-01-01

    In olive (Olea europaea L.), the processes controlling self-incompatibility are still unclear and the molecular basis underlying this process are still not fully characterized. In order to determine compatibility relationships, using next-generation sequencing techniques and a de novo transcriptome assembly strategy, we show that pollen tubes from different olive plants, grown in vitro in a medium containing its own pistil and in combination pollen/pistil from self-sterile and self-fertile cultivars, have a distinct gene expression profile and many of the differentially expressed sequences between the samples fall within gene families involved in the development of the pollen tube, such as lipase, carboxylesterase, pectinesterase, pectin methylesterase, and callose synthase. Moreover, different genes involved in signal transduction, transcription, and growth are overrepresented. The analysis also allowed us to identify members in actin and actin depolymerization factor and fibrin gene family and member of the Ca(2+) binding gene family related to the development and polarization of pollen apical tip. The whole transcriptomic analysis, through the identification of the differentially expressed transcripts set and an extended functional annotation analysis, will lead to a better understanding of the mechanisms of pollen germination and pollen tube growth in the olive.

  15. Valuable Nutrients and Functional Bioactives in Different Parts of Olive (Olea europaea L.)—A Review

    Science.gov (United States)

    Ghanbari, Rahele; Anwar, Farooq; Alkharfy, Khalid M.; Gilani, Anwarul-Hassan; Saari, Nazamid

    2012-01-01

    The Olive tree (Olea europaea L.), a native of the Mediterranean basin and parts of Asia, is now widely cultivated in many other parts of the world for production of olive oil and table olives. Olive is a rich source of valuable nutrients and bioactives of medicinal and therapeutic interest. Olive fruit contains appreciable concentration, 1–3% of fresh pulp weight, of hydrophilic (phenolic acids, phenolic alchohols, flavonoids and secoiridoids) and lipophilic (cresols) phenolic compounds that are known to possess multiple biological activities such as antioxidant, anticarcinogenic, antiinflammatory, antimicrobial, antihypertensive, antidyslipidemic, cardiotonic, laxative, and antiplatelet. Other important compounds present in olive fruit are pectin, organic acids, and pigments. Virgin olive oil (VOO), extracted mechanically from the fruit, is also very popular for its nutritive and health-promoting potential, especially against cardiovascular disorders due to the presence of high levels of monounsaturates and other valuable minor components such as phenolics, phytosterols, tocopherols, carotenoids, chlorophyll and squalene. The cultivar, area of production, harvest time, and the processing techniques employed are some of the factors shown to influence the composition of olive fruit and olive oil. This review focuses comprehensively on the nutrients and high-value bioactives profile as well as medicinal and functional aspects of different parts of olives and its byproducts. Various factors affecting the composition of this food commodity of medicinal value are also discussed. PMID:22489153

  16. Nutrition metabolism plays an important role in the alternate bearing of the olive tree (Olea europaea L..

    Directory of Open Access Journals (Sweden)

    Mine Turktas

    Full Text Available The olive tree (Olea europaea L. is widely known for its strong tendency for alternate bearing, which severely affects the fruit yield from year to year. Microarray based gene expression analysis using RNA from olive samples (on-off years leaves and ripe-unripe fruits are particularly useful to understand the molecular mechanisms influencing the periodicity in the olive tree. Thus, we carried out genome wide transcriptome analyses involving different organs and temporal stages of the olive tree using the NimbleGen Array containing 136,628 oligonucleotide probe sets. Cluster analyses of the genes showed that cDNAs originated from different organs could be sorted into separate groups. The nutritional control had a particularly remarkable impact on the alternate bearing of olive, as shown by the differential expression of transcripts under different temporal phases and organs. Additionally, hormonal control and flowering processes also played important roles in this phenomenon. Our analyses provide further insights into the transcript changes between "on year" and "off year" leaves along with the changes from unrpipe to ripe fruits, which shed light on the molecular mechanisms underlying the olive tree alternate bearing. These findings have important implications for the breeding and agriculture of the olive tree and other crops showing periodicity. To our knowledge, this is the first study reporting the development and use of an olive array to document the gene expression profiling associated with the alternate bearing in olive tree.

  17. Freezing avoidance by supercooling in Olea europaea cultivars: the role of apoplastic water, solute content and cell wall rigidity.

    Science.gov (United States)

    Arias, Nadia S; Bucci, Sandra J; Scholz, Fabian G; Goldstein, Guillermo

    2015-10-01

    Plants can avoid freezing damage by preventing extracellular ice formation below the equilibrium freezing temperature (supercooling). We used Olea europaea cultivars to assess which traits contribute to avoid ice nucleation at sub-zero temperatures. Seasonal leaf water relations, non-structural carbohydrates, nitrogen and tissue damage and ice nucleation temperatures in different plant parts were determined in five cultivars growing in the Patagonian cold desert. Ice seeding in roots occurred at higher temperatures than in stems and leaves. Leaves of cold acclimated cultivars supercooled down to -13 °C, substantially lower than the minimum air temperatures observed in the study site. During winter, leaf ice nucleation and leaf freezing damage (LT50 ) occurred at similar temperatures, typical of plant tissues that supercool. Higher leaf density and cell wall rigidity were observed during winter, consistent with a substantial acclimation to sub-zero temperatures. Larger supercooling capacity and lower LT50 were observed in cold-acclimated cultivars with higher osmotically active solute content, higher tissue elastic adjustments and lower apoplastic water. Irreversible leaf damage was only observed in laboratory experiments at very low temperatures, but not in the field. A comparative analysis of closely related plants avoids phylogenetic independence bias in a comparative study of adaptations to survive low temperatures. © 2015 John Wiley & Sons Ltd.

  18. Histochemical location of key enzyme activities involved in receptivity and self-incompatibility in the olive tree (Olea europaea L.).

    Science.gov (United States)

    Serrano, Irene; Olmedilla, Adela

    2012-12-01

    Stigma-surface and style enzymes are important for pollen reception, selection and germination. This report deals with the histochemical location of the activity of four basic types of enzyme involved in these processes in the olive (Olea europaea L.). The detection of peroxidase, esterase and acid-phosphatase activities at the surface of the stigma provided evidence of early receptivity in olive pistils. The stigma maintained its receptivity until the arrival of pollen. Acid-phosphatase activity appeared in the style at the moment of anthesis and continued until the fertilization of the ovule. RNase activity was detected in the extracellular matrix of the styles of flowers just before pollination and became especially evident in pistils after self-pollination. This activity gradually decreased until it practically disappeared in more advanced stages. RNase activity was also detected in pollen tubes growing in pollinated pistils and appeared after in vitro germination in the presence of self-incompatible pistils. These findings suggest that RNases may well be involved in intraspecific pollen rejection in olive flowers. To the best of our knowledge this is the first time that evidence of enzyme activity in stigma receptivity and pollen selection has been described in this species. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  19. Nutrition Metabolism Plays an Important Role in the Alternate Bearing of the Olive Tree (Olea europaea L.)

    Science.gov (United States)

    Turktas, Mine; Inal, Behcet; Okay, Sezer; Erkilic, Emine Gulden; Dundar, Ekrem; Hernandez, Pilar; Dorado, Gabriel; Unver, Turgay

    2013-01-01

    The olive tree (Olea europaea L.) is widely known for its strong tendency for alternate bearing, which severely affects the fruit yield from year to year. Microarray based gene expression analysis using RNA from olive samples (on-off years leaves and ripe-unripe fruits) are particularly useful to understand the molecular mechanisms influencing the periodicity in the olive tree. Thus, we carried out genome wide transcriptome analyses involving different organs and temporal stages of the olive tree using the NimbleGen Array containing 136,628 oligonucleotide probe sets. Cluster analyses of the genes showed that cDNAs originated from different organs could be sorted into separate groups. The nutritional control had a particularly remarkable impact on the alternate bearing of olive, as shown by the differential expression of transcripts under different temporal phases and organs. Additionally, hormonal control and flowering processes also played important roles in this phenomenon. Our analyses provide further insights into the transcript changes between ”on year” and “off year” leaves along with the changes from unrpipe to ripe fruits, which shed light on the molecular mechanisms underlying the olive tree alternate bearing. These findings have important implications for the breeding and agriculture of the olive tree and other crops showing periodicity. To our knowledge, this is the first study reporting the development and use of an olive array to document the gene expression profiling associated with the alternate bearing in olive tree. PMID:23555820

  20. The first cytogenetic description of Euleptes europaea (Gené, 1839 from Northern Sardinia reveals the highest diploid chromosome number among sphaerodactylid geckos (Sphaerodactylidae, Squamata

    Directory of Open Access Journals (Sweden)

    Ekaterina Gornung

    2013-06-01

    Full Text Available The karyotype of a sphaerodactylid gecko Euleptes europaea (Gené, 1839 was assembled for the first time in this species. It is made of 2n = 42 gradually decreasing in size chromosomes, the highest chromosome number so far acknowledged in the family Sphaerodactylidae. The second chromosome pair of the karyotype appears slightly heteromorphic in the male individual. Accordingly, FISH with a telomeric probe revealed an uneven distribution of telomeric repeats on the two homologues of this pair, which may be indicative of an XY sex-determination system in the species, to be further investigated.

  1. [The preparation and characterization of fine dusts carried out in the Clinica del Lavoro di Milano in support of experimental studies].

    Science.gov (United States)

    Occella, E; Maddalon, G; Peruzzo, G F; Foà, V

    1999-01-01

    This paper aims to illustrate the conditions selected at the Clinica del Lavoro of the University of Milan to prepare and analyze a large number of fine dust samples produced over a period of about 50 years, that were initially used for studies within the Clinic performed in its own facilities, and since 1956 were sent to other Italian and overseas laboratories (Luxembourg, UK, Germany, Norway, Sweden, South Korea, USA). The total quantity of material distributed (with maximum size 7-10 microns) was about 2 kg and consisted of the following mineral and artificial compounds: quartz, HF-treated quartz, tridymite, HF-treated tridymite, cristobalite, chromite, anthracite, quartz sand for foundry moulds, sand from the Lybian desert, vitreous silica, pumice, cement, as well small quantities of metallic oxides, organic resins, chrysotile, crocidolite, fibres (vitreous, cotton and polyamidic). About half of the entire quantity of dusts produced consisted of partially HF-treated tridymite. Initially, research on the etiology of silicosis used quartz dust samples, simply sieved or ventilated (consisting of classes finer than 0.04 mm, containing a 15-20% respirable fraction). From 1956 to 1960 the dusts were produced by manual grinding in an agate mortar, below about 10 microns, starting from quartz from Quincinetto (near Ivrea, Province of Turin), containing about 99.5% quartz: particle size and composition were checked using an optical-petrographic technique, with identification of the free and total silica content. Subsequently, the dusts used for biological research were obtained by grinding coarse material with a cast iron pestle and planetary mills, agate and corundum jars. The grinding products were sized by means of centrifugal classification, using the selector developed by N. Zurlo, ensuring control of dust size both optically and by means of wet levigators and hydraulic classifiers (in cooperation with the Institute of Mines of Turin Polytechnic School). After 1990

  2. Effect of cognitive stimulation in patients with mild congenital deterioration, in the reduction of progression to dementia, in the Clinica de la Memoria, Hospital Nacional de Geriatria y Gerontologia, during the period from September 2008 to September 2013

    International Nuclear Information System (INIS)

    Giangiulio Lobo, Andrea

    2014-01-01

    The efficacy of cognitive stimulation in the progression to dementia is verified in patients with mild cognitive impairment, from the Clinica de Memoria of the Hospital Nacional de Geriatria y Gerontologia, between September 2008 and September 2013. A sample of 190 patients of the Metropolitan Area, the majority of female, complete primary, with self-care, aged 70 to 79 years are selected. The investigated group has had a history of hypertension, diabetes mellitus to a lesser extent and some degree of associated sensory deficit. The evolution time of memory loss presented is 2.6 years at the time of the medical evaluation. The most common cognitive impairment in the study has been the multiple dominion amnesia, followed by the non-amnesic dominion multiple. The etiology has leaded the degenerative, followed by vascular and thirdly the deficit of vitamin B12. Patients with mild cognitive impairment almost half of the cases have had neuro-behavioral disorder, being the depression most frequent, followed by anxiety and apathy. Patients have been partial independent in ABVD and dependent on AIVD. Absenteeism to dating has existed both in Clinica de Memoria; but mainly to the appointment with psychology. During the study it is determined that the deterioration was developed without progress to dementia, relatives have reported cognitive stability in more than half of the cases, only 18 patients have progressed to dementia. In the process only 29 patients have concluded and were reevaluated; without being able to demonstrate that the cognitive stimulation delays the cognitive deterioration to the dementia, but nevertheless; this result is given without unduly discrediting cognitive stimulation as a non-pharmacological measure for the prevention and delaying of dementia. (author) [es

  3. Olea europaea leaf extract improves the treatment response of GBM stem cells by modulating miRNA expression.

    Science.gov (United States)

    Tezcan, Gulcin; Tunca, Berrin; Bekar, Ahmet; Budak, Ferah; Sahin, Saliha; Cecener, Gulsah; Egeli, Unal; Taskapılıoglu, Mevlut Ozgur; Kocaeli, Hasan; Tolunay, Sahsine; Malyer, Hulusi; Demir, Cevdet; Tumen, Gulendam

    2014-01-01

    The stem-like cells of Glioblastoma multiforme (GBM) tumors (GSCs) are one of the important determinants of recurrence and drug resistance. The aims of the current study were to evaluate the anticancer effect of Olea europaea leaf extract (OLE) on GBM cell lines, the association between OLE and TMZ responses, and the effect of OLE and the OLE-TMZ combination in GSCs and to clarify the molecular mechanism of this effect on the expression of miRNAs related to cell death. The anti-proliferative activity of OLE and the effect of the OLE-TMZ combination were tested in the T98G, U-138MG and U-87MG GBM cell lines using WST-1 assay. The mechanism of cell death was analyzed with Annexin V/FITC and TUNEL assays. The effects of OLE on the expression levels of miR-181b, miR-153, miR-145 and miR-137 and potential mRNA targets were analyzed in GSCs using RT-qPCR. OLE exhibited anti-proliferative effects via apoptosis and necrosis in the GBM cell lines. In addition, OLE significantly induced the expression of miR-153, miR-145, and miR-137 and decreased the expression of the target genes of these miRNAs in GSCs (p GBM cells with different TMZ responses, and this effect is synergistically increased when the cells are treated with a combination of OLE and TMZ. This is the first study to indicate that OLE may interfere with the pluripotency of GSCs by modulating miRNA expression. Further studies are required, but we suggest that OLE may have a potential for advanced therapeutic cancer drug studies in GBM.

  4. Genome-Scale, Constraint-Based Modeling of Nitrogen Oxide Fluxes during Coculture of Nitrosomonas europaea and Nitrobacter winogradskyi

    Science.gov (United States)

    Giguere, Andrew T.; Murthy, Ganti S.; Bottomley, Peter J.; Sayavedra-Soto, Luis A.

    2018-01-01

    ABSTRACT Nitrification, the aerobic oxidation of ammonia to nitrate via nitrite, emits nitrogen (N) oxide gases (NO, NO2, and N2O), which are potentially hazardous compounds that contribute to global warming. To better understand the dynamics of nitrification-derived N oxide production, we conducted culturing experiments and used an integrative genome-scale, constraint-based approach to model N oxide gas sources and sinks during complete nitrification in an aerobic coculture of two model nitrifying bacteria, the ammonia-oxidizing bacterium Nitrosomonas europaea and the nitrite-oxidizing bacterium Nitrobacter winogradskyi. The model includes biotic genome-scale metabolic models (iFC578 and iFC579) for each nitrifier and abiotic N oxide reactions. Modeling suggested both biotic and abiotic reactions are important sources and sinks of N oxides, particularly under microaerobic conditions predicted to occur in coculture. In particular, integrative modeling suggested that previous models might have underestimated gross NO production during nitrification due to not taking into account its rapid oxidation in both aqueous and gas phases. The integrative model may be found at https://github.com/chaplenf/microBiome-v2.1. IMPORTANCE Modern agriculture is sustained by application of inorganic nitrogen (N) fertilizer in the form of ammonium (NH4+). Up to 60% of NH4+-based fertilizer can be lost through leaching of nitrifier-derived nitrate (NO3−), and through the emission of N oxide gases (i.e., nitric oxide [NO], N dioxide [NO2], and nitrous oxide [N2O] gases), the latter being a potent greenhouse gas. Our approach to modeling of nitrification suggests that both biotic and abiotic mechanisms function as important sources and sinks of N oxides during microaerobic conditions and that previous models might have underestimated gross NO production during nitrification. PMID:29577088

  5. Genome-Scale, Constraint-Based Modeling of Nitrogen Oxide Fluxes during Coculture of Nitrosomonas europaea and Nitrobacter winogradskyi.

    Science.gov (United States)

    Mellbye, Brett L; Giguere, Andrew T; Murthy, Ganti S; Bottomley, Peter J; Sayavedra-Soto, Luis A; Chaplen, Frank W R

    2018-01-01

    Nitrification, the aerobic oxidation of ammonia to nitrate via nitrite, emits nitrogen (N) oxide gases (NO, NO 2 , and N 2 O), which are potentially hazardous compounds that contribute to global warming. To better understand the dynamics of nitrification-derived N oxide production, we conducted culturing experiments and used an integrative genome-scale, constraint-based approach to model N oxide gas sources and sinks during complete nitrification in an aerobic coculture of two model nitrifying bacteria, the ammonia-oxidizing bacterium Nitrosomonas europaea and the nitrite-oxidizing bacterium Nitrobacter winogradskyi . The model includes biotic genome-scale metabolic models (iFC578 and iFC579) for each nitrifier and abiotic N oxide reactions. Modeling suggested both biotic and abiotic reactions are important sources and sinks of N oxides, particularly under microaerobic conditions predicted to occur in coculture. In particular, integrative modeling suggested that previous models might have underestimated gross NO production during nitrification due to not taking into account its rapid oxidation in both aqueous and gas phases. The integrative model may be found at https://github.com/chaplenf/microBiome-v2.1. IMPORTANCE Modern agriculture is sustained by application of inorganic nitrogen (N) fertilizer in the form of ammonium (NH 4 + ). Up to 60% of NH 4 + -based fertilizer can be lost through leaching of nitrifier-derived nitrate (NO 3 - ), and through the emission of N oxide gases (i.e., nitric oxide [NO], N dioxide [NO 2 ], and nitrous oxide [N 2 O] gases), the latter being a potent greenhouse gas. Our approach to modeling of nitrification suggests that both biotic and abiotic mechanisms function as important sources and sinks of N oxides during microaerobic conditions and that previous models might have underestimated gross NO production during nitrification.

  6. Hepatoprotective and antioxidant properties of the aqueous extract of Olea europaea leaves against Diclofenac-induced liver damages in mice.

    Science.gov (United States)

    Soussi, Rawya; Hfaiedh, Najla; Guesmi, Fatma; Sakly, Mohsen; Ben Rhouma, Khémais

    2018-04-20

    Historically, olive tree "Olea europaea" is one of the most important fruit trees in Mediterranean countries. Several studies suggest that olive leaf is a significant source of bioactive phenolic compounds compared to olive oil and fruits. This study was undertaken to investigate, the protective effect of the aqueous extract of « Chemlali » olive leaves against diclofenac-induced damages in liver and haematological alterations in swiss albinos mice. For this, twenty-eight mice were divided into four groups: a control group, a diclofenac-treated group (2.37 mg/kg) for 5 consecutive days, a group orally gavaged with aqueous extract of olive leaves, (3.3g/kg) during 28 days, and a group pre-treated with aqueous extract of olive leaves during 23 days then injected with diclofenac for 5 days. Results obtained from this study revealed that administration of diclofenac alone led to disturbance of some haematological parameters including red and white blood cells (RBC), (WBC) haemoglobin (Hb) and platelets content (PLT). However, diclofenac-treated mice group showed a increasing in the levels of cholesterol, triglyceride, glucose, creatinine, urea, aspartate aminotransferase (ASAT), and alanine aminotransferase (ALAT). Additionally we noted a state of oxidative stress in hepatic tissue indicated by the increasing of lipid peroxidation level (TBARS) and decreasing of superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPX). Interstingly, pre-treatment with olive leaves extract improved the haematological parameters and minimised the adverse effect on the hepatic function markers induced by diclofenac. The beneficial effect of olive leaves could be attributed to its antioxidant components as confirmed by phytochemical analysis.

  7. Immunoproteomic tools are used to identify masked allergens: Ole e 12, an allergenic isoflavone reductase from olive (Olea europaea) pollen.

    Science.gov (United States)

    Castro, Lourdes; Crespo, Jesús F; Rodríguez, Julia; Rodríguez, Rosalía; Villalba, Mayte

    2015-12-01

    Proteins performing important biochemical activities in the olive tree (Olea europaea) pollen have been identified as allergens. One novel 37-kDa protein seems to be associated to the IgE-binding profile of a group of patients suffering allergy to peach and olive pollen. Three previously described olive pollen allergens exhibit very similar molecular mass. Our objective was to identify this allergen by using immunoproteomic approaches. After 2D-electrophoresis and mass spectrometry, peptide sequences from several IgE-binding spots, allowed identifying this new allergen, as well as cloning and DNA sequencing of the corresponding gene. The allergen, named Ole e 12, is a polymorphic isoflavone reductase-like protein of 308 amino acids showing 80% and 74% identity with birch and pear allergens, Bet v 6 and Pyr c 5, respectively. A prevalence of 33% in the selected population is in contrast to 4%-10% in groups of subjects suffering from pollinosis. Recombinant allergen was produced in Escherichia coli, and deeply characterised. Immunoblotting and ELISA detection as well as inhibition experiments were performed with polyclonal antisera and allergic patients' sera. The recombinant allergen retains the IgE reactivity of its natural counterpart. Close structural and immunological relationships between members of this protein family were supported by their IgG recognition in vegetable species. In summary, Ole e 12 is a minor olive pollen allergen, which gains relevance in patients allergic to peach with olive pollinosis. Proteomic approaches used to analyse this allergen provide useful tools to identify hidden allergens, relevant for several allergic populations and thus complete allergenic panels. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Thriving at the limit: Differential reproductive performance in range-edge populations of a Mediterranean sclerophyll (Olea europaea)

    Science.gov (United States)

    Granado-Yela, Carlos; Balaguer, Luis; García-Verdugo, Carlos; Carrillo, Katty; Méndez, Marcos

    2013-10-01

    Peripheral populations are often lumped together on the assumption of thriving in marginal habitats where reproductive performance is compromised. We have tested this hypothesis in peripheral populations of wild olive tree (Olea europaea L.) presumably limited by different factors at the westernmost limit of the species range. Additionally, we hypothesized that differences in reproductive outcome among populations are better explained by site-specific environmental conditions (PAR, soil water, soil nutrients, air humidity and air temperature) than by differences in phenotypic traits (tree size and leaf traits). To test these hypotheses, we assessed the number of flowering trees, the flowering intensity, fruit set and seed viability in eight populations for three consecutive years. Our findings provided sufficient evidence to reject the first hypothesis. Peripheral populations that occur under oceanic conditions, resembling the Tertiary subtropical climate, consistently presented higher values for all components of reproductive performance than those at the thermal and rainfall tolerance limits. In support of our second hypothesis, the variation in reproductive performance among populations was primarily accounted for by local environmental conditions. Leaf traits, however, also explained reproductive variation but to a lesser extent. Finally, we found that small changes in tree size may cause large differences in reproductive performance. This close relationship between tree size and reproductive performance suggests that any impact on population size structure would likely jeopardize persistence and expansion at the range edge. Our results suggest that reproductive performance of wild olive trees was not shaped by the population geographic position within the species range, but by the interaction between local environment, as the main driver, and individual phenotypic traits.

  9. Human Invariant Natural Killer T Cells Respond to Antigen-Presenting Cells Exposed to Lipids from Olea europaea Pollen.

    Science.gov (United States)

    Abos Gracia, Beatriz; López Relaño, Juan; Revilla, Ana; Castro, Lourdes; Villalba, Mayte; Martín Adrados, Beatriz; Regueiro, Jose Ramon; Fernández-Malavé, Edgar; Martínez Naves, Eduardo; Gómez Del Moral, Manuel

    2017-01-01

    Allergic sensitization might be influenced by the lipids present in allergens, which can be recognized by natural killer T (NKT) cells on antigen-presenting cells (APCs). The aim of this study was to analyze the effect of olive pollen lipids in human APCs, including monocytes as well as monocyte-derived macrophages (Mϕ) and dendritic cells (DCs). Lipids were extracted from olive (Olea europaea) pollen grains. Invariant (i)NKT cells, monocytes, Mϕ, and DCs were obtained from buffy coats of healthy blood donors, and their cell phenotype was determined by flow cytometry. iNKT cytotoxicity was measured using a lactate dehydrogenase assay. Gene expression of CD1A and CD1D was performed by RT-PCR, and the production of IL-6, IL-10, IL-12, and TNF-α cytokines by monocytes, Mϕ, and DCs was measured by ELISA. Our results showed that monocytes and monocyte-derived Mϕ treated with olive pollen lipids strongly activate iNKT cells. We observed several phenotypic modifications in the APCs upon exposure to pollen-derived lipids. Both Mϕ and monocytes treated with olive pollen lipids showed an increase in CD1D gene expression, whereas upregulation of cell surface CD1d protein occurred only in Mϕ. Furthermore, DCs differentiated in the presence of human serum enhance their surface CD1d expression when exposed to olive pollen lipids. Finally, olive pollen lipids were able to stimulate the production of IL-6 but downregulated the production of lipopolysaccharide- induced IL-10 by Mϕ. Olive pollen lipids alter the phenotype of monocytes, Mϕ, and DCs, resulting in the activation of NKT cells, which have the potential to influence allergic immune responses. © 2017 S. Karger AG, Basel.

  10. Assessing ambient ozone injury in olive (Olea europaea L.) plants by using the antioxidant ethylenediurea (EDU) in Saudi Arabia.

    Science.gov (United States)

    Basahi, J M; Ismail, I M; Haiba, N S; Hassan, I A; Lorenzini, G

    2016-06-01

    The antiozonant chemical, ethylenediurea (N-[2-(2-oxo-1-imidazolidinyl)ethyl]-N'-phenylurea, abbreviated as EDU), was applied as stem injections or soil drenches to 5-year-old containerized plants of olive (Olea europaea L. cultivar Kalamata) in growth chambers in order to assess its ameliorative effects against realistic ozone (O3) stress. Visible injury symptoms were reduced greatly in individuals treated with EDU, with injection applications having greater protection than soil drenches. EDU application caused increases in the measured ecophysiological parameters compared to untreated individuals. In particular, the stem injection protected plants against photosynthetic impairment (unchanged net photosynthetic rates and intercellular CO2 concentration, in comparison to plants grown in filtered air). EDU application increased the protection of PSII from ambient O3 oxidative stress, although it did not retain the proportion of redox state of QA, pigment composition of photosynthetic apparatus and size of light-harvesting complex of PSII. However, the stem injection of plants with EDU induced lower non-photochemical quenching (NPQ) values in comparison to ambient air (-2 %), indicating a better photoprotection of PSII in comparison to soil drench application. EDU application caused increases in the morphological and biometric parameters compared to individuals exposed to ambient air. To the best of our knowledge, this is the first study highlighting the protection of Kalamata olive trees due to EDU in terms of growth, yield, visible injury, and photosynthetic performance. Furthermore, this study proved that EDU could be a low-cost and a low-technology efficient tool for assessing O3 effects on plant performances in the field in Saudi Arabia.

  11. Pentacyclic triterpene in Olea europaea L: A simultaneous determination by high-performance liquid chromatography coupled to mass spectrometry.

    Science.gov (United States)

    Giménez, Estela; Juan, M Emília; Calvo-Melià, Sara; Barbosa, José; Sanz-Nebot, Victoria; Planas, Joana M

    2015-09-04

    Pentacyclic triterpenes are gaining interest due to their beneficial health effects, as anti-inflammatory, anti-diabetic and anti-tumoral, among others. In this study, an analytical LC-MS method was developed for the simultaneous determination of maslinic, oleanolic and ursolic acids along with erythrodiol and uvaol, which are the main triterpenic compounds present in the fruits and leaves of Olea europaea L. A Zorbax Eclipse PAH column at 30°C with mobile phase of water (17%) and methanol (83%) at 0.8mL/min conformed the optimal chromatographic conditions that allowed the separation of the compounds of interest, two pairs of which are isomers differing only in the position of one methyl group (oleanolic-ursolic and erythrodiol-uvaol). The ionization was performed in an APCI source at 450°C programmed in negative mode for the triterpenic acids, and in positive for the alcohols. An ion trap (LC-IT-MS) and a triple quadrupole (LC-QqQ-MS) were assessed for maximal sensitivity that was achieved with LC-QqQ-MS. The LODs of triterpenic acids were lower than 1nM, whereas for erythrodiol and uvaol were 4.5 and 7.5nM, respectively. The method was linear for the five analytes in the range of concentrations from 0.005 to 15μM with correlation coefficients exceeding 0.99. The precision and accuracy were ≤9.90% and ≤9.57%, respectively. The applicability of the validated method was assessed in the analysis of the pentacyclic triterpenes in Marfil table olives, after the optimization of the extraction procedure. The developed method constitutes the first step for future studies of triterpenic compounds present in foods that would allow establishing their effects on human health. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Identification of new polymorphic regions and differentiation of cultivated olives (Olea europaea L.) through plastome sequence comparison

    Science.gov (United States)

    2010-01-01

    Background The cultivated olive (Olea europaea L.) is the most agriculturally important species of the Oleaceae family. Although many studies have been performed on plastid polymorphisms to evaluate taxonomy, phylogeny and phylogeography of Olea subspecies, only few polymorphic regions discriminating among the agronomically and economically important olive cultivars have been identified. The objective of this study was to sequence the entire plastome of olive and analyze many potential polymorphic regions to develop new inter-cultivar genetic markers. Results The complete plastid genome of the olive cultivar Frantoio was determined by direct sequence analysis using universal and novel PCR primers designed to amplify all overlapping regions. The chloroplast genome of the olive has an organisation and gene order that is conserved among numerous Angiosperm species and do not contain any of the inversions, gene duplications, insertions, inverted repeat expansions and gene/intron losses that have been found in the chloroplast genomes of the genera Jasminum and Menodora, from the same family as Olea. The annotated sequence was used to evaluate the content of coding genes, the extent, and distribution of repeated and long dispersed sequences and the nucleotide composition pattern. These analyses provided essential information for structural, functional and comparative genomic studies in olive plastids. Furthermore, the alignment of the olive plastome sequence to those of other varieties and species identified 30 new organellar polymorphisms within the cultivated olive. Conclusions In addition to identifying mutations that may play a functional role in modifying the metabolism and adaptation of olive cultivars, the new chloroplast markers represent a valuable tool to assess the level of olive intercultivar plastome variation for use in population genetic analysis, phylogenesis, cultivar characterisation and DNA food tracking. PMID:20868482

  13. Cold perception and gene expression differ in Olea europaea seed coat and embryo during drupe cold acclimation.

    Science.gov (United States)

    D'Angeli, S; Falasca, G; Matteucci, M; Altamura, M M

    2013-01-01

    FAD2 and FAD7 desaturases are involved in cold acclimation of olive (Olea europaea) mesocarp. There is no research information available on cold acclimation of seeds during mesocarp cold acclimation or on differences in the cold response of the seed coat and embryo. How FAD2 and FAD7 affect seed coat and embryo cold responses is unknown. Osmotin positively affects cold acclimation in olive tree vegetative organs, but its role in the seeds requires investigation. OeFAD2.1, OeFAD2.2, OeFAD7 and Oeosmotin were investigated before and after mesocarp acclimation by transcriptomic, lipidomic and immunolabelling analyses, and cytosolic calcium concentration ([Ca(2+)](cyt)) signalling, F-actin changes and seed development were investigated by epifluorescence/histological analyses. Transient [Ca(2+)](cyt) rises and F-actin disassembly were found in cold-shocked protoplasts from the seed coat, but not from the embryo. The thickness of the outer endosperm cuticle increased during drupe exposure to lowering of temperature, whereas the embryo protoderm always lacked cuticle. OeFAD2 transcription increased in both the embryo and seed coat in the cold-acclimated drupe, but linoleic acid (i.e. the product of FAD2 activity) increased solely in the seed coat. Osmotin was immunodetected in the seed coat and endosperm of the cold-acclimated drupe, and not in the embryo. The results show cold responsiveness in the seed coat and cold tolerance in the embryo. We propose a role for the seed coat in maintaining embryo cold tolerance by increasing endosperm cutinization through FAD2 and osmotin activities. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.

  14. Construction of Core Collections Suitable for Association Mapping to Optimize Use of Mediterranean Olive (Olea europaea L.) Genetic Resources

    Science.gov (United States)

    El Bakkali, Ahmed; Haouane, Hicham; Moukhli, Abdelmajid; Costes, Evelyne; Van Damme, Patrick; Khadari, Bouchaib

    2013-01-01

    Phenotypic characterisation of germplasm collections is a decisive step towards association mapping analyses, but it is particularly expensive and tedious for woody perennial plant species. Characterisation could be more efficient if focused on a reasonably sized subset of accessions, or so-called core collection (CC), reflecting the geographic origin and variability of the germplasm. The questions that arise concern the sample size to use and genetic parameters that should be optimized in a core collection to make it suitable for association mapping. Here we investigated these questions in olive (Olea europaea L.), a perennial fruit species. By testing different sampling methods and sizes in a worldwide olive germplasm bank (OWGB Marrakech, Morocco) containing 502 unique genotypes characterized by nuclear and plastid loci, a two-step sampling method was proposed. The Shannon-Weaver diversity index was found to be the best criterion to be maximized in the first step using the Core Hunter program. A primary core collection of 50 entries (CC50) was defined that captured more than 80% of the diversity. This latter was subsequently used as a kernel with the Mstrat program to capture the remaining diversity. 200 core collections of 94 entries (CC94) were thus built for flexibility in the choice of varieties to be studied. Most entries of both core collections (CC50 and CC94) were revealed to be unrelated due to the low kinship coefficient, whereas a genetic structure spanning the eastern and western/central Mediterranean regions was noted. Linkage disequilibrium was observed in CC94 which was mainly explained by a genetic structure effect as noted for OWGB Marrakech. Since they reflect the geographic origin and diversity of olive germplasm and are of reasonable size, both core collections will be of major interest to develop long-term association studies and thus enhance genomic selection in olive species. PMID:23667437

  15. Peroxynitrite mediates programmed cell death both in papillar cells and in self-incompatible pollen in the olive (Olea europaea L.)

    Science.gov (United States)

    Serrano, Irene; Romero-Puertas, María C.; Rodríguez-Serrano, María; Sandalio, Luisa M.; Olmedilla, Adela

    2012-01-01

    Programmed cell death (PCD) has been found to be induced after pollination both in papillar cells and in self-incompatible pollen in the olive (Olea europaea L.). Reactive oxygen species (ROS) and nitric oxide (NO) are known to be produced in the pistil and pollen during pollination but their contribution to PCD has so far remained elusive. The possible role of ROS and NO was investigated in olive pollen–pistil interaction during free and controlled pollination and it was found that bidirectional interaction appears to exist between the pollen and the stigma, which seems to regulate ROS and NO production. Biochemical evidence strongly suggesting that both O2˙− and NO are essential for triggering PCD in self-incompatibility processes was also obtained. It was observed for the first time that peroxynitrite, a powerful oxidizing and nitrating agent generated during a rapid reaction between O2˙− and NO, is produced during pollination and that this is related to an increase in protein nitration which, in turn, is strongly associated with PCD. It may be concluded that peroxynitrite mediates PCD during pollen–pistil interaction in Olea europaea L. both in self-incompatible pollen and papillar cells. PMID:22140239

  16. Partial Root-Zone Drying of Olive (Olea europaea var. 'Chetoui' Induces Reduced Yield under Field Conditions.

    Directory of Open Access Journals (Sweden)

    Soumaya Dbara

    Full Text Available The productivity of olive trees in arid and semi-arid environments is closely linked to irrigation. It is necessary to improve the efficiency of irrigation techniques to optimise the amount of olive fruit produced in relation to the volume of water used. Partial root-zone drying (PRD is a water saving irrigation technique that theoretically allows the production of a root-to-shoot signal that modifies the physiology of the above-ground parts of the plant; specifically reducing stomatal conductance (gs and improving water use efficiency (WUE. Partial root-zone drying has been successfully applied under field conditions to woody and non-woody crops; yet the few previous trials with olive trees have produced contrasting results. Thirty year-old olive trees (Olea europaea 'var. Chetoui' in a Tunisian grove were exposed to four treatments from May to October for three-years: 'control' plants received 100% of the potential evapotranspirative demand (ETc applied to the whole root-zone; 'PRD100' were supplied with an identical volume of water to the control plants alternated between halves of the root-zone every ten-days; 'PRD50' were given 50% of ETc to half of the root-system, and; 'rain-fed' plants received no supplementary irrigation. Allowing part of the root-zone to dry resulted in reduced vegetative growth and lower yield: PRD100 decreased yield by ~47% during productive years. During the less productive years of the alternate bearing cycle, irrigation had no effect on yield; this suggests that withholding of water during 'off-years' may enhance the effectiveness of irrigation over a two-year cycle. The amount and quality of oil within the olive fruit was unaffected by the irrigation treatment. Photosynthesis declined in the PRD50 and rain-fed trees due to greater diffusive limitations and reduced biochemical uptake of CO2. Stomatal conductance and the foliar concentration of abscisic acid (ABA were not altered by PRD100 irrigation, which may

  17. Partial Root-Zone Drying of Olive (Olea europaea var. 'Chetoui') Induces Reduced Yield under Field Conditions.

    Science.gov (United States)

    Dbara, Soumaya; Haworth, Matthew; Emiliani, Giovani; Ben Mimoun, Mehdi; Gómez-Cadenas, Aurelio; Centritto, Mauro

    2016-01-01

    The productivity of olive trees in arid and semi-arid environments is closely linked to irrigation. It is necessary to improve the efficiency of irrigation techniques to optimise the amount of olive fruit produced in relation to the volume of water used. Partial root-zone drying (PRD) is a water saving irrigation technique that theoretically allows the production of a root-to-shoot signal that modifies the physiology of the above-ground parts of the plant; specifically reducing stomatal conductance (gs) and improving water use efficiency (WUE). Partial root-zone drying has been successfully applied under field conditions to woody and non-woody crops; yet the few previous trials with olive trees have produced contrasting results. Thirty year-old olive trees (Olea europaea 'var. Chetoui') in a Tunisian grove were exposed to four treatments from May to October for three-years: 'control' plants received 100% of the potential evapotranspirative demand (ETc) applied to the whole root-zone; 'PRD100' were supplied with an identical volume of water to the control plants alternated between halves of the root-zone every ten-days; 'PRD50' were given 50% of ETc to half of the root-system, and; 'rain-fed' plants received no supplementary irrigation. Allowing part of the root-zone to dry resulted in reduced vegetative growth and lower yield: PRD100 decreased yield by ~47% during productive years. During the less productive years of the alternate bearing cycle, irrigation had no effect on yield; this suggests that withholding of water during 'off-years' may enhance the effectiveness of irrigation over a two-year cycle. The amount and quality of oil within the olive fruit was unaffected by the irrigation treatment. Photosynthesis declined in the PRD50 and rain-fed trees due to greater diffusive limitations and reduced biochemical uptake of CO2. Stomatal conductance and the foliar concentration of abscisic acid (ABA) were not altered by PRD100 irrigation, which may indicate the

  18. Genome-wide identification of alternate bearing-associated microRNAs (miRNAs) in olive (Olea europaea L.)

    Science.gov (United States)

    2013-01-01

    Background Alternate bearing is a widespread phenomenon among crop plants, defined as the tendency of certain fruit trees to produce a high-yield crop one year ("on-year"), followed by a low-yield or even no crop the following year ("off-year"). Several factors may affect the balance between such developmental phase-transition processes. Among them are the microRNA (miRNA), being gene-expression regulators that have been found to be involved as key determinants in several physiological processes. Results Six olive (Olea europaea L. cv. Ayvalik variety) small RNA libraries were constructed from fruits (ripe and unripe) and leaves (”on year” and ”off year” leaves in July and in November, respectively) and sequenced by high-throughput Illumina sequencing. The RNA was retrotranscribed and sequenced using the high-throughput Illumina platform. Bioinformatics analyses of 93,526,915 reads identified 135 conserved miRNA, belonging to 22 miRNA families in the olive. In addition, 38 putative novel miRNAs were discovered in the datasets. Expression of olive tree miRNAs varied greatly among the six libraries, indicating the contribution of diverse miRNA in balancing between reproductive and vegetative phases. Predicted targets of miRNA were categorized into 108 process ontology groups with significance abundance. Among those, potential alternate bearing-associated processes were found, such as development, hormone-mediated signaling and organ morphogenesis. The KEGG analyses revealed that the miRNA-targeted genes are involved in seven main pathways, belonging to carbohydrate metabolism and hormone signal-transduction pathways. Conclusion A comprehensive study on olive miRNA related to alternate bearing was performed. Regulation of miRNA under different developmental phases and tissues indicated that control of nutrition and hormone, together with flowering processes had a noteworthy impact on the olive tree alternate bearing. Our results also provide significant data

  19. Clinical manifestations of peripheral nervous system involvement in human chronic chagas disease Manifestaciones clinicas de compromiso del sistema nervioso periférico en el estádio crônico de la enfermedad de Chagas

    Directory of Open Access Journals (Sweden)

    Osvaldo Genovese

    1996-06-01

    Full Text Available We conducted a clinical and electromyographical study in patients with Chagas' disease in the indeterminate or chronic stages of the illness. Altogether 841 patients were examined. Only 511 were admitted within the protocol; the remainder patients were rejected because they showed other causes able to damage the nervous system. Fifty two (10.17% out of the 511 patients showed signs and symptoms of peripheral nervous system involvement in the form of sensory impairment and diminished tendon jerks suggesting the presence of neuropathy. Forty five of them were submitted to a conventional electromyographical examination. Fifteen of mem showed normal results, while the remainder 30 disclosed a reduced interference pattern, being most of the remaining motor unit potentials fragmented or poliphasic, reduced sensory and motor conduction velocities and diminished amplitude of the sensory action potential. The findings suggest that some chagasic patients in the indeterminate or chronic stages of the disease may develop a clinical mild sensory-motor peripheral neuropathy.El estúdio presente fue diseftado con ei objeto de pesquizar Ia existência de manifestaciones clinicas en pacientes afectados por enfermedad de Chagas, en estádio indeterminado o crônico, que tuviesen, ai menos, 2 reacciones serologicas positivas. En total fueron examinados 841 enfermos. De ellos solo 511 fueron admitidos en ei protocolo; los restantes fueron rechazados por mostrar Ia presencia de otras causas que hubiesen podido danar su sistema nervioso. Dentro de los 511 pacientes admitidos, 52 (10.17% evidenciaron alteraciones objetivas y subjetivas de Ia sensibilidad y disminucion de los reflejos osteotendinosos. Estos signos y sintomas, que sugieren la presencia de neuropatia, podian combinarse de diferente manera. Como complemento dei examen clinico, se efectuo estúdio electromiografico convencional en 45 de estos pacientes. En 15 los hallazgos fueron normales, en tanto que en

  20. Olive tree (Olea europaea L.) leaf as a waste by-product of table olive and olive oil industry: a review.

    Science.gov (United States)

    Şahin, Selin; Bilgin, Mehmet

    2018-03-01

    Research into finding new uses for by-products of table olive and olive oil industry are of great value not only to the economy but also to the environment where olives are grown and to the human health. Since leaves represent around 10% of the total weight of olives arriving at the mill, it is worth obtaining high added-value compounds from those materials for the preparation of dietary supplements, nutraceuticals, functional food ingredients or cosmeceuticals. In this review article, olive tree (Olea europaea L.) leaf is reviewed as being a potential inexpensive, renewable and abundant source of biophenols. The importance of this agricultural and industrial waste is emphasised by means of describing its availability, nutritional and therapeutic effects and studies conducted on this field. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  1. Steady-State Growth under Inorganic Carbon Limitation Conditions Increases Energy Consumption for Maintenance and Enhances Nitrous Oxide Production in Nitrosomonas europaea.

    Science.gov (United States)

    Mellbye, Brett L; Giguere, Andrew; Chaplen, Frank; Bottomley, Peter J; Sayavedra-Soto, Luis A

    2016-06-01

    Nitrosomonas europaea is a chemolithoautotrophic bacterium that oxidizes ammonia (NH3) to obtain energy for growth on carbon dioxide (CO2) and can also produce nitrous oxide (N2O), a greenhouse gas. We interrogated the growth, physiological, and transcriptome responses of N. europaea to conditions of replete (>5.2 mM) and limited inorganic carbon (IC) provided by either 1.0 mM or 0.2 mM sodium carbonate (Na2CO3) supplemented with atmospheric CO2 IC-limited cultures oxidized 25 to 58% of available NH3 to nitrite, depending on the dilution rate and Na2CO3 concentration. IC limitation resulted in a 2.3-fold increase in cellular maintenance energy requirements compared to those for NH3-limited cultures. Rates of N2O production increased 2.5- and 6.3-fold under the two IC-limited conditions, increasing the percentage of oxidized NH3-N that was transformed to N2O-N from 0.5% (replete) up to 4.4% (0.2 mM Na2CO3). Transcriptome analysis showed differential expression (P ≤ 0.05) of 488 genes (20% of inventory) between replete and IC-limited conditions, but few differences were detected between the two IC-limiting treatments. IC-limited conditions resulted in a decreased expression of ammonium/ammonia transporter and ammonia monooxygenase subunits and increased the expression of genes involved in C1 metabolism, including the genes for RuBisCO (cbb gene cluster), carbonic anhydrase, folate-linked metabolism of C1 moieties, and putative C salvage due to oxygenase activity of RuBisCO. Increased expression of nitrite reductase (gene cluster NE0924 to NE0927) correlated with increased production of N2O. Together, these data suggest that N. europaea adapts physiologically during IC-limited steady-state growth, which leads to the uncoupling of NH3 oxidation from growth and increased N2O production. Nitrification, the aerobic oxidation of ammonia to nitrate via nitrite, is an important process in the global nitrogen cycle. This process is generally dependent on ammonia

  2. Olea europaea leaf extract and bevacizumab synergistically exhibit beneficial efficacy upon human glioblastoma cancer stem cells through reducing angiogenesis and invasion in vitro.

    Science.gov (United States)

    Tezcan, Gulcin; Taskapilioglu, Mevlut Ozgur; Tunca, Berrin; Bekar, Ahmet; Demirci, Hilal; Kocaeli, Hasan; Aksoy, Secil Ak; Egeli, Unal; Cecener, Gulsah; Tolunay, Sahsine

    2017-06-01

    Patients with glioblastoma multiforme (GBM) that are cancer stem-cell-positive (GSC [+]) essentially cannot benefit from anti-angiogenic or anti-invasive therapy. In the present study, the potential anti-angiogenic and anti-invasive effects of Olea europaea (olive) leaf extract (OLE) were tested using GSC (+) tumours. OLE (2mg/mL) caused a significant reduction in tumour weight, vascularisation, invasiveness and migration (p=0.0001, p<0.001, p=0.004; respectively) that was associated with reducing the expression of VEGFA, MMP-2 and MMP-9. This effect was synergistically increased in combination with bevacizumab. Therefore, our current findings may contribute to research on drugs that inhibit the invasiveness of GBM. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  3. The expression of light-related leaf functional traits depends on the location of individual leaves within the crown of isolated Olea europaea trees.

    Science.gov (United States)

    Escribano-Rocafort, Adrián G; Ventre-Lespiaucq, Agustina B; Granado-Yela, Carlos; Rubio de Casas, Rafael; Delgado, Juan A; Balaguer, Luis

    2016-04-01

    The spatial arrangement and expression of foliar syndromes within tree crowns can reflect the coupling between crown form and function in a given environment. Isolated trees subjected to high irradiance and concomitant stress may adjust leaf phenotypes to cope with environmental gradients that are heterogeneous in space and time within the tree crown. The distinct expression of leaf phenotypes among crown positions could lead to complementary patterns in light interception at the crown scale. We quantified eight light-related leaf traits across 12 crown positions of ten isolated Olea europaea trees in the field. Specifically, we investigated whether the phenotypic expression of foliar traits differed among crown sectors and layers and five periods of the day from sunrise to sunset. We investigated the consequences in terms of the exposed area of the leaves at the tree scale during a single day. All traits differed among crown positions except the length-to-width ratio of the leaves. We found a strong complementarity in the patterns of the potential exposed area of the leaves among day periods as a result of a non-random distribution of leaf angles across the crown. Leaf exposure at the outer layer was below 60 % of the displayed surface, reaching maximum interception during morning periods. Daily interception increased towards the inner layer, achieving consecutive maximization from east to west positions within the crown, matching the sun's trajectory. The expression of leaf traits within isolated trees of O. europaea varies continuously through the crown in a gradient of leaf morphotypes and leaf angles depending on the exposure and location of individual leaves. The distribution of light-related traits within the crown and the complementarity in the potential exposure patterns of the leaves during the day challenges the assumption of low trait variability within individuals. © The Author 2016. Published by Oxford University Press on behalf of the Annals of

  4. Composition, quality and oxidative stability of virgin olive oils from some selected wild olives (Olea europaea L. subsp. oleaster

    Directory of Open Access Journals (Sweden)

    Zarrouk, Mokhtar

    2008-12-01

    Full Text Available A study on the characterization of virgin olive oils from wild olives (Olea europaea L. subsp. oleaster was conducted in order to define new cultivars which are welladapted to the Tunisian environment and yield high quality oils. The study was done during the crop years 2003/04, 2004/05 and 2005/06. The main analytical parameters of the oils were evaluated: fatty acid compositions, chlorophylls, carotenoids, tocopherols and phenolic compounds as well as their relationship with oxidative stability. The fatty acid composition of all the wild olive trees tested produced virgin olive oil which complies with commercial standards, as well as for their appreciable amounts of tocopherols and phenolic compounds. Tocopherol analysis by HPLC revealed the presence of α, β, γ and δ tocopherols in all the studied olive oils. Total tocopherol content was significantly influenced by the varietal factor. It ranged from 310 (SB12 to 780 mg/kg (H3. As for total tocopherols, the amount of each tocopherol varied according to genotype. α tocopherol is the most prominent, whereas β, γ and δ tocopherols are less represented. Results showed a clear influence of total phenols and o-diphenols on virgin olive oil stability (R = 0.905, 0.963 P En este trabajo se han caracterizado los aceites obtenidos a partir de siete acebuches previamente seleccionados entre varias poblaciones de Olea europea L. Subsp. oleaster. El estudio se llevó a cabo durante las campañas de producción 2003/04, 2004/05 y 2005/06.Varios parámetros analíticos fueron evaluados: composiciones en ácidos grasos, pigmentos, tocoferoles, fenoles; así mismo, se investigó la relación de estos parámetros con la estabilidad de los aceites. Los resultados obtenidos mostraron que todas las muestras de frutos de acebuche produjeron aceites cuya composición de ácidos grasos, tocoferoles y compuestos fenólicos cumplió las normas comerciales para aceite de oliva virgen del Comit

  5. Influence of inorganic and organic amendments in the soil properties and the growth and survival of Olea Europaea var. Sylvestris in the semiarid Mediterranean area

    Science.gov (United States)

    Ortega, Raúl; Miralles, Isabel; Anguita-Maeso, Manuel; Domene, Miguel; Soriano, Miguel

    2017-04-01

    Selecting the most appropriate types of plants adapted to the harsh climatic conditions of restoring drylands is essential to success in landscape restoration. Besides improving soil quality is a key factor to consider when designing the restoration procedures. The use of organic and inorganic amendments can help with this task. On this study, we evaluated the influence of different mineral (clays) and organic (compost and poultry) amendments on the properties of a bare soil and how this influenced on the growth and survival of the Olea europaea var. sylvestrys, a perennial bush plant adapted to the Mediterranean semi-arid zone. Tests were designed and carried out in a greenhouse at the "Experimental Station of Cajamar foundation "Las Palmerillas" in El Ejido (Almería, Spain). Plants were grown in 250L pots and their substrate was bare soil and mineral and/or organic amendments. The experimental design consisted of three replicas for five treatments: 1. compost, 2. "ZeoPro", a cliptonolite commercial clay, 3. mordenite clay from local quarries plus compost, 4. cliptonolite clay from Turkey plus compost, 5. cliptonolite from Turquey plus poultry; with four levels each one: 5%, 10%, 20%, 30% volume of amendment. Including three control samples without amendment total plants accounted for 63. Climatic sensors inside and outside the greenhouse permitted to establish the same meteorological conditions for the plants and only emergency watering was supplied when necessary for the survival of the plants when arid conditions were extreme. The physico-chemical soil properties of each treatment and level were analyzed before planting and the biovolume and the survival rates of the plants were measured regularly along eleven months. Statistically the best treatment for the growing of the plants was number 3 (mordenite and compost) with no deaths recorded. According to the growing rates the best level was soil with 20% of amendment. Besides we analyzed the evolution of the

  6. Specific Fluorescence in Situ Hybridization (FISH) Test to Highlight Colonization of Xylem Vessels by Xylella fastidiosa in Naturally Infected Olive Trees (Olea europaea L.)

    Science.gov (United States)

    Cardinale, Massimiliano; Luvisi, Andrea; Meyer, Joana B.; Sabella, Erika; De Bellis, Luigi; Cruz, Albert C.; Ampatzidis, Yiannis; Cherubini, Paolo

    2018-01-01

    The colonization behavior of the Xylella fastidiosa strain CoDiRO, the causal agent of olive quick decline syndrome (OQDS), within the xylem of Olea europaea L. is still quite controversial. As previous literature suggests, even if xylem vessel occlusions in naturally infected olive plants were observed, cell aggregation in the formation of occlusions had a minimal role. This observation left some open questions about the whole behavior of the CoDiRO strain and its actual role in OQDS pathogenesis. In order to evaluate the extent of bacterial infection in olive trees and the role of bacterial aggregates in vessel occlusions, we tested a specific fluorescence in situ hybridization (FISH) probe (KO 210) for X. fastidiosa and quantified the level of infection and vessel occlusion in both petioles and branches of naturally infected and non-infected olive trees. All symptomatic petioles showed colonization by X. fastidiosa, especially in the larger innermost vessels. In several cases, the vessels appeared completely occluded by a biofilm containing bacterial cells and extracellular matrix and the frequent colonization of adjacent vessels suggested a horizontal movement of the bacteria. Infected symptomatic trees had 21.6 ± 10.7% of petiole vessels colonized by the pathogen, indicating an irregular distribution in olive tree xylem. Thus, our observations point out the primary role of the pathogen in olive vessel occlusions. Furthermore, our findings indicate that the KO 210 FISH probe is suitable for the specific detection of X. fastidiosa. PMID:29681910

  7. Vulnerability to cavitation in Olea europaea current-year shoots: further evidence of an open-vessel artifact associated with centrifuge and air-injection techniques.

    Science.gov (United States)

    Torres-Ruiz, José M; Cochard, Hervé; Mayr, Stefan; Beikircher, Barbara; Diaz-Espejo, Antonio; Rodriguez-Dominguez, Celia M; Badel, Eric; Fernández, José Enrique

    2014-11-01

    Different methods have been devised to analyze vulnerability to cavitation of plants. Although a good agreement between them is usually found, some discrepancies have been reported when measuring samples from long-vesseled species. The aim of this study was to evaluate possible artifacts derived from different methods and sample sizes. Current-year shoot segments of mature olive trees (Olea europaea), a long-vesseled species, were used to generate vulnerability curves (VCs) by bench dehydration, pressure collar and both static- and flow-centrifuge methods. For the latter, two different rotors were used to test possible effects of the rotor design on the curves. Indeed, high-resolution computed tomography (HRCT) images were used to evaluate the functional status of xylem at different water potentials. Measurements of native embolism were used to validate the methods used. The pressure collar and the two centrifugal methods showed greater vulnerability to cavitation than the dehydration method. The shift in vulnerability thresholds in centrifuge methods was more pronounced in shorter samples, supporting the open-vessel artifact hypothesis as a higher proportion of vessels were open in short samples. The two different rotor designs used for the flow-centrifuge method revealed similar vulnerability to cavitation. Only the bench dehydration or HRCT methods produced VCs that agreed with native levels of embolism and water potential values measured in the field. © 2014 Scandinavian Plant Physiology Society.

  8. Variability of Virgin Olive Oil Phenolic Compounds in a Segregating Progeny from a Single Cross in Olea europaea L. and Sensory and Nutritional Quality Implications

    Science.gov (United States)

    Pérez, Ana G.; León, Lorenzo; Pascual, Mar; Romero-Segura, Carmen; Sánchez-Ortiz, Araceli; de la Rosa, Raúl; Sanz, Carlos

    2014-01-01

    Virgin olive oil phenolic compounds are responsible for its nutritional and sensory quality. The synthesis of phenolic compounds occurs when enzymes and substrates meet as olive fruit is crushed during the industrial process to obtain the oil. The genetic variability of the major phenolic compounds of virgin olive oil was studied in a progeny of the cross of Picual x Arbequina olive cultivars (Olea europaea L.). They belong to four different groups: compounds that included tyrosol or hydroxytyrosol in their molecules, lignans, flavonoids, and phenolic acids. Data of phenolics in the oils showed that the progeny displayed a large degree of variability, widely transgressing the genitor levels. This high variability can be of interest on breeding programs. Thus, multivariate analysis allowed to identify genotypes within the progeny particularly interesting in terms of phenolic composition and deduced organoleptic and nutritional quality. The present study has demonstrated that it is possible to obtain enough degree of variability with a single cross of olive cultivars for compounds related to the nutritional and organoleptic properties of virgin olive oil. PMID:24651694

  9. AOX1-Subfamily Gene Members in Olea europaea cv. "Galega Vulgar"-Gene Characterization and Expression of Transcripts during IBA-Induced in Vitro Adventitious Rooting.

    Science.gov (United States)

    Velada, Isabel; Grzebelus, Dariusz; Lousa, Diana; M Soares, Cláudio; Santos Macedo, Elisete; Peixe, Augusto; Arnholdt-Schmitt, Birgit; G Cardoso, Hélia

    2018-02-17

    Propagation of some Olea europaea L. cultivars is strongly limited due to recalcitrant behavior in adventitious root formation by semi-hardwood cuttings. One example is the cultivar "Galega vulgar". The formation of adventitious roots is considered a morphological response to stress. Alternative oxidase (AOX) is the terminal oxidase of the alternative pathway of the plant mitochondrial electron transport chain. This enzyme is well known to be induced in response to several biotic and abiotic stress situations. This work aimed to characterize the alternative oxidase 1 (AOX1)-subfamily in olive and to analyze the expression of transcripts during the indole-3-butyric acid (IBA)-induced in vitro adventitious rooting (AR) process. OeAOX1a (acc. no. MF410318) and OeAOX1d (acc. no. MF410319) were identified, as well as different transcript variants for both genes which resulted from alternative polyadenylation events. A correlation between transcript accumulation of both OeAOX1a and OeAOX1d transcripts and the three distinct phases (induction, initiation, and expression) of the AR process in olive was observed. Olive AOX1 genes seem to be associated with the induction and development of adventitious roots in IBA-treated explants. A better understanding of the molecular mechanisms underlying the stimulus needed for the induction of adventitious roots may help to develop more targeted and effective rooting induction protocols in order to improve the rooting ability of difficult-to-root cultivars.

  10. Thermal stability of oils added with avocado (Persea americana cv. Hass) or olive (Olea europaea cv. Arbequina) leaf extracts during the French potatoes frying.

    Science.gov (United States)

    Jiménez, Paula; García, Paula; Bustamante, Andrés; Barriga, Andrés; Robert, Paz

    2017-04-15

    Effect of the addition of avocado (Persea americana cv. Hass) or olive (Olea europaea cv. Arbequina) hydroalcoholic leaf extracts (AHE and OHE, respectively) on thermal stability of canola oil (CO) and high oleic sunflower oil (HOSO) during French potatoes frying at 180°C was studied. The extracts were characterized by the total phenolic content, phenol chromatographic profiles and antioxidant activity. B-type trimer procyanidins were the major phenolic compounds identified in AHE. OHE showed higher phenol content, antioxidant activity regarding AHE. CO+OHE and HOSO+OHE decreased the formation of polar compounds and showed an anti-polymeric effect with respect to oils without extracts, whereas AHE extract showed a prooxidant effect on HOSO. Therefore, OHE showed an antioxidant effect on HOSO and CO under the studied conditions. In addition, all systems (CO+AHE, HOSO+AHE, CO+OHE and HOSO+OHE) increased the retention of tocopherols. These results demonstrate the potential utility of OHE as natural antioxidant for oils. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Changes in olive oil volatile organic compounds induced by water status and light environment in canopies of Olea europaea L. trees.

    Science.gov (United States)

    Benelli, Giovanni; Caruso, Giovanni; Giunti, Giulia; Cuzzola, Angela; Saba, Alessandro; Raffaelli, Andrea; Gucci, Riccardo

    2015-09-01

    Light and water are major factors in fruit development and quality. In this study, the effect of water and light in Olea europaea trees on volatile organic compounds (VOCs) in olive oil was studied over 2 years. Mature fruits were harvested from three zones of the canopy with different light exposure (64%, 42% and 30% of incident light) of trees subjected to full, deficit or complementary irrigation. VOCs were determined by SPME GC-MS and analysed by principal component analysis followed by discriminant analysis to partition treatment effects. Fruit fresh weight and mesocarp oil content decreased in zones where intercepted light was less. Low light levels significantly slowed down fruit maturation, whereas conditions of water deficit accelerated the maturation process. The presence of cyclosativene and α-muurulene was associated with water deficit, nonanal, valencene with full irrigation; α-muurulene, (E)-2-hexanal were related to low light conditions, while trans-β-ocimene, α-copaene, (Z)-2-penten-1-ol, hexanal and nonanal to well exposed zones. The year strongly affected the VOC profile of olive oil. This is the first report on qualitative changes in VOCs induced by light environment and/or water status. This information is valuable to better understand the role of environmental factors on the sensory quality of virgin olive oil. © 2014 Society of Chemical Industry.

  12. Colonization of olive trees (Olea europaea L.) with the arbuscular mycorrhizal fungus Glomus sp. modified the glycolipids biosynthesis and resulted in accumulation of unsaturated fatty acids.

    Science.gov (United States)

    Mechri, Beligh; Attia, Faouzi; Tekaya, Meriem; Cheheb, Hechmi; Hammami, Mohamed

    2014-09-01

    The influence of arbuscular mycorrhizal (AM) fungi colonization on photosynthesis, mineral nutrition, the amount of phospholipids and glycolipids in the leaves of olive (Olea europaea L.) trees was investigated. After six months of growth, the rate of photosynthesis, carboxylation efficiency, transpiration and stomatal conductance in mycorrhizal (M) plants was significantly higher than that of non-mycorrhizal (NM) plants. The inoculation treatment increased the foliar P and Mg but not N. The amount of glycolipids in the leaves of M plants was significantly higher than that of NM plants. However, the amount of phospholipids in the leaves of M plants was not significantly different to that in the leaves of NM plants. Also, we observed a significant increase in the level of α-linolenic acid (C18:3ω3) in glycolipids of M plants. This work supports the view that increased glycolipids level in the leaves of M plants could be involved, at least in part, in the beneficial effects of mycorrhizal colonization on photosynthesis performance of olive trees. To our knowledge, this is the first report on the effect of AM fungi on the amount of glycolipids in the leaves of mycorrhizal plants. Copyright © 2014 Elsevier GmbH. All rights reserved.

  13. Endophytic colonization and biocontrol performance of Pseudomonas fluorescens PICF7 in olive (Olea europaea L.) are determined neither by pyoverdine production nor swimming motility.

    Science.gov (United States)

    Maldonado-González, M Mercedes; Schilirò, Elisabetta; Prieto, Pilar; Mercado-Blanco, Jesús

    2015-09-01

    Pseudomonas fluorescens PICF7 is an indigenous inhabitant of olive (Olea europaea L.) rhizosphere, able to display endophytic lifestyle in roots, to induce a wide range of defence responses upon colonization of this organ and to exert effective biological control against Verticillium wilt of olive (VWO) (Verticillium dahliae). We aimed to evaluate the involvement of specific PICF7 phenotypes in olive root colonization and VWO biocontrol effectiveness by generating mutants impaired in swimming motility (fliI) or siderophore pyoverdine production (pvdI). Besides, the performance of mutants with diminished in vitro growth in potato dextrose agar medium (gltA) and cysteine (Cys) auxotrophy was also assessed. Results showed that olive root colonization and VWO biocontrol ability of the fliI, pvdI and gltA mutants did not significantly differ from that displayed by the parental strain PICF7. Consequently, altered in vitro growth, swimming motility and pyoverdine production contribute neither to PICF7 VWO suppressive effect nor to its colonization ability. In contrast, the Cys auxotroph mutant showed reduced olive root colonization capacity and lost full biocontrol efficacy. Moreover, confocal laser scanning microscopy revealed that all mutants tested were able to endophytically colonize root tissue to the same extent as wild-type PICF7, discarding these traits as relevant for its endophytic lifestyle. © 2014 Society for Applied Microbiology and John Wiley & Sons Ltd.

  14. Lipophilization of Hydroxytyrosol-Enriched Fractions from Olea europaea L. Byproducts and Evaluation of the in Vitro Effects on a Model of Colorectal Cancer Cells.

    Science.gov (United States)

    Bernini, Roberta; Carastro, Isabella; Palmini, Gaia; Tanini, Annalisa; Zonefrati, Roberto; Pinelli, Patrizia; Brandi, Maria Luisa; Romani, Annalisa

    2017-08-09

    A hydroxytyrosol (HTyr)-enriched fraction containing HTyr 6% w/w, derived from Olea europaea L. byproducts and obtained using an environmentally and economically sustainable technology, was lipophilized under green chemistry conditions. The effects of three fractions containing hydroxytyrosyl butanoate, octanoate, and oleate, named, respectively, lipophilic fractions 5, 6, and 7, and unreacted HTyr on the human colon cancer cell line HCT8-β8 engineered to overexpress estrogen receptor β (ERβ) were evaluated and compared to those of pure HTyr. The experimental data demonstrated that HTyr and all fractions showed an antiproliferative effect, as had been observed by the evaluation of the cellular doubling time under these different conditions (mean control, 32 ± 4 h; HTyr 1, 65 ± 9 h; fraction 5, 64 ± 11 h; fraction 6, 62 ± 14 h; fraction 7, 133 ± 30 h). As evidenced, fraction 7 containing hydroxytyrosyl oleate showed the highest activity. These results were related to the link with ER-β, which was assessed through simultaneous treatment with an inhibitor of ERβ.

  15. Evaluation of RNA extraction methods and identification of putative reference genes for real-time quantitative polymerase chain reaction expression studies on olive (Olea europaea L.) fruits.

    Science.gov (United States)

    Nonis, Alberto; Vezzaro, Alice; Ruperti, Benedetto

    2012-07-11

    Genome wide transcriptomic surveys together with targeted molecular studies are uncovering an ever increasing number of differentially expressed genes in relation to agriculturally relevant processes in olive (Olea europaea L). These data need to be supported by quantitative approaches enabling the precise estimation of transcript abundance. qPCR being the most widely adopted technique for mRNA quantification, preliminary work needs to be done to set up robust methods for extraction of fully functional RNA and for the identification of the best reference genes to obtain reliable quantification of transcripts. In this work, we have assessed different methods for their suitability for RNA extraction from olive fruits and leaves and we have evaluated thirteen potential candidate reference genes on 21 RNA samples belonging to fruit developmental/ripening series and to leaves subjected to wounding. By using two different algorithms, GAPDH2 and PP2A1 were identified as the best reference genes for olive fruit development and ripening, and their effectiveness for normalization of expression of two ripening marker genes was demonstrated.

  16. Variability of virgin olive oil phenolic compounds in a segregating progeny from a single cross in Olea europaea L. and sensory and nutritional quality implications.

    Science.gov (United States)

    Pérez, Ana G; León, Lorenzo; Pascual, Mar; Romero-Segura, Carmen; Sánchez-Ortiz, Araceli; de la Rosa, Raúl; Sanz, Carlos

    2014-01-01

    Virgin olive oil phenolic compounds are responsible for its nutritional and sensory quality. The synthesis of phenolic compounds occurs when enzymes and substrates meet as olive fruit is crushed during the industrial process to obtain the oil. The genetic variability of the major phenolic compounds of virgin olive oil was studied in a progeny of the cross of Picual x Arbequina olive cultivars (Olea europaea L.). They belong to four different groups: compounds that included tyrosol or hydroxytyrosol in their molecules, lignans, flavonoids, and phenolic acids. Data of phenolics in the oils showed that the progeny displayed a large degree of variability, widely transgressing the genitor levels. This high variability can be of interest on breeding programs. Thus, multivariate analysis allowed to identify genotypes within the progeny particularly interesting in terms of phenolic composition and deduced organoleptic and nutritional quality. The present study has demonstrated that it is possible to obtain enough degree of variability with a single cross of olive cultivars for compounds related to the nutritional and organoleptic properties of virgin olive oil.

  17. Impact of proline application on cadmium accumulation, mineral nutrition and enzymatic antioxidant defense system of Olea europaea L. cv Chemlali exposed to cadmium stress.

    Science.gov (United States)

    Zouari, Mohamed; Ben Ahmed, Chedlia; Elloumi, Nada; Bellassoued, Khaled; Delmail, David; Labrousse, Pascal; Ben Abdallah, Ferjani; Ben Rouina, Bechir

    2016-06-01

    Proline plays an important role in plant response to various environmental stresses. However, its involvement in mitigation of heavy metal stress in plants remains elusive. In this study, we examined the effectiveness of exogenous proline (10 and 20 mM) in alleviating cadmium induced inhibitory effects in young olive plants (Olea europaea L. cv. Chemlali) exposed to two Cd levels (10 and 30 mg CdCl2 kg(-1) soil). The Cd treatment induced substantial accumulation of Cd in both root and leaf tissues and a decrease in gas exchange, photosynthetic pigments contents, uptake of essential elements (Ca, Mg and K) and plant biomass. Furthermore, an elevation of antioxidant enzymes activities (superoxide dismutase, catalase, glutathione peroxydase) and proline content in association with relatively high amounts of hydrogen peroxide, thiobarbituric acid reactive substances and electrolyte leakage were observed. Interestingly, the application of exogenous proline alleviated the oxidative damage induced by Cd accumulation. In fact, Cd-stressed olive plants treated with proline showed an increase of antioxidant enzymes activities, photosynthetic activity, nutritional status, plant growth and oil content of olive fruit. Generally, it seems that proline supplementation alleviated the deleterious effects of young olive plants exposed to Cd stress. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Identification of leaf volatiles from olive (Olea europaea) and their possible role in the ovipositional preferences of olive fly, Bactrocera oleae (Rossi) (Diptera: Tephritidae).

    Science.gov (United States)

    Malheiro, Ricardo; Casal, Susana; Cunha, Sara C; Baptista, Paula; Pereira, José Alberto

    2016-01-01

    The olive fly, Bactrocera oleae (Rossi), is a monophagous pest that displays an oviposition preference among cultivars of olive (Olea europaea L.). To clarify the oviposition preference, the olive leaf volatiles of three olive cultivars (Cobrançosa, Madural and Verdeal Transmontana) were assessed by headspace solid-phase microextraction gas chromatography-mass spectrometry (HS-SPME-GC/MS) at six different periods of olive fruit maturation and degrees of infestation. A total of 39 volatiles were identified, mainly esters and alcohols, with a minor percentage of aldehydes, ketones and terpenic compounds, including sesquiterpenes. At sampling dates with higher degrees of infestation, cv. Cobrançosa had, simultaneously, significantly lower infestation degrees and higher volatile amounts than the other two cultivars, with a probable deterrent effect for oviposition. The green leaf volatiles (GLVs) (Z)-3-hexen-1-ol and (Z)-3-hexen-1-ol acetate) were the main compounds identified in all cultivars, together with toluene. The abundance of GLVs decreased significantly throughout maturation, without significant differences among cultivars, while toluene showed a general increase and positive correlation with olive fly infestation levels. The results obtained could broaden our understanding of the roles of various types and amounts of olive volatiles in the environment, especially in olive fly host selection and cultivar preference. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. The transcriptional response to the olive fruit fly (Bactrocera oleae) reveals extended differences between tolerant and susceptible olive (Olea europaea L.) varieties.

    Science.gov (United States)

    Grasso, Filomena; Coppola, Mariangela; Carbone, Fabrizio; Baldoni, Luciana; Alagna, Fiammetta; Perrotta, Gaetano; Pérez-Pulido, Antonio J; Garonna, Antonio; Facella, Paolo; Daddiego, Loretta; Lopez, Loredana; Vitiello, Alessia; Rao, Rosa; Corrado, Giandomenico

    2017-01-01

    The olive fruit fly Bactrocera oleae (Diptera: Tephritidae) is the most devastating pest of cultivated olive (Olea europaea L.). Intraspecific variation in plant resistance to B. oleae has been described only at phenotypic level. In this work, we used a transcriptomic approach to study the molecular response to the olive fruit fly in two olive cultivars with contrasting level of susceptibility. Using next-generation pyrosequencing, we first generated a catalogue of more than 80,000 sequences expressed in drupes from approximately 700k reads. The assembled sequences were used to develop a microarray layout with over 60,000 olive-specific probes. The differential gene expression analysis between infested (i.e. with II or III instar larvae) and control drupes indicated a significant intraspecific variation between the more tolerant and susceptible cultivar. Around 2500 genes were differentially regulated in infested drupes of the tolerant variety. The GO annotation of the differentially expressed genes implies that the inducible resistance to the olive fruit fly involves a number of biological functions, cellular processes and metabolic pathways, including those with a known role in defence, oxidative stress responses, cellular structure, hormone signalling, and primary and secondary metabolism. The difference in the induced transcriptional changes between the cultivars suggests a strong genetic role in the olive inducible defence, which can ultimately lead to the discovery of factors associated with a higher level of tolerance to B. oleae.

  20. Correlation between airborne Olea europaea pollen concentrations and levels of the major allergen Ole e 1 in Córdoba, Spain, 2012-2014

    Science.gov (United States)

    Plaza, M. P.; Alcázar, P.; Galán, C.

    2016-12-01

    Olea europaea L. pollen is the second-largest cause of pollinosis in the southern Iberian Peninsula. Airborne-pollen monitoring networks provide essential data on pollen dynamics over a given study area. Recent research, however, has shown that airborne pollen levels alone do not always provide a clear indicator of actual exposure to aeroallergens. This study sought to evaluate correlations between airborne concentrations of olive pollen and Ole e 1 allergen levels in Córdoba (southern Spain), in order to determine whether atmospheric pollen concentrations alone are sufficient to chart changes in hay fever symptoms. The influence of major weather-related variables on local airborne pollen and allergen levels was also examined. Monitoring was carried out from 2012 to 2014. Pollen sampling was performed using a Hirst-type sampler, following the protocol recommended by the Spanish Aerobiology Network. A multi-vial cyclone sampler was used to collect aeroallergens, and allergenic particles were quantified by ELISA assay. Significant positive correlations were found between daily airborne allergen levels and atmospheric pollen concentrations, although there were occasions when allergen was detected before and after the pollen season and in the absence of airborne pollen. The correlation between the two was irregular, and pollen potency displayed year-on-year variations and did not necessarily match pollen-season-intensity.

  1. A possible role for flowering locus T-encoding genes in interpreting environmental and internal cues affecting olive (Olea europaea L.) flower induction.

    Science.gov (United States)

    Haberman, Amnon; Bakhshian, Ortal; Cerezo-Medina, Sergio; Paltiel, Judith; Adler, Chen; Ben-Ari, Giora; Mercado, Jose Angel; Pliego-Alfaro, Fernando; Lavee, Shimon; Samach, Alon

    2017-08-01

    Olive (Olea europaea L.) inflorescences, formed in lateral buds, flower in spring. However, there is some debate regarding time of flower induction and inflorescence initiation. Olive juvenility and seasonality of flowering were altered by overexpressing genes encoding flowering locus T (FT). OeFT1 and OeFT2 caused early flowering under short days when expressed in Arabidopsis. Expression of OeFT1/2 in olive leaves and OeFT2 in buds increased in winter, while initiation of inflorescences occurred i n late winter. Trees exposed to an artificial warm winter expressed low levels of OeFT1/2 in leaves and did not flower. Olive flower induction thus seems to be mediated by an increase in FT levels in response to cold winters. Olive flowering is dependent on additional internal factors. It was severely reduced in trees that carried a heavy fruit load the previous season (harvested in November) and in trees without fruit to which cold temperatures were artificially applied in summer. Expression analysis suggested that these internal factors work either by reducing the increase in OeFT1/2 expression or through putative flowering repressors such as TFL1. With expected warmer winters, future consumption of olive oil, as part of a healthy Mediterranean diet, should benefit from better understanding these factors. © 2017 John Wiley & Sons Ltd.

  2. A sensitive liquid chromatography-mass spectrometry method for the simultaneous determination in plasma of pentacyclic triterpenes of Olea europaea L.

    Science.gov (United States)

    Giménez, Estela; Juan, M Emília; Calvo-Melià, Sara; Planas, Joana M

    2017-08-15

    Table olives are especially rich in pentacyclic triterpenic compounds, which exert several biological activities. A crucial step in order to know if these compounds could contribute to the beneficial and healthy properties of this food is their measurement in blood. Therefore, the present study describes a simple and accurate liquid-liquid extraction followed by LC-QqQ-MS analysis for the simultaneous determination of the main pentacyclic triterpenes from Olea europaea L. in rat plasma. The method was validated by the analysis of blank plasma samples spiked with pure compounds, obtaining a linear correlation, adequate sensitivity with a limit of quantification ranging from 1nM for maslinic acid to 10nM for uvaol. Precision and accuracy were lower than 10% in all cases and recoveries were between 95 and 104%. The oral administration of olives to rats and its determination in plasma verified that the established methodology is appropriate for bioavailability studies. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Clinical utility from the determination of serico galactomannan in the diagnosis of invasive aspergillosis in hematological patients of the Hospital San Juan de Dios, between January 2009 and December 2012; Utilidad clinica de la determinacion de galactomanano serico en el diagnostico de aspergilosis invasiva en pacientes hematologicos del Hospital San Juan de Dios, entre enero 2009 y diciembre 2012

    Energy Technology Data Exchange (ETDEWEB)

    Li Sandi, Silvia

    2014-07-01

    Nosocomial infections have become more important to the health system by the high costs of these, but are little data available about them in recent years. The clinical utility of the determination of serum galactomannan (GMS) in patients with high risk of contracting the infection by Aspergillus spp, was assessed, between January 2009 and December 2012 at the Hospital San Juan de Dios. Several existing studies in the scientific literature have already evaluated the clinical usefulness, specific data have been inexistent for Costa Rica or for Central America and the Caribbean; so it is important to have known whether the conduct of the test has been similar to the other populations or have specific variations [Spanish] Las enfermedades nosocomiales han cobrado mayor importancia para el sistema de salud por el gasto elevado que han representado, pero son pocos los datos disponibles respecto a ellas en los ultimos anos. La utilidad clinica de la determinacion de galactomanano serico (GMS) en pacientes con alto riesgo a contraer la infeccion por Aspergillus spp, fue evaluada, entre enero del 2009 y diciembre del 2012 en el Hospital San Juan de Dios. Varios estudios existentes en la literatura cientifica ya han evaluado esta utilidad clinica, datos especificos han sido inexistentes para Costa Rica, o para la region Centroamericana y el Caribe, por lo que es importante haber conocido si el comportamiento de la prueba ha sido similar a las otras poblaciones o tiene variaciones.

  4. Transformación genética de olivo (Olea europaea L.) con un gen de Medicago truncatula que codifica para un proteína tipo FT

    OpenAIRE

    Cerezo Medina, Sergio; Barceló-Muñoz, Araceli; Samach, Alon; Mercado Carmona, José A.; Pliego Alfaro, Fernando

    2013-01-01

    En el olivo (Olea europaea L.), la modificación de la arquitectura de la planta y la reducción del periodo juvenil son caracteres de interés en la mejora. Las proteínas codificadas por genes tipo FT (FLOWERING LOCUS T), además de actuar como componente principal de la señal sistémica inductora de floración conocida como florígeno, participan en la regulación de otros procesos del desarrollo en plantas, entre ellos, la determinación de la arquitectura o la dormancia. El objetivo de este trabaj...

  5. Assessing Animal Welfare Impacts in the Management of European Rabbits (Oryctolagus cuniculus), European Moles (Talpa europaea) and Carrion Crows (Corvus corone)

    Science.gov (United States)

    Baker, Sandra E.; Sharp, Trudy M.; Macdonald, David W.

    2016-01-01

    Human-wildlife conflict is a global issue. Attempts to manage this conflict impact upon wild animal welfare, an issue receiving little attention until relatively recently. Where human activities harm animal welfare these effects should be minimised where possible. However, little is known about the welfare impacts of different wildlife management interventions, and opinions on impacts vary widely. Welfare impacts therefore need to be assessed objectively. Our objectives were to: 1) establish whether an existing welfare assessment model could differentiate and rank the impacts of different wildlife management interventions (for decision-making purposes); 2) identify and evaluate any additional benefits of making formal welfare assessments; and 3) illustrate issues raised by application of the model. We applied the welfare assessment model to interventions commonly used with rabbits (Oryctolagus cuniculus), moles (Talpa europaea) and crows (Corvus corone) in the UK. The model ranked interventions for rabbits (least impact first: fencing, head shot, chest shot) and crows (shooting, scaring, live trapping with cervical dislocation). For moles, managing molehills and tunnels scored least impact. Both spring trapping, and live trapping followed by translocation, scored greater impacts, but these could not be compared directly as they scored on different axes of the model. Some rankings appeared counter-intuitive, highlighting the need for objective formal welfare assessments. As well as ranking the humaneness of interventions, the model highlighted future research needs and how Standard Operating Procedures might be improved. The model is a milestone in assessing wildlife management welfare impacts, but our research revealed some limitations of the model and we discuss likely challenges in resolving these. In future, the model might be developed to improve its utility, e.g. by refining the time-scales. It might also be used to reach consensus among stakeholders about

  6. Assessing Animal Welfare Impacts in the Management of European Rabbits (Oryctolagus cuniculus), European Moles (Talpa europaea) and Carrion Crows (Corvus corone).

    Science.gov (United States)

    Baker, Sandra E; Sharp, Trudy M; Macdonald, David W

    2016-01-01

    Human-wildlife conflict is a global issue. Attempts to manage this conflict impact upon wild animal welfare, an issue receiving little attention until relatively recently. Where human activities harm animal welfare these effects should be minimised where possible. However, little is known about the welfare impacts of different wildlife management interventions, and opinions on impacts vary widely. Welfare impacts therefore need to be assessed objectively. Our objectives were to: 1) establish whether an existing welfare assessment model could differentiate and rank the impacts of different wildlife management interventions (for decision-making purposes); 2) identify and evaluate any additional benefits of making formal welfare assessments; and 3) illustrate issues raised by application of the model. We applied the welfare assessment model to interventions commonly used with rabbits (Oryctolagus cuniculus), moles (Talpa europaea) and crows (Corvus corone) in the UK. The model ranked interventions for rabbits (least impact first: fencing, head shot, chest shot) and crows (shooting, scaring, live trapping with cervical dislocation). For moles, managing molehills and tunnels scored least impact. Both spring trapping, and live trapping followed by translocation, scored greater impacts, but these could not be compared directly as they scored on different axes of the model. Some rankings appeared counter-intuitive, highlighting the need for objective formal welfare assessments. As well as ranking the humaneness of interventions, the model highlighted future research needs and how Standard Operating Procedures might be improved. The model is a milestone in assessing wildlife management welfare impacts, but our research revealed some limitations of the model and we discuss likely challenges in resolving these. In future, the model might be developed to improve its utility, e.g. by refining the time-scales. It might also be used to reach consensus among stakeholders about

  7. Olive (Olea europaea) leaf methanolic extract prevents HCl/ethanol-induced gastritis in rats by attenuating inflammation and augmenting antioxidant enzyme activities.

    Science.gov (United States)

    Al-Quraishy, Saleh; Othman, Mohamed S; Dkhil, Mohamed A; Abdel Moneim, Ahmed Esmat

    2017-07-01

    Gastritis is preponderantly characterized by inflammation of the lining epithelial layer and the chronic gastritis is considered as a pre-cancer lesion. For many centuries olive (Olea europaea) leaf has been used for its putative health potential, nonetheless, to date, the gastroprotective effects of olive leaves have not been studied yet. Hence, in this study we investigated whether olive leaf extract (OLE) could protect gastric mucosa against HCl/ethanol-induced gastric mucosal damage in rats. Hcl/ethanol administration caused significant damage to the gastric mucosa, as confirmed by gastric ulcer index and histological evaluation. However, this damage was largely prevented by pre-administering 20mg/kg omeprazole or 100mg/kg OLE. Interestingly, the damage was completely prevented by pre-administering 200 and 300mg/kg OLE. Moreover, OLE attenuated the inflammatory response by decreasing nuclear factor-κB (NF-κB), cycloxygenase-2 (COX-2) and tumor necrosis factor-α (TNF-α) expressions, and down-regulating inducible nitric oxide synthase (iNOS) and interleukin-1β (IL-1β) in gastric mucosa. The gastroprotective mechanism of OLE involved the promotion of enzymatic and nonenzymatic molecules (superoxide dismutase, catalase, glutathione peroxidase, glutathione reductase and glutathione reduced form), promoting nuclear factor erythroid 2-related factor 2 (Nrf2) mRNA expression, halting lipid peroxidation and preventing the overproduction of nitric oxide. Together, our findings clearly demonstrated that OLE could prevent HCl/ethanol-induced gastritis by attenuating inflammation and oxidant/antioxidant imbalance. Indeed, OLE could potentially be useful as a natural therapy for gastritis. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  8. A de novo transcriptomic approach to identify flavonoids and anthocyanins switch-off in olive (Olea europaea L. drupes at different stages of maturation

    Directory of Open Access Journals (Sweden)

    Domenico eIaria

    2016-01-01

    Full Text Available During ripening, the fruits of the olive tree (Olea europaea L. undergo a progressive chromatic change characterized by the formation of a red-brown spot which gradually extends on the epidermis and in the innermost part of the mesocarp. This event finds an exception in the Leucocarpa cultivar, in which we observe a destabilized equilibrium between the metabolisms of chlorophyll and other pigments, particularly the anthocyanins whose switch-off during maturation promotes the white coloration of fruits. Despite its importance, genomic information on the olive tree is still lacking. Different RNA-seq libraries were generated from drupes of ‘Leucocarpa’ and ‘Cassanese’ olive genotypes, sampled at 100 and 130 days after flowering (DAF, and were used in order to identify transcripts involved in the main phenotypic changes of fruits during maturation and their corresponding expression patterns. A total of 103,359 transcripts were obtained and 3792 and 3064 were differentially expressed in ‘Leucocarpa’ and ‘Cassanese’ genotypes, respectively, during 100-130 DAF transition. Among them flavonoid and anthocyanin related transcripts such as phenylalanine ammonia lyase (PAL, cinnamate 4-hydroxylase (C4H, 4-coumarate-CoA ligase (4CL, chalcone synthase (CHS, chalcone isomerase (CHI, flavanone 3-hydroxylase (F3H, flavonol 3’-hydrogenase (F3'H, flavonol 3’5’-hydrogenase (F3'5'H, flavonol synthase (FLS, dihydroflavonol 4-reductase (DFR, anthocyanidin synthase (ANS, UDP-glucose:anthocianidin:flavonoid glucosyltransferase (UFGT were identified.These results contribute to reducing the current gap in information regarding metabolic processes, including those linked to fruit pigmentation in the olive.

  9. Assessing Animal Welfare Impacts in the Management of European Rabbits (Oryctolagus cuniculus, European Moles (Talpa europaea and Carrion Crows (Corvus corone.

    Directory of Open Access Journals (Sweden)

    Sandra E Baker

    Full Text Available Human-wildlife conflict is a global issue. Attempts to manage this conflict impact upon wild animal welfare, an issue receiving little attention until relatively recently. Where human activities harm animal welfare these effects should be minimised where possible. However, little is known about the welfare impacts of different wildlife management interventions, and opinions on impacts vary widely. Welfare impacts therefore need to be assessed objectively. Our objectives were to: 1 establish whether an existing welfare assessment model could differentiate and rank the impacts of different wildlife management interventions (for decision-making purposes; 2 identify and evaluate any additional benefits of making formal welfare assessments; and 3 illustrate issues raised by application of the model. We applied the welfare assessment model to interventions commonly used with rabbits (Oryctolagus cuniculus, moles (Talpa europaea and crows (Corvus corone in the UK. The model ranked interventions for rabbits (least impact first: fencing, head shot, chest shot and crows (shooting, scaring, live trapping with cervical dislocation. For moles, managing molehills and tunnels scored least impact. Both spring trapping, and live trapping followed by translocation, scored greater impacts, but these could not be compared directly as they scored on different axes of the model. Some rankings appeared counter-intuitive, highlighting the need for objective formal welfare assessments. As well as ranking the humaneness of interventions, the model highlighted future research needs and how Standard Operating Procedures might be improved. The model is a milestone in assessing wildlife management welfare impacts, but our research revealed some limitations of the model and we discuss likely challenges in resolving these. In future, the model might be developed to improve its utility, e.g. by refining the time-scales. It might also be used to reach consensus among

  10. Involvement of alternative oxidase (AOX) in adventitious rooting of Olea europaea L. microshoots is linked to adaptive phenylpropanoid and lignin metabolism.

    Science.gov (United States)

    Santos Macedo, E; Sircar, D; Cardoso, H G; Peixe, A; Arnholdt-Schmitt, B

    2012-09-01

    Alternative oxidase (AOX) has been proposed as a functional marker candidate in a number of events involving cell differentiation, including rooting efficiency in semi-hardwood shoot cuttings of olive (Olea europaea L.). To ascertain the general importance of AOX in olive rooting, the auxin-induced rooting process was studied in an in vitro system for microshoot propagation. Inhibition of AOX by salicylhydroxamic acid (SHAM) significantly reduced rooting efficiency. However, the inhibitor failed to exhibit any effect on the preceding calli stage. This makes the system appropriate for distinguishing dedifferentiation and de novo differentiation during root induction. Metabolite analyses of microshoots showed that total phenolics, total flavonoids and lignin contents were significantly reduced upon SHAM treatment. It was concluded that the influence of alternative respiration on root formation was associated to adaptive phenylpropanoid and lignin metabolism. Transcript profiles of two olive AOX genes (OeAOX1a and OeAOX2) were examined during the process of auxin-induced root induction. Both genes displayed stable transcript accumulation in semi-quantitative RT-PCR analysis during all experimental stages. In contrary, when the reverse primer for OeAOX2 was designed from the 3'-UTR instead of the ORF, differential transcript accumulation was observed suggesting posttranscriptional regulation of OeAOX2 during metabolic acclimation. This result confirms former observations in olive semi-hardwood shoot cuttings on differential OeAOX2 expression during root induction. It further points to the importance of future studies on the functional role of sequence and length polymorphisms in the 3'-UTR of this gene. The manuscript reports the general importance of AOX in olive adventitious rooting and the association of alternative respiration to adaptive phenylpropanoid and lignin metabolism.

  11. Salt stress induces differential regulation of the phenylpropanoid pathway in Olea europaea cultivars Frantoio (salt-tolerant) and Leccino (salt-sensitive).

    Science.gov (United States)

    Rossi, Lorenzo; Borghi, Monica; Francini, Alessandra; Lin, Xiuli; Xie, De-Yu; Sebastiani, Luca

    2016-10-01

    Olive tree (Olea europaea L.) is an important crop in the Mediterranean Basin where drought and salinity are two of the main factors affecting plant productivity. Despite several studies have reported different responses of various olive tree cultivars to salt stress, the mechanisms that convey tolerance and sensitivity remain largely unknown. To investigate this issue, potted olive plants of Leccino (salt-sensitive) and Frantoio (salt-tolerant) cultivars were grown in a phytotron chamber and treated with 0, 60 and 120mM NaCl. After forty days of treatment, growth analysis was performed and the concentration of sodium in root, stem and leaves was measured by atomic absorption spectroscopy. Phenolic compounds were extracted using methanol, hydrolyzed with butanol-HCl, and quercetin and kaempferol quantified via high performance liquid-chromatography-electrospray-mass spectrometry (HPLC-ESI-MS) and HPLC-q-Time of Flight-MS analyses. In addition, the transcripts levels of five key genes of the phenylpropanoid pathway were measured by quantitative Real-Time PCR. The results of this study corroborate the previous observations, which showed that Frantoio and Leccino differ in allocating sodium in root and leaves. This study also revealed that phenolic compounds remain stable or are strongly depleted under long-time treatment with sodium in Leccino, despite a strong up-regulation of key genes of the phenylpropanoid pathway was observed. Frantoio instead, showed a less intense up-regulation of the phenylpropanoid genes but overall higher content of phenolic compounds. These data suggest that Frantoio copes with the toxicity imposed by elevated sodium not only with mechanisms of Na + exclusion, but also promptly allocating effective and adequate antioxidant compounds to more sensitive organs. Copyright © 2016 Elsevier GmbH. All rights reserved.

  12. On the use of leaf spectral indices to assess water status and photosynthetic limitations in Olea europaea L. during water-stress and recovery.

    Science.gov (United States)

    Sun, Pengsen; Wahbi, Said; Tsonev, Tsonko; Haworth, Matthew; Liu, Shirong; Centritto, Mauro

    2014-01-01

    Diffusional limitations to photosynthesis, relative water content (RWC), pigment concentrations and their association with reflectance indices were studied in olive (Olea europaea) saplings subjected to water-stress and re-watering. RWC decreased sharply as drought progressed. Following rewatering, RWC gradually increased to pre-stress values. Photosynthesis (A), stomatal conductance (gs), mesophyll conductance (gm), total conductance (gt), photochemical reflectance index (PRI), water index (WI) and relative depth index (RDI) closely followed RWC. In contrast, carotenoid concentration, the carotenoid to chlorophyll ratio, water content reflectance index (WCRI) and structural independent pigment index (SIPI) showed an opposite trend to that of RWC. Photosynthesis scaled linearly with leaf conductance to CO2; however, A measured under non-photorespiratory conditions (A1%O2) was approximately two times greater than A measured at 21% [O2], indicating that photorespiration likely increased in response to drought. A1%O2 also significantly correlated with leaf conductance parameters. These relationships were apparent in saturation type curves, indicating that under non-photorespiratory conditions, CO2 conductance was not the major limitations to A. PRI was significant correlated with RWC. PRI was also very sensitive to pigment concentrations and photosynthesis, and significantly tracked all CO2 conductance parameters. WI, RDI and WCRI were all significantly correlated with RWC, and most notably to leaf transpiration. Overall, PRI correlated more closely with carotenoid concentration than SIPI; whereas WI tracked leaf transpiration more effectively than RDI and WCRI. This study clearly demonstrates that PRI and WI can be used for the fast detection of physiological traits of olive trees subjected to water-stress.

  13. Investigation of cytochrome P450 inhibitory properties of maslinic acid, a bioactive compound from Olea europaea L., and its structure-activity relationship.

    Science.gov (United States)

    Sun, Min; Tang, Yu; Ding, Tonggui; Liu, Mingyao; Wang, Xin

    2015-01-15

    Maslinic acid (MA), the main pentacyclic triterpene of Olea europaea L. fruit, possesses a variety of pharmacological actions, including hypoglycemic, antioxidant, cardioprotective and antitumoral activities. Despite its importance, little is known about its effects on the cytochrome P450 (CYP) activity in both humans and animals. Therefore, the aim of this study was to investigate the effects of MA on the CYP 1A2, 2C9/11, 2D1/6, 2E1 and 3A2/4 activities by human and rat liver microsomes and specific CYP isoforms. In humans, MA only weakly inhibited CYP3A4 activity in human liver microsomes and specific CYP3A4 isoform with IC50 value at 46.1 and 62.3µM, respectively. In rats, MA also exhibited weak inhibition on CYP2C11, CYP2E1 and CYP3A2 activities with IC50 values more than 100µM. Enzyme kinetic studies showed that the MA was not only a competitive inhibitor of CYP3A4 in humans, but also a competitive inhibitor of CYP2C11 and 3A2 in rats, with Ki of 18.4, 98.7 and 66.3µM, respectively. Moreover, the presence of hydroxyl group at C-2 position of triterpenic acid in MA compared with oleanolic acid could magnify its competitive inhibition on human CYP3A4 activity. The relatively high Ki values of MA would have a low potential to cause the possible toxicity and drug interactions involving CYP enzymes, thus suggesting a sufficient safety for its putative use as a nutraceutical taken together with drugs. Copyright © 2014 Elsevier GmbH. All rights reserved.

  14. Neuroprotection by Combined Administration with Maslinic Acid, a Natural Product from Olea europaea, and MK-801 in the Cerebral Ischemia Model

    Directory of Open Access Journals (Sweden)

    Yisong Qian

    2016-08-01

    Full Text Available Glutamate-mediated excitotoxicity is a major cause of ischemic brain damage. MK-801 confers neuroprotection by attenuating the activation of the N-methyl-d-aspartate (NMDA receptor, but it failed in clinical use due to the short therapeutic window. Here we aim to investigate the effects of maslinic acid, a natural product from Olea europaea, on the therapeutic time window and dose range for the neuroprotection of MK-801. Rats were administered with maslinic acid intracerebroventricularly and cerebral ischemia was induced by middle cerebral artery occlusion (MCAO followed by reperfusion. MK-801 was administered at 1 h, 2 h, 3 h and 4 h after ischemia, respectively. The cerebral infarct volume was determined by 2,3,5-Triphenyltetrazolium chloride (TTC staining, neuronal damage was assessed by Haematoxylin Eosin (H&E staining, and the expression of glial glutamate transporters and glial fibrillary acidic protein (GFAP was evaluated by immunohistochemistry and Western blot post-ischemia. Results showed that the presence of maslinic acid extended the therapeutic time window for MK-801 from 1 h to 3 h. Co-treatment of maslinic acid and MK-801 at a subthreshold dosage obviously induced neuroprotection after ischemia. The combination of these two compounds improved the outcome in ischemic rats. Moreover, maslinic acid treatment promoted the expression of GLT-1 and GFAP post-ischemia. These data suggest that the synergistic effect of maslinic acid on neurological protection might be associated with the improvement of glial function, especially with the increased expression of GLT-1. The combination therapy of maslinic acid and MK-801 may prove to be a potential strategy for treating acute ischemic stroke.

  15. RP-HPLC-DAD-ESI-QTOF-MS based metabolic profiling of the potential Olea europaea by-product "wood" and its comparison with leaf counterpart.

    Science.gov (United States)

    Ammar, Sonda; Contreras, Maria Del Mar; Gargouri, Boutheina; Segura-Carretero, Antonio; Bouaziz, Mohamed

    2017-05-01

    Olea europaea L. organs such as leaves, stems and roots have been associated with numerous in vivo and in vitro biological activities and used for traditional medicinal purposes. However, tree wood is an untapped resource with little information about their chemical composition. That is why, the objective of this study is to increase the knowledge about phytochemicals from 'Chemlali' olive wood by means of mass spectrometry-based analyses. Its comparison with by-products derived from leaves was also studied. Hydromethanol extracts from wood and leaves with stems of 'Chemlali' olive cultivar were analysed using reversed-phase (RP) high-performance liquid chromatography (HPLC) coupled to two detection systems: diode-array detection (DAD) and quadrupole time-of-flight (QTOF) mass spectrometry (MS) in negative ion mode. Tandem MS experiments were performed to establish the chemical structure of olive phytochemicals. A total of 85 compounds were characterised in the studied olive parts and classified as: sugars (3), organic acids (5), one phenolic aldehyde, simple phenolic acids (6), simple phenylethanoids (5), flavonoids (14), coumarins (3), caffeoyl phenylethanoid derivatives (6), iridoids (5), secoiridoids (32), and lignans (5). To our knowledge, the major part of these metabolites was not previously reported in olive tree wood, and 10 olive chemical constituents were identified for the first time in the Oleaceae family. The results presented here demonstrated the usefulness of the methodology proposed, based on RP-HPLC-DAD-ESI-QTOF-MS and MS/MS, to develop an exhaustive metabolic profiling and to recover new biologically active compounds in olive wood with pharmacologic and cosmetic potential. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  16. Differential Contribution of Endoplasmic Reticulum and Chloroplast ω-3 Fatty Acid Desaturase Genes to the Linolenic Acid Content of Olive (Olea europaea) Fruit.

    Science.gov (United States)

    Hernández, M Luisa; Sicardo, M Dolores; Martínez-Rivas, José M

    2016-01-01

    Linolenic acid is a polyunsaturated fatty acid present in plant lipids, which plays key roles in plant metabolism as a structural component of storage and membrane lipids, and as a precursor of signaling molecules. The synthesis of linolenic acid is catalyzed by two different ω-3 fatty acid desaturases, which correspond to microsomal- (FAD3) and chloroplast- (FAD7 and FAD8) localized enzymes. We have investigated the specific contribution of each enzyme to the linolenic acid content in olive fruit. With that aim, we isolated two different cDNA clones encoding two ω-3 fatty acid desaturases from olive (Olea europaea cv. Picual). Sequence analysis indicates that they code for microsomal (OepFAD3B) and chloroplast (OepFAD7-2) ω-3 fatty acid desaturase enzymes, different from the previously characterized OekFAD3A and OekFAD7-1 genes. Functional expression in yeast of the corresponding OepFAD3A and OepFAD3B cDNAs confirmed that they encode microsomal ω-3 fatty acid desaturases. The linolenic acid content and transcript levels of olive FAD3 and FAD7 genes were measured in different tissues of Picual and Arbequina cultivars, including mesocarp and seed during development and ripening of olive fruit. Gene expression and lipid analysis indicate that FAD3A is the gene mainly responsible for the linolenic acid present in the seed, while FAD7-1 and FAD7-2 contribute mostly to the linolenic acid present in the mesocarp and, therefore, in the olive oil. These results also indicate the relevance of lipid trafficking between the endoplasmic reticulum and chloroplast in determining the linolenic acid content of membrane and storage lipids in oil-accumulating photosynthetic tissues. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  17. Neuroprotection by Combined Administration with Maslinic Acid, a Natural Product from Olea europaea, and MK-801 in the Cerebral Ischemia Model.

    Science.gov (United States)

    Qian, Yisong; Tang, Xuzhen; Guan, Teng; Li, Yunman; Sun, Hongbin

    2016-08-19

    Glutamate-mediated excitotoxicity is a major cause of ischemic brain damage. MK-801 confers neuroprotection by attenuating the activation of the N-methyl-d-aspartate (NMDA) receptor, but it failed in clinical use due to the short therapeutic window. Here we aim to investigate the effects of maslinic acid, a natural product from Olea europaea, on the therapeutic time window and dose range for the neuroprotection of MK-801. Rats were administered with maslinic acid intracerebroventricularly and cerebral ischemia was induced by middle cerebral artery occlusion (MCAO) followed by reperfusion. MK-801 was administered at 1 h, 2 h, 3 h and 4 h after ischemia, respectively. The cerebral infarct volume was determined by 2,3,5-Triphenyltetrazolium chloride (TTC) staining, neuronal damage was assessed by Haematoxylin Eosin (H&E) staining, and the expression of glial glutamate transporters and glial fibrillary acidic protein (GFAP) was evaluated by immunohistochemistry and Western blot post-ischemia. Results showed that the presence of maslinic acid extended the therapeutic time window for MK-801 from 1 h to 3 h. Co-treatment of maslinic acid and MK-801 at a subthreshold dosage obviously induced neuroprotection after ischemia. The combination of these two compounds improved the outcome in ischemic rats. Moreover, maslinic acid treatment promoted the expression of GLT-1 and GFAP post-ischemia. These data suggest that the synergistic effect of maslinic acid on neurological protection might be associated with the improvement of glial function, especially with the increased expression of GLT-1. The combination therapy of maslinic acid and MK-801 may prove to be a potential strategy for treating acute ischemic stroke.

  18. The influence of light, temperature and feeding on the growth of the Coras cladocora caespitosa and Balanophyllia europaea; L'influenza di luce, temperatura e alimentazione sulla crescita dei coralli mediterranei Cladocora caespitosa e Balanophyllia europaea. Risultati preliminari di una sperimentazione in ambiente controllato

    Energy Technology Data Exchange (ETDEWEB)

    Rodolfo-Metalpa, R.; Abbate, M.; Peirano, A. [ENEA, Divisione Ambiente Globale e Mediterraneo, Centro Ricerche S. Teresa, La Spezia (Italy)

    2001-07-01

    In the course of the environmental studies, carried out by ENEA-CRAM Center of S. Teresa near La Spezia, research has been performed about bioconstructional organisms in the Mediterranean Sea. To understand how these organisms respond to environmental parameters an experiment has been carried out in aquaria. Specimens of the Mediterranean coral Cladocora caespitosa and Balanophyllia europaea has been maintained in 80 independent aquaria for four months. Growth rates, pigments concentration and asexual reproduction of the corals were compared in experimental procedures with controlled conditions of light, temperature and food. Environmental parameters have been set out to simulate natural (winter and summer) ambient in the Ligurian Sea. Heterotrophic and autotrophic abilities of the corals have been compared. Results show different growth rates between the two species but similar heterotrophic growth patterns. Summer temperature largely influences growth rates and asexual reproduction of the species while light influence is small. [Italian] Nell'ambito delle ricerche svolte dall'ENEA sullo studio degli organismi biocostruttori nell'ambiente marino, e' stata svolta una sperimentazione al fine di valutare l'influenza di alcuni parametri ambientali (luce, temperatura e alimentazione), impostati in modo da simulare la naturale stagionalita' (inverno ed estate), sulla crescita e sulla riproduzione asessuale dei coralli mediterranei Cladocora caespitosa e Balanophyllia europaea. Queste sperimentazioni sono state condotte, per un periodo di circa quattro mesi, in ottanta acquari indipendenti caratterizzati da differenti livelli di luce, temperatura e alimentazione. Le valutazioni degli incrementi di peso e della crescita lineare sono state eseguite utilizzando differenti metodiche note in letteratura. Soprattutto la tecnica del Peso Galleggiante (Buoyant Weight) si e' dimostrata molto sensibile ed efficace. La capacita' (eterotrofia

  19. Effect of water deficit on leaf phenolic composition, gas exchange, oxidative damage and antioxidant activity of four Greek olive (Olea europaea L.) cultivars.

    Science.gov (United States)

    Petridis, Antonios; Therios, Ioannis; Samouris, Georgios; Koundouras, Stefanos; Giannakoula, Anastasia

    2012-11-01

    The olive tree (Olea europaea L.) is often exposed to severe water stress during the summer season. In this study, we determined the changes in total phenol content, oleuropein and hydroxytyrosol in the leaves of four olive cultivars ('Gaidourelia', 'Kalamon', 'Koroneiki' and 'Megaritiki') grown under water deficit conditions for two months. Furthermore, we investigated the photosynthetic performance in terms of gas exchange and chlorophyll a fluorescence, as well as malondialdehyde content and antioxidant activity. One-year-old self-rooted plants were subjected to three irrigation treatments that received a water amount equivalent to 100% (Control, C), 66% (Field Capacity 66%, FC(66)) and 33% (Field Capacity 33%, FC(33)) of field capacity. Measurements were conducted 30 and 60 days after the initiation of the experiment. Net CO(2) assimilation rate, stomatal conductance and F(v)/F(m) ratio decreased only in FC(33) plants. Photosynthetic rate was reduced mainly due to stomatal closure, but damage to PSII also contributed to this decrease. Water stress induced the accumulation of phenolic compounds, especially oleuropein, suggesting their role as antioxidants. Total phenol content increased in FC(33) treatment and oleuropein presented a slight increase in FC(66) and a sharper one in FC(33) treatment. Hydroxytyrosol showed a gradual decrease as water stress progressed. Malondialdehyde (MDA) content increased due to water stress, mostly after 60 days, while antioxidant activity increased for all cultivars in the FC(33) treatment. 'Gaidourelia' could be considered as the most tolerant among the tested cultivars, showing higher phenolic concentration and antioxidant activity and lower lipid peroxidation and photochemical damage after two months of water stress. The results indicated that water stress affected olive tree physiological and biochemical parameters and magnitude of this effect depended on genotype, the degree of water limitation and duration of treatment

  20. Indigenous Pseudomonas spp. Strains from the Olive (Olea europaea L.) Rhizosphere as Effective Biocontrol Agents against Verticillium dahliae: From the Host Roots to the Bacterial Genomes

    Science.gov (United States)

    Gómez-Lama Cabanás, Carmen; Legarda, Garikoitz; Ruano-Rosa, David; Pizarro-Tobías, Paloma; Valverde-Corredor, Antonio; Niqui, José L.; Triviño, Juan C.; Roca, Amalia; Mercado-Blanco, Jesús

    2018-01-01

    The use of biological control agents (BCA), alone or in combination with other management measures, has gained attention over the past decades, driven by the need to seek for sustainable and eco-friendly alternatives to confront plant pathogens. The rhizosphere of olive (Olea europaea L.) plants is a source of bacteria with potential as biocontrol tools against Verticillium wilt of olive (VWO) caused by Verticillium dahliae Kleb. A collection of bacterial isolates from healthy nursery-produced olive (cultivar Picual, susceptible to VWO) plants was generated based on morphological, biochemical and metabolic characteristics, chemical sensitivities, and on their in vitro antagonistic activity against several olive pathogens. Three strains (PIC25, PIC105, and PICF141) showing high in vitro inhibition ability of pathogens' growth, particularly against V. dahliae, were eventually selected. Their effectiveness against VWO caused by the defoliating pathotype of V. dahliae was also demonstrated, strain PICF141 being the rhizobacteria showing the best performance as BCA. Genotypic and phenotypic traits traditionally associated with plant growth promotion and/or biocontrol abilities were evaluated as well (e.g., phytase, xylanase, catalase, cellulase, chitinase, glucanase activities, and siderophore and HCN production). Multi-locus sequence analyses of conserved genes enabled the identification of these strains as Pseudomonas spp. Strain PICF141 was affiliated to the “Pseudomonas mandelii subgroup,” within the “Pseudomonas fluorescens group,” Pseudomonas lini being the closest species. Strains PIC25 and PIC105 were affiliated to the “Pseudomonas aeruginosa group,” Pseudomonas indica being the closest relative. Moreover, we identified P. indica (PIC105) for the first time as a BCA. Genome sequencing and in silico analyses allowed the identification of traits commonly associated with plant-bacteria interactions. Finally, the root colonization ability of these olive

  1. Physiological Response of Common Glasswort (Salicornia europaea L. to Potassium Nano-Particles Grown in Saline Soils around the Lake Urmia

    Directory of Open Access Journals (Sweden)

    Alireza Pirzad

    2016-06-01

    Full Text Available To evaluate the effects of spraying potassium nano-particles on the osmolytes, photosynthetic pigments, total carotenoids and nutrients of aerial parts of common glasswort (Salicornia europaea L., a factorial experiment based on randomized complete block design with three replications was conducted at the marginal lands of Lake Urmia in 2012. The treatments consisted of application of potassium nano-particle concentrations at five levels (0, 1, 2, 3 and 4 g/l of K nano-particles applied, once, twice and three times. Results of analysis of variance (ANOVA showed that there were significant interaction between the levels and concentrations of potassium nano-particles sprayings on aerial parts with respect to their contents proline, total soluble carbohydrates, total chlorophyll, chlorophyll a and b, total carotenoids (xanthophyll and carotene and nutrients (nitrogen, phosphorus, potassium, calcium and sodium. The highest levels of proline (1.84 mg/g dry weight at one time spraying 4 g/l of K, total soluble carbohydrates (66.9 mg/g dry weight at three times spraying 4 g/l, total chlorophyll (26.23 mg/g fresh weight and chlorophyll b (22.85 mg/g fresh weight at two times of water spraying, and chlorophyll a (9.93 mg/g fresh weight at three times of 4g/l of potassium nano-particles sprayings were obtained. The highest nitrogen (0.95 % of aerial parts and phosphorus (2.99 g/kg dry weight of aerial parts contents were obtained from three times water spraying. However, the highest amounts of aerial plant part of potassium (65.08 g/kg dry weight and sodium (403 g/kg dry weight belonged to the two times, and calcium (29.23 g/kg dry weight to the three times spraying of 4 g/l nano-potassium. Despite of the high concentration of osmolytes by potassium spraying, the nutrient accumulations levels were not significantly different from each other.

  2. Validation of reference genes for gene expression analysis in olive (Olea europaea) mesocarp tissue by quantitative real-time RT-PCR

    Science.gov (United States)

    2014-01-01

    Background Gene expression analysis using quantitative reverse transcription PCR (qRT-PCR) is a robust method wherein the expression levels of target genes are normalised using internal control genes, known as reference genes, to derive changes in gene expression levels. Although reference genes have recently been suggested for olive tissues, combined/independent analysis on different cultivars has not yet been tested. Therefore, an assessment of reference genes was required to validate the recent findings and select stably expressed genes across different olive cultivars. Results A total of eight candidate reference genes [glyceraldehyde 3-phosphate dehydrogenase (GAPDH), serine/threonine-protein phosphatase catalytic subunit (PP2A), elongation factor 1 alpha (EF1-alpha), polyubiquitin (OUB2), aquaporin tonoplast intrinsic protein (TIP2), tubulin alpha (TUBA), 60S ribosomal protein L18-3 (60S RBP L18-3) and polypyrimidine tract-binding protein homolog 3 (PTB)] were chosen based on their stability in olive tissues as well as in other plants. Expression stability was examined by qRT-PCR across 12 biological samples, representing mesocarp tissues at various developmental stages in three different olive cultivars, Barnea, Frantoio and Picual, independently and together during the 2009 season with two software programs, GeNorm and BestKeeper. Both software packages identified GAPDH, EF1-alpha and PP2A as the three most stable reference genes across the three cultivars and in the cultivar, Barnea. GAPDH, EF1-alpha and 60S RBP L18-3 were found to be most stable reference genes in the cultivar Frantoio while 60S RBP L18-3, OUB2 and PP2A were found to be most stable reference genes in the cultivar Picual. Conclusions The analyses of expression stability of reference genes using qRT-PCR revealed that GAPDH, EF1-alpha, PP2A, 60S RBP L18-3 and OUB2 are suitable reference genes for expression analysis in developing Olea europaea mesocarp tissues, displaying the highest level

  3. Separation and identification of phenolic compounds of extra virgin olive oil from Olea europaea L. by HPLC-DAD-SPE-NMR/MS. Identification of a new diastereoisomer of the aldehydic form of oleuropein aglycone.

    Science.gov (United States)

    Pérez-Trujillo, Míriam; Gómez-Caravaca, Ana María; Segura-Carretero, Antonio; Fernández-Gutiérrez, Alberto; Parella, Teodor

    2010-08-25

    The phenolic fraction of a monovarietal extra virgin olive oil (EVOO) from Olea europaea L. var. Cornezuelo was studied by the hyphenated HPLC-DAD-SPE-NMR/MS techniques. This survey led to the identification of 25 main compounds. One was identified as a new diastereoisomer of the aldehydic form of oleuropein aglycone (AOA) and characterized by 1D and 2D NMR techniques. The relative configuration of this new AOA was determined as 5R*,8S*,9S* on the basis of the results obtained from the combination of NOE experiments and Monte Carlo conformational search calculations. Assuming, as for the described diastereoisomers, that the new AOA comes from the natural oleuropein aglycone (OA), the absolute configuration was proposed as 5S,8R,9R.

  4. Fauna Europaea: Mollusca – Bivalvia

    Directory of Open Access Journals (Sweden)

    Rafael Araujo

    2015-07-01

    European freshwater bivalves belong to the Orders Unionoida and Cardiida. All the European unionoids are included in the superfamily Unionoidea, the freshwater mussels or naiads. The European cardiids belong to the following three superfamilies: Cardioidea, Cyrenoidea and Dreissenoidea. Among the Unionoidea there are the most imperilled animal groups on the planet while the Cardioidea includes the cosmopolitan genus Pisidium, the Cyrenoidea the Asiatic clam (Corbicula fluminea and the Dreissenoidea the famous invasive zebra mussel (Dreissena polymorpha. Basic information is summarized on their taxonomy and biology. Tabulations include a complete list of the current estimated families, genera and species.

  5. Efecto vasodilatador e inhibidor de vasoconstricción del extracto hidroalcohólico de hojas de Olea europaea (olivo sobre anillos aórticos de ratas

    Directory of Open Access Journals (Sweden)

    Job Nexar-QH

    2013-10-01

    Full Text Available Objetivos: Evaluar el efecto vasodilatador, la inhibición de la vasoconstricción, así como el mecanismo responsable, del extracto hidroalcohólico de hojas de Olea europaea (olivo, sobre anillos aórticos en ratas. Diseño: Experimental. Lugar: Centro de Investigación y Desarrollo Científico, Facultad de Medicina, Universidad Nacional de San Agustín, Arequipa, Perú. Material biológico: Hojas de Olea europea y anillos aórticos de Rattus norvegicus, variedad albina swiss. Intervenciones: Se obtuvo un extracto hidroalcohólico de las hojas de Olea europaea. Se usó anillos aórticos de rata en cámara de órganos aislados y se registró la actividad vasomotora con un transductor de tensión isométrica. Se produjo contracción basal máxima con CaCl2 6 mM y se determinó el efecto vasodilatador con dosis de 25, 50 y 100 mg/mL de extracto hidroalcohólico de las hojas de Olea europaea. Se usó 1H-[1,2,4] oxadiazolo [4,3 alquinoxalin-1-one] (ODQ y nifedipino para determinar el mecanismo de acción. Se comparó la inhibición de la vasoconstricción tras la incubación durante 30 minutos con extracto 100 mg/mL y con captopril 10 µM. Principales medidas de resultados: Porcentaje de vasodilatación y de vasoconstricción. Resultados: Se obtuvo una vasodilatación de 7,20 ± 1,49%, 9,84 ± 1,42% y 12,31 ± 1,16% para las dosis de 25, 50 y 100 mg/mL, respectivamente, siendo significativa con la dosis de 100 mg/mL. La vasodilatación se incrementó tras la administración de ODQ 100 mM. La vasodilatación se inhibió tras la incubación con ODQ 100 mM más nifedipino 5 µM. No se encontró diferencia significativa entre la inhibición de la vasoconstricción con captopril 10µM y extracto a 100 mg/mL. Conclusiones: El extracto hidroalcohólico de hojas de Olea europea, a una dosis de 100 mg/mL, tiene efecto vasodilatador sobre anillos aórticos de ratas, mediado por el bloqueo de canales de calcio; además, posee efecto inhibidor de la

  6. Workshop Euratom Directive 97/43. New trends in radiation protection in clinical practice, in research and in regulation; Giornata di studio La Direttiva Europea 97/43: nuovi orientamenti per la radioprotezione nella pratica clinica, nella ricerca e nel quadro normativo

    Energy Technology Data Exchange (ETDEWEB)

    Mazzei, F [ed.; Istituto Superiore di Sanita' , Rome (Italy). Lab. di Fisica

    1999-07-01

    The Euratom Directive 97/43 on health protection of individuals against the dangers of ionizing radiation in relation to medical exposure is presented. In particular the following topics are focused, with a multidisciplinary approach, on: diagnostic reference levels in radiodiagnostics and nuclear medicine; radiation protection in paediatrics, in interventional radiology and in computer tomography; radiation protection radiotherapy, radiation protection in medical research; radiation protection in prenatal and neonatal exposure; radiation protection in medical-legal exposures. [Italian] Il rapporto raccoglie una presentazione della Direttiva Euratom 97/43 riguardante la protezione sanitaria delle persone contro i pericoli delle radiazioni ionizzanti connessi a esposizioni mediche. In particolare sono affrontati in modo interdisciplinare i seguenti argomenti: livelli diagnostici di riferimento in radiodiagnostica e in medicina nucleare; radioprotezione nelle esposizioni in eta' pediatrica, in radiologica interventistica e in tomografia computerizzata; radioprotezione in radioterapia; radioprotezione nella ricerca scientifica clinica; radioprotezione nell'esposizione in eta' prenatale e neonatale; esposizioni potenziali e radioprotezione nelle esposizioni medico-legali.

  7. Workshop Euratom Directive 97/43. New trends in radiation protection in clinical practice, in research and in regulation; Giornata di studio La Direttiva Europea 97/43: nuovi orientamenti per la radioprotezione nella pratica clinica, nella ricerca e nel quadro normativo

    Energy Technology Data Exchange (ETDEWEB)

    Mazzei, F. [ed.] [Istituto Superiore di Sanita' , Rome (Italy). Lab. di Fisica

    1999-07-01

    The Euratom Directive 97/43 on health protection of individuals against the dangers of ionizing radiation in relation to medical exposure is presented. In particular the following topics are focused, with a multidisciplinary approach, on: diagnostic reference levels in radiodiagnostics and nuclear medicine; radiation protection in paediatrics, in interventional radiology and in computer tomography; radiation protection radiotherapy, radiation protection in medical research; radiation protection in prenatal and neonatal exposure; radiation protection in medical-legal exposures. [Italian] Il rapporto raccoglie una presentazione della Direttiva Euratom 97/43 riguardante la protezione sanitaria delle persone contro i pericoli delle radiazioni ionizzanti connessi a esposizioni mediche. In particolare sono affrontati in modo interdisciplinare i seguenti argomenti: livelli diagnostici di riferimento in radiodiagnostica e in medicina nucleare; radioprotezione nelle esposizioni in eta' pediatrica, in radiologica interventistica e in tomografia computerizzata; radioprotezione in radioterapia; radioprotezione nella ricerca scientifica clinica; radioprotezione nell'esposizione in eta' prenatale e neonatale; esposizioni potenziali e radioprotezione nelle esposizioni medico-legali.

  8. Essais de prolifération et d'enracinement de matériel issu de rajeunissement par bouturage d'oliviers adultes (Olea europaea L. et de germination in vitro : effets de cytokinine et d'auxines

    Directory of Open Access Journals (Sweden)

    Walali Loudiyi D

    2005-01-01

    Full Text Available Proliferation and rooting of juvenile and adult olive explants (Olea europaea L.: effects of cytokinin and auxins. The micropropagation trials conducted concerned juvenile and adult material from the ‘Moroccan Picholine’ olive cultivar. Zeatin, added to the proliferation medium, was tested at 0, 1, 5, 10 et 20 mg/l. Root induction was performed on media contaning IAA, IBA or NAA tested at 0, 0.5, 1, 2 et 4 mg/l. A significant (P<0.001 interaction exists between the explant type and the cytokinine concentration on one hand and the type and concentration of auxin on the other hand. The highest bud sprouting and shoot development were obtained on medium supplemented with 5 mg/l zeatin. For economical reasons, satisfying results can be obtained with only 1 mg/l. Rooting of microcuttings reached 100% when NAA, which proved to be the best auxin for root induction, was used at 1 mg/l. No rooting was observed in the case of adult plant material. Further investigations are being undertaken to improve the reactivity of this recalcitrant type of material.

  9. AOX1-Subfamily Gene Members in Olea europaea cv. “Galega Vulgar”—Gene Characterization and Expression of Transcripts during IBA-Induced in Vitro Adventitious Rooting

    Science.gov (United States)

    Lousa, Diana; M. Soares, Cláudio; Santos Macedo, Elisete; Arnholdt-Schmitt, Birgit

    2018-01-01

    Propagation of some Olea europaea L. cultivars is strongly limited due to recalcitrant behavior in adventitious root formation by semi-hardwood cuttings. One example is the cultivar ”Galega vulgar”. The formation of adventitious roots is considered a morphological response to stress. Alternative oxidase (AOX) is the terminal oxidase of the alternative pathway of the plant mitochondrial electron transport chain. This enzyme is well known to be induced in response to several biotic and abiotic stress situations. This work aimed to characterize the alternative oxidase 1 (AOX1)-subfamily in olive and to analyze the expression of transcripts during the indole-3-butyric acid (IBA)-induced in vitro adventitious rooting (AR) process. OeAOX1a (acc. no. MF410318) and OeAOX1d (acc. no. MF410319) were identified, as well as different transcript variants for both genes which resulted from alternative polyadenylation events. A correlation between transcript accumulation of both OeAOX1a and OeAOX1d transcripts and the three distinct phases (induction, initiation, and expression) of the AR process in olive was observed. Olive AOX1 genes seem to be associated with the induction and development of adventitious roots in IBA-treated explants. A better understanding of the molecular mechanisms underlying the stimulus needed for the induction of adventitious roots may help to develop more targeted and effective rooting induction protocols in order to improve the rooting ability of difficult-to-root cultivars. PMID:29462998

  10. Determination of the Effects of Medium Composition on the Monochloramine Disinfection Kinetics of Nitrosomonas europaea by the Propidium Monoazide Quantitative PCR and Live/Dead BacLight Methods ▿

    Science.gov (United States)

    Wahman, David G.; Schrantz, Karen A.; Pressman, Jonathan G.

    2010-01-01

    Various medium compositions (phosphate, 1 to 50 mM; ionic strength, 2.8 to 150 meq/liter) significantly affected Nitrosomonas europaea monochloramine disinfection kinetics, as determined by the Live/Dead BacLight (LD) and propidium monoazide quantitative PCR (PMA-qPCR) methods (lag coefficient, 37 to 490 [LD] and 91 to 490 [PMA-qPCR] mg·min/liter; Chick-Watson rate constant, 4.0 × 10−3 to 9.3 × 10−3 [LD] and 1.6 × 10−3 to 9.6 × 10−3 [PMA-qPCR] liter/mg·min). Two competing effects may account for the variation in disinfection kinetic parameters: (i) increasing kinetics (disinfection rate constant [k] increased, lag coefficient [b] decreased) with increasing phosphate concentration and (ii) decreasing kinetics (k decreased, b increased) with increasing ionic strength. The results support development of a standard medium for evaluating disinfection kinetics in drinking water. PMID:20952645

  11. EFSA NDA Panel (EFSA Panel on Dietetic Products, Nutrition and Allergies), 2014. Scientific Opinion on the substantiation of a health claim related to olive leaf (Olea europaea L.) water extract and increase in glucose tolerance pursuant to Article 13(5) of Regulation (EC) No 1924/2006

    DEFF Research Database (Denmark)

    Tetens, Inge

    substantiation of a health claim related to olive (Olea europaea L.) leaf water extract and increase in glucose tolerance. The food that is the subject of the health claim, olive leaf water extract standardised by its content of oleuropein, is sufficiently characterised. The claimed effect, an increase...... is insufficient to establish a cause and effect relationship between the consumption of olive leaf water extract and an increase in glucose tolerance....... in glucose tolerance, is a beneficial physiological effect as long as serum insulin concentrations are not disproportionately increased. One human intervention study showed an increase in glucose tolerance without disproportionate increase in insulin concentrations after daily consumption of the olive leaf...

  12. Isolation of Pseudomonas aeruginosa strains from dental office environments and units in Barretos, state of São Paulo, Brazil, and analysis of their susceptibility to antimicrobial drugs Isolamento de cepas de Pseudomonas aeruginosa provenientes do meio ambiente e de equipos dentarios em clinicas dentarias em Barretos, São Paulo, Brasil; analises da susceptibilidade das cepas a drogas antimicrobianas

    Directory of Open Access Journals (Sweden)

    Ana Claudia de Oliveira

    2008-09-01

    Full Text Available A wide variety of opportunistic pathogens has been detected in the tubing supplying water to odontological equipment, in special in the biofilm lining of these tubes. Among these pathogens, Pseudomonas aeruginosa, one of the leading causes of nosocomial infections, is frequently found in water lines supplying dental units. In the present work, 160 samples of water, and 200 fomite samples from forty dental units were collected in the city of Barretos, State of São Paulo, Brazil and evaluated between January and July, 2005. Seventy-six P. aeruginosa strains, isolated from the dental environment (5 strains and water system (71 strains, were tested for susceptibility to six antimicrobial drugs most frequently used against P. aeruginosa infections. Susceptibility to ciprofloxacin, followed by meropenem was the predominant profile. The need for effective means of reducing the microbial burden within dental unit water lines is emphasized, and the risk of exposure and cross-infection in dental practice, in special when caused by opportunistic pathogens like P. aeruginosa, are highlighted.Uma ampla variedade de patógenos oportunistas tem sido detectadas nos tubos de alimentação de água dos equipos odontológicos, particularmente no biofilme formado na superfície do tubo. Entre os patógenos oportunistas encontrados nos tubos de água, Pseudomonas aeruginosa é reconhecida como uma das principais causadoras de infecções nosocomiais. Foram coletadas 160 amostras de água e 200 amostras de fomites em quarenta clinicas odontológicas na cidade de Barretos, São Paulo, Brasil, durante o período de Janeiro a Julho de 2005. Setenta e seis cepas de P. aeruginosa, isoladas a partir dos fomites (5 cepas e das amostras de água (71 cepas, foram analisadas quanto à susceptibilidade à seis drogas antimicrobianas freqüentemente utilizadas para o tratamento de infecções provocadas por P. aeruginosa. As principais suscetibilidades observadas foram para a

  13. Construcao de subconjuntos terminologicos: contribuicoes a pratica clinica do enfermeiro

    Directory of Open Access Journals (Sweden)

    Jorge Wilker Bezerra Clares

    2013-08-01

    Full Text Available A Classificação Internacional para a Prática de Enfermagem (CIPE® é um sistema de classificação unificador dos elementos da prática de enfermagem (diagnósticos, resultados e intervenções, que possibilita elucidar elementos da linguagem própria da Enfermagem por meio da construção de subconjuntos terminológicos. Neste ensaio reflexivo, destacam-se aspectos relevantes para a construção de subconjuntos terminológicos CIPE®, bem como suas contribuições para a prática clínica do enfermeiro. Discute-se a elaboração de subconjuntos como ferramenta que contribui para a universalização da linguagem da Enfermagem, facilita o processo comunicativo, bem como o avanço científico e tecnológico da profissão. Portanto, incentiva-se seu uso por enfermeiros de todo o mundo.

  14. Ruolo ed organizzazione della microbiologia clinica di domani

    Directory of Open Access Journals (Sweden)

    Giorgio Mucignat

    2006-12-01

    Full Text Available Infectious diseases continue to represent an important preventive and clinical problem especially in the light of the emergence of new pathogens, of the return of infrequent pathogens and of the increased risk of infective pathologies associated with migratory flow. Another critical point is represented by the possible insurgence of infections due to agents used in bioterrorism. More than ever it is indispensable for our country to define a network of structures able to give an organized response to these relevant problems both in terms of prevention and assistance. It is therefore important to define a protocol for clinical microbiology on a national basis that responds to different levels of activity. Keeping in mind that the fundamental objectives of microbiology are: - diagnosis of infective diseases - determination of resistance to antimicrobic drugs as a valid instrument to allow the clinician to proceed with specific treatment - control of infection spreading in the sanitary structures (hospital infections - to develop front line defence in new infections and bioterrorism, in collaboration with the department of prevention - to be a reference centre for specific training The principals on which one must base the reorganization are essentially three: 1. to configurate the microbiology service on the basis of real needs of the local population 2. to give qualitatively optimal results in real time 3. supporting “good clinical practice” to assure adequate patient results and acceptable costs for the regionale sanitary system (SSR The organization of microbiology should therefore foresee a microbiology department, structured on a provincial basis or a vast area including a structured centralized complex with peripheral structures (even simplified. This must integrate actively with the department of prevention in regard to the dynamics of infectious diseases in the territory and with the Division of Infectious Diseases (where this exists. In parallel an active interaction with research structures (IRCCS and University present in the territory to enable the coordinated implementation of the guidelines of research and its relapse on diagnostic exams. Keeping in mind that the quality of diagnostic performance is closely linked to the professional experience of the operators it is good practice centralizing some diagnostic procedures by identifying a reference centre. In a regional network organized in this way it is important to include a coordinating structure, since it is necessary to activate a complete level of communication, information exchange, activity planning, and complete problem solving.

  15. Historia clinica de un caso de endocrinología

    Directory of Open Access Journals (Sweden)

    Max Olaya Restrepo

    1951-09-01

    de la Distrofia adiposo-genital de Babinsky-Frolich. Consiste en un sujeto, hombre o mujer, estadísticamente es más frecuente en los hombres, que presenta algunas de las modalidades características del Síndrome de Frolich, tan conocido y estudiado por, todos los investigadores. Sobre esta base endocrina, se injertan tres, distintivos somáticos que le dan cierta individualidad al Síndrome de Lawrence. Son ellos: LA POLIDACTILIA, LA RETINITIS PIGMENTARIA Y EL BOCIO. Se presentan a continuación los dos casos anteriormente descritos entre nosotros, que aparecen publicados ambos, en el BOLETIN CLINICO, Organo de la Facultad de Medicina y Ciencias Naturales de la Universidad de Antioquia.

  16. Come pesci nell’acqua. Elementi di etnopsicologia clinica

    Directory of Open Access Journals (Sweden)

    Wanda Ielasi

    2007-03-01

    Full Text Available Starting from her clinical experience with migrant people, the author summarizes the theoretical and operational instruments in ethno-psychological field with a critical review of some key concepts: psyche and body, health and suffering, culture, ethnic group and race, diagnosis and treatment, individual and collective dimension. Especially, culture becomes most relevant when psychological competences are involved in cultural contexts which are different from our own: both when we work with foreign people in our country and when we are involved in mental health projects abroad. Transcultural clinic, ethnopsychiatry, critical medical anthropology and anthropology of contemporaneousness constitute the disciplinary horizon of therapeutic communications capable of managing caregiver’s and client’s cultural aspects.

  17. Legionnaires' disease in the renal transplant unit of "Hospital das Clinicas, FMUSP": during a five year period (1988-1993 Doença dos legionários na Unidade de Transplante Renal (UTR do Hospital das Clínicas FMUSP, no período de 1988 a 1993

    Directory of Open Access Journals (Sweden)

    Neusa Augusta de Oliveira Mazieri

    1994-06-01

    Full Text Available Several reports have related Legionella pneumophila with pneumonia in renal transplant patients, however this association has not been systematically documented in Brazil. Therefore this paper reports the incidence, by serologycal assays, of Legionella pneumophila serogroup 1 in these patients during a five year period. For this purpose sera from blood samples of 70 hospitalized patients with pneumonia from the Renal Transplant Unit of Hospital das Clinicas, FMUSP collected at the acute and convalescent phase of infection were submitted to indirect immunofluorescence assay (IFA to demonstrate anti-Legionella pneumophila serogroup 1 antibodies. Of these 70 patients studied during the period of 1988 to 1993,18 (25.71 % had significant rises in specific antibody titers for Legionella pneumophila serogroup 1. Incidence was interrupted following Hospital water decontamination procedures, with recurrence of infections after treatment interruption. In this study, the high susceptibility (25.71% of immunodepressed renal transplant patients to Legionella pneumophila serogroup 1 nosocomial infections is documented. The importance of the implementation and maintenance of water decontamination measures for prophylaxis of the infection is also clearly evident.Embora vários trabalhos tem mostrado a presença de Legionella pneumophila associado a pneumopatias infecciosas em transplantados renais, tal associação não fora antes realizado de maneira sistemática no Brasil. Os autores julgaram oportuno a determinação da incidência por comprovação sorológica da Legionella pneumophila sorogrupo 1 em transplantados renais num período de 5 anos. Para tanto amostras de soros de 70 pacientes com pneumopatia infecciosa internados na UTR do HC-FMUSP, colhidos na fase aguda e convalescente da infecção, foram submetidas à reação de imunofluo-rescência indireta para pesquisa de anticorpos anti-Legionella pneumophila sorogrupo 1. Dos 70 pacientes

  18. Olea europaea Linn (Oleaceae) Fruit Pulp Exhibits ...

    African Journals Online (AJOL)

    Methods: Sprague–Dawley rats were fed with a normal diet, a high-cholesterol diet or high- .... HPLC finger print analysis of OFP-EA extract ... protein levels were quantified using western ..... Cook NC, Samman S. Flavonoids-chemistry,.

  19. Lesões desportivas no atletismo: comparação entre informações obtidas em prontuários e inquéritos de morbidade referida Lesiones deportivas en el atletismo: comparacion entre las informaciones obtenidas en historias clinicas y consultas de la morbilidad referida Sports injuries in track and field: comparison between information obtained in medical records and reported morbidity inquires

    Directory of Open Access Journals (Sweden)

    Carlos Marcelo Pastre

    2004-02-01

    ões desportivas para a população investigada.Para comprender las lesiones deportivas (LD es necesario cuantificarlas, asociandolas a factores causales particulares al esporte. Aún así, faltan registros sobre estas patologías en las instituciones deportivas, sobretodo en el atletismo brasileño, donde pocos son los clubes que poseen servicios de asistencia de la salud. La ausencia de tales registros, estudios en el área de Salud Pública, se utilizan otros recursos epidemiológicos para colectas, tales como las consultas de morbilidad referida. A partir de esta escasez de información y de la facilidad de obtención de datos junto a los propios atletas, se objetivó, para esta pesquisa, levantar informaciones sobre las LD referidas por los atletas de alto rendimento, retrocediendo ocho meses, y comparándolas con los registros de historias clínicas. Por lo tanto, fueron tomados veinticinco atletas de elite, dieciseis de género masculino y nueve del femenino, con edades de 25,7 ± 4,4 años, altura de 1,74 ± 0,10 m, peso 70,4 ± 13,15 kg e tiempo médio de entrenamiento de 8,38 ± 4,06 años. Dos fisioterapeutas fueron entrenados separadamente para recolectar información sobre LD. Uno de ellos en historias clinicas y el otro de los propios atletas a través de entrevistas (Interrogatorio de Morbidade Referida - IMR. El estudio de concordancia de respuestas para las dos formas de colecta fué realizado por el test de proporción binomial, estabeleciendose límites de 95% de confianza para la concordancia. Los resultados mostraron que en todas las variables estudiadas los valores estaban dentro de los límites de confianza estabelecidos para los tests estadísticos, siendo: 88,33% para las variables tipo de lesión o agravio y mecanismo de lesión o aumento de los síntomas, 90% para la variable calidad del reintegro a las actividades deportivas el 91,67% para las variables local anatómico y período de entrenamiento. Se concluye por lo tanto, que ha habido una elevada

  20. Analysis of epidemiological and clinical characteristics of patients admitted diagnosed with acute ischemic cerebrovascular event in internal medicine services and neurology of the Hospital Mexico in March 2013 to March 2014; Analisis de las caracteristicas epidemiologicas y clinicas de los pacientes ingresados con diagnostico de evento cerebrovascular isquemico agudo en los servicios de medicina interna y neurologia del Hospital Mexico de marzo 2013 a marzo 2014

    Energy Technology Data Exchange (ETDEWEB)

    Araya Gonzalez, Manuel Alberto

    2014-07-01

    transformation was documented in 6% of cases. 70% of patients were performed Doppler ultrasound of neck vessels. Without injuries 82%, 9% with obstruction between 50-70% and 9% with over 70% lumen obstruction. Echocardiography was performed in 54% of cases and 76% was obtained left ventricular hypertrophy, left atrial dilation 37% and 2% intramural thrombus. With respect to functionality 81% of patients had no or minimal dependence upon admission, to the time of discharge 74% have had moderated to severe disability, 12% mild and only 14% had no disability or this was minimal. 51% of patients have presented one or more complications during hospitalization, the 5 most frequent have been: bronchopneumonia 25%, bronchial aspiration and urinary tract infection 19%, 16% cognitive impairment and 10% cardiac arrhythmias. The average overall stay has been 13 days. Internal medicine has been 14± days and in neurology has been 12 ± days. The mortally rate has been 19% while 71% of patients were discharged to home and 10% were moved to the medical center. (author) [Spanish] Expedientes de 100 pacientes internos fueron revisados con el diagnostico de evento cerebrovascular isquemico, en los servicios de neurologia y medicina interna del Hospital Mexico desde marzo del 2013 hasta marzo del 2014. Del total de pacientes 46 eran hombres y 54 eran mujeres. La edad promedio en general era de 69 anos, para los hombres ha sido de 66 anos y para las mujeres de 71. Pacientes de todas las provincias fueron ingresados, principalmente de San Jose con un 56% y Alajuela con un 19%. El manejo intrahospitalario segun especialidad fue distribuido en 60% medicina interna y 40% neurologia. Los factores de riesgo mas frecuentemente encontrados han sido: hipertension arterial 85%, diabetes mellitus 40%, tabaquismo 35%, dislipidemia 35%. El sobrepeso fue observado en 23% de los pacientes y la obesidad en 22%. En cuanto a las manifestaciones clinicas iniciales documentadas en la primera exploracion fisica, las 6

  1. Flowering in the wild olive ( Olea europaea L.) tree (oleaster ...

    African Journals Online (AJOL)

    flowers with absence or reduced stamens and flowers with absence of pistil) are frequently observed and may reduce fruit set. This study investigates the phenology evolution and the male and female abortion of the oleaster tree (or the wild olive ...

  2. Mycorrhizal status of Olea europaea spp. oleaster in Morocco

    African Journals Online (AJOL)

    SARAH

    2013-01-31

    Jan 31, 2013 ... decline of forests, accelerated soil degradation and the developed ... in terrestrial ecosystems of the arid areas. (Brundett, 1991 ... restoration of the degraded soils and in the plants prophylaxis ... Moroccan forest ecosystems. This species of ..... attributed to the method used in estimating the mycorrhization ...

  3. Genetic variation within the olive (Olea europaea L.) cultivar Oblica ...

    African Journals Online (AJOL)

    USER

    2010-05-17

    May 17, 2010 ... Oblica is the predominant olive cultivar in Croatia, spread widely in all the olive growing regions. Morphological variability within the cultivar is well documented but often it has been attributed to environmental factors rather than to genetic ones. In order to investigate intracultivar variability on the molecular ...

  4. Genetic variation within the olive ( Olea europaea L. ) cultivar Oblica ...

    African Journals Online (AJOL)

    Oblica is the predominant olive cultivar in Croatia, spread widely in all the olive growing regions. Morphological variability within the cultivar is well documented but often it has been attributed to environmental factors rather than to genetic ones. In order to investigate intracultivar variability on the molecular level, olive ...

  5. Heavy metal accumulation in under crown Olea europaea L forest ...

    African Journals Online (AJOL)

    Heavy metal concentration in plants increased in site irrigation with wastewater. Zn, Pb and Ni exceeded their permitted limits in soils and Pb, Cr and Ni exceeded their permitted limits in roots of plants irrigated with wastewater. It was concluded that the use of wastewater in urban forest enriched the soils with heavy metals ...

  6. Hydrophilic C terminus of Salicornia europaea vacuolar Na /H ...

    Indian Academy of Sciences (India)

    2014-08-08

    Aug 8, 2014 ... Soil salinity caused, particularly by NaCl, is a major abi- otic stress worldwide. ... sodium, plants have developed several adaptive mechanisms including accumulation of ..... and pH-dependent manner. Proc. Natl. Acad. Sci.

  7. Olea europaea Linn (Oleaceae) Fruit Pulp Extract Suppresses Sterol ...

    African Journals Online (AJOL)

    ISSN: 1596-5996 (print); 1596-9827 (electronic). © Pharmacotherapy ... increasing fatty acid oxidation and constitutive lipoprotein ... The ethanol extract obtained (180 g) was re- suspended in ... 10 % heat-inactivated foetal bovine serum (FBS;.

  8. Flowering in the wild olive (Olea europaea L.) tree (oleaster ...

    African Journals Online (AJOL)

    Yomi

    2012-04-19

    Apr 19, 2012 ... This study investigates the phenology evolution and the male and female ... ecological niches in oleaster trees. ... The self-pollination may occur, but olive cultivars are ... Plants can ..... The fruit set results from the interaction.

  9. Comparative molecular analysis of old olive ( Olea europaea L ...

    African Journals Online (AJOL)

    We compared the genetic profiles of six old olive cultivars from an Eastern Mediterranean Region of Turkey to 15 modern Turkish olive cultivars from different geographical origins. The RAPD profiles successfully clarified the molecular relationships among the genotypes tested. Seventeen RAPD primers generated 153 ...

  10. Experimental measurement of the biomass of Olea europaea L ...

    African Journals Online (AJOL)

    The C stock evaluation methodology made in this research and the calculation of biomass expansion factor can be considered as the first scientific contribution in estimating productivity, CO2 sequestration, carbon stocks and yield of olive groves. Key words: Biomass, biomass expansion factor, Intergovernmental Panel on ...

  11. Multiplicação in vitro de oliveira (Olea europaea L. Olive (Olea europaea L. in vitro multiplication

    Directory of Open Access Journals (Sweden)

    Leonardo Ferreira Dutra

    2004-02-01

    Full Text Available Com o objetivo de induzir a multiplicação em explantes de oliveira, segmentos nodais oriundos de plântulas mantidas in vitro foram excisados e inoculados em tubos de ensaio contendo meio de cultura MS suplementado com 2 g L-1 de carvão ativado, BAP (0, 1, 2 e 4 mg L-1 e ANA (0; 0,01; 0,1 e 1 mg L-1, solidificado com 6 g L-1 de ágar e pH ajustado para 5,8. Durante 100 dias, os explantes foram mantidos em sala de crescimento a 25±1ºC, intensidade luminosa de 32 µmoles.m-2.s-1 e fotoperíodo de 16 horas. Não houve indução de brotações nos segmentos nodais. O maior comprimento da parte aérea foi obtido com 0,1 mg L-1 de ANA na ausência de BAP. O meio de cultura sem BAP proporcionou maior peso de matéria fresca da parte aérea.This work had the objective to induce olive multiplication. Nodal segments from in vitro plantlets were excised and inoculated in test tubes containing MS culture medium supplemented with activated charcoal (2 g L-1, BAP (0, 1, 2 and 4 mg L-1, NAA (0; 0.01; 0.1 and 1 mg L-1, agar (6 g L-1 and pH adjusted to 5.8. The explant were maintained in growth room to 25±1°C, 32 µmoles.m-2.s-1 light intensity and 16 hours photoperiod for 100 days. There was not shoots induction in the nodal segments. Larger length of aerial part were obtained with ANA 0.1 mg L-1 in the BAP absence. Culture medium without BAP provides larger weight of fresh matter of the aerial part.

  12. SOPORTE SOCIAL Y FAMILIAR: EXPERIENCIAS CON FAMILIAS DE PACIENTES ATENDIDOS EN UNA CLINICA UNIVERSITARIA

    Directory of Open Access Journals (Sweden)

    María Eugenia Agudelo Bedoya

    2016-08-01

    Full Text Available Este artículo está basado en una investigación realizada sobre problemáticas familiares de 133 pacientes interconsultados y atendidos por Trabajo Social en los servicios de internación de la Clínica Universitaria Bolivariana (CUB entre febrero-julio de 2013.1 Se utilizó un diseño mixto, integrando aspectos cuantitativos y cualitativos para describir las familias, variables de la atención ofrecida por trabajo social y la manera como se organizaban las familias para el cuidado del paciente en su hospitalización. Se encontraron varias configuraciones familiares, un porcentaje alto atravesando ciclo vital de adulto o anciano. El mayor número de remisiones corrieron por cuenta del médico internista y correspondieron a situaciones catalogadas por trabajo social como “problemas relacionados con otros hechos estresantes que afectan la familia”. El tipo de intervención en el que fueron atendidas fue el acompañamiento. Algunas de las familias, encontraron soporte entre sus miembros, amigos, vecinos, cuidadores formales e informales y en instituciones que por su competencia deben brindarlo. La ausencia de estos apoyos se constituye el principal motivo de remisión a trabajo social.

  13. Clinical applications of cells labelling; Aplicaciones clinicas del marcado de celulas

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, B M [Instituto Nacional de Pediatria (Mexico)

    1994-12-31

    Blood cells labelled with radionuclides are reviewed and main applications are described. Red blood cell labelling by both random and specific principle. A table with most important clinical uses, 99mTc labelling of RBC are described pre tinning and in vivo reduction of Tc, in vitro labelling and administration of labelled RBC and in vivo modified technique. Labelled leucocytes with several 99mTc-complex radiopharmaceuticals by in vitro technique and specific monoclonal s for white cells(neutrofiles). Labelled platelets for clinical use and research by in vitro technique and in vivo labelling.

  14. Radio sterilized human ligaments and their clinical application;Ligamentos humanos radioesterilizados y su aplicacion clinica

    Energy Technology Data Exchange (ETDEWEB)

    Luna Z, D.; Reyes F, M. L. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Diaz M, I.; Hernandez R, G., E-mail: daniel.luna@inin.gob.m [Centro Estatal de Trasplantes del Estado de Mexico, Pablo Sidar No. 602, Col. Universidad, 50130 Toluca, Estado de Mexico (Mexico)

    2009-10-15

    The ligaments are human tissues that are used in the transplantation area. A ligament is an anatomical structure in band form, composed by resistant fibers that connect the tissues that unite the bones with the articulations. In an articulation, the ligaments allow and facilitate the movement inside the natural anatomical directions, while it restricts those movements that are anatomically abnormal, impeding lesions that could arise of this type of movements. The kneecap ligament is a very important tissue in the knee mobility and of walking in the human beings. This ligament can injure it because of automobile accidents, for sport lesions or illnesses, and in many cases the only form of recovering the knee movement is carried out a transplant with the purpose of replacing the damage ligament by allo gen kneecap ligament processed in specialized Tissue Banks where the tissue is sterilized with gamma radiation of {sup 60}Co at very low temperatures, obtaining high quality ligaments for clinical application in injured patients. The kneecap ligaments are processed in the Tissue Banks with a segment of kneecap bone, a segment of tibial bone, the contained ligament between both bones and in some cases a fraction of the quadriceps tendon. In this work is given a description of the selection method of the tissue that includes the donor's serologic control, the kneecap ligament processing in the Radio Sterilized Tissues Bank, its sterilization with gamma radiation of {sup 60}Co, also it is indicated like the clinical application of the allo gen ligament was realized in a hasty patient and whose previous crossed ligament was injured. Finally the results are presented from the tissue obtaining until the clinical application of it is, and in this case is observed a favorable initial evolution of the transplantation patient. (Author)

  15. [Food status peculiarities, anthropometric, clinica and biochemical indices at professional sportsmen].

    Science.gov (United States)

    Gapparova, K M; Nikitiuk, D B; Zaĭnudinov, Z M; Tserekh, A A; Chekhonina, Iu G; Golubeva, A A; Sil'vestrova, G A; Rusakova, D S; Grigor'ian, O N

    2011-01-01

    Under steady state conditions in 66 athletes involved in weightlifting, bodybuilding, judo and taekwondo have studied features of the metabolic status. Data on matter-of-fact nutrition, body weight content within the inter-competition period, energy exchange, clinical and biochemical indices and physical acceptability indices were analyzed. As a result, the decrease indexes of metabolism at all the sportsmen and high-level caloric value at sportsmen who are engaged in weightlifting, which corresponds their energy expenditures, was revealed.

  16. Possibilities of radiographic digitalisation in dental clinics; Possibilidades de digitalizacao radiografica na clinica odontologica

    Energy Technology Data Exchange (ETDEWEB)

    Zenobio, Madelon A.F. [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), Belo Horizonte, MG (Brazil); Zenobio, Elton Goncalves [Pontificia Univ. Catolica de Minas Gerais, Belo Horizonte, MG (Brazil)

    2002-07-01

    In the evolution diagnostic processes by image, the improvement of the intrabucal radiographic sensibility generated and digitalized is today, of great expressiveness in the evolution and effectiveness in the odontological area. This methodology applicability as a possibility of a more precise and accurate diagnostic formulation among other advantages, justifies this technique use. This paper intends to, thorough the literature magazine and clinic case presentations to show its applicability in the daily odontological clinic, and specially, in the periodonty area. (author)

  17. Two patients walk into a clinic...a genomics perspective on the future of schizophrenia

    LENUS (Irish Health Repository)

    Corvin, Aiden P

    2011-11-11

    Abstract Progress is being made in schizophrenia genomics, suggesting that this complex brain disorder involves rare, moderate to high-risk mutations and the cumulative impact of small genetic effects, coupled with environmental factors. The genetic heterogeneity underlying schizophrenia and the overlap with other neurodevelopmental disorders suggest that it will not continue to be viewed as a single disease. This has radical implications for clinical practice, as diagnosis and treatment will be guided by molecular etiology rather than clinical diagnostic criteria.

  18. Coronary CT: clinical indications and future directions; Tomografia de coronarias: indicacoes clinicas e perspectivas futuras

    Energy Technology Data Exchange (ETDEWEB)

    Nomura, Cesar H.; Serpa, Bruna S.; Kay, Fernando U.; Szarf, Gilberto; Passos, Rodrigo B.; Neto, Roberto S.; Chate, Rodigo C.; Funar, Marcelo B., E-mail: cesarnomura@gmail.com [Hospital Israelita Albert Einstein, Sao Paulo, SP (Brazil); Cury, Roberto C. [Hospital Samaritano, Sao Paulo, SP (Brazil)

    2011-01-15

    Multidetector computed tomography (MDCT) has started its implementation in cardiology with calcium quantification of coronary plaques in the study without contrast, using the calcium score, demonstrating an important independent predictor of future cardiac events. The examination with intravenous contrast, coronary angiography, appeared later as a noninvasive method for evaluation of anatomy and obstructive coronary disease, characterizing the degree of stenosis and the presence of non calcified atherosclerotic plaques, assessing not only the lumen, but also the vessel wall. With the advent of new machines with more detectors and higher temporal resolution has been a reduction in radiation dose and the possibility of new applications. (author)

  19. Cardiovascular risk assessment: audit findings from a nurse clinic--a quality improvement initiative.

    Science.gov (United States)

    Waldron, Sarah; Horsburgh, Margaret

    2009-09-01

    Evidence has shown the effectiveness of risk factor management in reducing mortality and morbidity from cardiovascular disease (CVD). An audit of a nurse CVD risk assessment programme undertaken between November 2005 and December 2008 in a Northland general practice. A retrospective audit of CVD risk assessment with data for the first entry of 621 patients collected exclusively from PREDICT-CVDTM, along with subsequent data collected from 320 of these patients who had a subsequent assessment recorded at an interval ranging from six months to three years (18 month average). Of the eligible population (71%) with an initial CVD risk assessment, 430 (69.2%) had afive-year absolute risk less than 15%, with 84 (13.5%) having a risk greater than 15% and having not had a cardiovascular event. Of the patients with a follow-up CVD risk assessment, 34 showed improvement. Medication prescribing for patients with absolute CVD risk greater than 15% increased from 71% to 86% for anti-platelet medication and for lipid lowering medication from 65% to 72% in the audit period. The recently available 'heart health' trajectory tool will help patients become more aware of risks that are modifiable, together with community support to engage more patients in the nurse CVD prevention programme. Further medication audits to monitor prescribing trends. Patients who showed an improvement in CVD risk had an improvement in one or more modifiable risk factors and became actively involved in making changes to their health.

  20. Two patients walk into a clinic...a genomics perspective on the future of schizophrenia

    Directory of Open Access Journals (Sweden)

    Corvin Aiden P

    2011-11-01

    Full Text Available Abstract Progress is being made in schizophrenia genomics, suggesting that this complex brain disorder involves rare, moderate to high-risk mutations and the cumulative impact of small genetic effects, coupled with environmental factors. The genetic heterogeneity underlying schizophrenia and the overlap with other neurodevelopmental disorders suggest that it will not continue to be viewed as a single disease. This has radical implications for clinical practice, as diagnosis and treatment will be guided by molecular etiology rather than clinical diagnostic criteria.

  1. Factors Affecting Resident Satisfaction in Continuity Clinic-a Systematic Review.

    Science.gov (United States)

    Stepczynski, J; Holt, S R; Ellman, M S; Tobin, D; Doolittle, Benjamin R

    2018-05-07

    In recent years, with an increasing emphasis on time spent in ambulatory training, educators have focused attention on improving the residents' experience in continuity clinic. The authors sought to review the factors associated with physician trainee satisfaction with outpatient ambulatory training. A systematic literature review was conducted for all English language articles published between January 1980 and December 2016 in relevant databases, including Medline (medicine), CINAHL (nursing), PSYCHinfo (psychology), and the Cochrane Central Register of Controlled Clinical Trials. Search terms included internship and residency, satisfaction, quality of life, continuity of care, ambulatory care, and medical education. We included studies that directly addressed resident satisfaction in the ambulatory setting through interventions that we considered reproducible. Three hundred fifty-seven studies were reviewed; 346 studies were removed based on exclusion criteria with 11 papers included in the final review. Seven studies emphasized aspects of organizational structure such as block schedules, working in teams, and impact on resident-patient continuity (continuity between resident provider and patient as viewed from the provider's perspective). Four studies emphasized the importance of a dedicated faculty for satisfaction. The heterogeneity of the studies precluded aggregate analysis. Clinic structures that limit inpatient and outpatient conflict and enhance continuity, along with a dedicated outpatient faculty, are associated with greater resident satisfaction. Implications for further research are discussed.

  2. Estudo de produção enzimatica da dextrana clinica

    OpenAIRE

    Juan Heraldo Viloche Bazan

    1993-01-01

    Resumo: Este trabalho consiste na obtenção "in vitro" de dextrana clínica a partir da sacarose utilizando a enzima dextrana-sacarase obtida pela fermentação do Leuconostoc mesenteroides linhagem NRRL B512-F. A dextrana clínica, de peso molecular médio 40.000 daltons, tem sua aplicação consagrada como expansor volumétrico de sangue humano. A enzima foi produzida por fermentação e purificada usando ultrafiltração, separada com o uso de polietilenoglicol de peso molecular 1500 daltons e estocada...

  3. Guías clinicas de RCP y SRI enfermería

    OpenAIRE

    Donis Mulero, Elena

    2015-01-01

    La reanimación cardiopulmonar (RCP) es un procedimiento de emergencia para salvar vidas que se lleva a cabo cuando una persona se encuentra en parada cardiorrespiratoria (PCR). Tanto la técnica de RCP como la de intubación, son aspectos olvidados por los profesionales de la salud. Recopilar las últimas recomendaciones sobre RCP para poder elaborar un programa sencillo enfocado a la enfermería. Elaborar una guía sencilla de secuencia rápida de intubación (SRI). Revisión bibliográfica en la que...

  4. The equivalent Histograms in clinical practice; Los histogramas equivalentes en la practica clinica

    Energy Technology Data Exchange (ETDEWEB)

    Pizarro Trigo, F.; Teijeira Garcia, M.; Zaballos Carrera, S.

    2013-07-01

    Is frequently abused of The tolerances established for organ at risk [1] in diagrams of standard fractionation (2Gy/session, 5 sessions per week) when applied to Dose-Volume histograms non-standard schema. The purpose of this work is to establish when this abuse may be more important and realize a transformation of fractionation non-standard of histograms dosis-volumen. Is exposed a case that can be useful to make clinical decisions. (Author)

  5. Corrimentos vaginais em gestantes: comparacao da abordagem sindromica com exames da pratica clinica da enfermagem

    Directory of Open Access Journals (Sweden)

    Thais Marques Lima

    2013-12-01

    Full Text Available Estudo avaliativo de abordagem quantitativa, com amostra de 104 gestantes, com o objetivo de comparar os achados de infecções vaginais em gestantes obtidos por meio do fluxograma de corrimento vaginal com exames presentes na prática clínica da Enfermagem. Os dados foram coletados por meio de entrevista e exame ginecológico realizados de janeiro a julho de 2011. O fluxograma não se mostrou eficaz na identificação de candidíase e tricomoníase, apresentou baixa sensibilidade (0,0%; 50% e valor preditivo positivo (0,0%; 3,6% para as duas infecções e baixa especificidade para tricomoníase (46%. Mostrou-se satisfatório para vaginose bacteriana, com alta sensibilidade (100%, valor preditivo negativo (100% e acurácia (74%. Conclui-se que o emprego do fluxograma precisa ser reavaliado, visto que não foi eficaz em identificar infecções importantes em gestantes. Os esforços para o desenvolvimento de testes eficazes devem ser contínuos, com intuito de prevenir a disseminação de infecções e reduzir tratamentos desnecessários.

  6. Fracture liaison service in a non-regional orthopaedic clinic--a cost-effective service.

    LENUS (Irish Health Repository)

    Ahmed, M

    2012-01-01

    Fracture liaison services (FLS) aim to provide cost-effective targeting of secondary fracture prevention. It is proposed that a dedicated FLS be available in any hospital to which a patient presents with a fracture. An existing orthopaedic clinic nurse was retrained to deliver a FLS. Proformas were used so that different nurses could assume the fracture liaison nurse (FLN) role, as required. Screening consisted of fracture risk estimation, phlebotomy and DXA scanning. 124 (11%) of all patients attending the orthopaedic fracture clinic were reviewed in the FLS. Upper limb fractures accounted for the majority of fragility fractures screened n=69 (55.6%). Two-thirds of patients (n=69) had reduced bone mineral density (BMD). An evidence based approach to both non-pharmacological and pharmacotherapy was used and most patients (76.6%) receiving pharmacotherapy received an oral bisphosphonate (n=46). The FLS has proven to be an effective way of delivering secondary prevention for osteoporotic fracture in a non-regional fracture clinic, without increasing staff costs.

  7. CONSENTIMIENTO INFORMADO EN LA PRÁCTICA CLINICA: RETOS DEL PERSONAL DE SALUD

    Directory of Open Access Journals (Sweden)

    Francisco Javier Bonilla Escobar

    2013-08-01

    Full Text Available El consentimiento informado es una herramienta cotidiana en la práctica clínica; para comprenderlo se requiere de un proceso formativo y académico que genere las actitudes para proponer consentimientos informados éticamente aceptables y que estos abarquen la perspectiva del paciente. El consentimiento requiere de un uso adecuado y de su entendimiento por parte del paciente como del profesional de salud que lo administra, siendo de utilidad ética y legal, motivo por el cual no debe ser subestimado. Es importante que dicho conocimiento implique en forma clara el reconocimiento tanto del médico como del paciente de la(s intervención(es, de las posibles consecuencias y situaciones a las que pudiera estar expuesto. Este artículo es una revisión al respecto del consentimiento informado, partiendo de su historia, evolución e implicaciones para el personal de la salud en general, con el objetivo de orientar e informar sobre su uso y evolución en la práctica clínica. El área bioética y los temas concernientes al consentimiento informado son necesidades de difusión e investigación en Latinoamérica para la protección del paciente y la buena práctica del personal de salud.

  8. CONSENTIMIENTO INFORMADO EN LA PRÁCTICA CLINICA: RETOS DEL PERSONAL DE SALUD

    Directory of Open Access Journals (Sweden)

    Francisco Javier Bonilla Escobar

    2012-01-01

    Full Text Available El consentimiento informado es una herramienta cotidiana en la práctica clínica; para comprenderlo se requiere de un proceso formativo y acadé- mico que genere las actitudes para proponer consentimientos informados éticamente aceptables y que estos abarquen la perspectiva del paciente. El consentimiento requiere de un uso adecuado y de su entendimiento por parte del paciente como del profesional de salud que lo administra, siendo de utilidad ética y legal, motivo por el cual no debe ser subestimado. Es importante que dicho conocimiento implique en forma clara el reconoci- miento tanto del médico como del paciente de la(s intervención(es, de las posibles consecuencias y situaciones a las que pudiera estar expuesto. Este artículo es una revisión al respecto del consentimiento informado, partiendo de su historia, evolución e implicaciones para el personal de la salud en general, con el objetivo de orientar e informar sobre su uso y evolución en la práctica clínica. El área bioética y los temas concernientes al consentimiento informado son necesidades de difusión e investigación en Latinoamérica para la protección del paciente y la buena práctica del personal de salud.

  9. A clinica como pratica arborifica e rizomorfica do trabalho em enfermagem cirurgica

    Directory of Open Access Journals (Sweden)

    Lenice Dutra de Sousa

    2013-12-01

    Full Text Available Foi realizada uma pesquisa qualitativa e exploratória, na forma de um estudo de caso, em uma unidade de internação cirúrgica de um hospital universitário, que objetivou analisar o trabalho do enfermeiro sob a ótica da produção de cuidados em saúde e do exercício da clínica. Os sujeitos do estudo foram seis enfermeiros e foram realizadas observações não participantes, pesquisa documental e entrevistas em profundidade com posterior análise textual discursiva. Verificou-se que o trabalho da enfermagem é organizado segundo duas perspectivas interconectadas e interdependentes: a do modelo clínico, que compõe a estrutura-mestre de sua prática, e uma estrutura composta por elementos múltiplos e heterogêneos. O modelo clínico de assistência organiza-se como uma estrutura centrada que possibilita a resolutividade das necessidades biológicas e atua como base para a conexão de outros saberes e práticas que expandem o fazer do enfermeiro por meio de interligações com o ambiente.

  10. Positron Emission Tomography (PET) in the oncologic clinical practice; Tomografia por Emision de Positrones (PET) en la practica clinica oncologica

    Energy Technology Data Exchange (ETDEWEB)

    Serna M, J A; Luviano, C; Martinez V, D [Hospital Angeles del Pedregal Mexico DF (Mexico); Maldonado S, A [Centro PET Complutense, Madrid (Spain)

    2005-07-01

    We intended to determine the frequency with that the computer axial tomography (TAC), it was able to visualize the lesions extra neoplasia detected by the PET tomography in patients with fully identified primary malignant neoplasia. (Author)

  11. Clinical, radiographic and scintigraphic aspects of the trapeziometacarpal osteoarthritis; Caracterizacao clinica, radiografica e cintilografica da osteoartrose trapeziometacarpiana

    Energy Technology Data Exchange (ETDEWEB)

    Kaziyama, Helena Hideko Seguchi

    1996-12-31

    Trapeziometacarpal osteoarthritis occurs mainly in women during the menopausal period. It is related to manual activities and is usually bilateral. The onset is insidious and the evolution is slow and progressive. It is characterized by of strength and pain in the basis of the thumb resulting in limitation of the use and function of the hand. The diagnosis of this condition is based on the physical examination. The manouver of compression axial-rotation of the trapezimetacarpal joint is a common positive finding. Typical findings of osteoarthritis are present in the radiological studies. Scintigraphic images have a predictive value. The early diagnosis is important to avoid the risk factors and to prevent disabilities of the hand. (author) 102 refs., 18 figs., 10 tabs.

  12. Mammary neoplasm inflammatory: clinic presentation: combined treatment value; Cancer inflamatorio de mama: presentacion clinica: valor de los tratamientos combinados

    Energy Technology Data Exchange (ETDEWEB)

    Viola Alles, A; Sabini Gaye, G; Barrios Herrera, E; Muse Sevrini, I

    1995-06-01

    On a total of 1152 patients bearing of cancer of she suckles tried in the period 1978-1988, 41 of she(3.5% )corresponding to the variety inflamatory. Her ages was understood between 26 and 73 years , was been 15(63,5% )postmenopause. Clinically they presented commitment mammary exclusive 34,1%, invasion ganglionar lorregional 48,7% and 17% was disseminated remaining. The initial treatment bases on 3-4 cycles of chemotherapy type FCA, safe in patient with more years that they received the association CMF. All then were irradiated with dose of 5000-6000 cGy on she suckles and territories ganglionares. Finish the treatment with 6 to 8 additional cycles of the patients' chemotherapy. Nobody it was subjected to surgical. The middle survive of the population's total it was of 22 meses, has been of 26 for the premenopause and 15 for the posmenopause. The percentage of relapses arrive to 30% and 45% in the located ways they were disseminated during its evolution. It highlights that the therapeutic strategy you bases on the association open chemotherapy, radiotherapy remaining the possibility of the handling of high citostatics dose with or without transplants of osseous medulla osea (Author) [Spanish] Sobre un total de 1152 pacientes portadoras de cancer de mama tratadas en el periodo 1978-1988, 41 de ellas(3.5%)correspondieron a la variedad inflamatoria. Sus edades estaban comprendidas entre 26 y 73 an os,siendo 15(63,5%) posmenopausicas. Clinicamente presentaron compromiso mamario exclusivo 34,1%, invasion ganglionar lorregional 48,7% y estaban diseminadas 17% resptantes. El tratamiento inicial se baso en 3-4 ciclos de quimioterapia tipo FCA, salvo en pacientes anosas que recibieron la asociacion CMF. Todas ellas luego se irradiaron con dosis de 5000-6000 cGy sobre mama y territorios ganglionares. Se culmino el tratamiento con 6 a 8 ciclos adicionales de quimioterapia. Ninguna de las pacientes fue sometida a cirugia. La sobrevida media del total de la poblacion fue de 22 meses, siendo de 26 para las premenopausicas y 15 para las posmenopausicas. El porcentaje de recidivas llego al 30 % y 45% de las formas localizadas se diseminaron durante su evolucion. Se destaca que la estrategia terapeutica se baso en la asociacion qumio-radioterapia, quedando abierta la posibilidad del manejo de altas dosis de citostaticos con o sin trasplantes de madula osea(Au)

  13. APRENDIZAJE COOPERATIVO SOBRE LA PRÁCTICA CLINICA EN ENFERMERÍA: EVALUACIÓN DE DOCENTES

    Directory of Open Access Journals (Sweden)

    María-Aurora Rodríguez Borrego

    2011-01-01

    Full Text Available El proyecto se desarrolló entre las Universidades de Córdoba y A Coruña en España y consistió en una experiencia de aprendizaje cooperativo intercultural e Interuniversitario con alumnos/as del primer curso de la Diplomatura de Enfermería que estaban realizando sus prácticas clínicas, con los objetivos de encontrar puntos de encuentro a la habitual distorsión entre teoría y práctica que detecta el alumnado cuando realiza sus primeras prácticas clínicas, trabajar en grupo cooperativo y ganar habilidad para la crítica y la autocrítica. Se presenta la evaluación de la experiencia por los docentes participantes con el modelo DAFO (Dificultades, Amenazas, Fortalezas y Oportunidades. Para los alumnos, el encuentro de la igualdad en la diferencia se constituyo en una gran oportunidad de aprendizaje, si bien contrastó con la dificultad de trabajar en grupo cooperativo. Como conclusión se puede decir que el método docente empleado mostró su efectividad y su dificultad.

  14. Sintese do processo de obtenção de dextrana clinica e frutose a partir de sacarose

    OpenAIRE

    Guilherme Martinez Mibieli

    2001-01-01

    Resumo: A dextrana é um polissacarídeo composto exclusivamente por unidades monoméricas de glicose, unidas por ligações glicosídicas do tipo a-1,6 na posição linear. Este polissacarídeo apresenta interesse industrial nas áreas de petroquímica, alimentos, química e farmacêutica. Durante o processo de síntese de dextrana ocorre a liberação de frutose, que é um monossacarídeo de grande importância na indústria de alimentos. Este trabalho teve por finalidade sintetizar as etapas do processo de ob...

  15. Estudo das condições de hidrolise acida para obtenção de dextrana clinica

    OpenAIRE

    Vanessa Mendes Santos

    1996-01-01

    Resumo: A dextrana é um biopolímero formado por resíduos de glicose unidos por ligação et-1,6 maioritariamente. É sintetizada peia enzima dextrana-sacarase, enzima esta produzida extracelularmente por algumas bactérias, principalmente do genêro Leuconosíoa A apiicacão deste polímero está diretamente relacionada com o seu peso molecular- As dextranas de peso molecular na faixa de 20,000 a 100,000 daltons (dextrana clínica) possui notáveis aplicações no ramo da medicina como expansor do plasma ...

  16. La day surgery centralizzata: l’appropriatezza clinica e organizzativa come leva di creazione di valore sanitario

    Directory of Open Access Journals (Sweden)

    Bruno Vogliolo

    2001-12-01

    Full Text Available In the last years Public Health Service has been trying to find out solutions in order to improve its health value added creation capacity. The implementation of the Day-surgery division mainly aims to follow that direction, since it enables the improvement of the ratio between efficacy, quality and healthcare suitability and on the other hand efficiency, costs and modality of better resources utilization. The centralization of Day-surgery activities proposes some innovative characteristics, concerning that it introduces an organizational model focused on needs and it performs the separation of the clinic and therapeutic activities from the ones involving the assistance. Both economic and qualitative advantages deriving from the changes stand out in term of: - high possibility of activities’ scheduling; - improved customer satisfaction; - rationalisation of day-hospital recovery, with positive effects on the inpatients; - improved hospital economic stability. This study was carried out with the support of the multiple-skill group composed of doctors, nurses, administrative staff as well as experts in the field of organisation with an aim to provide the full outline of the necessary competences. The proposed discussion reflects the multidisciplinary view of the problem and different perspectives. Each of them regards particular aspects and implications indicated as following: - clinical perspective, related to the possibility of day-surgery interventions both from the medical and the anaesthetic point of view; - organisational perspective, which refers to the possible day-surgery models in conjunction with the organisational model and their peculiarities; - operative perspective, which consist of the analysis of the ideal structural dimension, flows of activities among all services involved and the analysis of the productive capability; (number of necessary beds, staff dimension and a relapse of the operation activities needs; - economic perspective, focused mainly to provide the final valuation on the capacity of the project to contribute to the improvement of the hospital.

  17. Las experiencias clinicas de los estudiantes de enfermeria: Estudio de caso hacia la integracion de la mentoria

    Science.gov (United States)

    Rivera Rodriguez, Ivelisse

    Clinical experiences are an essential part of the training of future nursing professionals. The period of clinical experience aims to develop in the student the necessary skills to practice as a nursing professional, when the academic program ends. This case study aimed to understand the opinion and explore the perception of faculty, clinical instructors, and nursing students on the meaning, contributions and challenges presented during clinical experiences. Among the themes explored in the focus groups were the meaning and importance to learning about the profession of clinical experiences, teaching strategies used during the practice scenarios, didactic relationships developed among students, clinical instructors, and teachers. The goal was to learn from all participants about what they do, their expectations, and the challenges presented during the clinical experiences. A qualitative, descriptive and contextual research design was followed, which required conducting six focus groups to collect the information from the perspective of all the participants. Faculty, clinical instructors, and nursing students participated each in two focus groups. Collected data were transcribed, coded and analyzed in order to organize it under themes related to the research framework. The qualitative analysis of the focus groups revealed that nursing faculty and clinical instructors perceived clinical experiences as a very important element in the training of nursing students, but that coordination between the academy and practice scenarios is disconnected and needs improvement. They also expressed that they use various learning strategies during the clinical experiences, however, they recognize it needs more structure and suggested mentoring as a strategy to consider. They affirmed that mentoring could contribute positively to enhance the teaching-learning process. Clinical instructors understand they perform mentoring roles, but they would like to have a more defined role and structured process. Nursing students, also, recognized the importance of clinical experiences in their professional training. They expressed the need to improve the communication between the academy and the practice scenarios in order to reduce the levels of anxiety they experience when entering the clinical experiences. Nursing students also expressed the need to consider the use of different teaching strategies, such as mentoring, to improve clinical experiences.

  18. Vivencias emocionais de mulheres submetidas a cirurgia bariatrica no Hospital de Clinicas da Unicamp : um estudo clinico-qualitativo

    OpenAIRE

    Ronis Magdaleno Junior

    2009-01-01

    Resumo: Este estudo teve por objetivo compreender as vivências emocionais de mulheres obesas mórbidas submetidas à cirurgia bariátrica. A obesidade tornou-se, globalmente, um grave problema de saúde pública e, em função disto, tem crescido de modo expressivo o número de cirurgias bariátricas como opção de tratamento para a obesidade mórbida. Contudo, é um procedimento que implica em importantes modificações físicas e psicossociais para o paciente. Metodologia: Aplicamos o Método Clínico Quali...

  19. Actinomicose cerebral: observação anatomo-clinica e revisão da literatura brasileira

    Directory of Open Access Journals (Sweden)

    Luciano de Souza Queiroz

    1975-12-01

    Full Text Available Os autores relatam a observação anátomo-clínica de um paciente de 33 anos, com síndrome de hipertensão intracraniana e hemiparesia à direita. O líquido cefalorraqueano revelava discreta hipercitose linfomonocitária. A autópsia mostrou três abscessos cerebrais, com edema difuso mais intenso no hemisfério cerebral esquerdo, sem leptomeningite purulenta. O exame histopatológico demonstrou grãos actinomicóticos nos abscessos cerebrais e pulmonares. A literatura brasileira sobre neuroactinomicose é analisada, com encontro de seis casos, publicados entre 1934 e 1946. São discutidos aspectos clínicos e anátomo-patológicos relevantes dos casos nacionais.

  20. Phyllodes tumor: clinical, radiological and pathological correlation in 50 cases; Tumor filodes: correlacion clinica, radiologica y anatomopatologica en 50 casos

    Energy Technology Data Exchange (ETDEWEB)

    Higueras, A.; Alvarez, M.; Jimenez, A.; Garcia Revillo, J.; Cano, A. [Hospital Universitario Reina Sofia. Cordoba (Spain)

    2000-07-01

    To review the radiological features of the phyllodes tumor, correlating them with the clinical presentation, histological type and response to treatment. Fifty phyllodes tumors in 29 patients aged 16 to 59 years (mean: 41 years) were analyzed retrospectively. The series included 12 cases of recurrence, 1 of bilateral tumor and 6 of multiple tumor. Forty-five lesions were studied by mammography and 36 by ultrasound. Clinically guided fine-needle aspiration cytology was performed in 8 cases. The pathological diagnosis was obtained by means of surgical biopsy in every case (31 benign and 19 malignant). Twenty-four patients underwent postoperative clinical and radiological follow-up for a mean period of 32 months. Mammography revealed the presence of a nodule or mass in 42 cases, asymmetrical density in two and a generalized increase in density in one: Multifocal lesions were detected in six cases. The size varied widely, with masses measuring >5 cm showing a greater probability of malignancy (p<0.01). Calcifications were observed in 13% of the cases. Ultrasound revealed the presence of heterogeneous, hypoechoic nodules, with cystic areas in five tumors, all of which were malignant (p<0.01). Local recurrence was detected in 31% of the cases and bone metastases in one. The phyllodes tumor is an uncommon fibroepithelial tumor that has a potential for recurrence and distant metastasis. Mammographic and ultrasound features are similar to those of the fibroadenoma, a lesion with which it is occasionally associated. Multiple lesions are not infrequent and it can present with calcifications. The presence of cystic areas and a tumor size of >5 cm are the only radiological findings that are statistically associated with malignancy. The recurrence rate is greater in malignant tumors than in benign lesions, especially in patients treated by tumor resection. (Author) 28 refs.

  1. Recuperación Clinica Pero No Cognitiva En Esquizofrenia A Traves De La Experiencia Del Cine De Ficcion

    Directory of Open Access Journals (Sweden)

    J. Peña

    2015-12-01

    Discusión: Una intervención breve basada en actividades de la vida diaria puede ser transformada en herramienta eficaz de rehabilitación psiquiátrica. Sin embargo, con las características actuales y en la muestra de este estudio, la misma intervención no aportó beneficios en parámetros de cognición.

  2. Design and construction of ophthalmic simulators for clinical applications; Projeto e confeccao de simuladores oftalmicos para aplicacoes clinicas

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, Andrea

    2006-07-01

    This work presents a calculational methodology for dose determination in human eye structures, such as: sclera, choroid, retina, lens, vitreous body, optic nerve and disc, and cornea, as well as tumor due to treatment to the eye plaques. A human eye model was constructed taking into consideration its main structural and dimension characteristics. Beyond that a mathematical model for the Co-60 and 1-125 plaques with all geometric details were built employing the MCNP-4C code. This model is able to calculate the axial and radial doses in any point of the eye and for each of its structures. An acrylic eye simulator was also built with the aim to obtain experimental results for the both model validations. This simulator is made of an acrylic sphere split into foils of 1 mm thickness which allow the introduction of a radiographic film to measure the axial and radial doses. The experimental data were used to validate the MCNP-4C results. The data from the mathematical model will serve as the basis to build a data bank for all the eye structures allowing different position and sizes of tumor as well as the replacement of all ophthalmic plaques used in the treatment. This data bank will be the principal part for the construction of a national software for the dose calculation and can be of great help for a reliable treatment system planning in radiotherapy/brachytherapy. (author)

  3. [Instituto de Investigaciones Clinicas "Dr. Américo Negrette": 55 years of excellent research versus global economic recession].

    Science.gov (United States)

    Valero Cedeño, Nereida Josefina

    2014-12-01

    The Instituto de Investigaciones Clínicas "Dr. Américo Negrette" belongs to the Faculty of Medicine at University of Zulia in Maracaibo, Zulia State, Venezuela. It was created on December 4, 1959 by Dr. Américo Negrette. Today, with 55 years of existence, the Institute seeks to fulfill the mission that characterizes it, based on the values instilled by its founder and maintained by subsequent generations, whose research projects are implemented through seven research sections: Biochemistry, Hematologic Research, Neuropharmacology and Neuroscience, Immunology and Cell Biology, Clinical Neurochemistry, Parasitology and Virology. The research originated in these laboratories have become national and international points of reference, despite the current economic situation with budget deficits that put at risk the quality and originality of their projects with negative consequences on the productivity and applications for health population, reasons of biomedical research.

  4. Electronic medical history designed by a multidisciplinary unit mastology; Historia clinica electronica disenada por una unidad de mastologia multidisciplinaria

    Energy Technology Data Exchange (ETDEWEB)

    Camejo, N.; Castillo, C.; Vaca, N.; Camargo, B.; Artagaveytia, N.; Acuna, S.; Milans, S.; Lavina, G.; Carzoglio, J.; Jacobo, O.; Pressa, C.; Delgado, L. [Servicio de Oncologia, Hospital de Clinicas, Montevideo (Uruguay)

    2012-11-15

    Full text: Objective: To facilitate the collection, organization and analysis of data from patients Unit assisted in Mastology by producing an electronic health record. Materials and Methods: We evaluated forms provided by medical oncologists, radio therapists, radiologists, pathologists, and plastic surgeons mastologists collect data interrogation, physical examination, complementary examinations, diagnoses, anatomy pathological evolution and treatment instituted and generating the system was computerized {sup U}nit Mastology - Electronic Health Record ( UMAHCE){sup .} Results: The story was designed in modules that collect data on instances arising diagnostic, treatment and monitoring of patients. Each module is represented by an icon that changes color to enter data, allowing the objectify doctor if they are or not the data for that module. The system can attach images recorded by breast exam photos, photos of study, imaging (mammography, CT, MRI) in the same way that the surgeon to enter the protocol surgical or anatomical pathologist enter a pathological report of a study untimely or after definitive surgery. The system can generate an automatic report of the input data that can be printed and placed in the patient's medical history. It also can generate the e mail alerts doctors on pathological results were entered into regarding the diagnosis or treatment breast cancer (eg, mammography B I-Rads 4 or 5, report positive cytologic puncture malignancy, H R and Her status). Conclusions: We developed an electronic medical record that allows different doctors involved in the management of breast disease can be accessed through the web regardless of where they are ( pathology laboratory, room radiology reports, clinic, operation theater), both for information about a patient to enter data the same in relation to their specialty. Moreover, homogenize manages the type and quality of the data and therefore can improve the care and research activities as well as facilitate the audit of the activities of the Unit. Its main limitation is the internet browsing speed. During the presentation work will show some electronic forms, how history is used by different specialists and patients reporting examples.

  5. Leitura rapida do KDIGO 2012: Diretrizes para avaliacao e manuseio da doenca renal cronica na pratica clinica

    Directory of Open Access Journals (Sweden)

    Gianna Mastroianni Kirsztajn

    2014-03-01

    Full Text Available Os autores desta "leitura rápida" apresentam os dados que consideraram mais relevantes na versão 2012 do KDIGO referente à avaliação e manuseio da doença renal crônica. Não se trata da opinião dos autores, mas sim de uma apresentação mais concisa das diretrizes, que podem ser úteis na prática clínica.

  6. Clinical, radiographic and scintigraphic aspects of the trapeziometacarpal osteoarthritis; Caracterizacao clinica, radiografica e cintilografica da osteoartrose trapeziometacarpiana

    Energy Technology Data Exchange (ETDEWEB)

    Kaziyama, Helena Hideko Seguchi

    1997-12-31

    Trapeziometacarpal osteoarthritis occurs mainly in women during the menopausal period. It is related to manual activities and is usually bilateral. The onset is insidious and the evolution is slow and progressive. It is characterized by of strength and pain in the basis of the thumb resulting in limitation of the use and function of the hand. The diagnosis of this condition is based on the physical examination. The manouver of compression axial-rotation of the trapezimetacarpal joint is a common positive finding. Typical findings of osteoarthritis are present in the radiological studies. Scintigraphic images have a predictive value. The early diagnosis is important to avoid the risk factors and to prevent disabilities of the hand. (author) 102 refs., 18 figs., 10 tabs.

  7. Selection, processing and clinical application of muscle-skeletal tissue; Seleccion, Procesamiento y Aplicacion Clinica de Tejido Musculo-Esqueletico

    Energy Technology Data Exchange (ETDEWEB)

    Luna Z, D.; Reyes F, M.L.; Lavalley E, C.; Castaneda J, G. [ININ, Carretera Mexico-Toluca s/n, 52750 La Marquesa, Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: dlz@nuclear.inin. mx

    2007-07-01

    Due to the increase in the average of the world population's life, people die each time to more age, this makes that the tissues of support of the human body, as those muscle-skeletal tissues, when increasing the individual's age go weakening, this in turn leads to the increment of the illnesses like the osteoporosis and the arthritis, that undoubtedly gives as a result more injure of the muscle-skeletal tissues joined a greater number of traffic accidents where particularly these tissues are affected, for that the demand of tissues muscle-skeletal for transplant every day will be bigger. The production of these tissues in the Bank of Radio sterilized Tissues, besides helping people to improve its quality of life saved foreign currencies because most of the muscle-skeletal tissues transplanted in Mexico are of import. The use of the irradiation to sterilize tissues for transplant has shown to be one of the best techniques with that purpose for what the International Atomic Energy Agency believes a Technical cooperation program to establish banks of tissues using the nuclear energy, helping mainly to countries in development. In this work the stages that follows the bank of radio sterilized tissues of the National Institute of Nuclear Research for the cadaverous donor's of muscle-skeletal tissue selection are described, as well as the processing and the clinical application of these tissues. (Author)

  8. Utilidad clinica de biomarcadores en el diagnóstico y tratamiento de la enfermedad glomerular del adulto

    OpenAIRE

    Jatem Escalante, Elias

    2015-01-01

    Con el presente proyecto de tesis, mediante el desarrollo de estudios observacionales con inclusión de grupos de pacientes afectos de formas primarias y secundarias de glomerulopatías causantes de síndrome nefrótico, específicamente gloméruloesclerósis focal y segmentaria,(GFS), y la nefropatía membranosa (NM), donde se practican mediciones séricas y urinarias de determinadas moléculas (receptor soluble de la urokinasa y anticuerpos contra el receptor tipo M de la fosfolipasa A2), para determ...

  9. Clinical Training of Medical Physicists Specializing in Diagnostic Radiology (Spanish Edition); Capacitacion clinica de fisicos medicos especialistas en radiodiagnostico

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-01-15

    The application of radiation in human health, for both diagnosis and treatment of disease, is an important component of the work of the IAEA. The responsibility for the increasing technical aspects of this work is undertaken by the medical physicist. To ensure good practice in this vital area, structured clinical training programmes are required to complement academic learning. This publication is intended to be a guide to the practical implementation of such a programme for diagnostic radiology. There is a general and growing awareness that radiation medicine is increasingly dependent on well trained medical physicists based in the clinical setting. However, an analysis of the availability of medical physicists indicates a large shortfall of qualified and capable professionals. This is particularly evident in developing countries. While strategies to increase academic educational opportunities are critical to such countries, the need for guidance on structured clinical training was recognized by the members of the Regional Cooperative Agreement (RCA) for Research, Development and Training related to Nuclear Sciences for Asia and the Pacific. Consequently, a technical cooperation regional project (RAS6038) under the RCA programme was formulated to address this need in the Asia-Pacific region by developing suitable material and establishing its viability. Development of a clinical training guide for medical physicists specializing in diagnostic radiology started in 2007 with the appointment of a core drafting committee of regional and international experts. The publication drew on the experiences of clinical training programmes in Australia and New Zealand, the UK and the USA, and was moderated by physicists working in the Asian region. This publication follows the approach of the IAEA publication Training Course Series No. 37, Clinical Training of Medical Physicists specializing in Radiation Oncology. This approach to clinical training has been successfully tested in Thailand, with two other Member States currently undergoing testing, and is believed to be applicable to the medical physics community in general.

  10. Clinical Training of Medical Physicists Specializing in Nuclear Medicine (Spanish Edition); Capacitacion clinica de fisicos medicos especialistas en medicina nuclear

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-07-15

    The application of radiation in human health, for both diagnosis and treatment of disease, is an important component of the work of the IAEA. The responsibility for the increasingly technical aspects of this work is undertaken by the medical physicist. To ensure good practice in this vital area, structured clinical training programmes are required to complement academic learning. This publication is intended to be a guide to the practical implementation of such a programme for nuclear medicine. There is a general and growing awareness that radiation medicine is increasingly dependent on well trained medical physicists who are based in a clinical setting. However an analysis of the availability of medical physicists indicates a large shortfall of qualified and capable professionals. This is particularly evident in developing countries. While strategies to increase educational opportunities are critical to such countries, the need for guidance on structured clinical training was recognized by the members of the Regional Cooperative Agreement for Research, Development and Training related to Nuclear Science and Technology (RCA) for the Asia-Pacific region. Consequently, a technical cooperation regional project (RAS6038) under the RCA programme was formulated to address this need in this region by developing suitable material and establishing its viability. Development of a clinical training guide for medical physicists specialising in nuclear medicine was started in 2009 with the appointment of a core drafting committee of regional and international experts. The publication drew on the experience of clinical training in Australia, Croatia and Sweden and was moderated by physicists working in the Asian region. The present publication follows the approach of earlier IAEA publications in the Training Course Series, specifically Nos 37 and 47, Clinical Training of Medical Physicists Specializing in Radiation Oncology and Clinical Training of Medical Physicists Specializing in Diagnostic Radiology, respectively. This approach to clinical training has been successfully tested in Thailand, with three other Member States currently undergoing testing, and is believed to be generally applicable to the medical physics community in general.

  11. Characterization of a caleosin expressed during olive (Olea europaea L. pollen ontogeny

    Directory of Open Access Journals (Sweden)

    Rodríguez-García María

    2011-08-01

    Full Text Available Abstract Background The olive tree is an oil-storing species, with pollen being the second most active site in storage lipid biosynthesis. Caleosins are proteins involved in storage lipid mobilization during seed germination. Despite the existence of different lipidic structures in the anther, there are no data regarding the presence of caleosins in this organ to date. The purpose of the present work was to characterize a caleosin expressed in the olive anther over different key stages of pollen ontogeny, as a first approach to unravel its biological function in reproduction. Results A 30 kDa caleosin was identified in the anther tissues by Western blot analysis. Using fluorescence and transmission electron microscopic immunolocalization methods, the protein was first localized in the tapetal cells at the free microspore stage. Caleosins were released to the anther locule and further deposited onto the sculptures of the pollen exine. As anthers developed, tapetal cells showed the presence of structures constituted by caleosin-containing lipid droplets closely packed and enclosed by ER-derived cisternae and vesicles. After tapetal cells lost their integrity, the caleosin-containing remnants of the tapetum filled the cavities of the mature pollen exine, forming the pollen coat. In developing microspores, this caleosin was initially detected on the exine sculptures. During pollen maturation, caleosin levels progressively increased in the vegetative cell, concurrently with the number of oil bodies. The olive pollen caleosin was able to bind calcium in vitro. Moreover, PEGylation experiments supported the structural conformation model suggested for caleosins from seed oil bodies. Conclusions In the olive anther, a caleosin is expressed in both the tapetal and germ line cells, with its synthesis independently regulated. The pollen oil body-associated caleosin is synthesized by the vegetative cell, whereas the protein located on the pollen exine and its coating has a sporophytic origin. The biological significance of the caleosin in the reproductive process in species possessing lipid-storing pollen might depend on its subcellular emplacement. The pollen inner caleosin may be involved in OB biogenesis during pollen maturation. The protein located on the outside might rather play a function in pollen-stigma interaction during pollen hydration and germination.

  12. Over-expressing Salicornia europaea (SeNHX1) gene in tobacco ...

    African Journals Online (AJOL)

    use

    2011-11-21

    Nov 21, 2011 ... 1School of Chemical Engineering and Technology, Tianjin University, Tianjin, P. R. 300072, ... stronger salt-tolerance than their wild-type counterparts. .... CTAGC-3' (reverse), which amplified an about 1700 bp full-length.

  13. Transcript Analysis and Regulative Events during Flower Development in Olive (Olea europaea L..

    Directory of Open Access Journals (Sweden)

    Fiammetta Alagna

    Full Text Available The identification and characterization of transcripts involved in flower organ development, plant reproduction and metabolism represent key steps in plant phenotypic and physiological pathways, and may generate high-quality transcript variants useful for the development of functional markers. This study was aimed at obtaining an extensive characterization of the olive flower transcripts, by providing sound information on the candidate MADS-box genes related to the ABC model of flower development and on the putative genetic and molecular determinants of ovary abortion and pollen-pistil interaction. The overall sequence data, obtained by pyrosequencing of four cDNA libraries from flowers at different developmental stages of three olive varieties with distinct reproductive features (Leccino, Frantoio and Dolce Agogia, included approximately 465,000 ESTs, which gave rise to more than 14,600 contigs and approximately 92,000 singletons. As many as 56,700 unigenes were successfully annotated and provided gene ontology insights into the structural organization and putative molecular function of sequenced transcripts and deduced proteins in the context of their corresponding biological processes. Differentially expressed genes with potential regulatory roles in biosynthetic pathways and metabolic networks during flower development were identified. The gene expression studies allowed us to select the candidate genes that play well-known molecular functions in a number of biosynthetic pathways and specific biological processes that affect olive reproduction. A sound understanding of gene functions and regulatory networks that characterize the olive flower is provided.

  14. Hydroxylamine addition impact to Nitrosomonas europaea activity in the presence of monochloramine

    Science.gov (United States)

    In drinking water, monochloramine may promote ammonia–oxidizing bacteria (AOB) growth because of concurrent ammonia presence. AOB use (i) ammonia monooxygenase for biological ammonia oxidation to hydroxylamine and (ii) hydroxylamine oxidoreductase for hydroxylamine oxidation to ...

  15. Effect of gamma irradiation on quality of olive fruits (Olea Europaea L. ), and its oil

    International Nuclear Information System (INIS)

    Al-Bashir, M.

    2000-12-01

    A study was conducted to investigate the effect of gamma radiation on accelerating the debittering steps of olive fruits, oil extractability and the quality of extracted oil. Olive fruits (Olea Europea. var. Surrany) were treated with 0, 1, 2, and 3 kGy of gamma irradiation at a dose rate of 669 Gy/hr., a part of these fruits was debittered in distilled water, the second was processed with NaOH (3.6% concentration) for 3 or 6 hr. Both treated fruits with a control part were kept in brine (5.6% sodium chloride) and stored for 12 months at room temperature. Portions of all these treated fruits were subjected to oil extraction by mechanical means immediately after treatment. During the debittering period (8 days) the total dissolved and inorganic dissolved solids, Na, K, Ca, electric conductivity (EC) and ph values were determined in wastewater (daily), whereas the peroxide value, iodine number and the total acidity were measured in the extracted oil. The results showed that gamma irradiation increased the total and inorganic dissolved solids, a and K in wastewater. The most significant effect was noticed when irradiated fruits were processed with NaOH for 3 hrs. as indicated by the values of total and inorganic dissolved solids, Na and K concentration in wastewater. All used doses of gamma radiation, increased the extractability of the oil from the treated fruits, the total acidity and the peroxide value of that oil. (Author)

  16. Estabilidade de azeite de oliva extra virgem (Olea europaea) em diferentes sistemas de embalagem

    OpenAIRE

    Simone Faria Silva

    2011-01-01

    Resumo: O consumo de azeite de oliva no Brasil apresentou um crescimento de 70% na última década. As gôndolas dos supermercados foram tomadas por uma diversidade de azeites de oliva acondicionados em vários tipos de embalagens. Esses produtos são todos importados, sendo que uma parte é fracionada e envasada no Brasil, visto que não existe produção em escala comercial no país. O objetivo deste trabalho foi avaliar a estabilidade do azeite de oliva extra virgem em diferentes sistemas de embalag...

  17. The Major Qualitative Characteristics of Olive (Olea europaea L.) Cultivated in Southwest China.

    Science.gov (United States)

    Cheng, Zizhang; Zhan, Mingming; Yang, Zeshen; Zumstein, Kristina; Chen, Huaping; Huang, Qianming

    2017-01-01

    Olive trees, originated from Mediterranean, have been cultivated in China for decades and show great adaption to local environment. However, research on this topic is limited. In this study, the major qualitative characteristics and changes of olive grown in southwest China were investigated. The results showed that oil accumulated during fruit development and reached its maximum value when fruit had fully ripened. Phenolic and flavonoid contents increase rapidly in the early growth stage (0-90 DAFB) and then begin to decrease as fruit ripens. Compared with olive from the Mediterranean, olive from China has special characteristics: higher moisture content in the fruit combined with lower percentages of unsaturated fatty acids and oil content. This is due to southwest China's climate which is wetter and cooler compared to the Mediterranean. Our study suggests that southwest China's higher annual rainfall might contribute to higher fruit moisture content while its low temperatures would be conducive to higher unsaturated fatty acid levels in the fruit.

  18. Enzymatic tailoring of oleuropein from Olea europaea leaves and product identification by HRMS/MS spectrometry.

    Science.gov (United States)

    Nikolaivits, Efstratios; Termentzi, Aikaterini; Skaltsounis, Alexios-Leandros; Fokialakis, Nikolas; Topakas, Evangelos

    2017-07-10

    Oleuropein, a bioactive compound found in all parts of olive tree, especially in leaves and branches, presents numerous health promoting properties that increase research and market interest the last few years. In addition, oleuropein degradation products, such as hydroxytyrosol, elenolic acid, and the aglycones also exhibit biological activities with different properties compared to the starting compound. Under this view, a commercial lipase preparation Lipolase 100L and a thermophilic β-glucosidase from Myceliophthora thermophila were used for the regioselective hydrolysis of oleuropein towards the production of the corresponding biologically active compounds. The enzymatic degradation products of oleuropein, such as hydroxytyrosol, elenolic acid and its glucoside, and oleuropein aglycones were identified by LC-HRMS/MS and NMR spectroscopy. The latter, was found as a mix of diastereomers of the monoaldehydic form of oleuropein aglycone, identified as (5S, 8R, 9S)-, (5S, 8S, 9S)- and (5S, 8R, 9R). The high substrate specificity exhibited by both lipase and β-glucosidase allows the successful tailoring of oleuropein towards the production of different biologically active compounds with significant potential in the cosmeceutical and food industry. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Copa y concierto: variabilidad de caracteres funcionales foliares en "Olea europaea"

    OpenAIRE

    Escribano Rocafort, Adrián Gaspar

    2015-01-01

    Una de las premisas adoptadas en la teoría ecológica implica que la variabilidad en la expresión de caracteres funcionales es despreciable entre individuos conespecíficos comparada con la variabilidad existente entre especies. Sin embargo, la evidencia acumulada destaca la variabilidad intraespecífica en el funcionamiento de los ecosistemas y en los procesos de ensamblaje y dinámica de comunidades, especialmente en aquellas dominadas por una o pocas especies. La variabilidad funcional intraes...

  20. Ammonium-induced inhibition of ammonium-starved Nitrosomonas europaea cells in soil and sand slurries

    NARCIS (Netherlands)

    Gerards, S.; Duyts, H.; Laanbroek, H.J.

    1998-01-01

    Ammonia-oxidising bacteria are poor competitors for limiting amounts of ammonium. Hence, starvation for ammonium seems to be the regular condition for these bacteria in natural environments. Long-term survival in the absence of ammonium will be dependent on the ability to maintain large population

  1. Modelling of the carbon and water balances of olive (Olea europaea, L.)

    International Nuclear Information System (INIS)

    Villalobos, F.J.

    1999-01-01

    Olive orchards are the main component of numerous agricultural systems in the Mediterranean region. In this work we present the development of a simulation model of olive orchards, which is used here to illustrate some specific features of the water and carbon balances of olives. The fraction of daily Photosynthetically-Active Radiation (PAR) intercepted by the trees (Qd) changes substantially with solar declination. For a given LAI Qd increases as tree size is smaller. Canopy volume has a much larger effect on Qd than Leaf Area Density (LAD), implying that a submodel for canopy volume will be required. Estimates of Radiation-Use Efficiency for yield are 0.35 g dry matter/(MJ PAR) and 0.16 g oil/(MJ PAR) which are around 80% of those for sunflower under the same environment. Crop evaporation in olive orchards is characterized by a high proportion of evaporation from the soil surface (Es) and by the response of stomata to air humidity. Results from a evapotranspiration corresponds to Es, and that Water-Use Efficiency relative to transpiration is 0.9 kg fruit dry matter m-3, which is equal to that of sunflower. Important gaps in our knowledge of olive ecophysiology (dry matter partitioning and growth) require further research

  2. Pedologic Factors Affecting Virgin Olive Oil Quality of "Chemlali" Olive Trees (Olea europaea L.).

    Science.gov (United States)

    Rached, Mouna Ben; Galaverna, Gianni; Cirlini, Martina; Boujneh, Dalenda; Zarrouk, Mokhtar; Guerfel, Mokhtar

    2017-08-01

    The aim of this study examined the characterization of extra virgin olive oil samples from the main cultivar Chemlali, grown in five olive orchards with different soil type (Sandy, Clay, Stony, Brown, Limestone and Gypsum). Volatile compounds were studied using headspace-solid phase micro-extraction (HS-SPME) and gas chromatography-mass spectrometry (GC-MS) technics. Moreover, the sterol profile was established using gas chromatography-mass spectrometry. 35 different volatile compounds were identified: alcohols, esters, aldehydes, ketones and hydrocarbons. The chemical composition of the volatile fraction was characterized by the preeminence of 2-hexenal (32.75%) and 1-hexanol (31.88%). Three sterols were identified and characterized. For all olive oil samples, ß-sitosterol (302.25 mg/kg) was the most abundant sterol. Interestingly, our results showed significant qualitative and quantitative differences in the levels of the volatile compounds and sterols from oils obtained from olive trees grown in different soil type.

  3. Over-expressing Salicornia europaea (SeNHX1) gene in tobacco ...

    African Journals Online (AJOL)

    An increase of salt tolerance in transgenics was observed both in vitro and in pot culture. When exposed to either 138 mM or 172 mM NaCl in vitro, the transgenic apical meristem and stem segments with buds exhibited stronger salt-tolerance than their wild-type counterparts. In pot soil with 10.2 mg g-1 DW Na+ stress, ...

  4. Comparative study on fatty acid composition of olive (Olea europaea L.), with emphasis on phytosterol contents.

    Science.gov (United States)

    Ozkan, Ali; Aboul-Enein, Hassan Y; Kulak, Muhittin; Bindak, Recep

    2017-08-01

    The present study was designed to determine the fatty acid composition and phytosterol contents of Turkish native olive cultivars, namely Kilis Yağlık and Nizip Yağlık cv. In this context, olive fruits from 34 locations were sampled and then screened for their components in comparison. Fifteen different fatty acids were found in both olive oils. In the order of abundance, the most important ones were oleic acid (18:1) > palmitic acid (16:0) > linoleic acid (18:2) > stearic acid (18:0). Significant differences were observed in the contents of oleic acid (18:1), palmitic acid (16:0), linoleic acid (18:2) but not for stearic acid content in comparison both oils (p < 0.01). There were significant differences in terms of unsaturated fatty acids, saturated fatty acids and polyunsaturated fatty acids (p < 0.01). The seven phytosterols - cholesterol, campesterol, stigmasterol, β-sitosterol, Δ-5-avenasterol, Δ-7-stigmastenol and Δ-7-avenasterol - were studied in both oil sources. The predominant sterols were β-sitosterol, Δ5-avenasterol and campesterol in the samples analysed. However, no significant differences were found in the levels of the phytosterols between the two olive cultivars. Copyright © 2017 John Wiley & Sons, Ltd.

  5. Model for forecasting Olea europaea L. airborne pollen in South-West Andalusia, Spain

    Science.gov (United States)

    Galán, C.; Cariñanos, Paloma; García-Mozo, Herminia; Alcázar, Purificación; Domínguez-Vilches, Eugenio

    Data on predicted average and maximum airborne pollen concentrations and the dates on which these maximum values are expected are of undoubted value to allergists and allergy sufferers, as well as to agronomists. This paper reports on the development of predictive models for calculating total annual pollen output, on the basis of pollen and weather data compiled over the last 19 years (1982-2000) for Córdoba (Spain). Models were tested in order to predict the 2000 pollen season; in addition, and in view of the heavy rainfall recorded in spring 2000, the 1982-1998 data set was used to test the model for 1999. The results of the multiple regression analysis show that the variables exerting the greatest influence on the pollen index were rainfall in March and temperatures over the months prior to the flowering period. For prediction of maximum values and dates on which these values might be expected, the start of the pollen season was used as an additional independent variable. Temperature proved the best variable for this prediction. Results improved when the 5-day moving average was taken into account. Testing of the predictive model for 1999 and 2000 yielded fairly similar results. In both cases, the difference between expected and observed pollen data was no greater than 10%. However, significant differences were recorded between forecast and expected maximum and minimum values, owing to the influence of rainfall during the flowering period.

  6. Bioactivity Improvement of Olea europaea Leaf Extract Biotransformed by Wickerhamomyces anomalus Enzymes.

    Science.gov (United States)

    Palmeri, Rosa; Restuccia, Cristina; Monteleone, Julieta Ines; Sperlinga, Elisa; Siracusa, Laura; Serafini, Mauro; Finamore, Alberto; Spagna, Giovanni

    2017-06-01

    Olive leaves represent a quantitatively significant by-product of agroindustry. They are rich in phenols, mainly oleuropein, which can be hydrolyzed into several bioactive compounds, including hydroxytyrosol. In this study, water extract from olive leaves 'Biancolilla' was analyzed for polyphenol profile, DPPH (2,2-diphenyl-1-picrylhydrazyl) radical scavenging activity and protective effect on differentiated Caco-2 cells. The efficacy of two enzymatic treatments in promoting the release of bioactive phenols was investigated: a) enzymatic extract from Wickerhamomyces anomalus, characterized by β-glucosidase and esterase activities; b) commercial β-glucosidase. Composition and bioactivity of the resulting extracts were compared. The results showed that the yeast-treated extract presented hydroxytyrosol content and DPPH radical scavenging activity comparable to those obtained using commercial β-glucosidase; however, it was showed the additional presence of hydroxycinnamic acids. In experiments on Caco-2 cells, the leaf extracts promoted the recovery of cell membrane barrier at different minimum effective concentrations. The high specificity of W. anomalus enzymatic extract may represent an effective tool for the release of bioactive phenols from olive by-products.

  7. Leaf hairs of Olea europaea protect underlying tissues against ultraviolet-B radiation damage

    International Nuclear Information System (INIS)

    Karabourniotis, G.; Kyparissis, A.; Manetas, Y.

    1993-01-01

    The photochemical efficiency of photosystem II, as measured by chlorophyll fluorescence induction, was not affected in de-haired olive leaves kept in the dark or intact leaves irradiated with a moderate (3.75 W m-2) ultraviolet-B (UV-B) intensity. In de-haired, UV-B-irradiated leaves, however, the ratio of variable to maximum (F(v)/F(m)) chlorophyll fluorescence declined significantly and irreversibly. Reduction in F(v)/V(m) was associated with an increase in instantaneous and a decrease in maximum (F(m)) fluorescence, indicating perturbation by the UV-B exposure of more than one photosynthetic site. Extensive epidermal browning in de-haired, UV-B irradiated leaves was also observed, indicating possible damage to cell membranes. The results strengthen the hypothesis that leaf hairs protect the underlying tissues against UV-B radiation damage

  8. Salt acclimation process: a comparison between a sensitive and a tolerant Olea europaea cultivar.

    Science.gov (United States)

    Pandolfi, Camilla; Bazihizina, Nadia; Giordano, Cristiana; Mancuso, Stefano; Azzarello, Elisa

    2017-03-01

    Saline soils are highly heterogeneous in time and space, and this is a critical factor influencing plant physiology and productivity. Temporal changes in soil salinity can alter plant responses to salinity, and pre-treating plants with low NaCl concentrations has been found to substantially increase salt tolerance in different species in a process called acclimation. However, it still remains unclear whether this process is common to all plants or is only expressed in certain genotypes. We addressed this question by assessing the physiological changes to 100 mM NaCl in two contrasting olive cultivars (the salt-sensitive Leccino and the salt-tolerant Frantoio), following a 1-month acclimation period with 5 or 25 mM NaCl. The acclimation improved salt tolerance in both cultivars, but activated substantially different physiological adjustments in the tolerant and the sensitive cultivars. In the tolerant Frantoio the acclimation with 5 mM NaCl was more effective in increasing plant salt tolerance, with a 47% increase in total plant dry mass compared with non-acclimated saline plants. This enhanced biomass accumulation was associated with a 50% increase in K+ retention ability in roots. On the other hand, in the sensitive Leccino, although the acclimation process did not improve performance in terms of plant growth, pre-treatment with 5 and 25 mM NaCl substantially decreased salt-induced leaf cell ultrastructural changes, with leaf cell relatively similar to those of control plants. Taken together these results suggest that in the tolerant cultivar the acclimation took place primarily in the root tissues, while in the sensitive they occurred mainly at the shoot level. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Genetic Relationships Among Olive (Olea europaea L.) Cultivars Native to Turkey.

    Science.gov (United States)

    Sakar, Ebru; Unver, Hulya; Bakir, Melike; Ulas, Mehmet; Sakar, Zeynep Mujde

    2016-08-01

    Olive is a widely cultivated, mainly in the Mediterranean region, and economically important fruit species used as both olive oil and table olive consumption. In Turkey, more than 50 olive cultivars have been authorized for commercial plantations, representing the developmental base for the olive industry. The aim of the present study was to identify genetic relationships among the most widely grown 27 olive cultivars in Turkey, using microsatellite or simple sequence repeat markers. Nine well-known foreign olive cultivars from different countries are also included in the study to compare the Turkish cultivars. To determine genetic relationship and diversity, 10 SSR loci (DCA3, DCA9, DCA15, DCA18, UDO4, UDO9, UDO11, UDO12, UDO24, UDO28) were used. Jaccard's similarity coefficient and the UPGMA method for cluster analysis were performed using the software NTSYSpc. The results showed that the number of alleles per locus ranging from 4 (UDO4, UDO9, UDO11, UDO12, DCA15) to 12 (DCA9) presenting high polymorphism. There were no identical cultivars. High similarity was shown by cultivars Maviand Adana topağı (0.754). The most genetically divergent cultivars, Domat-Meski (0.240) and Domat-NizipYağlık (0.245), were also identified.

  10. Transcript Analysis and Regulative Events during Flower Development in Olive (Olea europaea L.).

    Science.gov (United States)

    Alagna, Fiammetta; Cirilli, Marco; Galla, Giulio; Carbone, Fabrizio; Daddiego, Loretta; Facella, Paolo; Lopez, Loredana; Colao, Chiara; Mariotti, Roberto; Cultrera, Nicolò; Rossi, Martina; Barcaccia, Gianni; Baldoni, Luciana; Muleo, Rosario; Perrotta, Gaetano

    2016-01-01

    The identification and characterization of transcripts involved in flower organ development, plant reproduction and metabolism represent key steps in plant phenotypic and physiological pathways, and may generate high-quality transcript variants useful for the development of functional markers. This study was aimed at obtaining an extensive characterization of the olive flower transcripts, by providing sound information on the candidate MADS-box genes related to the ABC model of flower development and on the putative genetic and molecular determinants of ovary abortion and pollen-pistil interaction. The overall sequence data, obtained by pyrosequencing of four cDNA libraries from flowers at different developmental stages of three olive varieties with distinct reproductive features (Leccino, Frantoio and Dolce Agogia), included approximately 465,000 ESTs, which gave rise to more than 14,600 contigs and approximately 92,000 singletons. As many as 56,700 unigenes were successfully annotated and provided gene ontology insights into the structural organization and putative molecular function of sequenced transcripts and deduced proteins in the context of their corresponding biological processes. Differentially expressed genes with potential regulatory roles in biosynthetic pathways and metabolic networks during flower development were identified. The gene expression studies allowed us to select the candidate genes that play well-known molecular functions in a number of biosynthetic pathways and specific biological processes that affect olive reproduction. A sound understanding of gene functions and regulatory networks that characterize the olive flower is provided.

  11. Identification of gut-derived metabolites of maslinic acid, a bioactive compound from Olea europaea L.

    Science.gov (United States)

    Lozano-Mena, Glòria; Sánchez-González, Marta; Parra, Andrés; Juan, M Emília; Planas, Joana M

    2016-09-01

    Maslinic acid has been described to exert a chemopreventive activity in colon cancer. Hereby, we determined maslinic acid and its metabolites in the rat intestine previous oral administration as a first step in elucidating whether this triterpene might be used as a nutraceutical. Maslinic acid was orally administered at 1, 2, and 5 mg/kg to male Sprague-Dawley for 2 days. At 24 h after the last administration, the content of the duodenum and jejunum, ileum, cecum, and colon was collected and extracted with methanol 80% prior to LC-APCI-MS analysis. The developed method was validated providing suitable sensitivity (LOQ of 5 nM), good recovery (97.8 ± 3.6%), linear correlation, and appropriate precision (< 9%). Maslinic acid was detected in all the segments with higher concentrations in the distal part of the intestine. LC-APCI-LTQ-ORBITRAP-MS allowed the identification of 11 gut-derived metabolites that were formed by mono-, dihydroxylation, and dehydrogenation reactions. Maslinic acid undergoes phase I reactions resulting in a majority of monohydroxylated metabolites without the presence of phase II derivatives. The high concentration of maslinic acid achieved in the intestine suggests that it could exert a beneficial effect in the prevention of colon cancer. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Biogenesis of protein bodies during legumin accumulation in developing olive (Olea europaea L.) seed.

    Science.gov (United States)

    Jimenez-Lopez, Jose C; Zienkiewicz, Agnieszka; Zienkiewicz, Krzysztof; Alché, Juan D; Rodríguez-García, Maria I

    2016-03-01

    Much of our current knowledge about seed development and differentiation regarding reserves synthesis and accumulation come from monocot (cereals) plants. Studies in dicotyledonous seeds differentiation are limited to a few species and in oleaginous species are even scarcer despite their agronomic and economic importance. We examined the changes accompanying the differentiation of olive endosperm and cotyledon with a focus on protein bodies (PBs) biogenesis during legumin protein synthesis and accumulation, with the aim of getting insights and a better understanding of the PBs' formation process. Cotyledon and endosperm undergo differentiation during seed development, where an asynchronous time-course of protein synthesis, accumulation, and differential PB formation patterns was found in both tissues. At the end of seed maturation, a broad population of PBs, particularly in cotyledon cells, was distinguishable in terms of number per cell and morphometric and cytochemical features. Olive seed development is a tissue-dependent process characterized by differential rates of legumin accumulation and PB formation in the main tissues integrating seed. One of the main features of the impressive differentiation process is the specific formation of a broad group of PBs, particularly in cotyledon cells, which might depend on selective accumulation and packaging of proteins and specific polypeptides into PBs. The nature and availability of the major components detected in the PBs of olive seed are key parameters in order to consider the potential use of this material as a suitable source of carbon and nitrogen for animal or even human use.

  13. Phenolic compounds and sterol contents of olive (olea europaea l.) oils obtained from different

    International Nuclear Information System (INIS)

    Juhaimi, F.; Ghafoor, K.; Adiamo, O.Q.; Babiker, E.E.

    2017-01-01

    Oil obtained from 5 different olive cultivars was analyzed for phenolic and sterol composition. Total phenolic contents of oils were determined between 94.99 mg GAE/kg oil (Al-Joif) to 405.71 mg GAE/ kg oil (Sariulak) (p<0.05). Phenolic compounds of oils obtained from different olive verities (Ayvalik, Sariulak, Savrani, Al-Joif and Gemlik) when fully ripened were evaluated using reversed phase high performance liquid chromatography (RP-HPLC). Hydroxytyrosol and tyrosol were identified to have higher concentrations than other compounds. Tyrosol contents were between 3.65 mg/kg to 21.47 mg/kg oil (p<0.05) in different verities. The contents of hydroxytyrosol of oils for Ayvalik and Gemlik were 1.23 and 14.42 mg/kg, respectively. Cinnamic acid was detected only in Al-Joif olive oil sample. Low amounts of syringic, vanillin, p-cumaric, quercetin and luteolin were observed in different varieties' oils. (author)

  14. Radical-Scavenging Compounds from Olive Tree (Olea europaea L.) wood

    NARCIS (Netherlands)

    Pérez-Bonilla, M.; Salido, S.; Beek, van T.A.; Altarejos, J.

    2014-01-01

    The purpose of this study was to complete knowledge on the chemical composition and radical-scavenging activity of olive tree wood. Two new monoterpene glycosides, (-)-oleuropeic acid 6'-O-a-d-glucopyranosyl ester (6a) and (-)-perillic acid 1'-O-ß-d-primeverosyl ester (8), together with the known

  15. LTR retrotransposon dynamics in the evolution of the olive (Olea europaea) genome

    Czech Academy of Sciences Publication Activity Database

    Barghini, E.; Natali, L.; Giordani, T.; Cossu, R.M.; Scalabrin, S.; Cattonaro, F.; Šimková, Hana; Vrána, Jan; Doležel, Jaroslav; Morgante, M.; Cavallini, A.

    2015-01-01

    Roč. 22, č. 1 (2015), s. 91-100 ISSN 1340-2838 R&D Projects: GA ČR GBP501/12/G090; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : LTR retrotransposons * next-generation sequencing * olive Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.267, year: 2015

  16. Metabolomics reveals variation and correlation among different tissues of olive (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Rao Guodong

    2017-09-01

    Full Text Available Metabolites in olives are associated with nutritional value and physiological properties. However, comprehensive information regarding the olive metabolome is limited. In this study, we identified 226 metabolites from three different tissues of olive using a non-targeted metabolomic profiling approach, of which 76 named metabolites were confirmed. Further statistical analysis revealed that these 76 metabolites covered different types of primary metabolism and some of the secondary metabolism pathways. One-way analysis of variance (ANOVA statistical assay was performed to calculate the variations within the detected metabolites, and levels of 65 metabolites were differentially expressed in different samples. Hierarchical cluster analysis (HCA dendrograms showed variations among different tissues that were similar to the metabolite profiles observed in new leaves and fruit. Additionally, 5776 metabolite-metabolite correlations were detected by a Pearson correlation coefficient approach. Screening of the calculated correlations revealed 3136, 3025, and 5184 were determined to metabolites and had significant correlations in three different combinations, respectively. This work provides the first comprehensive metabolomic of olive, which will provide new insights into understanding the olive metabolism, and potentially help advance studies in olive metabolic engineering.

  17. CARACTERIZACION FENOTIPICA Y TIPIFICACION MOLECULAR DE CEPAS DE CRYPTOCOCCUS NEOFORMANS AISLADAS DE MUESTRAS CLINICAS EN HOSPITALES TERCIARIOS DEL SUR DE CHILE

    OpenAIRE

    BARRIA I., YOLANDA B.

    2012-01-01

    Criptococosis es una micosis sistémica oportunista causada por dos especies levaduriformes capsuladas, C. neoformans causan infecciones en individuos immunodeprimidos ptincipalmente y Criptococcus gattii lo hace tanto en immunocompetentes como en personas inmunodeprimidas. C. neoformans es comúnmente asociado a excretas de palomas mientras que la especie C. gattii es encontrado en especies arbóreas como eucaliptos, ficus y otras. C neoformcms se subdivide en dos variedades distintas neofor...

  18. Development of software for management of radioactive waste in biological research and clinical assistance; Desenvolvimento do software para gerenciamento de rejeitos radioativos em pesquisa biologica e assistencia clinica

    Energy Technology Data Exchange (ETDEWEB)

    Maciel, Bianca; Mattos, Maria Fernanda S.S.; Medeiros, Regina B. [Universidade Federal de Sao Paulo (UNIFESP/EPM), Sao Paulo, SP (Brazil). Dept. de Diagnostico por Imagem. Nucleo de Protecao Radiologica; Franca Junior, Jose Antonio de, E-mail: fernanda@cfhr.epm.b, E-mail: rbitelli@cfhr.epm.b, E-mail: jafjunior@unifesp.b [Universidade Federal de Sao Paulo (UNIFESP/EPM), Sao Paulo, SP (Brazil). Dept. de Tecnologia da Informacao. Div. de Sistema de Informacao

    2011-10-26

    This paper describes the development of software which facilitates the automation of this process by mean of the Safety Analysis Report generating a data base allowing the statistic analysis and elaboration of radioactive wastes inventory. The software was developed in PHP language and the information is stored in a data base generated in Oracle and organized in different tables which allows to calculate the storage time of waste and to register the specificities of radioisotopes, cadastral data of the professionals which handle that radioisotope and also the characteristics of handling laboratories. That tool collaborates for a effective control on the use of radioisotopes in research laboratories and assistance areas as well

  19. Frecuencia de anticuerpos anti Trypanozoma cruzi en pacientes portadores de marcapasos de la Clinica San Pedro Claver de Bogotá

    Directory of Open Access Journals (Sweden)

    Guillermo Mora

    2007-12-01

    Conclusiones. La prevalencia de anticuerpos anti-T. cruzi en pacientes portadores de marcapaso es alta. La implantación de marcapasos se presentó más tempranamente en el grupo seropositivo. No hay adecuada sospecha clínica ni información al paciente sobre el diagnóstico de la enfermedad de Chagas.

  20. Management units radio physics hospital clinic: New management model; Unidades de gestion clinica de radiofisica hospitalaria, ¿nuevo modelo de gestion?

    Energy Technology Data Exchange (ETDEWEB)

    Iborra Oquendo, M.; Angulo Pain, E.; Castro Ramirez, I.; Quinones Rodriguez, L. A.; Urena Llinares, A.; Richarter Reina, J. M.; Lupiani Castellanos, J.; Ramos Caballero, L. I.

    2011-07-01

    Clinical management in the Andalusian Health Service is a process of organizational design that allows professionals to incorporate the management of resources used in their own clinical practice. In the Clinical Management Units activity develops according to different objectives, among them: encourage the involvement of health professionals in managing the centers, enhance continuity of care between the two levels of care, improve work organization and raise patient satisfaction.

  1. ISO 9001 certification in the clinical dosimetry process in physics medical service; Certificacion ISO9001 en el proceso de dosimetria clinica en un servicio de fisica medica

    Energy Technology Data Exchange (ETDEWEB)

    Font Gomez, J. A.; Andres Redondo, M. M.; Gandia Martinez, A.; Jimenez Albericio, F. J.; Mengual Gil, M. A.

    2013-07-01

    The objective of this work is to simply name a series of procedures that are part of the certification and technical instructions (manuals about how to perform specific tasks) without going into details. (Author)

  2. Valutazione analitica e applicazione clinica di un metodo Real Time PCR per il dosaggio della carica virale di Epstein-Barr virus

    Directory of Open Access Journals (Sweden)

    Maria Teresa Bortolin

    2004-03-01

    Full Text Available We assessed the performance of a Real Time PCR assay to be used for EBV viremia evaluation in clinical specimens. Sensitivity and intra-/interassay reproducibility were evaluated by using DNA serial dilutions from the Namalwa cell line. EBV DNA was analyzed in serum samples from 39 patients (pts with undifferentiated type nasopharyngeal carcinoma (UCNT, from 5 infectious mononucleosis (IM pts and from 18 healthy donors. Results obtained by Real Time PCR were compared with those obtained by quantitative competitive (QC-PCR assay.We thereafter measured the dynamics of EBV DNA load in 5 HIV-seropositive (HIV+ and 9 HIV-seronegative (HIV-, as controls pts with lymphoma, treated with high-dose chemotherapy (HCT followed by autologus stem-cell transplantation (ASCT. We found a sensitivity of 100% at 10 EBV copies. The Spearman correlation for both the intra- and the interassay reproducibility was statistically significant (r=0.99; p20 copies/reaction and >30% for EBV viral loads <20 copies/reaction. No EBV DNA was detected in healthy donors. Higher EBV DNA loads were found by Real Time PCR (range 1173-46328 copies/ml than by QC-PCR (range 450-5000 copies/ml (p<0.05. 54% of UCNT and 100% of IM pts were EBV DNA positive. Two HIV+(40% and 2 HIV-(22% pts with lymphoma had detectable EBV viremia during the follow-up. The Real Time PCR is a suitable technique for high-throughput screening and frequent monitoring of patients at risk for developing EBV-associated diseases.

  3. Evolution of sensitivity to fosfomycin in bacteria isolated in 1973, 1974 and 1975 in the Servicio de Microbiologia y Epidemiologia of the 'Clinica Puerta de Hierro', Madrid.

    Science.gov (United States)

    Dámaso, D; Moreno-López, M; Martínez-Beltrán, J

    1977-01-01

    The bacteriostatic activity of fosfomycin was studied in vitro against 1,243 clinical isolations of gram-positive cocci and 4,086 isolations of gram-negative bacilli that were obtained in 1973, 1974 and in the period from January to May of 1975. MIC was determined by the agar diffusion method, quantifying it by means of the standard curve that was worked out with the strain of E. coli NCTC 10,418. A slight increase in resistance was observed in the gram-positive cocci: 64 mug/ml were inhibitory for 63% of the 249 isolations obtained in 1973, 59.1% of the 716 isolations obtained in 1974, and 57.5% of the 278 isolations from 1975. A slight loss of sensitivity was also observed in the gram-negative bacilli: the aforementioned concentration of fosfomycin inhibited 36% of the 742 isolations from 1973, 33.6% of the 2,387 isolations from 1974 and 32.6% of the 957 isolations from 1975. 933 g of this antibiotic were consumed in our hospital in 1973, 4,203 g in 1974 and 957 g in 1975. The consumption rate per patient per year was 0.15, 0.72 and 0.20 g, respectively. In conclusion, although no change was observed in the sensitivity of some bacterial strains to fosfomycin, the overall study indicates a slight decrease in the sensitivity, although it does not apparently have any relationship to the consumption of fosfomycin in our hospital.

  4. [Congenital toxoplasmosis: clinical manifestation, treatment and follow-up] [Article in Italian] • Il neonato con toxoplasmosi congenita: clinica, terapia e follow-up

    Directory of Open Access Journals (Sweden)

    Lina Bollani

    2014-01-01

    Full Text Available Toxoplamosis is a parasitic zoonosis which occurs worldwide, but is prevalent in Europe, South America and Africa. When infection occurs for the first time during pregnancy, mother to child transmission of the parasite can cause congenital toxoplasmosis. Rate of congenital infection ranges from less than 0.1 to approximately 1 per 1,000 live births. The risk of transmission depends on the gestational age at the time of maternal infection. A diagnosis of congenital toxoplasmosis is usually considered in infants who present: hydrocephalus, chorioretinitis, and intracranial calcifications, but this triade is very rare. Approximately 85% of the infants with congenital toxoplasmosis are clinically normal at birth; however, sequelae of infection may become apparent only months or even years later. Chorioretinitis is the main complication of congenital toxoplasmosis, late onset retinal lesions and relapse can appear many years after birth, but the overall ocular prognosis is satisfactory when infection is identified and treated accordingly. Fortunately, serious neonatal forms and severe neurological impairment have become rare, but prompt treatment of children with convulsions, abnormal muscle tone, hydrocephalus, may improve the prognosis and result in almost normal outcome. For infants who have congenital toxoplasmosis, treatment soon after birth for 1 year with pyrimetamine, sulfadiazine and leukoverin led to remarkable resolution of serious, active disease. A long follow-up is necessary to assess the long-term outcome of children and young adults with congenital toxoplasmosis, that is favourable for the majority of cases. Epidemiological surveillance needs to be improved in order to determine the effectiveness of prevention programs.Articoli Selezionati del “3° Convegno Pediatrico del Medio Campidano” · Guspini · 25 Maggio 2013Guest Editor: Roberto Antonucci

  5. Laser diagnostic and therapy of dental caries: the clinic point of view; Laser diagnostico e tratamento da carie dental: uma visao clinica

    Energy Technology Data Exchange (ETDEWEB)

    Paiva, Priscila Faria

    2001-07-01

    Dental caries's diagnosis is a major dentistry problem from the clinic point of view. The laser beam on the region of 655 nm induces the fluorescence of the compounds present in the hard tissue, quantifying differences between sound and carious enamel and dentine. Diagnodent (Kavo, Germany), showed to be effective regarding dental caries's diagnosis in the present research sampling. The Er:YAG laser (Kavo Key Laser 2, Germany) performed efficient cavity preparations in caries lesions of I and V class type, using up energies that ranged from 300 mJ to 350 mJ with 4 Hz repetition rate for the enamel; and from 250 mJ to 300 mJ with 4 Hz repetition rate for the dentine, and with 80 mJ with 6 Hz of repetition rate for laser conditioning. In the Er:YAG laser preparations no patient was anesthetized even when there were deeper cavities, and the maximum degree of pain ( which ranged from 0 to 10) was 4. In the control group with conventional high-speed drill two patients were anesthetized and the maximum degree of pain was 7. Restorations performed by conventional method of composite were equally satisfying both in caries groups of I and V class type and in the control group. The laser application in the operative dentistry office as a new method of diagnosis and dental preparations should be a good alternative to the use of the conventional dental drill. Nevertheless, dentistry practice has a lot to improve from technology progress, as well as new researches on laser dentistry are necessary in a long term. New types of lasers will come about and will increasingly improve the dental practice assistance and procedures quality. (author)

  6. Porous bone radio sterilized chips and their clinical application in vertebral arthrodesis; Chips de hueso esponjoso radioesterilizados y su aplicacion clinica en arthrodesis vertebral

    Energy Technology Data Exchange (ETDEWEB)

    Luna Z, D. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Ortega E, J.; Zayas M, L. A. [Instituto de Salud del Estado de Mexico, Centro Medico Lic. Adolfo Lopez Mateos, Av. Nicolas San Juan s/n, Ex-Hacienda La Magdalena, 50170 Toluca, Estado de Mexico (MX); Diaz M, I., E-mail: daniel.luna@inin.gob.mx [Centro Estatal de Trasplantes del Estado de Mexico, Pablo Sidar No. 602, Col. Universidad, 50130 Toluca, Estado de Mexico (MX)

    2011-11-15

    The diseases of the muscle-skeletal tissue are the main cause of physical disability which affects in the entire world to millions of people. The bone is part of the muscle-skeletal tissue and the spine is a group of bones that are located in the dorsal part of the human body. At present the spine lesions are varied as those that people suffer when they have automobile accidents of for fallen, mainly in the major adults, if the spine lesions are not treated appropriately they can have consequences to short or long term. A procedure that has been useful for the spine lesions is the vertebral arthrodesis. The tissue banks are places where is obtained bone of distinct origin for clinical use, the chips of porous bone are obtained in banks of specialized tissues which are sterilized with gamma radiation of cobalt-60, the use of this bone type has been demonstrated that these help in the recovery of patients that suffer spine fracture. In this work the process of procurement of human bone is presented, just as the process of its transformation in chips form and its sterilization method. At the end a case of a young patient is presented who suffers an automobile accident and was treated by the vertebral arthrodesis technique of spine, using chips of porous bone for his recovery. (Author)

  7. Colorectal cancer clinical epidemiological characteristics in patients attended at Oncology service; Caracteristicas clinicas epidemiologicas del cancer colorrectal en un grupo de enfermos atendidos en consulta de Oncologia

    Energy Technology Data Exchange (ETDEWEB)

    Area Abreu, Daniel; Borrego Pino, Luis; Borrego Diaz, Luis; Abreu Rivera, Pedro; Garrote, Tillan; Aurora, [Hospital Provincial ' Vladimir Ilich Lenin' , Holguin (Cuba)

    2009-07-01

    A study of series of cases from January 2006 to December 2007 was carried out in 195 patients with colorectal cancer. They were attended at Oncology Service at Lenin Hospital, and were diagnosed at different health areas of the province. 63% and 37% of them had tumors in rectum and colon respectively. The age group between 40 and 69 years old was the most affected one (81.0%) and 56.9% of them were males. The main risk factors were the family history of the illness, chronic constipation, bleeding polyps and vesicular lithiasis. The most frequent clinical manifestations were rectal hemorrhage and anemia. (author)

  8. Endoscopic, epidemiologic and clinic characterization of the colorectal cancer in geriatric patients;Caracterizacion clinica, epidemiologica y endoscopica del cancer colorrectal en pacientes geriatricos

    Energy Technology Data Exchange (ETDEWEB)

    Umpierrez Garcia, Ibis [Hospital Militar Docente ' Dr Mario Munnoz Monroy' , Matanzas (Cuba); Norma, Herrera Hernandez [Hospital Universitario Clinico-Quirurgico ' Cmdte Faustino Perez Hernandez' Matanzas (Cuba); Hernandez Ortega, Ania [Hospital Territorial Docente ' Mario Munnoz Monroy' , Municipio de Colon, Matanzas (Cuba)

    2009-07-01

    The colorectal cancer is a serious health problem because of its high incidence. In Cuba, this disease is the fourth neoplasm in order of frequency with a rate of 17.1 per 100 000 inhabitants. With the objective of determining the precocious diagnosis of this complaint we carried out a prospective, longitudinal and descriptive study among geriatric patients with colorectal disease assisting to consultation at the policlinic 'Carlos Verdugo' of Matanzas in the period from January 2006 to December 2007. The studied parameters were age, genre, risk facts, presentation forms, localization, and endoscopic diagnosis of the disease. The results showed predominance of female sex (52,1 %), in ages from 60 to 69 years old (59.3 %), predominating risk facts like familiar antecedents (13,5 %), idiopathic ulcerative colitis (8.1 %), and an inadequate diet (35.1 %). The most used diagnostic method was colonoscopy (18 patients), with predominance of the rectosigmoidal cancer (15 cases), being the polypoid one the most common endoscopic kind (13 %). We concluded that generally there is not a precocious diagnosis of the colorectal cancer among geriatric patients, leading to a decrease of the healing possibilities and surviving of these patients

  9. VALORACION DEL TRATAMIENTO CON ACUPUNTURA Y MOXIBUSTION EN PACIENTES CON BURSITIS DE HOMBRO DE LA CLINICA DE ACUPUNTURA DE LA ESCUELA NACIONAL DE MEDICINA Y HOMEOPATIA.

    OpenAIRE

    DE LEON POLANCO, ALEJANDRO PACIANO

    2009-01-01

    LA BURSITIS ES LA INFLAMACION DE LAS BURSAS, QUE SON PEQUENAS BOLSAS LLENAS DE LIQUIDO SEROSO QUE SE ENCUENTRAN ENTRE LOS TENDONES Y EL PLANO OSEO. LA CINTURA ESCAPULAR TIENE 11 BURSAS LAS CUALES SE PUEDEN AFECTAR UNA O MAS EN FORMA SIMULTANEA CONDICIONANDO DOLOR, INFLAMACION Y LIMITACION FUNCIONAL QUE TRAE COMO CONSECUENCIA TRASTORNOS EN LA VIDA COTIDIANA DEL INDIVIDUO. LA BURSITIS SE CLASIFICA EN AGUDAS Y CRONICAS. LAS POSIBLES ETIOLOGIAS DE LA BURSITIS PUEDEN SER TRAUMATISMOS AGUDOS, PROC...

  10. Clinical manifestations in patients with computerized tomography diagnosis of neurocysticercosis; Manifestacoes clinicas de pacientes com diagnostico de neurocisticercose por tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Pfuetzenreiter, Marcia Regina [Universidade do Estado de Santa Catarina (UDESC), Florianopolis, SC (Brazil). Dept. de Medicina Veterinaria Preventiva e Tecnologia]. E-mail: a2mrp@cav.udesc.br; Avila-Pires, Fernando Dias de [Santa Catarina Univ., Florianopolis, SC (Brazil). Dept. de Saude Publica

    1999-09-01

    A survey was conducted in the urban area of Lages using patients who had been submitted to a computed tomography of the skull in the period of March-December, 1996, for different reasons. Forty-two patients with a provisional diagnosis of neurocysticercosis, and 57 negatives were personally interviewed by one of the authors (Pfuetzenreiter), using a semi-structured procedure. More individuals with a provisional diagnostic of neurocysticercosis reported clinical manifestations related to this infection than those found negative. this difference is more marked among women, except in relation to convulsions, more frequently reported by men (19.05%) than by women (7.14%). The greater percentage of inactive forms (83.33%0 and a longer history of perceived symptoms among those positives suggest that the condition is not new. (author)

  11. Radiological protection in the interventional techniques: experience in the Pain Clinic of the CIMEQ; Proteccion radiologica en las tecnicas intervencionistas: experiencia en la Clinica del Dolor del CIMEQ

    Energy Technology Data Exchange (ETDEWEB)

    Guerrero C, M. C.; Benitez N, P. P.; Gonzalez G, Y. [Centro de Investigaciones Medico Quirurgicas, Av. 216 Esq. 11B, Playa Siboney, 6096 La Habana (Cuba); Martinez G, A.; Gonzalez R, N. [Centro de Proteccion e Higiene de las Radiaciones, Carretera de la Cantera, Victoria II, Km. 21.5 Guanabacoa, La Habana (Cuba); Sanchez Z, L. R., E-mail: mayka@infomed.sld.cu [Hospital C. Q. Hermanos Ameijeiras, San Lazaro 701, Centro Habana, La Habana (Cuba)

    2014-08-15

    The Pain Clinic of the CIMEQ offers treatment to patients with different pathologies, using interventional techniques as the radiology like visual guide to reach the target structure and to apply the election technique. The personnel that carry out these procedures are inserted in the program of radiological surveillance of the institution, reason for which a radiological event could be detected where the main physician responsible of the service was implied. In this work the results of an investigation are presented realized with the objective of to know the causes of the event and to determine the necessary measures to avoid that this repeats again. The investigation was oriented to three fundamental aspects: medical exam of the affected worker; evaluation of the operational procedures from the radiological protection view point; and dosimetric measurements simulating the real conditions of work for which were used ionization chamber, radiometer and PMMA mannequin. As a result of the medical exam was detected that the main physician of the service did not use during the execution of all the procedures the extremities dosimetry and that he presented a radio induced erythema in the right hand, reason for which he was separated of the activity with ionizing radiations, until the conclusion of the investigation. With relationship to the evaluation of the operational procedures from the radiological protection view point, was verified that the medical physician not carried out any collimation of the beam and he was located in the positions where the dose rate reached the maximum values, frequently introducing the hands in the direct beam; that which implied an overexposure of the superior extremities and a not optimized exposure for whole body. This result was proven with the realized experimental measurements, which gave dose estimated values in extremities of the order of the deterministic effects. The investigation facilitated to introduce modifications in the operational procedures from the radiological protection view point that allowed optimizing the occupational exposure and to avoid the appearance of deterministic effects on the workers of this practice. Parallel was carried out the completion of the protection individual media and working media that allowed the proper application of the mentioned procedures were substituted. On the other hand, this investigation pointed to that the personnel training in radiological protection matter and the control of the occupational exposure in the interventional techniques are indispensable for the safe performance of the medical practice. (author)

  12. The role of the medical physic on radiologic, hemodynamic and surgery unit at Hospital das Clinicas de Porto Alegre, Rio Grande do Sul State, Brazil

    International Nuclear Information System (INIS)

    Bacelar, A.; Furtado, A.P.A.; Krebs, E.M.; Oliveira, S.S.; Lima, A.A.; Jacques, L.C.; Silveira, C.S.

    1996-01-01

    The activities executed by the medical physic in the radiologic, hemodynamic and surgery unit are presented. Topics such as organization of a radiologic protection project and a quality assurance program, monthly information of the individual doses, sanitary inspection and training of the professionals involved are emphasized. The methodology and results are briefly presented

  13. Correlação clinica entre a mielopatia cervical e o índice de Torg Correlation between the clinic and the index of cervical myelopathy Torg

    Directory of Open Access Journals (Sweden)

    Agnaldo Rogério Lozorio

    2012-01-01

    Full Text Available OBJETIVO: A mielopatia cervical é uma disfunção da medula espinhal relacionada a degeneração típica do envelhecimento, cuja patologia se relaciona com a isquemia e compressão da medula. Muitos são os problemas clínicos apresentados por portadores de mielopatia, nos casos mais graves este acometimento pode levar a para ou tetraplegia quando não tratado. Devido a patologia primária desta doença ser causada por compressão gerando isquemia medular, julgamos poder existir uma correlação entre o grau de compressão e clínica dos pacientes portadores de mielopatia cervical, porém não encontramos nenhum estudo na literatura que realizou esta correlação, por existir esta dúvida na literatura é que objetivamos em nosso estudo analisar a correlação entre o grau do comprometimento clínico dos pacientes com mielopatia cervical e o índice de Torg. MÉTODOS: Estudo prospectivo, de caráter descritivo, avaliados 46 pacientes, realizado mensuração radiográfica do índice de Torg e análise clínica através da escala de JOA e Nurick. RESULTADOS: Dos 46 pacientes, 100% apresentaram Torg OBJECTIVE: Cervical myelopathy is a spinal cord dysfunction related to degeneration typical of aging. Its primary pathology is related to ischemia and spinal cord compression. Patients with myelopathy present many clinical problems; more severe cases may lead to quadriplegia if not treated in a timely manner. Because the primary pathology of this disease is caused by compression, thus generating spinal cord ischemia, we believed there must be a correlation between the degree of compression and the clinical assessment of patients with cervical myelopathy, but we did not find any study in the literature that made this correlation. Because there is doubt the literature we aimed, in our study, to analyze the correlation between the degree of clinical impairment of patients with cervical myelopathy and the Torg index. METHODS: A prospective, descriptive study, evaluating 46 patients, in which radiographic measurements of the Torg index were performed, with clinical analysis through the Nurick and JOA scale. RESULTS: Of the 46 study patients included in the study, 100% presented a Torg score <0.8. The decrease in Torg values was directly proportional to clinical worsening on the Nurick and JOA scale. CONCLUSIONS: The degree of clinical impairment in patients with cervical myelopathy is directly related to the degree of spinal canal stenosis. Level of Evidence I, Prognostic Studies - Investigating the effect of the characteristics of a patient on the outcome of the disease.

  14. Laser diagnostic and therapy of dental caries: the clinic point of view; Laser diagnostico e tratamento da carie dental: uma visao clinica

    Energy Technology Data Exchange (ETDEWEB)

    Paiva, Priscila Faria

    2001-07-01

    Dental caries's diagnosis is a major dentistry problem from the clinic point of view. The laser beam on the region of 655 nm induces the fluorescence of the compounds present in the hard tissue, quantifying differences between sound and carious enamel and dentine. Diagnodent (Kavo, Germany), showed to be effective regarding dental caries's diagnosis in the present research sampling. The Er:YAG laser (Kavo Key Laser 2, Germany) performed efficient cavity preparations in caries lesions of I and V class type, using up energies that ranged from 300 mJ to 350 mJ with 4 Hz repetition rate for the enamel; and from 250 mJ to 300 mJ with 4 Hz repetition rate for the dentine, and with 80 mJ with 6 Hz of repetition rate for laser conditioning. In the Er:YAG laser preparations no patient was anesthetized even when there were deeper cavities, and the maximum degree of pain ( which ranged from 0 to 10) was 4. In the control group with conventional high-speed drill two patients were anesthetized and the maximum degree of pain was 7. Restorations performed by conventional method of composite were equally satisfying both in caries groups of I and V class type and in the control group. The laser application in the operative dentistry office as a new method of diagnosis and dental preparations should be a good alternative to the use of the conventional dental drill. Nevertheless, dentistry practice has a lot to improve from technology progress, as well as new researches on laser dentistry are necessary in a long term. New types of lasers will come about and will increasingly improve the dental practice assistance and procedures quality. (author)

  15. Polimorfismos no SNP CGIL4: estudo de associação ao fenótipo de resistência a mastite clinica em vacas holandesas

    OpenAIRE

    Molina, Rachel Dias; Univates; Kich, Débora Mara; Univates; Vendramin, Tatiane; Univates; Souza, Claucia Fernanda Volken de; Univates; Lehn, Daniel Neutzling; Univates; Pozzobon, Adriane; Univates; Bustamante-Filho, Ivan Cunha; Univates

    2014-01-01

    A mastite bovina é a principal patologia da glândula mamária e a maior causadora de prejuízos na produção leiteira. Sua etiologia é quase sempre relacionada a problemas de manejo sanitário e de ordenha. Entretanto, observa-se a existência de animais com maior ou menor resistência a mastite, mesmo quando fatores ambientais são controlados. Recentemente, alguns marcadores moleculares foram associados ao fenótipo de resistência a mastite. O presente estudo teve como objetivo verificar se com bas...

  16. Small vessel vasculitis History, classification, etiology, histopathology, clinic, diagnosis and treatment; Vasculitis de pequenos vasos. Historia, clasificacion, etiologia, histopatologia, clinica, diagnostico y tratamiento

    Energy Technology Data Exchange (ETDEWEB)

    Iglesias Gamarra, Antonio; Matteson, Eric L; Restrepo, Jose Felix

    2007-07-01

    Small-vessel vasculitis is a convenient descriptor for a wide range of diseases characterized by vascular inflammation of the venules, capillaries, and/or arterioles with pleomorphic clinical manifestations. The classical clinical phenotype is leucocytoclastic vasculitis with palpable purpura, but manifestations vary widely depending upon the organs involved. Histopathologic examination in leucocytoclastic vasculitis reveals angiocentric segmental inflammation, fibrinoid necrosis, and a neutrophilic infiltrate around the blood vessel walls with erythrocyte extravasation. The etiology of small-vessel vasculitis is unknown in many cases, but in others, drugs, post viral syndromes, malignancy, primary vasculitis such as microscopic polyarteritis, and connective tissue disorders are associated, The diagnosis of small- vessel vasculitis relies on a thorough history and physical examination, as well as relevant antibody testing including antinuclear antibody and anti neutrophil cytoplasmic antibody, hepatitis B and C serologies, assessment of complement, immunoglobulins, blood count, serum creatinine liver function tests, urinalysis, radiographic imaging and biopsy. The treatment is based primarily on corticosteroid and immunosuppressive agents.

  17. Existe diferença no estadiamento entre doentes operados de câncer colorretal no sistema previdenciário e na clinica privada?

    Directory of Open Access Journals (Sweden)

    Rodrigo Cuiabano Paes Leme

    Full Text Available OBJETIVO: Avaliar se existe diferença no estadiamento de doentes submetidos à ressecção intestinal por câncer colorretal no sistema previdenciário e na clínica privada. MÉTODO: Foram estudados de forma retrospectiva 41 doentes (16 homens e 25 mulheres com idade média de 59,4 anos operados no sistema previdenciário (SP e 33 doentes (18 homens e 15 mulheres com idade média de 60,8 anos operados na clínica privada (CP. Foram avaliados o estadiamento TNM, a frequência de operações de urgência, de operações paliativas e do uso de colostomia. RESULTADOS: Não se observou diferença entre o estadiamento dos dois grupos. A frequência de operações de urgência foi 26,8% no SP e 12,1% na CP (p=0,100. As operações paliativas ( 19,5% SP x 6,1% CP e o uso de colostomia ( 26,8 SP X 15,2 CP foram maiores no sistema previdenciário porém os valores não foram estatisticamente significantes, valores de p=0,087 e p=0,352 respectivamente. CONCLUSÃO: Não há diferença significante entre o estadiamento TNM de doentes operados no sistema previdenciário e privado.

  18. Study effect of plant extraction for Cuscuta europaea (Dodder against two species of bacteria Staphylococcus aureus and Escherichia coli

    Directory of Open Access Journals (Sweden)

    Jasim A. Abdullah

    2016-12-01

    Conclusion: There are no significant differences between the concentration of plant extract of bacteria, and we showed the plant extract have a high effect on gram positive bacteria but do not have any effect on gram negative bacteria.

  19. Acetylene and oxygen as inhibitors of nitrous oxide production in Nitrosomonas europaea and Nitrosospira briensis: a cautionary tale

    NARCIS (Netherlands)

    Wrage, N.; Velthof, G.L.; Oenema, O.; Laanbroek, H.J.

    2004-01-01

    Autotrophic ammonia-oxidizing bacteria produce nitrous oxide (N2O) as a by-product of nitrification or as an intermediate of nitrifier denitrification. In soil incubations, acetylene (C2H2) and large partial pressures of oxygen (O2) are used to distinguish between these sources. C2H2 inhibits

  20. Effect of Tea (Camellia sinensis and Olive (Olea europaea L. Leaves Extracts on Male Mice Exposed to Diazinon

    Directory of Open Access Journals (Sweden)

    Atef M. Al-Attar

    2013-01-01

    Full Text Available The present study was aimed to evaluate the effects of tea and olive leaves extracts and their combination in male mice intoxicated with a sublethal concentration of diazinon. Exposure of mice to 6.5 mg/kg body weight of diazinon for seven weeks resulted in statistical increases of serum alanine aminotransferase, aspartate aminotransferase, gamma glutamyl transferase, alkaline phosphatase, creatine kinase, creatinine, glucose, triglycerides, and cholesterol, while the value of serum total protein was declined. Treating diazinon-intoxicated mice with tea and olive leaves extracts or their combination significantly attenuated the severe alterations in these hematobiochemical parameters. Moreover, the results indicated that the supplementation with combination of tea and olive leaves extracts led to more attenuation effect against diazinon toxicity. Additionally, these new findings suggest that the effect of tea and olive leaves extracts and their combination against toxicity of diazinon may be due to antioxidant properties of their chemical constituents. Finally, the present study indicated that the extracts of tea and olive leaves and their combination can be considered as promising therapeutic agents against hepatotoxicity, cardiotoxicity, nephrotoxicity, and metabolic disorders induced by diazinon and maybe by other toxicants and pathogenic factors.

  1. Identification and Assessment of the Potential Allergenicity of 7S Vicilins in Olive (Olea europaea L. Seeds

    Directory of Open Access Journals (Sweden)

    Jose C. Jimenez-Lopez

    2016-01-01

    Full Text Available Olive seeds, which are a raw material of interest, have been reported to contain 11S seed storage proteins (SSPs. However, the presence of SSPs such as 7S vicilins has not been studied. In this study, following a search in the olive seed transcriptome, 58 sequences corresponding to 7S vicilins were retrieved. A partial sequence was amplified by PCR from olive seed cDNA and subjected to phylogenetic analysis with other sequences. Structural analysis showed that olive 7S vicilin contains 9 α-helixes and 22 β-sheets. Additionally, 3D structural analysis displayed good superimposition with vicilin models generated from Pistacia and Sesamum. In order to assess potential allergenicity, T and B epitopes present in these proteins were identified by bioinformatic approaches. Different motifs were observed among the species, as well as some species-specific motifs. Finally, expression analysis of vicilins was carried out in protein extracts obtained from seeds of different species, including the olive. Noticeable bands were observed for all species in the 15–75 kDa MW interval, which were compatible with vicilins. The reactivity of the extracts to sera from patients allergic to nuts was also analysed. The findings with regard to the potential use of olive seed as food are discussed.

  2. Molecular characterization of three common olive (Olea europaea L.) cultivars in Palestine, using simple sequence repeat (SSR) markers.

    Science.gov (United States)

    Obaid, Ramiz; Abu-Qaoud, Hassan; Arafeh, Rami

    2014-09-03

    Eight accessions of olive trees from three common varieties in Palestine, Nabali Baladi, Nabali Mohassan and Surri, were genetically evaluated using five simple sequence repeat (SSR) markers. A total of 17 alleles from 5 loci were observed in which 15 (88.2%) were polymorphic and 2 (11.8%) were monomorphic. An average of 3.4 alleles per locus was found ranging from 2.0 alleles with the primers GAPU-103 and DCA-9 to 5.0 alleles with U9932 and DCA-16. The smallest amplicon size observed was 50 bp with the primer DCA-16, whereas the largest one (450 bp) with the primer U9932. Cluster analysis with the unweighted pair group method with arithmetic average (UPGMA) showed three clusters: a cluster with four accessions from the 'Nabali Baladi' cultivar, another cluster with three accessions that represents the 'Nabali Mohassen' cultivar and finally the 'Surri' cultivar. The similarity coefficient for the eight olive tree samples ranged from a maximum of 100% between two accessions from Nabali Baladi and also in two other samples from Nabali Mohassan, to a minimum similarity coefficient (0.315) between the Surri and two Nabali Baladi accessions. The results in this investigation clearly highlight the genetic dissimilarity between the three main olive cultivars that have been misidentified and mixed up in the past, based on conventional morphological characters.

  3. Transcriptomic analysis of the Olea europaea L. roots during the Verticillium dahliae early infection process

    DEFF Research Database (Denmark)

    Jiménez-Ruiz, Jaime; Pérez, Maria De la O Leyva; Schilirò, Elisabetta

    2017-01-01

    Olive cultivation is affected by a wide range of biotic constraints. Verticillium wilt of olive is one of the most devastating diseases affecting this woody crop, inflicting major economic losses in many areas, particularly within the Mediterranean Basin. Little is known about gene-expression cha...

  4. Influence of calcium carbonate on extraction yield and quality of extra virgin oil from olive (Olea europaea L. cv. Coratina).

    Science.gov (United States)

    Squeo, G; Silletti, R; Summo, C; Paradiso, V M; Pasqualone, A; Caponio, F

    2016-10-15

    The aim of the research was to evaluate the effect of calcium carbonate (1%, 2%, and 4% of addition) at two different particle sizes (2.7μm and 5.7μm), added at the beginning of the malaxation phase, on both the extraction yield and the quality of oil obtained from Coratina olives at different ripening index. The results showed that calcium carbonate significantly increased the extraction yield of olive oil, more than affecting chemical indices. In particular, for less ripened olives, 1-2% of larger particle size calcium carbonate addiction determined a significant increase of the extraction effectiveness, ranging from 4.0 to 4.9%, while more ripened olives required higher amounts of coadjuvant (2-4% when using the larger particle size and 4% when using the smaller one), with a significant increase of the extraction yield up to 5%. Moreover, an increase of pungent perception was observed in some cases when adding calcium carbonate to more ripened olives. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Effect of agronomical practices on carpology, fruit and oil composition, and oil sensory properties, in olive (Olea europaea L.).

    Science.gov (United States)

    Rosati, Adolfo; Cafiero, Caterina; Paoletti, Andrea; Alfei, Barbara; Caporali, Silvia; Casciani, Lorena; Valentini, Massimiliano

    2014-09-15

    We examined whether some agronomical practices (i.e. organic vs. conventional) affect olive fruit and oil composition, and oil sensory properties. Fruit characteristics (i.e. fresh and dry weight of pulp and pit, oil content on a fresh and dry weight basis) did not differ. Oil chemical traits did not differ except for increased content of polyphenols in the organic treatments, and some changes in the acidic composition. Sensory analysis revealed increased bitterness (both cultivars) and pungency (Frantoio) and decreased sweetness (Frantoio) in the organic treatment. Fruit metabolomic analysis with HRMAS-NMR indicated significant changes in some compounds including glycocholate, fatty acids, NADPH, NADP+, some amino acids, thymidine, trigonelline, nicotinic acid, 5,6-dihydrouracil, hesanal, cis-olefin, β-D-glucose, propanal and some unassigned species. The results suggest that agronomical practices may have effects on fruit composition that may be difficult to detect unless a broad-spectrum analysis is used. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. Water relation response to soil chilling of six olive (Olea europaea L.) cultivars with different frost resistance

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Lopez, D.; Gijon, M. C.; Marino, J.; Moriana, A.

    2010-07-01

    The relationship between the water relations of six olive cultivars exposed to different soil temperatures (14 0.1, 9.9 0.1 and 5.8 0.2 degree centigrade) and their inherent frost resistance (as determined by two different methods) was investigated. Soil chilling was achieved by introducing pots of olive plants into water baths. The water relations of these plants were compared to those of plants kept under conditions of room temperature. The cultivars Frantoio, Picual and Changlot Real began to show significant dehydration below 14 degree centigrade, while Cornicabra, Arbequina and Ascolana Tenera showed this below 10 degree centigrade. This response is probably due to delayed stomatal closure. Only Cornicabra and Picual showed a significant reduction in leaf conductance (below 10 degree centigrade and 6 degree centigrade respectively). This absence of stomatal control led to a significantly greater dehydration in Ascolana Tenera. These variations in response to the soil chilling temperature suggest that different mechanisms may be at work, and indicate that would be necessary to study the influence of rootstock in the frost resistance of olive plants. The variations recorded grouped the cultivars as either resistant (Cornicabra), tolerant (Picual, Ascolana Tenera and Arbequina), or sensitive (Frantoio and Changlot Real). This classification is in line with the frost resistance reported for these cultivars in the literature, and with the results obtained in the present work using the stomatal density and ion leakage methods of determining such resistance. (Author) 40 refs.

  7. Identification and gene expression analysis of AUX1 influencing adventitious root induction in olive cuttings (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Seyed Mehdi Hosseini Mazinani

    2014-12-01

    Full Text Available Olive is one of the most important fruit crops throughout the Mediterranean Basin, mainly propagated by cuttings. The adventitious root development is a key stage in vegetative propagation however the low rooting capacity of some cultivars severely affects the efficiency of olive clonal propagation. Auxin Influx Carrier gene (AUX1, plays a key role in lateral root formation in many plant species promoting the export of IAA from newly developing leaves to lateral root primordia. Putative olive homologues were amplified by using degenerate primers designed on the conserved regions of AUX1 transcripts identified in other plants. Transcript and amino acid sequences in root (OeAUX1R and base of cutting (OeAUX1B were different causes of polymorphisms relating to possible distinct roles in these tissues. In order to investigate the gene expression patterns, Real-time PCR was performed on cuttings during the rooting stage collected from genotypes characterized by high and low rooting ability. Moreover, the gene expression was investigated on different olive tissues. Preliminary results showed that the expression of OeAUX1B and OeAUX1R in base of cuttings and roots of the high-rooting genotype were higher which suggests the hypothesis of the involvement of OeAUX1 in olive rooting. Bioinformatics analysis revealed that AUX1 gene had 8 exons in olive and the sequence of this gene in plant was conserved during evolution.

  8. Influence of process parameters and biomass characteristics on the durability of pellets from the pruning residues of Olea europaea L.

    Energy Technology Data Exchange (ETDEWEB)

    Carone, Maria Teresa; Pantaleo, Antonio; Pellerano, Achille [Department of Engineering and Management of the Agricultural, Livestock and Forest Systems, Faculty of Agriculture, University of Bari, Via Amendola, 165/A, 70126 Bari (Italy)

    2011-01-15

    The present work aims to investigate the influence of the main process parameters (pressure and temperature) and biomass characteristics (moisture content and particle size) on some mechanical properties (density and durability) of olive tree pruning residues pellets. By means of a lab scale pellet press, able to control process parameters, the biomass, ground with three different hammer mill screen sizes (1, 2 and 4 mm) and conditioned at different moisture contents (5, 10, 15 and 20% w.b.), was pelletized at various process temperatures (60, 90, 120 and 150 C) and pressures (71, 106, 141 and 176 MPa). Compressed sample dimensions and mass were measured in order to calculate pellet density, while compressive strength tests were carried out to estimate the durability of the final biofuel. The relationships between the factor settings and the responses (density, compression strength and modulus of elasticity) were examined by univariate and multivariate statistical analysis. Temperature resulted the most important variable influencing pellet mechanical properties, followed by the initial moisture content and the particle size of the raw material. In particular, high process temperature, low moisture contents and reduced particle sizes allowed obtaining good quality pellets. The effect of compression force resulted scarcely relevant. (author)

  9. Trocas gasosas influenciam na morfogênese in vitro de duas cultivares de oliveira (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Marcos Vinícius Marques Pinheiro

    2013-02-01

    Full Text Available Os objetivos deste trabalho foram estabelecer in vitro as cultivares de oliveira 'Arbequina' e 'Maria da Fé' e avaliar a influência das tampas com membranas permeáveis a gases na morfogênese in vitro dessas cultivares. Inocularam-se segmentos nodais com gemas previamente descontaminadas pelo protocolo aqui desenvolvido. Utilizaram-se o delineamento inteiramente casualizado (DIC em esquema fatorial 2³, duas cultivares; dois meios de cultura OM (Olive medium (OM + 20 µM de zeatina [1]; e OM + 20 µM de zeatina + 10 µM de GA3 [2]; dois tipos de vedação (tampa rígida sem orifício e com membrana porosa com cinco repetições/ tratamento; e a unidade experimental constituída por quatro tubos de ensaio. Avaliaram-se: a porcentagem de contaminação total; a porcentagem de contaminação fúngica e bacteriana; o número de gemas intumescidas; o número de brotos; e a porcentagem de oxidação. Aos 30 dias de cultivo, constatou-se a contaminação de 15% e 8,8% dos explantes de 'Arbequina' e 'Maria da Fé', respectivamente. Em 'Arbequina', 33,3% e 66,7% ocorreram por contaminação fúngica e bacteriana, respectivamente. Em 'Maria da Fé', 28,6% e 71,4% decorreram de contaminação fúngica e bacteriana, respectivamente. O número de gemas foi superior (p<0,05 em 'Arbequina', comparativamente à 'Maria da Fé', quando se utilizou tampa com membrana porosa para vedar os frascos. Em tampa rígida não houve diferença entre cultivares. O número de brotos no meio 1 foi superior estatisticamente (p<0,05 ao no meio 2. Não houve diferença estatística em porcentagem de oxidação. Sugere-se a utilização do protocolo de desinfestação aqui desenvolvido, como também do meio 1 e tampas com membranas porosas, pois isso favorecerá o desenvolvimento das gemas e a posterior formação de plantas.

  10. The eastern part of the Fertile Crescent concealed an unexpected route of olive (Olea europaea L.) differentiation.

    Science.gov (United States)

    Mousavi, Soraya; Mariotti, Roberto; Bagnoli, Francesca; Costantini, Lorenzo; Cultrera, Nicolò G M; Arzani, Kazem; Pandolfi, Saverio; Vendramin, Giovanni Giuseppe; Torkzaban, Bahareh; Hosseini-Mazinani, Mehdi; Baldoni, Luciana

    2017-06-01

    Olive is considered a native plant of the eastern side of the Mediterranean basin, from where it should have spread westward along the Mediterranean shores, while little is known about its diffusion in the eastern direction. Genetic diversity levels and population genetic structure of a wide set of olive ecotypes and varieties collected from several provinces of Iran, representing a high percentage of the entire olive resources present in the area, was screened with 49 chloroplast and ten nuclear simple sequence repeat markers, and coupled with archaeo-botanical and historical data on Mediterranean olive varieties. Approximate Bayesian Computation was applied to define the demographic history of olives including Iranian germplasm, and species distribution modelling was performed to understand the impact of the Late Quaternary on olive distribution. The results of the present study demonstrated that: (1) the climatic conditions of the last glacial maximum had an important role on the actual olive distribution, (2) all Iranian olive samples had the same maternal inheritance as Mediterranean cultivars, and (3) the nuclear gene flow from the Mediterranean basin to the Iranian plateau was almost absent, as well as the contribution of subspecies cuspidata to the diversity of Iranian olives. Based on this evidence, a new scenario for the origin and distribution of this important fruit crop has been traced. The evaluation of olive trees growing in the eastern part of the Levant highlighted a new perspective on the spread and distribution of olive, suggesting two routes of olive differentiation, one westward, spreading along the Mediterranean basin, and another moving towards the east and reaching the Iranian plateau before its domestication. © The Author 2017. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com

  11. Specialized consultant in radiological safety to the clinical north central hospital of high speciality, PEMEX. IV. - December of 2001; Asesoria especializada en seguridad radiologica a la clinica hospital central norte de alta especialidad, PEMEX. IV.- Diciembre de 2001

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Vizuet G, J.; Benitez S, J. A.; Garcia A, J.; Rodriguez A, F

    2002-01-15

    The clinical north central hospital of high speciality, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the hospital can conserve its respective sanitary license.(Author)

  12. Specialized consultant in radiological safety to the south central hospital of high speciality, PEMEX. IV. - October of 2001; Asesoria especializada en seguridad radiologica a la clinica al hospital central sur de alta especialidad, PEMEX. IV.- Octubre de 2001

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Vizuet G, J.; Benitez S, J. A.; Garcia A, J.; Rodriguez A, F

    2002-01-15

    The south central hospital of high speciality, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the hospital can conserve its respective sanitary license.(Author)

  13. Avaliação clínica da vertebroplastia percutânea transpedicular Evaluación clinica de la vertebroplastia transpedicular percutánea Clinic evaluation of transpedicular percutaneous vertebroplasty

    Directory of Open Access Journals (Sweden)

    André Rafael Hubner

    2011-01-01

    Full Text Available OBJETIVO: Avaliar a eficácia do efeito analgésico da vertebroplastia com polimetilmetacrilato (PMMA e da estabilização vertebral obtida nos pacientes com fraturas vertebrais patológicas e realizar uma revisão detalhada da técnica da vertebroplastia percutânea, analisando suas indicações. MÉTODOS: Análise retrospectiva de 64 procedimentos de vertebroplastia percutânea em 46 pacientes. Foram realizadas avaliações dos prontuários e das radiografias pré e pós-operatórias e em nova consulta de rotina, na qual foi aplicado o questionário de dor (escala analógica visual da dor. RESULTADOS: Entre os 46 pacientes analisados, 37 (80,4% eram do sexo feminino e 9 (19,6% do sexo masculino, com média de idade de 71 anos (desvio-padrão +/- 9,2, variando de 50 a 90 anos. Foram operados 64 níveis, com predomínio do segmento toracolombar, sendo realizadas 17 (26,6% vertebroplastias a maioria em pedículos de T12. Trinta e um pacientes (67,4% apresentaram apenas um nível fraturado, 12 (26,1% apresentaram 02 níveis operados e três pacientes (6,5% apresentaram 03 ou mais níveis operados. O diagnóstico de osteoporose foi o mais comum (33 casos, 71,7%. Quanto ao alívio da dor no pós-operatório, houve um alto índice de satisfação de 90 a 100% em 37 (80% pacientes. CONCLUSÃO: A vertebroplastia demonstra ser um procedimento eficaz no tratamento da dor por fratura patológica de coluna, sendo tamb��m utilizada em investigação diagnóstica (biópsia óssea. É um procedimento seguro com baixas taxas de complicações.OBJETIVO: Evaluar la eficacia del efecto analgésico y estabilización vertebral de la vertebroplastia con polimetilmetacrilato (PMMA en pacientes con fracturas patológicas de la columna vertebral, y realizar una revisión detallada de la técnica de vertebroplastia percutánea, analizando sus indicaciones. MÉTODOS: Evaluación retrospectiva de 64 fracturas tratadas en 46 pacientes sometidos a vertebroplastia percutánea en el período de enero de 2000 a diciembre de 2008. Los pacientes fueron evaluados por las historias clínicas, por las radiografías pre y postoperatorias y consultas de rutina en las cuales se realizaron encuestas de dolor (escala universal visual del dolor. RESULTADOS: 37 (80,4% eran mujeres y 9 (19,6% eran varones, con edad promedio de 71 años (desvío estándar de + / - 9,2, que oscila entre 50 y 90 años. 64 niveles fueron operados, con predominio de lo segmento torácico-lumbar, se realizaron 17 (26,6% la mayoría en pedículos vertebroplastia de T12. Treinta y un pacientes (67,4% tenían sólo un nivel de fractura, 12 pacientes (26,1% tenían 02 niveles y 03 (6,5% pacientes tenían 03 o más niveles de fractura. El diagnóstico de osteoporosis fue el más común (33 casos, el 71,7%. Cuanto al alivio del dolor postoperatorio, hubo un alto índice de satisfacción de 90 a 100% en 37 (80% pacientes. CONCLUSIÓN: La vertebroplastia es un procedimiento que probó ser eficaz en el tratamiento del dolor por fractura patológica de la columna, y también se utiliza con fines de diagnóstico (biopsia de hueso. Es un procedimiento seguro y tiene bajas tasas de complicaciones.OBJECTIVE: This paper evaluates the analgesic effect and obtained vertebral stability of percutaneous vertebroplasty with polymethylmethacrylate (PMMA in patients with vertebral pathological fractures, and performs a detailed revision of this technique. METHODS: A retrospective analysis of 64 percutaneous vertebroplasty procedures in 46 patients was performed. Patients were evaluated by medical records, pre and post-operative radiographs, and by pain status (visual analog pain scale. RESULTS: 37 (80.4% patients were female and 9 (19.6% male, with mean age of 71 years (standard deviation + / - 9.2, ranging from 50 to 90 years. Sixty-four levels were treated, with a predominance of thoracic-lumbar segment, the majority 17 (26.6% of vertebroplaties at T12 pedicle. Thirty-one patients (67.4% presented only one fractured level, 12 patients (26.1% presented 02 levels and three (6.5% presented 03 or more treated levels. Osteoporosis was the most common diagnosis (33 cases, 71.7%. A high satisfaction rate of 90 to 100% was observed to the majority of patients when considering relief of pain postoperatively. CONCLUSIONS: Vertebroplasty has proven to be an effective procedure to treat pain caused by pathological fracture, and it is also used for diagnostic investigation (bone biopsy. The technique is secure and has provided low complications rates.

  14. Gunshot wounds to the head. Correlations between CT and clinical findings, neurosurgical treatment and long-term sequels; Traumi cranio-encefalici da proiettile: correlazione tra tomografia computerizzata, clinica, trattamento neurochirurgico e sequele a distanza

    Energy Technology Data Exchange (ETDEWEB)

    Salzano, A.; Nocera, V. [Ospedale S. Giovanni di Dio, Frattamaggiore, NA (Italy). Servizio di Radiologia; De Rosa, A.; Nunziata, A. [Ospedale Loreto Mare, Neaples (Italy). Servizio di Radiologia; Rossi, E.; Brunese, L. [Universita' degli Studi Federico II, Neaples (Italy). Ist. di Scienze Radiologiche; Tuccillo, M. [Azienda Ospedaliera di Rilievo Nazionale A. Cardarelli, Neaples (Italy). Servizio di Radiologia; Grassi, R. [Seconda Universita' degli Studi, Neaples (Italy). Ist. di Radiologia

    2000-03-01

    With the aim of demonstrating the usefulness of computerised tomography (CT) findings in the planning of brain neurosurgery in gunshot victims, for prompt and successful treatment, 30 patients with brain gunshot wounds were examined with CT over 5 years. The mortality rate of firearm wounds of the skull base was 34% higher than that of the hemisphere; this is due to carotid hemorrhage and midbrain damage. Such traumas require emergency radiological diagnosis and neurosurgical treatment because of their severity and early irreversible complications. Complex operations and skilled surgeons may prevent disabling postoperative sequels. CT findings are indispensable and must be correctly interpreted. The radiologist and the neurosurgeon must collaborate closely and both must consider several diagnostic factors affecting surgical planning. [Italian] Scopo dello studio e' stato quello di dimostrare l'utilita' della semeiologia della tomografia computerizzata in relazione con la pianificazione dell'intervento neochirurgico, al fine di attuare con tempestivita' interventi chirurgici soddisfacenti e meno lesivi. Lo studio comprende 30 casi di lesioni cranio-encefaliche da arma da fuoco esaminate con tomografia computerizzata nel periodo di 5 anni. Materiali e metodi utilizzati sono analiticamente descritti. L'esperienza dimostra che nelle lesioni da arma da fuoco del basicranio si nota una mortalita' del 34% superiore rispetto a quelle piu' craniali come quelle emisferiche in relazione a emorragie carotidee e lesioni tronco-mesencefaliche. Tali traumi esigono diagnosi radiologica e terapia neurochirurgica d'urgenza per la gravita' e le precoci complicanze irreversibili. Cio' richiede interventi complessi e manualita' esperte e rapide al fine di evitare sequele postoperatorie invalidanti. La corretta e indispensabile interpretazione dei segni radiologici della tomografia computerizzata deve avvenire in stretta collaborazione tra il radiologo e il neurochirurgo, ed entrambi devono tenere conto di una vasta gamma di fattori diagnostici, prognostici e di strategia terapeutica, che influenzano il tipo di decisionalita' e di aggressivita' chirurgica.

  15. OCTAVIUS 4D: Commissioning and routine clinical use of a device for VMAT verifications; OCTAVIUS 4D: establecimiento del estado de referencia inicial y uso en rutina clinica de un dispositivo para verifiicaciones VMAT

    Energy Technology Data Exchange (ETDEWEB)

    Gimeno Olmos, J.; Candela Juan, C.; Palomo Linares, R.; Carmona Meseguer, V.; Lliso Valverde, F.; Ballester Pallares, F.; Perez Calatayud, J.

    2015-07-01

    Purpose: To commission OCTAVIUS 4D and its arrays 729 and 1000 SRS for VMAT patient-specific QA verifications, and to provide clinical results obtained with this device. Methods: The performance of both arrays was analysed by evaluating: homogeneity, linearity, reproducibility and leakage current. The accuracy of the dose reconstruction of OCTAVIUS 4D with array 729 was evaluated through ion chamber measurements at several points of interest. The performance of both arrays was compared for the same clinical plans. Finally, results of the 3D gamma analysis performed in our hospital for more than 900 patient plans are provided. Results: Both arrays present good homogeneity, linearity, reproducibility, and negligible leakage current. Dose differences between OCTAVIUS-calculated doses and ion chamber measurements or TPS-calculated doses were within 2% for single field plans, and within 4% for clinical plans. The mean value of the local gamma passing rate (3%/3 mm) of clinical plans verified with array 729 is 89.7%, whereas for 1000 SRS it is 97.8%. Conclusions: OCTAVIUS 4D provides accurate 3D dose reconstructions from 2D dose measurements. Clinical results here presented may be used to establish reference levels for VMAT verifications with this device. (Author)

  16. Clinical characterization of OSL dosimeters for use in dosimetry of teletherapy beams in conventional fractionation; Caracterizacion clinica de dosimetros OSL para su uso en dosimetria de haces de teleterapia en fraccionamiento convencional

    Energy Technology Data Exchange (ETDEWEB)

    Lopez V, A.; Gutierrez M, J. G.; Rivera M, T. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria No. 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Velazquez T, J. J., E-mail: jggm25@yahoo.com.mx [Centro Medico Nacional Siglo XXI, Hospital de Oncologia, Departamento de Fisica Medica, Av. Cuauhtemoc No. 330, Col. Doctores, 06720 Mexico D. F. (Mexico)

    2015-10-15

    Optically stimulated materials are increasingly used for dosimetry in clinical settings; to be sure of the obtained reading their proper clinical characterization is necessary. Is important to know the homogeneity of a batch, reproducibility, be exposed to the same conditions of irradiation repeatedly and other dependences that could present such as energy, angular, the type of radiation which are exposed and the dose deposited in them. For characterization they were designed and implemented tests for each of the factors of interest, taking into account the need for them (calculations, manufacture of mannequins, conditions, practicality, etc.) It was shown that we can apply this dosimetry in clinical practice within a radiotherapy center, relying on the readings and practicality. (Author)

  17. Clinic implementation of method Zacarias for the correction of errors of convergence of optimization of IMRT in lung; Implementacion clinica del metodo Zacarias para la correccion de errores de convergencia de optimizacion en la IMRT en pulmon

    Energy Technology Data Exchange (ETDEWEB)

    Pardo Perez, E.; Molina Lopez, M. Y.; Ruiz Maqueda, S.; Castro Novais, J.; Counago Lorenzo, F.

    2013-07-01

    The implemented procedure is acceptable per a unit of radiophysic since it does not increase planning time in more than 30 - 45 minutes. Plans thus obtained show an improvement in dosimetric parameters for a small increase in the complexity of the plan, without appreciable increase risk organ doses. (Author)

  18. Development and clinical implementation of a global software use and analysis of radiochromic s films; Desarrollo e implementacion clinica de un software global de uso y analisis de peliculas radiocromicas

    Energy Technology Data Exchange (ETDEWEB)

    Gimeno Olmos, J.; Martinez Fernandez, J. M.; Pastor Sanchis, V.; Gonzalez Perez, V.; Guardino de la Flor, C.; Dolores Alemany, V. de los; Crispin Contreras, V.

    2011-07-01

    The aim of this study was to gather information in one solution the different processes that occur with the use of radiochromic films: calibration, reading, corrections, step-absorbed dose, dose distribution analysis and comparison with reference distributions.

  19. Octavius 4D: Initial state of reference and clinical implementation of a new equipment for checks VMAT; Octavius 4D: Estado de referencia inicial e implementacion clinica de un nuevo equipamiento para verificaciones VMAT

    Energy Technology Data Exchange (ETDEWEB)

    Eno Olmos, J.; Carmona Mesequer, V.; Lliso Vlaverde, F.; Garcia Martinez, M. t.; Pujades Claumarchiran, M. C.; Palomo Llinares, R.; Ballester Pallares, F.; Perez-Calatayud, J.

    2013-07-01

    The objective of this work is the establishment of the State of initial reference of a new system of measurement with the above capabilities, as well as the evaluation of its use in clinical routine. (Author)

  20. Specialized consultant in radiological safety to the Reforma peripheral clinic, PEMEX. - III. - September and October of 2002; Asesoria especializada en seguridad radiologica a la clinica periferica Reforma, PEMEX.- III.- Septiembre y Octubre de 2002

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Rodriguez A, F.; Garcia A, J

    2003-02-15

    The Reforma peripheral clinic, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the clinic can conserve its respective sanitary license.(Author)

  1. Specialized consultant in radiological safety to the Reforma peripheral clinic, PEMEX. - I. - May-June of 2003; Asesoria especializada en seguridad radiologica a la clinica periferica Reforma, PEMEX.- I.- Mayo-Junio de 2003

    Energy Technology Data Exchange (ETDEWEB)

    Torres P, A.; Garcia A, J.; Rodriguez A, F

    2003-07-15

    The Reforma peripheral clinic, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the clinic can conserve its respective sanitary license.(Author)

  2. Gingival healing after gingivectomy procedure and low intensity laser irradiation. A clinical and biometrical study in anima nobile; Reparacao gengival apos a tecnica de gengivectomia e aplicacao de laser em baixa intensidade. Avaliacao clinica e biometrica em humanos

    Energy Technology Data Exchange (ETDEWEB)

    Amorim, Jose Claudio Faria

    2001-07-01

    For the present study seven patients presenting periodontal disease were selected in a way that they required the performance of gingivectomy procedure in the region of premolars in both sides, being this in the upper or lower region. After the surgical procedure one side was submitted to low intensity laser radiation, wavelength 685 nm, power 50 mW and fluency of 4J/cm{sup 2}, contact mode. The other side was used as a control, not receiving any laser irradiation. Healing process for both sides, was clinically and biometrically evaluated and compared using photographs for the periods: pre-operative, immediate post-operative, 3, 7,14,21, 28 and 35 days. The analysis was performed by 3 specialists in Periodontology considering aspects of healing. Results were submitted to statistical analysis. Biometrical evaluation showed improvement of healing for the period of 21 and 28 days in the lased group. Clinical evaluation showed better reparation mainly after the third day for the active group. Laser group was considered to present an improved healing when compared to the control group. (author)

  3. Elements determination of clinical relevance in biological tissues Dmd{sup mdx}/J dystrophic mice strains investigated by NAA; Determinacao de elementos de relevancia clinica em tecidos biologicos de camundongos distroficos Dmd{sup mdx}/J por AAN

    Energy Technology Data Exchange (ETDEWEB)

    Metairon, Sabrina

    2012-07-01

    In this work the determination of chemistry elements in biological tissues (whole blood, bones and organs) of dystrophic mice, used as animal model of Duchenne Muscular Dystrophy (DMD), was performed using analytical nuclear technique. The aim of this work was to determine reference values of elements of clinical (Ca, Cl, K, Mg, Na) and nutritional (Br and S) relevance in whole blood, tibia, quadriceps and hearts from Dmdmdx/J (10 males and 10 females) dystrophic mice and C57BL/6J (10 males) control group mice, using Neutron Activation Analysis technique (NAA). To show in more details the alterations that this disease may cause in these biological tissues, correlations matrixes of the DMD{sup mdx}/J mouse strain were generated and compared with C57BL/6J control group. For this study 119 samples of biological tissue were irradiated in the IEA-R1 nuclear reactor at IPEN (Sao Paulo, Brazil). The concentrations of these elements in biological tissues of Dmd{sup mdx}/J and C57B/6J mice are the first indicative interval for reference values. Moreover, the alteration in some correlation coefficients data among the elements in the health status and in the diseased status indicates a connection between these elements in whole blood, tibia, quadriceps and heart. These results may help the researchers to evaluate the efficiency of new treatments and to compare the advantages of different treatment approaches before performing tests in patients with muscular dystrophy. (author)

  4. Administered activities of {sup 18}F-FDG PET clinics in pediatrics patients in Brazil- preliminary study; Atividades administradas de {sup 18}F-FDG aos pacientes pediatricos nas clinicas PET no Brasil - estudo preliminar

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Cassio Miri, E-mail: cmo@cdtn.br [Universidade Federal de Minas Gerais (PCTN/UFMG), Belo Horizonte, MG (Brazil). Pos-Graduacao em Ciencias e Tecnicas Nucleares; Silva, Teogenes A. da, E-mail: silvata@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Sa, Lidia V. de, E-mail: lidia@ird.gov.br [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    A survey was conducted among the Brazilian clinical PET, with the purpose of investigating the activities administered to pediatric oncology patients and assess whether significant differences between the protocols adopted. In addition, this survey can cooperate to the suggestion diagnostic reference levels (DRLs) in nuclear medicine. Although the methodology for delivering doses by most clinics be based on patient's weight, the results showed variations of up to 191, 6% between the activities administered in clinics, even for similar devices. The average value of the distribution of activities reported was 4.46 {+-} 1,6 MBq /kg. These data demonstrate the need for harmonization and optimization of {sup 18}F-FDG/PET procedures, as well as training for professionals involved in the clinical routine.

  5. Specialized consultant in radiological safety to the Reforma peripheral clinic, PEMEX. - IV. - November and December of 2002; Asesoria especializada en seguridad radiologica a la clinica periferica Reforma, PEMEX.- IV.- Noviembre y Diciembre de 2002

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A; Hernandez C, J E; Rodriguez A, F; Garcia A, J

    2003-02-15

    The Reforma peripheral clinic, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray quipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the clinic can conserve its respective sanitary license.(Author)

  6. Specialized consultant in radiological safety to the Macuspana peripheral clinic, PEMEX. - IV. - November and December of 2002; Asesoria especializada en seguridad radiologica a la clinica periferica Macuspana, PEMEX.- IV.- Noviembre y Diciembre de 2002

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A.; Hernandez C, J. E.; Garcia A, J.; Rodriguez A, F

    2003-02-15

    The Macuspana peripheral clinic, dependent of PEMEX, It request consultant of the ININ to be able to maintain their sanitary license for the use of X-ray equipment for the radiologic diagnostic.The proposal of the ININ was to be a program of technical attendance, schedule monthly to be able to solve the observations that are presented in the use of those equipment, and that the clinic can conserve its respective sanitary license.(Author)

  7. Temporal evolution of the environmental dose remaining in a clinical irradiation bunker after the cessation of irradiation; Evolucion temporal de la Dosis ambiental remanente en un bunker de irradiacion clinica tras el cese de la irradiacion

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Egea, E.; Sanchez Carrascal, M.; Torres Pozas, S.; Monja Ray, P. de la; Perez Molina, J. L.; Madan Rodriguez, C.; Luque Japon, L.; Morera Molina, A.; Hernandez Perez, A.; Barquero Bravo, Y.; Morengo Pedagna, I.; Oliva Gordillo, M. C.; Martin Olivar, R.

    2011-07-01

    In this paper we try to quantify the dose emitted by different radioactive processes that occur in the head of a clinical linear accelerator and the patient is irradiated, or walls of the bunker, converted into tertiary sources of radiation trying to establish the origin of the came in different parts of the bunker.

  8. Clinical and morphologic evaluation of Er:YAG laser action at the front of cervical dentinal hypersensitivity; Avaliacao clinica e morfologica da acao do laser de Er:YAG frente a hipersensibilidade dentinaria cervical

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, Dalva Maria

    2001-07-01

    This work was achieved in vivo and in vitro to evaluate the efficiency of Er:YAG laser in the cervical dentinal hypersensitivity treatment (HSDC). The Clinical study was achieved in patients with HSDC. The treatment was realized in five sessions: the first for selection, the second for exams (clinic and X-Ray) and trying to remove the etiologic factors that could cause the HSDC. The third and fourth sessions were subjected to the radiation with that protocol: 60 mJ energy ,2 Hz frequency, 6 mm out of focus, under air cooling, 20 seconds each application which the same was repeated four times with one minute breaks, which scanning movements and without using anaesthetics. The fifth was evaluation. The patients were evaluated and registered in a subject scale of pain 0 to 3, in the beginning and end of each session of irradiation, and one month after the last session. The results showed that for the irradiated group occurs significant differences in the beginning of each session and between. For the control group did not occur significant differences in the beginning and after each session, but did show a difference between the sessions. As the control group as the irradiated group, had reduction of sensibility between the session. For the morphologic study nine teeth were selected, 7 molars and 2 pre-molars from operative dentistry discipline. Half of the surface was irradiated with Er:YAG laser, the same protocol used in vivo, and the other half was used as a control without receiving any laser irradiation. Subsequently, specimens were prepared for SEM examinations. The results showed that laser treated surfaces showed a reduction of dentine tubular diameter with partial or total closure of the dentine tubules. For the control group, it was observed bigger amounts smear layer and open dentine tubular. The results obtained indicated that the Er:YAG laser can contribute to the HSDC treatment. (author)

  9. Nd:YAG laser in caries prevention: a clinical study; Avaliacao clinica da eficiencia do laser de Nd:YAG associado ao fluor fosfato acidulado na prevencao de caries de sulcos e fissuras de criancas e adolescentes

    Energy Technology Data Exchange (ETDEWEB)

    Boari, Heloisa Gomes Dimiranda

    2000-07-01

    The caries prevention by using laser irradiation has been investigated during the last 30 years. The Nd: YAG laser associated with acidulated phosphate fluoride has been shown as a very promising technique for enamel caries prevention. The aim of this work was to clinically evaluate the efficiency of Nd: YAG laser associated with acidulated phosphate fluoride in pit and fissure caries prevention of children and adolescents. In this work it was determined the dye that enhance the effect of Nd: YAG laser in enamel. It was selected 242 pre-molar and molar teeth from 33 children and adolescents, aged from 7 to 15 years old. The selected teeth were free from caries or decalcification marks (active white marks) to the clinical and radiographic exams. The teeth were divided into two groups: the first group was laser irradiated and their homologous remained as a control. The right side teeth were dye-assisted Nd:YAG laser irradiated. The dye solution was a moisture of dust coal and equal parts of water and alcohol. The irradiation conditions were 60 mJ/10 Hz, optical fiber in contact mode, with diameter of 300 {mu}m, resulting in an energy density of 84,9 J/cm{sup 2}. The oclusal surface of the teeth was completely irradiated, specially on the slopes and in the deepest part of the pits and fissures. This procedure was repeated three times. In the sequence it was applied the acidulated phosphate fluoride for 4 minutes. On the left side teeth - control group- only acidulated phosphate fluoride was applied for the same time. The final examination considered the presence of caries and active white marks after a period of one year. There were statistical significant differences (p < 0.01) between the lased + fluoride group and the non irradiated group. The present study concluded that the technique used in this work can be an alternative clinical method for caries prevention. (author)

  10. Influence of the curve density relative electron in dosimetry clinic in treatments stereo tactics; Influencia de la curva de densidad electronica relativa en la dosimetria clinica en tratamientos estereotaxicos

    Energy Technology Data Exchange (ETDEWEB)

    Moreno Saiz, C.; Benitez Villegas, E. M.; Casado Villalon, F. J.; Parra Osorio, V.; Bodineau Gil, C.; Garcia Pareja, S.

    2013-07-01

    The objective of this study is to analyze the difference between clinical dosimetry in the treatments with radiosurgery and stereotactic radiotherapy fractional obtained from the relative Electron density curve (Schneider 1996) tabulated and provided with the scanner's radiation therapy. (Author)

  11. Dosimetry characterization and clinical application of Exa skin: Bolus of high of high density for use with photons; Caracterizacion dosimetrica y aplicacion clinica de Exaskin: bolus de alta densidad para uso con fotones

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz Seidel, M.; Velazquez Miranda, S.

    2013-07-01

    Bolus of high density eXaSkin of density 1.6 g/cm{sub 3} is calculated correctly in the planning systems, is easy to use and generates optimum coupling with the radiation area, at the same time which is easily reproducible in their placement, avoiding the use of electron beams. On the other hand its behavior varies very slightly with the presence of air gaps. (Author)

  12. Accounting of costs in a service of physical health. Relative units of value in dosimetry clinic in teletherapy; Contabilidad de costes en un servicio de fisica medica. Unidades relativas de valor en dosimetria clinica en teleterapia

    Energy Technology Data Exchange (ETDEWEB)

    Font Gomez, J. A.; Gandia Martinez, A.; Jimenez Albericio, F. J.; Andres Redondon, M. M.; Mengual Gil, M. A.

    2013-07-01

    A single - although laborious - start in the economic and clinical management of our units can be come to the knowledge of the time invested in the tasks functional, having to differentiate them, name them and even encrypt them. The time spent in performing the tasks multiplied by the annual number of these will indicate the resources necessary to achieve our objectives. In addition, pooling the values of times that members of the Unit provide analysed inter-workers dispersal, their causes and possible solutions. The establishment of relative units of value in any process benefits all workers involved in the process since it allows to know the dispersion of the times that each person employed in the development of the tasks. (Author)

  13. Use of clinical practice as a motivating tool of radioprotection teaching and radiopharmacology in early semesters of pharmacy course; Uso da pratica clinica como ferramenta motivadora de ensino de radioprotecao e radiofarmacologia em semestres iniciais em cursos de farmacia

    Energy Technology Data Exchange (ETDEWEB)

    Andrighetto, Daniela; Lüdke, Everton, E-mail: daniela.andrighetto@hotmail.com, E-mail: evertonludke@gmail.com [Universidade Federal de Santa Maria (CCNE/DEFIS/UFSM), RS (Brazil). Departamento de Fisica

    2014-07-01

    The research teaching methods aimed at the success of the higher education student in pharmacology and medicine courses in technical expertise in the fields of radiological protection, radiopharmacology and interventional radiology is extremely important in view of the progress of these sectors. The objective of this work is to propose a methodological sequence of teaching work with first-year students of pharmacy and medicine courses within a biophysical discipline where the integrated knowledge to clinical practice can be used for this purpose. The methodology was to assess individual learning of a group of N = 49 students of the first half in the age group of 17-19 years through conceptual acquisition by the traditional method of 'blackboard and chalk' and developed method that includes four pedagogical moments focused on the area health. An analysis of the evaluation student performance through Variance Analysis of a pathway showed improved scores with respect to the performance of application issues of knowledge concerning radiation protection and biological mechanisms of radiation with respect to the method of 'blackboard and chalk' with p < 0.05. Therefore, work with students with respect to the content in the form of six steps of clinical interest are a promising technique for radiation protection education in the early grades of college courses with experimental effectiveness.

  14. Caracterização do perfil de colonização oral por Candida spp. em pacientes submetidos a transplante de celulas progenitoras hematopoieticas no Hospital de Clinicas da UNICAMP

    OpenAIRE

    Monica Leal Alcure

    2006-01-01

    Resumo: As infecções superficiais e sistêmicas provocadas por Candida são freqüentes causas de morbidade e mortalidade em pacientes submetidos a transplante de células progenitoras hematopoiéticas (TCPH). Entre os fatores de risco destaca-se a colonização prévia a qual parece ser um pré-requisito para o desenvolvimento de infecção. Desta forma, a cavidade oral pode atuar como um reservatório para esses microorganismos. O presente estudo teve como objetivo avaliar, prospectivamente, o fluxo sa...

  15. Dissection of the sentry ganglion by laparoscopic boarding in patients with cervix uterine cancer clinical stages IA2 at IIB; Diseccion de ganglio centinela por abordaje laparoscopico en pacientes con cancer cervicouterino etapas clinicas IA2 a IIB

    Energy Technology Data Exchange (ETDEWEB)

    Valdez U, J J; Pichardo M, P A; Cortes M, G; Escudero de los Rios, P. [Hospital de Oncologia. Centro Medico Nacional Siglo XXI. IMSS, Mexico D.F. (Mexico)

    2005-07-01

    The obtained results in presently study demonstrate that the feasibility of the detection of the sentry ganglion in cervix uterine cancer using a boarding by laparoscopic via, being necessary the use of twice labelled as much with patent blue and radioisotope (colloid of labelled rhenium with {sup 99m}Tc, total dose of 3 MCi) to achieve the identification of the ganglion. (Author)

  16. PET/MRI: a novel hybrid imaging technique: major clinical indications and preliminary experience in Brazil; PET/RM: um novo metodo de imagem hibrida: principais indicacoes clinicas e experiencia preliminar no Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Vitor, Taise; Martins, Karine Minaif; Ionescu, Tudor Mihai and others, E-mail: taisevitor@gmail.com [Hospital Israelita Albert Einstein, Sao Paulo, SP (Brazil)

    2017-04-01

    In recent years, medical imaging with hybrid techniques has widely accepted and employed in clinical routine. PET/MRI offers significant advantages, including excellent contrast and resolution and reduced ionizing radiation, as compared to well-established PET/ CT. Therefore, PET/MRI is a promising modality for oncologic imaging of some regions, such as brain, head and neck, liver and pelvis. This article set out to analyze clinical conditions that could benefit from PET/MRI imaging based on our caseload. The potential of PET/MRI to become the imaging modality of choice for assessment of neurologic and oncologic conditions associated with soft tissues is highlighted. Clinical aspects of PET/MRI and its application to clinical cases are illustrated with examples extracted from the authors' preliminary experience. (author)

  17. Spatial map dose of nuclear medicine service of the Clinical Hospital of Botucatu, SP, Brazil; Mapa espacial de dose do servico de medicina nuclear do Hospital das Clinicas de Botucatu

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Caio V.; Mendonca, Caroline; Silva, Eduardo T.; Moriguchi, Sonia M.; Koga, Katia H., E-mail: caiov_oliveira@yahoo.com.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Faculdade de Medicina

    2013-12-15

    This study was conducted to describe levels of occupational and environmental exposure of the Nuclear Medicine Service of the Clinical Hospital of Botucatu. To this end, measurements were made of the radiometric levels of points strategically defined, in all the environments, for a period of six months, sampling different days and times, during operation normal routine of the sector. The results allow to estimate the expected dose for each environment, comparing them to the dose limitation established by the National Commission of Nuclear Energy (CNEN), allowing better targeting of occupationally exposed individuals, indicating the points where the occupation should be the minimum required, enabling the reduction of risks to potential exposures. (author)

  18. Acessibilidade do paciente à clinica de especialidades de endodontia: estudo dirigido dos inscritos aguardando em fila de espera, nos distritos de saúde Boa Vista e Cajuru do Município de Curitiba-PR

    OpenAIRE

    Wellington Menyrval Zaitter

    2009-01-01

    Inquéritos nacionais de saúde bucal indicam que uma parcela da população brasileira nunca passou por uma consulta com o cirurgião-dentista. Os motivos são variados, desde a falta de percepção desta necessidade até mesmo a dificuldade de acesso aos serviços de saúde. No Brasil o atendimento odontológico predominante é através do Sistema Único de Saúde que tem nas unidades básicas de saúde a porta de entrada a diversos serviços. Através da consulta odontológica o paciente é referendado a especi...

  19. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30248965 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

  20. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30250266 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

  1. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30249984 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

  2. Biological control of olive fruit fly in California – release, establishment and impact of Psyttalia lounsburyi and Psyttalia humilis

    Science.gov (United States)

    The invasive olive fruit fly Bactrocera oleae (Rossi) (Diptera: Tephritidae) likely originated in sub-Saharan Africa, where the wild olive Olea europaea cuspidata L. (Wall. ex G. Don) is found and from which the domesticated olive O. europaea europaea L. was derived. Following the path of olive cult...

  3. LOX Gene Transcript Accumulation in Olive (Olea europaea L. Fruits at Different Stages of Maturation: Relationship between Volatile Compounds, Environmental Factors, and Technological Treatments for Oil Extraction

    Directory of Open Access Journals (Sweden)

    Innocenzo Muzzalupo

    2012-01-01

    Full Text Available The quality of olive oil is influenced by genetic and environmental factors and by the maturation state of drupes, but it is equally affected by technological treatments of the process. This work investigates the possible correlation between olive LOX gene transcript accumulation, evaluated in fruits collected at different stages of maturation, and chemical biomarkers of its activity. During olive fruit ripening, the same genotype harvested from two different farms shows a positive linear trend between LOX relative transcript accumulation and the content of volatile compounds present in the olive oil aroma. Interestingly, a negative linear trend was observed between LOX relative transcript accumulation and the content of volatile compounds present in the olive pastes obtained from olive fruits with and without malaxation. The changes in the olive LOX transcript accumulation reveal its environmental regulation and suggest differential physiological functions for the LOXs.

  4. Effect of irrigation, nitrogen application, and a nitrification inhibitor on nitrous oxide, carbon dioxide and methane emissions from an olive (Olea europaea L.) orchard

    Energy Technology Data Exchange (ETDEWEB)

    Maris, S.C., E-mail: stefania@macs.udl.cat [University of Lleida, Environment and Soil Science Department, Av. Alcalde Rovira Roure 191, E-25198 Lleida (Spain); Teira-Esmatges, M.R. [University of Lleida, Environment and Soil Science Department, Av. Alcalde Rovira Roure 191, E-25198 Lleida (Spain); Arbonés, A.; Rufat, J. [Programa Ús Eficient de l’Aigua, Institut de Recerca i Tecnologia Agroalimentàries (IRTA), Parc Científic i Tecnològic Agroalimentari de Lleida (PCiTAL). Parc de Gardeny, Edifici Fruitcentre, E-2503 Lleida (Spain)

    2015-12-15

    Drip irrigation combined with nitrogen (N) fertigation is applied in order to save water and improve nutrient efficiency. Nitrification inhibitors reduce greenhouse gas emissions. A field study was conducted to compare the emissions of nitrous oxide (N{sub 2}O), carbon dioxide (CO{sub 2}) and methane (CH{sub 4}) associated with the application of N fertiliser through fertigation (0 and 50 kg N ha{sup −1}), and 50 kg N ha{sup −1} + nitrification inhibitor in a high tree density Arbequina olive orchard. Spanish Arbequina is the most suited variety for super intensive olive groves. This system allows reducing production costs and increases crop yield. Moreover its oil has excellent sensorial features. Subsurface drip irrigation markedly reduced N{sub 2}O and N{sub 2}O + N{sub 2} emissions compared with surface drip irrigation. Fertiliser application significantly increased N{sub 2}O + N{sub 2}, but not N{sub 2}O emissions. Denitrification was the main source of N{sub 2}O. The N{sub 2}O losses (calculated as emission factor) ranging from − 0.03 to 0.14% of the N applied, were lower than the IPCC (2007) values. The N{sub 2}O + N{sub 2} losses were the largest, equivalent to 1.80% of the N applied, from the 50 kg N ha{sup −1} + drip irrigation treatment which resulted in water filled pore space > 60% most of the time (high moisture). Nitrogen fertilisation significantly reduced CO{sub 2} emissions in 2011, but only for the subsurface drip irrigation strategies in 2012. The olive orchard acted as a net CH{sub 4} sink for all the treatments. Applying a nitrification inhibitor (DMPP), the cumulative N{sub 2}O and N{sub 2}O + N{sub 2} emissions were significantly reduced with respect to the control. The DMPP also inhibited CO{sub 2} emissions and significantly increased CH{sub 4} oxidation. Considering global warming potential, greenhouse gas intensity, cumulative N{sub 2}O emissions and oil production, it can be concluded that applying DMPP with 50 kg N ha{sup −1} + drip irrigation treatment was the best option combining productivity with keeping greenhouse gas emissions under control. - Highlights: • Subsurface drip irrigation mitigated N{sub 2}O emission compared with drip irrigation. • Nitrogen application didn't increase N{sub 2}O–N nor (N{sub 2}O + N{sub 2})–N emissions. • The olive orchard acted as a net CH{sub 4} sink for all the treatments. • DMPP reduced the cumulative N{sub 2}O, N{sub 2}O + N{sub 2} and CO{sub 2} emission compared to the control. • The N50 + DI + DMPP treatment reduced emissions at a high yield (2737 kg oil ha{sup −1}).

  5. The Role of Polyphenoloxidase, Peroxidase, and β-Glucosidase in Phenolics Accumulation in Olea europaea L. Fruits under Different Water Regimes

    Directory of Open Access Journals (Sweden)

    Marco Cirilli

    2017-05-01

    Full Text Available Olive fruits and oils contain an array of compounds that contribute to their sensory and nutritional properties. Phenolic compounds in virgin oil and olive-derived products have been proven to be highly beneficial for human health, eliciting increasing attention from the food industry and consumers. Although phenolic compounds in olive fruit and oil have been extensively investigated, allowing the identification of the main classes of metabolites and their accumulation patterns, knowledge of the molecular and biochemical mechanisms regulating phenolic metabolism remains scarce. We focused on the role of polyphenoloxidase (PPO, peroxidase (PRX and β-glucosidase (β-GLU gene families and their enzyme activities in the accumulation of phenolic compounds during olive fruit development (35–146 days after full bloom, under either full irrigation (FI or rain-fed (RF conditions. The irrigation regime affected yield, maturation index, mesocarp oil content, fruit size, and pulp-to-pit ratio. Accumulation of fruit phenolics was higher in RF drupes than in FI ones. Members of each gene family were developmentally regulated, affected by water regime, and their transcript levels were correlated with the respective enzyme activities. During the early phase of drupe growth (35–43 days after full bloom, phenolic composition appeared to be linked to β-GLU and PRX activities, probably through their effects on oleuropein catabolism. Interestingly, a higher β-GLU activity was measured in immature RF drupes, as well as a higher content of the oleuropein derivate 3,4-DHPEA-EDA and verbascoside. Activity of PPO enzymes was slightly affected by the water status of trees during ripening (from 120 days after full bloom, but was not correlated with phenolics content. Overall, the main changes in phenolics content appeared soon after the supply of irrigation water and remained thereafter almost unchanged until maturity, despite fruit growth and the progressive decrease in pre-dawn leaf water potential. We suggest that enzymes involved in phenolic catabolism in the olive fruit have a differential sensitivity to soil water availability depending on fruit developmental stage.

  6. Evaluation of Chlorophyll Content and Chlorophyll Fluorescence Parameters and Relationships between Chlorophyll a, b and Chlorophyll Content Index under Water Stress in Olea europaea cv. Dezful

    OpenAIRE

    E. Khaleghi; K. Arzani; N. Moallemi; M. Barzegar

    2012-01-01

    This study was conducted to determine effect of water stress on chlorophyll content and chlorophyll fluorescence parameter in young `Dezful- olive trees. Three irrigation regimes (40% ETcrop, 65% ETcrop and 100% ETcrop) were used. After irrigation treatments were applied, some of biochemical parameters including chlorophyll a, b, total chlorophyll, chlorophyll fluorescence and also chlorophyll content index (C.C.I) were measured. Results of Analysis of variance showed that irrigation treatmen...

  7. Fatty acid profiles of varietal virgin olive oils (Olea europaea L. from mature orchards in warm arid valleys of Northwestern Argentina (La Rioja

    Directory of Open Access Journals (Sweden)

    Rousseaux, M. C.

    2011-12-01

    Full Text Available The olive industry in Northwestern Argentina has experienced substantial growth during the past two decades to produce virgin olive oil for export. To assess the fatty acid profiles of the main varietal olive oils, 563 oil samples from 17 varieties cultivated in the province of La Rioja were analyzed from 2005-2008. Olive varieties were ranked according to oleic acid content as low (65%; Manzanilla, Empeltre, Leccino, Coratina, Changlot, Picual. Using data from this study and the literature, the fatty acid composition of Spanish (Arbequina, Picual and Italian (Coratina, Frantoio varieties indicated consistently lower oleic acid contents when grown in NW Argentina versus the Mediterranean. For Arbequina, the oleic content decreased with increasing temperature during oil accumulation (-2% per °C. The classification of varieties should be useful in the selection of virgin olive oils for corrective blending and for choosing varieties for new orchards in order to meet IOOC requirements. The differences in fatty acid composition between NW Argentina and the Mediterranean Basin are most likely to be related to a genotype produced by environmental interaction, and the negative effect of the high seasonal mean temperature during oil accumulation will need further research.La industria oleícola del noroeste de Argentina creció sustancialmente durante las últimas dos décadas para producir aceite de oliva virgen exportable. Para evaluar el perfil de ácidos grasos de los principales aceites varietales, se analizaron 563 muestras de aceite de 17 variedades en la provincia de La Rioja durante 2005-2008. Las variedades se clasificaron de acuerdo a su contenido de ácido oleico en bajo (65%; Manzanilla, Empeltre, Leccino, Coratina, Changlot, Picual. Utilizando datos de este trabajo y de la literatura, los aceites de variedades de origen español (Arbequina y Picual e italiano (Coratina y Frantoio mostraron consistentemente menor contenido de ácido oleico cuando crecieron en el noroeste de Argentina versus el Mediterráneo. Para Arbequina, el contenido de oleico disminuyó con la temperatura durante la síntesis y acumulación lipídica (-2 % por °C. La clasificación varietal por acido oleico debe ser útil para seleccionar aceites para mezclas correctivas y variedades para futuras plantaciones que cumplan con la normativa del COI. Diferencias en los perfiles de ácidos grasos entre el noroeste de Argentina y el Mediterráneo indican una interacción genotipo x ambiente, y el efecto negativo de la alta temperatura media estacional durante la síntesis de lípidos requerirá mayor investigación.

  8. Identification of Predominant Phytochemical Compounds and Cytotoxic Activity of Wild Olive Leaves (Olea europaea L. ssp. sylvestris) Harvested in South Portugal.

    Science.gov (United States)

    Makowska-Wąs, Justyna; Galanty, Agnieszka; Gdula-Argasińska, Joanna; Tyszka-Czochara, Małgorzata; Szewczyk, Agnieszka; Nunes, Ricardo; Carvalho, Isabel S; Michalik, Marta; Paśko, Paweł

    2017-03-01

    This study has been aimed at providing a qualitative and quantitative evaluation of selected phytochemicals such as phenolic acids, flavonoids, oleuropein, fatty acids profile, and volatile oil compounds, present in wild olive leaves harvested in Portugal, as well as at determining their antioxidant and cytotoxic potential against human melanoma HTB-140 and WM793, prostate cancer DU-145 and PC-3, hepatocellular carcinoma Hep G2 cell lines, as well as normal human skin fibroblasts BJ and prostate epithelial cells PNT2. Gallic, protocatechuic, p-hydroxybenzoic, vanillic acids, apigenin 7-O-glucoside, luteolin 7-O-glucoside, and rutin were identified in olive leaves. The amount of oleuropein was equal to 22.64 g/kg dry weight. (E)-Anethole (32.35%), fenchone (11.89%), and (Z)-3-nonen-1-ol (8%) were found to be the main constituents of the oil volatile fraction, whereas palmitic, oleic, and alpha-linolenic acid were determined to be dominating fatty acids. Olive leaves methanol extract was observed to exerted a significant, selective cytotoxic effect on DU-145 and PC-3 cell lines. Except the essential oil composition, evaluated wild olive leaves, with regard to their quantitative and qualitative composition, do not substantially differ from the leaves of other cultivars grown for industrial purposes and they reveal considerable antioxidant and cytotoxic properties. Thus, the wild species may prove to be suitable for use in traditional medicine as cancer chemoprevention. © 2017 Wiley-VHCA AG, Zurich, Switzerland.

  9. Caracterización de las enzimas esterasas implicadas en la interacción polen-pistilo en el olivo (Olea Europaea L.)

    OpenAIRE

    Rejón García, Juan David

    2013-01-01

    El éxito de la fertilización en las Angiospermas depende en gran medida de la capacidad del polen para germinar y emitir un tubo polínico, el cuál transporta los núcleos espermáticos a través del pistilo hasta el saco embrionario. En este contexto, los objetivos de este proyecto fueron: 1) determinar la existencia de actividad esterolítica en el polen de olivo, 2) identificar y clasificar desde el punto de vista funcional las distintas enzimas esterasas, 3) determinar las funciones del exudad...

  10. BACTÉRIAS DIAZOTRÓFICAS NÃO SIMBIÓTICAS E ENRAIZAMENTO DE ESTACAS SEMILENHOSAS DE OLIVEIRA (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Talita Filomena Silva

    2017-01-01

    Full Text Available Non-symbiotic diazotrophic bacteria (NSDB influence plant growth mainly through biological nitrogenfixation and production and release of plant growth-regulating substances. The effect of these bacteria on rooting of olive is not described in the international literature, which has been provided by the use of hormonal treatment based on indole butyric acid (IBA. The purpose of this study was to evaluate the physiological diversity of isolates obtained from soil samples of the Biological Reserve Serra dos Toledos, Itajubá, MG state, and of reference strains of NSDB, and their potential of substitution of IBA on rooting of olive semi-hardwood cuttings from the experimental farm ‘Maria da Fé’ (FEMF-EPAMIG. The isolates were divided into five groups (G1 to G5 according with cultural phenotypic characteristics based on color, diameter and consistence of colonies, and reference strains used were Azospirillum brasilense (BR11001 t , Azospirillum amazonense (BR11040 t , Herbaspirillum seropedicae (BR11175 t and Burkholderia brasilensis (BR11340 t . The diversity of physiological was performed using phosphate solubilization, tolerance to different conditions of temperature and pH and production of indole acetic acid (IAA. To evaluate the potential of semi-hardwood cuttings rooting in olive cultivars were used the cultivars Ascolano 315, Arbequina and Grappolo 541, from the germoplasm blank of the FEMF-EPAMIG. There were 33 treatments, and the cuttings were inoculated with the bacterial isolate groups, with the reference strains, without inoculation (control and only IBA, commercially used in rooting. Only two isolates showed ability to solubilize phosphate. Groups of isolates and of reference strains showed very similar environmental requirements, with wide ranges of optimum conditions of pH (5,0-9,0 and temperature (15-35ºC for maximum growth. The isolates and reference strains showed a production IAA ranging from 110.53 to 383.58 μg mL -1 , and the groups of isolates generally did not differ significantly from the values obtained by reference strains. All the groups of isolates present potential of rooting of olive cuttings, and those of groups 1 and 4 are more indicated to Arbequina, group 2 to Grappolo 541 and groups 1 and 5 to Ascolano 315, with performances similar to those obtained from IBA.

  11. Effects of Olea europaea L. Leaf Metabolites on the Tilapia (Oreochromis niloticus and Three Stored Pests, Sitophilus granarius, Tribolium confusum and Acanthoscelides obtectus

    Directory of Open Access Journals (Sweden)

    Ahmet Kısa

    2018-05-01

    Full Text Available Olea europea L. emerged as a good source of traditional medicine for the treatment of various ailments of various countries of the world, in particular Mediterranean countries. In this study, oleuropein (1, oleanolic acid (2, maslinic acid (3, a mixture of erythrodiol and uvaol (4 and 5 isolated from the leaves of olive were added at two concentrations (1g/100g feed and 4g/100 g feed into fish feed. Oreochromis niloticus (Nile tilapia were fed twice a day with the feed during 96 hours. The levels of alanine aminotransferase (ALT, aspartate aminotransferase (AST, alkaline phosphatase (ALP enzymes and glucose levels in the serums of fishes fed with pure compounds were found to be higher as compared with the control group. Pure metabolites affect the liver metabolism of Nile tilapia. These results suggested that the compounds tested affect the liver metabolism of Nile tilapia. Compounds 1, 2, 3 and 4+5 (2.5, 5.0 and 7.5 mg/Petri dish concentrations were also tested for contact toxic effects against three important stored pests, Sitophilus granarius (weevil, Tribolium confusum (confused flour beetle and Acanthoscelides obtectus (bean weevil. The toxic effects of the metabolites were lower than those of the insecticide, dichlorvos (DDVP. DDVP caused complete mortality of the insects after 48 hours of treatments, the metabolites caused the mortality rates 16.7-63.3 %, 13.3-67.0 % and 26.7-59.0 % of S. granarius, T. confusum and A. obtectus, respectively. Maslinic acid (3 has the most toxic compound with the lowest LC 50 values (0.66 mg/Petri, 0.61 mg/Petri and 1.71 mg/Petri for S. granarius, T. confusum and A. obtectus, respectively. These results show that maslinic acid (3 as well as other substances can be used as natural insecticides against these pests.

  12. Cuantificación de diazótrofos en la rizósfera del olivo (Olea europaea L. cultivado en Boyacá, Colombia

    Directory of Open Access Journals (Sweden)

    Oscar Fernando Bello Alvarez

    2016-04-01

    Full Text Available La investigación desarrollada tuvo como objeto cuantificar y determinar la actividad de las unidades formadoras de colonias de microorganismos fijadores de nitrógeno asociados a la rizósfera de árboles de olivo, plantados en el municipio de Sutamarchán, finca las Acacias de la provincia del Alto Ricaurte. Se utilizó un diseño en bloques con submuestras, teniendo como tratamientos la poda y el crecimiento libre; se usaron seis unidades experimentales (árboles tres por tratamiento, los árboles eran jóvenes (

  13. Phenological models to predict the main flowering phases of olive ( Olea europaea L.) along a latitudinal and longitudinal gradient across the Mediterranean region

    Science.gov (United States)

    Aguilera, Fátima; Fornaciari, Marco; Ruiz-Valenzuela, Luis; Galán, Carmen; Msallem, Monji; Dhiab, Ali Ben; la Guardia, Consuelo Díaz-de; del Mar Trigo, María; Bonofiglio, Tommaso; Orlandi, Fabio

    2015-05-01

    The aim of the present study was to develop pheno-meteorological models to explain and forecast the main olive flowering phenological phases within the Mediterranean basin, across a latitudinal and longitudinal gradient that includes Tunisia, Spain, and Italy. To analyze the aerobiological sampling points, study periods from 13 years (1999-2011) to 19 years (1993-2011) were used. The forecasting models were constructed using partial least-squares regression, considering both the flowering start and full-flowering dates as dependent variables. The percentages of variance explained by the full-flowering models (mean 84 %) were greater than those explained by the flowering start models (mean 77 %). Moreover, given the time lag from the North African areas to the central Mediterranean areas in the main olive flowering dates, the regional full-flowering predictive models are proposed as the most useful to improve the knowledge of the influence of climate on the olive tree floral phenology. The meteorological parameters related to the previous autumn and both the winter and the spring seasons, and above all the temperatures, regulate the reproductive phenology of olive trees in the Mediterranean area. The mean anticipation of flowering start and full flowering for the future period from 2081 to 2100 was estimated at 10 and 12 days, respectively. One question can be raised: Will the olive trees located in the warmest areas be northward displaced or will they be able to adapt their physiology in response to the higher temperatures? The present study can be considered as an approach to design more detailed future bioclimate research.

  14. Target molecules in 3T3-L1 adipocytes differentiation are regulated by maslinic acid, a natural triterpene from Olea europaea.

    Science.gov (United States)

    Pérez-Jiménez, Amalia; Rufino-Palomares, Eva E; Fernández-Gallego, Nieves; Ortuño-Costela, M Carmen; Reyes-Zurita, Fernando J; Peragón, Juan; García-Salguero, Leticia; Mokhtari, Khalida; Medina, Pedro P; Lupiáñez, José A

    2016-11-15

    Metabolic syndrome is a set of pathologies among which stand out the obesity, which is related to the lipid droplet accumulation and changes to cellular morphology regulated by several molecules and transcription factors. Maslinic acid (MA) is a natural product with demonstrated pharmacological functions including anti-inflammation, anti-tumor and anti-oxidation, among others. Here we report the effects of MA on the adipogenesis process in 3T3-L1 cells. Cell viability, glucose uptake, cytoplasmic triglyceride droplets, triglycerides quantification, gene transcription factors such as peroxisome proliferator-activated receptor γ (PPARγ) and adipocyte fatty acid-binding protein (aP2) and intracellular Ca 2+ levels were determined in pre-adipocytes and adipocytes of 3T3-L1 cells. MA increased glucose uptake. MA also decreased lipid droplets and triglyceride levels, which is in concordance with the down-regulation of PPARγ and aP2. Finally, MA increased the intracellular Ca 2+ concentration, which could also be involved in the demonstrated antiadipogenic effect of this triterpene. MA has been demonstrated as potential antiadipogenic compound in 3T3-L1 cells. Copyright © 2016 Elsevier GmbH. All rights reserved.

  15. A defence-related Olea europaea β-glucosidase hydrolyses and activates oleuropein into a potent protein cross-linking agent.

    Science.gov (United States)

    Koudounas, Konstantinos; Banilas, Georgios; Michaelidis, Christos; Demoliou, Catherine; Rigas, Stamatis; Hatzopoulos, Polydefkis

    2015-04-01

    Oleuropein, the major secoiridoid compound in olive, is involved in a sophisticated two-component defence system comprising a β-glucosidase enzyme that activates oleuropein into a toxic glutaraldehyde-like structure. Although oleuropein deglycosylation studies have been monitored extensively, an oleuropein β-glucosidase gene has not been characterized as yet. Here, we report the isolation of OeGLU cDNA from olive encoding a β-glucosidase belonging to the defence-related group of terpenoid-specific glucosidases. In planta recombinant protein expression assays showed that OeGLU deglycosylated and activated oleuropein into a strong protein cross-linker. Homology and docking modelling predicted that OeGLU has a characteristic (β/α)8 TIM barrel conformation and a typical construction of a pocket-shaped substrate recognition domain composed of conserved amino acids supporting the β-glucosidase activity and non-conserved residues associated with aglycon specificity. Transcriptional analysis in various olive organs revealed that the gene was developmentally regulated, with its transcript levels coinciding well with the spatiotemporal patterns of oleuropein degradation and aglycon accumulation in drupes. OeGLU upregulation in young organs reflects its prominent role in oleuropein-mediated defence system. High gene expression during drupe maturation implies an additional role in olive secondary metabolism, through the degradation of oleuropein and reutilization of hydrolysis products. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  16. Environmental effects on proline accumulation and water potential in olive leaves (Olea europaea L. (cv Chemlali)) under saline water irrigated field conditions

    Energy Technology Data Exchange (ETDEWEB)

    Ben Ahmed, C.; Ben Rouina, B.; Boukhris, M.

    2009-07-01

    In arid regions in Tunisia suffering from limited water resources, the olive extension to irrigated lands has led to the urgent use of saline water, the most readily available water in the these areas. Nevertheless, the effects of salt stress on olive tree seem to be reinforced by environmental conditions. The issue of this paper is to determine how does the olive tree respond to environmental stress in the Mediterranean climate under saline water irrigated field conditions with respect to leaf proline concentrations and water Status. (Author)

  17. Heat requirement for the onset of the Olea europaea L. pollen season in several sites in Andalusia and the effect of the expected future climate change

    Science.gov (United States)

    Galán, C.; García-Mozo, H.; Vázquez, L.; Ruiz, L.; Guardia, C. Díaz; Trigo, M. M.

    2005-01-01

    Olives are one of the largest crops in the Mediterranean region, especially in Andalusia, in southern Spain. A thermal model has been developed for forecasting the start of the olive tree pollen season at five localities in Andalusia: Cordoba, Priego, Jaen, Granada and Malaga using airborne pollen and meteorological data from 1982 to 2001. Threshold temperatures varied between 5°C and 12.5°C depending on bio-geographical characteristics. The external validity of the results was tested using the data for the year 2002 as an independent variable and it confirmed the model’s accuracy with only a few days difference from predicted values. All the localities had increasingly earlier start dates during the study period. This could confirm that olive flower phenology can be considered as a sensitive indicator of the effects of climate fluctuations in the Mediterranean area. The theoretical impact of the predicted climatic warming on the olive’s flowering phenology at the end of the century is also proposed by applying Regional Climate Model data. A general advance, from 1 to 3 weeks could be expected, although this advance will be more pronounced in mid-altitude inland areas.

  18. Fatty acid composition of oil obtained from irradiated and non-irradiated whole fruit and fruit flesh of olives (Olea europaea L. 

    Directory of Open Access Journals (Sweden)

    Mahfouz  Al-BACHIR

    2016-08-01

    Full Text Available This study aimed to investigate the fatty acid profile of olive oil extracted from whole fruit and fruit flesh of "Kaissy cultivar" olives, irradiated with 0, 2 and 3 kGy doses of gamma irradiation, and stored for 0, 6 and 12 months. Results on the fatty acid profile showed that the studied oils contained mostly oleic acid (68.1570.80% followed by palmitic acid (14.38-15.89% and linoleic acid (10.3412.51%. Generally, there are slight differences in the fatty acid profile between the oil extracted from whole olives and fruit flesh, but sometime significant (p<0.05. Also, the storage time influenced to a limited extent the fatty acid profile of both type of oils. Immediately after treatment, irradiation caused a significant (p<0.01 gradual decrease in the unsaturated fatty acid content and a significant (p<0.01 saturated fatty acid content increased in virgin olive oils.

  19. OeFAD8, OeLIP and OeOSM expression and activity in cold-acclimation of Olea europaea, a perennial dicot without winter-dormancy.

    Science.gov (United States)

    D'Angeli, Simone; Matteucci, Maya; Fattorini, Laura; Gismondi, Angelo; Ludovici, Matteo; Canini, Antonella; Altamura, Maria Maddalena

    2016-05-01

    Cold-acclimation genes in woody dicots without winter-dormancy, e.g., olive-tree, need investigation. Positive relationships between OeFAD8, OeOSM , and OeLIP19 and olive-tree cold-acclimation exist, and couple with increased lipid unsaturation and cutinisation. Olive-tree is a woody species with no winter-dormancy and low frost-tolerance. However, cold-tolerant genotypes were empirically selected, highlighting that cold-acclimation might be acquired. Proteins needed for olive-tree cold-acclimation are unknown, even if roles for osmotin (OeOSM) as leaf cryoprotectant, and seed lipid-transfer protein for endosperm cutinisation under cold, were demonstrated. In other species, FAD8, coding a desaturase producing α-linolenic acid, is activated by temperature-lowering, concomitantly with bZIP-LIP19 genes. The research was focussed on finding OeLIP19 gene(s) in olive-tree genome, and analyze it/their expression, and that of OeFAD8 and OeOSM, in drupes and leaves under different cold-conditions/developmental stages/genotypes, in comparison with changes in unsaturated lipids and cell wall cutinisation. Cold-induced cytosolic calcium transients always occurred in leaves/drupes of some genotypes, e.g., Moraiolo, but ceased in others, e.g., Canino, at specific drupe stages/cold-treatments, suggesting cold-acclimation acquisition only in the latter genotypes. Canino and Moraiolo were selected for further analyses. Cold-acclimation in Canino was confirmed by an electrolyte leakage from leaf/drupe membranes highly reduced in comparison with Moraiolo. Strong increases in fruit-epicarp/leaf-epidermis cutinisation characterized cold-acclimated Canino, and positively coupled with OeOSM expression, and immunolocalization of the coded protein. OeFAD8 expression increased with cold-acclimation, as the production of α-linolenic acid, and related compounds. An OeLIP19 gene was isolated. Its levels changed with a trend similar to OeFAD8. All together, results sustain a positive relationship between OeFAD8, OeOSM and OeLIP19 expression in olive-tree cold-acclimation. The parallel changes in unsaturated lipids and cutinisation concur to suggest orchestrated roles of the coded proteins in the process.

  20. Environmental effects on proline accumulation and water potential in olive leaves (Olea europaea L. CV Chemlali)) under saline water irrigated field conditions

    International Nuclear Information System (INIS)

    Ben Ahmed, C.; Ben Rouina, B.; Boukhris, M.

    2009-01-01

    In arid regions in Tunisia suffering from limited water resources, the olive extension to irrigated lands has led to the urgent use of saline water, the most readily available water in the these areas. Nevertheless, the effects of salt stress on olive tree seem to be reinforced by environmental conditions. The issue of this paper is to determine how does the olive tree respond to environmental stress in the Mediterranean climate under saline water irrigated field conditions with respect to leaf proline concentrations and water Status. (Author)

  1. Phenolic extract from oleaster (Olea europaea var. Sylvestris) leaves reduces colon cancer growth and induces caspase-dependent apoptosis in colon cancer cells via the mitochondrial apoptotic pathway.

    Science.gov (United States)

    Zeriouh, Wafa; Nani, Abdelhafid; Belarbi, Meriem; Dumont, Adélie; de Rosny, Charlotte; Aboura, Ikram; Ghanemi, Fatima Zahra; Murtaza, Babar; Patoli, Danish; Thomas, Charles; Apetoh, Lionel; Rébé, Cédric; Delmas, Dominique; Khan, Naim Akhtar; Ghiringhelli, François; Rialland, Mickael; Hichami, Aziz

    2017-01-01

    Dietary polyphenols, derived from natural products, have received a great interest for their chemopreventive properties against cancer. In this study, we investigated the effects of phenolic extract of the oleaster leaves (PEOL) on tumor growth in mouse model and on cell death in colon cancer cell lines. We assessed the effect of oleaster leaf infusion on HCT116 (human colon cancer cell line) xenograft growth in athymic nude mice. We observed that oleaster leaf polyphenol-rich infusion limited HCT116 tumor growth in vivo. Investigations of PEOL on two human CRC cell lines showed that PEOL induced apoptosis in HCT116 and HCT8 cells. We demonstrated an activation of caspase-3, -7 and -9 by PEOL and that pre-treatment with the pan-caspase inhibitor, N-benzyloxycarbonyl-Val-Ala-Asp-fluoromethylketone (z-VAD-fmk), prevented PEOL-induced cell death. We observed an involvement of the mitochondrial pathway in PEOL-induced apoptosis evidenced by reactive oxygen species (ROS) production, a decrease of mitochondrial membrane potential, and cytochrome c release. Increase in intracellular Ca2+ concentration induced by PEOL represents the early event involved in mitochondrial dysfunction, ROS-induced endoplasmic reticulum (ER) stress and apoptosis induced by PEOL, as ruthenium red, an inhibitor of mitochondrial calcium uptake inhibited apoptotic effect of PEOL, BAPTA/AM inhibited PEOL-induced ROS generation and finally, N-acetyl-L-cysteine reversed ER stress and apoptotic effect of PEOL. These results demonstrate that polyphenols from oleaster leaves might have a strong potential as chemopreventive agent in colorectal cancer.

  2. From which soil metal fractions Fe, Mn, Zn and Cu are taken up by olive trees (Olea europaea L., cv. 'Chondrolia Chalkidikis') in organic groves?

    Science.gov (United States)

    Chatzistathis, T; Papaioannou, A; Gasparatos, D; Molassiotis, A

    2017-12-01

    Organic farming has been proposed as an alternative agricultural system to help solve environmental problems, like the sustainable management of soil micronutrients, without inputs of chemical fertilizers. The purposes of this study were: i) to assess Fe, Mn, Zn and Cu bioavailability through the determination of sequentially extracted chemical forms (fractions) and their correlation with foliar micronutrient concentrations in mature organic olive (cv. 'Chondrolia Chalkidikis') groves; ii) to determine the soil depth and the available forms (fractions) by which the 4 metals are taken up by olive trees. DTPA extractable (from the soil layers 0-20, 20-40 and 40-60 cm) and foliar micronutrient concentrations were determined in two organic olive groves. Using the Tessier fractionation, five fractions, for all the metals, were found: exchangeable, bound to carbonates (acid-soluble), bound to Fe-Mn oxides (reducible), organic (oxidizable), as well as residual form. Our results indicated that Fe was taken up by the olive trees as organic complex, mainly from the soil layer 40-60 cm. Manganese was taken up from the exchangeable fraction (0-20 cm); Zinc was taken up as organic complex from the layers 0-20 and 40-60 cm, as well as in the exchangeable form from the upper 20 cm. Copper was taken up from the soil layers 0-20 and 40-60 cm as soluble organic complex, and as exchangeable ion from the upper 20 cm. Our data reveal the crucial role of organic matter to sustain metal (Fe, Zn and Cu) uptake -as soluble complexes-by olive trees, in mature organic groves grown on calcareous soils; it is also expected that these data will constitute a thorough insight and useful tool towards a successful nutrient and organic C management for organic olive groves, since no serious nutritional deficiencies were found. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Study on analysis of potential competition and discrimination issues relating to a pilot project for an EU tax consolidation scheme for the European Company statute (Societas Europaea)

    OpenAIRE

    Deloitte

    2004-01-01

    Would a specific tax regime that i) grants to companies formed under the European Company Statute the possibility to or ii) requires companies formed under the European Company Statute to establish the consolidated tax base for their EU wide activities according to one set of rules(either European or that of their ?home state?) and does not provide this possibility for companies which are run under a different legal form discriminate against these latter companies and/or provide state aid to ...

  4. Solid-Phase Contact Assay That Uses a lux-Marked Nitrosomonas europaea Reporter Strain To Estimate Toxicity of Bioavailable Linear Alkylbenzene Sulfonate in Soil

    OpenAIRE

    Brandt, Kristian K.; Pedersen, Anders; Sørensen, Jan

    2002-01-01

    Information about in situ toxicity of the bioavailable pools of adsorptive soil pollutants is a prerequisite for proper ecological risk assessment in contaminated soils. Such toxicity data may be obtained by assays allowing for direct exposure of introduced test microorganisms to the toxicants, as they appear in solid solution equilibria in the natural soil. We describe a novel sensitive solid-phase contact assay for in situ toxicity testing of soil pollutants based on a recombinant biolumine...

  5. Cooperation-Induced Topological Complexity: A Promising Road to Fault Tolerance and Hebbian Learning

    Science.gov (United States)

    2012-03-16

    Information Science Directorate, United States Army Research Office, Durham, NC, USA 4 Istituto di Fisiologia Clinica del Consiglio Nazionale delle...Vadim Uritsky, Catholic University of America at NASA Goddard Space Flight Center, USA *Correspondence: Paolo Allegrini , Istituto di Fisiologia Clinica

  6. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Nitrosomonas europaea ATCC 19718] ... Length = 96 ... Query: 3 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDS...IDPGPAGFTGSLIV 62 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDS...IDPGPAGFTGSLIV Sbjct: 1 ... YLIYGEDVPDSLAQRVASRPAHLARIRELQEQGRLLLAGPCPAIDSIDPGPAGFTGSLIV 60 ...

  7. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MVPEMGDYYVPATQNNARILVRNENGIELLSNICRHRQATILEGRGSSRNIVCP 101 ... YVGHELMVPEMGDYYVPATQNNARILVRNENGIE...LLSNICRHRQATILEGRGSSRNIVCP Sbjct: 1 ... YVGHELMVPEMGDYYVPATQNNARILVRNENGIELLSNICRHRQATILEGRGSSRNIVCP 60 ... ...otein ... 2Fe-2S subunit [Nitrosomonas europaea ATCC 19718] ... Length = 99 ... Query: 42 ... YVGHEL

  8. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Nitrosomonas europaea ATCC 19718] ... Length = 75 ... Query: 1 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEH...QLELFEMLLSLSDHDLWNIIIGNT 60 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEHQLELFEM...LLSLSDHDLWNIIIGNT Sbjct: 1 ... MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEHQLELFEMLLSLSDHDLWNIIIGNT 60 ...

  9. Whole-tree water balance and indicators for short-term drought stress in non-bearing 'Barnea' olives

    NARCIS (Netherlands)

    Ben-Gal, A.; Kool, D.; Agam, N.; Halsema, van G.E.; Yermiyahu, U.; Yafe, A.; Presnov, E.; Erel, R.; Majdop, A.; Zipori, I.; Segal, E.; Rüger, S.; Zimmermann, U.; Cohen, Y.; Alchanatis, V.; Dag, A.

    2010-01-01

    Drainage-weighing lysimetersallowedmonitoringofwaterbalancecomponentsofnon-bearingolive (Olea europaea cv Barnea)treesovera3-monthperiodincludingshort-termeventsofcontrolledbut severe waterstress.Theobjectiveofthestudywastoevaluateavarietyofsoilandplant-basedwater status

  10. Effects of moistening, salinity and competitive interactions on vitality and production activity of Salicorniaeuropaea (Chenopodiaceae

    Directory of Open Access Journals (Sweden)

    S. F. Kotov

    2005-09-01

    Full Text Available Dynamics of competitive interactions in populations of annual euhalophyte S. europaea was investigated. For S. europaea the hypothesis of Newman and Tilman is confirmed, concerning presence of intensive competition between plants on unproductive habitats for soil resources. Vital state of plants in populations of S. europaea is determined by intensity of competitive interactions, level of humidity and degree of salinity of ecotype. On an example of S. europaea, productive activity of plants on salted habitats was analyzed and the role of interspecific competition in this process was determined.

  11. Estudio comparativo de las características físico-químicas del aceite de sacha inchi (Plukenetia volubilis l., aceite de oliva (Olea europaea y aceite crudo de pescado

    Directory of Open Access Journals (Sweden)

    Luz María Paucar-Menacho

    2015-01-01

    Full Text Available Los aceites vegetales tales como el aceite de sacha inchi (ASI y oliva (AO contienen ácidos grasos mono-insaturados (omega-9 y poliinsaturados (omega-6, y pequeñas cantidades de omega-3. Por el contrario, los aceites de origen marino como el aceite crudo de pescado (ACP se caracterizan por su alto contenido en omega-3. El objetivo de la presente investigación fue determinar y comparar las características físico-químicas de estos tres aceites a fin de establecer cuál es el mejor para el uso alimentario. El Índice de acidez, índice de refracción y densidad relativa se determinó por métodos oficiales AOAC, y el tiempo de vida útil por el método Rancimat, a tres temperaturas (100 °C; 120 °C y 150 °C, extrapolando los resultados a 25 °C.Los resultados obtenidos en la caracterización fisicoquímica indican que estos aceites son significativamente diferentes. Los índices de acidez en % de ácido oleico fueron de 1,08, 1,14 y 1,561 para ASI, AO y ACP respectivamente. Los índices de refracción (20 °C fueron 1,475, 1,469 y 1,481 para ASI, AO y ACP respectivamente, la densidad relativa fue 0,9283, 0,9152 y 0,9308 para ASI, AO y ACP respectivamente. La vida útil para ASI, AO y ACP fue de 93, 137 y 2 días respectivamente. La composición de ácidos grasos tanto en los aceites de origen vegetal y marino además de su vida útil, imparte gran importancia desde el punto de vista nutricional, ya que están contenidos significativamente en los aceites estudiados. Los resultados indican la importancia de este tipo de aceites en la alimentación humana.

  12. Spatial and taxonomical overlap of fungi on phylloplanes and invasive alien ladybirds with fungal infections in tree crowns of urban green spaces

    DEFF Research Database (Denmark)

    Howe, Andrew Gordon; Ravn, Hans Peter; Jensen, Annette Bruun

    2016-01-01

    Occurrence of entomopathogenic fungi on phylloplanes in Tilia x europaea crowns between 1 - 13m was assessed in urban parks. Prevalence of fungal infections in ladybirds (Coleoptera: Coccinellidae) collected from T. x europaea was assessed to determine whether fungi found on phylloplanes also occ...

  13. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  14. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  15. ORF Alignment: NC_004572 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  16. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  17. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  18. ORF Alignment: NC_003116 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  19. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  20. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  1. ORF Alignment: NC_004551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  2. ORF Alignment: NC_003112 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  3. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  4. ORF Alignment: NC_002488 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  5. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  6. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  7. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  8. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  9. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  10. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  11. Frequency and clinical, hormonal and ultrasonographic characteristics suggestive of polycystic ovarian syndrome in a group of females with metabolic syndrome; Frecuencia y caracteristicas clinicas, hormonales y ultrasonograficas sugestivas de sindrome de ovarios poliquisticos en un grupo de mujeres con sindrome metabolico

    Energy Technology Data Exchange (ETDEWEB)

    Ovies Carballo, Gisel; Dominguez Alonso, Emma; Verdeja Varela, Olga L; Zamora Recinos, Hugo [Instituto Nacional de Endocrinologia, La Habana (Cuba)

    2008-07-01

    The polycystic ovarian syndrome is the most frequent endocrine affection in females at reproductive age. Nowadays, it is known that insulin resistance and consequent hyperinsulinism seem to be the basis of the disorders characterizing it. That's why, it is not erroneous to think that in females with metabolic syndrome, whose physiopathological bases are insulin resistance and hyperinsulinism, there may appear clinical, humoral and ultrasonographic elements of the polycystic ovarian syndrome.

  12. [The role of biochemical markers of myocardial damage in clinical practice: the diagnosis of infarct and risk stratification. The Intersociety Interdisciplinary Study Group of the ANMCO-SIBioC-SIMeL, Markers of Muocardial Lesions. L'Associazione Nazionale Medici Cardiologi Ospedalieri-Società Italiana di Biochimica Clinica-Società Italiana di Medicina di Laboratorio].

    Science.gov (United States)

    Ottani, F; Galvani, M; Panteghini, M; Dolci, A; Plebani, M; Tubaro, M; Zaninotto, M

    2000-01-01

    For many years creatine kinase (CK) and CK-MB isoenzymes were used together with the ECG to confirm the presence of myocardial infarction. During the last decade newer cardiac markers have been introduced and immunological test systems developed for their quantification. Among these new markers, a prominent role has emerged for cardiac troponins (T or I). These technological advanced assays have shown greater sensitivity compared to "conventional cardiac enzymes;, thereby identifying patients with small--at times, microscopic--infarcts who would not have met defining criteria for myocardial infarction in an earlier era. Another major advantage shown by both cardiac troponins with respect to "conventional cardiac enzymes" is their ability to predict clinical outcome over a short- or long-term follow-up in patients with acute coronary syndromes, and this appears to be particularly relevant in patients with micronecrosis, who constitute a high-risk subgroup of unstable angina patients. Recently, myoglobin has also been widely applied as a marker. Although lacking in myocardial specificity, it is the earliest marker to show an increase after coronary occlusion. Thus, the combined use of myoglobin and a cardiospecific structural protein such as troponin T or I may prove an attractive strategy for biochemical testing in chest pain patients. With the routine use of these novel cardiac markers, fascinating opportunities are now open in the field of diagnostic classification (making the World Health Organization definition of myocardial infarction obsolete) and risk stratification in chest pain patients; opportunities that were unforeseen in the era of cardiac enzymes. However, the use of these markers has also posed some important questions on: a) the best and most cost-effective diagnostic strategy in chest pain patients; b) the remaining role of cardiac enzymes; c) the therapeutic consequences of a positive test result.

  13. Síndrome psicótica evoluindo com demência como manifestação clinica de deleção do DNA mitocondrial Psycothic syndrome developing into dementia as a clinical manifestation of mitochondrial DNA deletion

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Rocha Vasconcellos

    2007-03-01

    Full Text Available As manifestações das doenças mitocondriais são variadas, acometendo, mais freqüentemente, órgãos com alto metabolismo aeróbico em que são mais abundantes, como, por exemplo, o sistema nervoso. O início dos sintomas em geral é observado na infância havendo relatos de início na idade adulta. Apresentamos caso atípico de doença mitocondrial associada à deleção do DNA mitocondrial em um homem de 39 anos com sintomas psiquiátricos configuraram quadro clínico inicial e somente 12 anos após o início dos sintomas surgiram alterações neurológicas. O diagnóstico da doença mitocondrial foi confirmado por biópsia de músculo sendo documentada deleção do DNA mitocondrial.The manifestations of mitochondrial disease are variable, affecting more frequently the organs with high aerobic metabolism in which they are more abundant, for example the nervous system. The beginning of symptoms in general is observed at chilhood, but some patients presented on adult age. We present an atypical case associated with mitochondrial DNA deletion. A 39-years-old man with psychiatric symptoms that configured initial clinical picture and only after 12 years of the beginning of symptoms neurological alterations became noticeable. The diagnosis of mitochondrial illness was confirmed by muscle biopsy being documented mitochondrial DNA deletion.

  14. Implantation of a double reading process for radiological exams of the radiology service of the Clinical Hospital of Porto Alegre using the IMPAX client system; Implantação de um processo de dupla leitura de exames radiológicos do serviço de radiologia do Hospital de Clinicas de Porto Alegre utilizando o sistema IMPAX cliente

    Energy Technology Data Exchange (ETDEWEB)

    Moraes, A.L.; Goulart, J.M.; Lucena, R.A.; Bacelar, A.; Pinto, A.L.A., E-mail: amoraese@hcpa.edu.br [Hospital de Clínicas de Porto Alegre (HCPA), RS (Brazil)

    2017-07-01

    A Quality Management System consists of several processes that qualify and quantify the performance of a service, minimizing the possibility of errors in the radiological diagnosis that may result in clinical consequences. One of these processes is the implantation of double reading, which consists in the evaluation of the report interpreted by a radiologist and the subsequent conference by another radiologist, through the analysis of archived PACS exams. The classification of the results of these analyzes was based on the recommendations of the American College of Radiology (ACR). Double reading is an extremely effective process for increasing the quality of the radiological report, in addition to contributing to the continuing education between the pairs.

  15. Collimator with compensated filtration: clinical adaptation for recommendation 4f of the EU about the radiation protection in oral dental radiology; Colimador con filtracion compensada: adaptacion clinica para alcanzar la recomendacion 4F de la Union Europea sobre proteccion radiologica al paciente en radiologia odontologica

    Energy Technology Data Exchange (ETDEWEB)

    Alcaraz, M; Garcia-Vera, C; Bravo, C La; Morant, J J; Armedo, D Y; Canteras, M

    2006-07-01

    Recent recommendations by the European Union (2004) for performing lateral cranial cephalometry (LCC) state that collimation should be maximized so that only those tissues necessary are irradiated when performing clinical diagnoses, although the fact that many manufacturers do not incorporate these elements in their equipment design has been recognised (recommendations 4f). Aim: the manufacture and utilization of a collimator with a pre-patient compensating filter for LLC which may be used in most extraoraldental radiology units, as well as determining the reduction in the dose of radiation absorbed by more sensitive tissues exposed to said clinical exploration. Making use of mannequins, phantom and craniums, we constructed a collimator with a compensating filter and established the necessary technical, dosimetric and quality specifications for its clinical use. Subsequently, we studied 16 patients referred for cephalometric study, determining the radiation dose (TLDs) in both the patients (crystalline lens, frontal lobe, parotid/submaxillary/thyroid glands and brain) and in the radiographic film, as well as in different parts of the collimator/filter. Al presented we are aiming for its clinical use by carrying out LCC in another 16 patients referred of orthodontic treatment but with the pre-a patient introduction of the tested collimator with the compensating filter as a substitute for the usual technique. The collimation reduced the field or radiation by some 40% and with that, so too the radiated tissues. The compensating filter reduced the dose in tissues by some 34.2. Our collimator has allowed the radiological image to be obtained with only one third the usual radiation dose. The dose reaching the film shies only between 17% less than in the usual technique and didn't alter its diagnostic capacity. A reduction of 61,6% of the dose administered to the patient is achieved by incorporating the collimator and filter to most radiological equipment without the need for renovating or substituting existing apparatus. (Author)

  16. Clinical evolution of patients hospitalized due to the first episode of Acute Coronary Syndrome Evolución clínica de pacientes internados debido el primer episodio de la Síndrome Aguda de las Coronarias Evolução clinica de pacientes internados em decorrência do primeiro episódio da Síndrome Coronariana Aguda

    Directory of Open Access Journals (Sweden)

    Gislaine Pinn Gil

    2012-10-01

    Full Text Available AIM: to assess the clinical evolution of patients hospitalized due to the first episode of Acute Coronary Syndrome (ACS according to its clinical manifestation. METHODS: data were collected from 234 patients, hospitalized between May 2006 and July 2009 due to the first episode of an ACS, by consulting their medical records. RESULTS: 234 patients were hospitalized, 140 (59.8% due to Acute Myocardial Infarction (AMI. In the group with AMI, 19.3% presented complications, against 12.8% in the group with Unstable Angina (UA (p=0.19. Angioplasty levels were higher among patients with AMI than with UA (p=0.02 and coronary artery bypass graft surgery was more frequent among UA patients (p=0.03. The majority (227; 97% survived after the coronary event. Among the seven patients who died during the hospitalization, four had AMI (2.9% and three UA (3.2%. CONCLUSIONS: A larger number of complications were found among infarction victims and the accomplishment of coronary artery bypass graft surgery differed between the groups.OBJETIVO: evaluar la evolución clínica de pacientes internados por el primer episodio del Síndrome Aguda de Coronarias según su manifestación clínica. MÉTODOS: Fueron colectados datos de 234 pacientes internados entre mayo de 2006 y julio de 2009 debido el primer episodio de una ACA mediante consultas a los prontuarios. RESULTADOS: La mayoría (59,8% internó debido al Infarto Agudo del Miocardio (IAM. En el grupo con IAM, 19,3% presentaron complicaciones y 12,8% en el grupo con Angina Inestable (AI(p=0,19. La realización de angioplastia fue mayor entre los pacientes con IAM de lo que con AI (p=0,02 y la cirugía de revascularización fue más realizada entre los pacientes con AI (p=0,03. La mayoría (227; 97% sobrevivió al evento de las coronarias. Entre los siete pacientes que murieron en la internación, cuatro tenían IAM (2,9% y tres AI (3,2%. CONCLUSIONES: Hubo mayor número de complicaciones entre los infartados y la realización de revascularización del miocardio fue diferente en los dos grupos.OBJETIVO: avaliar a evolução clínica de pacientes internados pelo primeiro episódio da síndrome coronariana aguda (SCA, segundo sua manifestação clínica. MÉTODOS: foram coletados dados de 234 pacientes internados entre maio de 2006 e julho de 2009, em decorrência do primeiro episódio de uma SCA, mediante consultas aos prontuários. RESULTADOS: a maioria (59,8% foi internada devido ao infarto agudo do miocárdio (IAM. No grupo com IAM, 19,3% apresentaram complicações e 12,8% no grupo com angina instável (AI (p=0,19. A realização de angioplastia foi maior entre os pacientes com IAM do que com AI (p=0,02 e a cirurgia de revascularização foi mais realizada entre os pacientes com AI (p=0,03. A maioria (227 - 97% sobreviveu ao evento coronariano. Entre os sete pacientes que morreram na internação, quatro tinham IAM (2,9% e três AI (3,2%. CONCLUSÕES: houve maior número de complicações entre os infartados e a realização de revascularização do miocárdio foi diferente nos dois grupos.

  17. Study of the positioning of the films of the MLC by a Test of bands and your influence in the clinic dosimetry in IMRT; Estudio del posicionamiento de las laminas del MLC mediante un test de bandas y su influencia en la dosimetria clinica en IMRT

    Energy Technology Data Exchange (ETDEWEB)

    Serrano Zabaleta, S.; Millan Cebrian, E.; Calvo Carrillo, S.; Alba Escorihuela, V.; Garcia Romero, A.; Ortega Pardina, P.; Canella Anoz, M.; Hernandez Vitoria, A.

    2015-07-01

    We performed a test of adjacent bands inspired by the proposed in AAPM Report No. 72, we provides a parameter characterizing the state of the MLC as to the actual position of its blades. This test has been validated by studying repeatability and reproducibility and has found the correlation between the parameter and creep detected by the ILD. Subsequently it has studied the impact of changes in the positioning of the blades on clinical dosimetry in IMRT patients, reconstructing the patient dose by Matrix Evolution team and Compass software, IBA Dosimetry. (Author)

  18. Calidad de vida en el trabajo: Profesionales de la salud de Clínica Río Blanco y Centro de Especialidades Médicas Quality of life at work: Health Professionals Clinica Rio Blanco and Center Especialidades Médicas

    Directory of Open Access Journals (Sweden)

    Diemen Delgado García

    2012-09-01

    Full Text Available Objetivo: Identificar un constructo sobre la calidad de vida en el trabajo de los médicos/as y enfermeros/as de Clínica Río Blanco y Centro de Especialidades Médicas. Métodos y Materiales: Estudio transversal y analítico. Se aplicó un cuestionario de datos socio-laborales integrados por 10 ítems y el instrumento CVT-GOHISALO, el cual consta de 74 ítems y mide la calidad de vida en el trabajo en siete dimensiones Resultados: En un grupo de 20 trabajadores entre médicos/as y enfermeros/as, el 40 % cuenta con dos trabajos, el 20 % reporta ausentismo por enfermedad el año previo. El 60 % se desempeñan principalmente en turno mixto. El 40 % tiene una antigüedad de dos a cinco años y el 30 % menos de dos años. El número de horas semanales que dedican al descanso es menor a 20 horas en un 50 % de los trabajadores. Las siete dimensiones evaluadas: soporte institucional para el trabajo, seguridad en el trabajo, integración al puesto de trabajo, satisfacción por el trabajo, bienestar a través del trabajo, desarrollo personal y administración del tiempo libre, reflejan grados de insatisfacción en la calidad de vida en el trabajo. Conclusiones: Los trabajadores de la salud evaluados muestran una serie de percepciones subjetivas que reflejan una realidad de su medio laboral.Objective: To identify a construct on quality of life in the work of doctors and nurses Clínica Río Blanco and Center Especialidades Médicas. Methods and Materials: Cross-sectional and analytical. A questionnaire was social and labor data consisting of 10 question and CVT-GOHISALO instrument, which consists of 74 question and measures the quality of life at work in seven dimensions. Results: In a group of 20 workers among doctors and nurses, 40 % have two jobs, 20 % reported absenteeism due to illness the previous year. 60 % work mainly in mixed shift. 40 % have a length of two to five years and 30 % less than two years. The number of hours per week devoted to rest is less than 20 hours in 50 % of workers. The seven dimensions assessed: institutional support for work, job security, integration into the workplace, job satisfaction, well-being through work, personal development and leisure management, reflect a degree of dissatisfaction in the quality of work life. Conclusions: The health workers evaluated show a series of subjective perceptions that reflect a reality of their workplace.

  19. Tumor carcinoide de la apéndice cecal: Reporte de cuatro casos en la Clínica Carlos Ardila Lülle, Floridablanca, Colombia Carcinoid tumor of the cecal appendix: A report of four cases in the Clinica Carlos Ardila Lulle, Floridablanca, Colombia

    Directory of Open Access Journals (Sweden)

    Julio Cesar Mantilla

    2011-08-01

    Full Text Available Introducción: Los tumores carcinoides son las neoplasias más frecuentes del apéndice cecal, se caracterizan por un crecimiento lento y curso clínico asintomático, su incidencia se calcula en 1-2 casos por cada 100,000 habitantes, se encuentran en menos del 1% de las apendicetomías y se presentan con mayor frecuencia en mujeres entre la cuarta a quinta época de la vida. Por lo general se trata de lesiones pequeñas que se diagnostican luego de la apendicetomía. Metodología El presente trabajo corresponde a una descripción de casos de tumor carcinoide del apéndice cecal, realizado en el laboratorio de patología MEGA, de la Clínica Ardila Lulle (CAL que incluye revisión de protocolos de especímenes quirúrgicos analizados entre enero 1 de 2000 y diciembre 31 de 2010. Resultados: Durante el periodo propuesto se encuentran cuatro casos de tumor carcinoide confinado al apéndice cecal en cuatro mujeres jóvenes. Tres de las lesiones presentan patrón histológico tipo A o insular y el restante un patrón tipo B o trabecular, en todos los casos se documentó reactividad con las sales de plata con la coloración de Fontana Masson y en los cuatro se encontró positividad con el marcador neuroendocrino cromogranina. Conclusión: Los tumores carcinoides de apéndice son lesiones de origen neuroendocrino, la mayoría circunscritas a la punta del órgano y de curso clínico indolente, sin embargo algunos de estos tumores tienen un comportamiento agresivo, que depende de su tamaño y de la actividad mitótica de sus células, por lo que se recomienda incluir en la evaluación diagnostica la cromogranina y el Ki67, marcadores neuroendocrino y de proliferación celular. Salud UIS 2011; 43 (2: 203-210Introduction: The carcinoids tumours are the most common neoplasm of the cecal appendix, are characterized by a slow growth and asymptomatic clinical course, its incidence is estimated at 1-2 cases per 100.000 inhabitants, are less than 1% of appendicectomies and occur most often in women between the fourth o fifth decade of life. Usually these are small lesions diagnosed after appendicectomy. Methodology: This work belongs to a description of cases of carcinoid tumor of cecal appendix, conduced in the MEGA anatomic pathology laboratory of Carlos Ardila Lulle Clinic (CAL, wich includes protocols review of surgical specimens analized between January 1, 2000 and December 31, 2010. Results: During the proposed period are four cases of carcinoid tumor confined to the cecal appendix in four young women. Three of the lesions have the A histological type or insular pattern, and the remainder have the B histological type or trabecular pattern, in all cases documented reactivity with silver salts with Masson-Fontana stain and all four were found positive with the neuroendocrine marker chromogragin. Conclusion: The carcinoid tumors of the apenddix are lesions of neuroendocrine origen, most of them located at the tip of the organ, and having a indolent clinical course; however some of these tumors have an aggressive behavior, which depends on its size and the mitotic activity of its cells, that's the reason why the diagnostic evaluation of neuroendocrine markers like chromogranin, and Ki67 (proliferation cell index are recommended. Salud UIS 2011; 43 (2: 203-210

  20. APOE epsilon4 and Alzheimer's disease: positive association in a Colombian clinical series and review of the Latin-American studies Asociación positiva entre APOE épsilon4 y demencia de Alzheimer en una serie clinica en Bogotá (Colombia y revision de los estudios latinoamericanos

    Directory of Open Access Journals (Sweden)

    Martine Jacquier

    2001-03-01

    Full Text Available OBJECTIVE: As the strength of the association between the APOE epsilon4 allele and Alzheimer's disease (AD varies across ethnic groups, we studied if there was such an association in Colombian patients. METHOD: We performed apolipoprotein E (APOE genotyping in a clinical sample of 83 unrelated AD patients, predominantly late-onset (>65 yrs including familial ( n =30 and sporadic AD cases (n= 53 diagnosed according to NINCDS-ADRDA criteria and assessed by a multi-disciplinary team. Control subjects (n = 44 had no significant cognitive impairment by medical interview and neuro-psychological testing. RESULTS: We found a high association (OR= 5.1 95%CI 1.9 -13.6 between APOE epsilon4 and AD, in this series with predominantly late-onset cases with familial aggregation in 24 cases (28.9%. A significant negative association was found between epsilon2 and AD (OR= 0.2 95% CI 0.05-0.75. CONCLUSION: Further population-based surveys in Colombia are warranted to precise a possible dose effect of APOE epsilon4.OBJETIVO: Como la fortaleza de la asociación entre el alelo épsilon4 del gen APOE y la enfermedad de Alzheimer (EA difiere entre grupos étnicos, quisimos evaluar si esta asociación existe en pacientes colombianos. MÉTODOS: Realizamos una genotipificación para el gen de la apolipoproteina E (APOE en una muestra clínica de 83 pacientes con EA no relacionados, de inicio predominantemente tardío (> 65 años, incluyendo casos familiares (n=30 y esporádicos (n=53 diagnosticados según los criterios del NINCDS-ADRDA y evaluados por un equipo multi-disciplinario. Los sujetos control (n= 44 no presentaban deterioro cognoscitivo de acuerdo con la entrevista médica y la evaluación neuropsicológica. RESULTADOS: Hallamos una alta asociación (OR= 5.1; IC95% 1.9- 13.6 entre APOE épsilon4 y EA en la serie de casos de inicio tardío y con agregación familiar en 24 sujetos (28.9%. Una asociación negativa, estadísticamente significativa, fue encontrada entre épsilon2 y EA (OR= 0.2; IC95% 0.05-0.75. CONCLUSIÓN: En Colombia son necesarios futuros estudios con base poblacional para poder precisar la existencia o no de un efecto de dosis de APOE épsilon4.

  1. Evaluation of conventional x-ray diagnostic equipment and radiological protection systems of hospitals and clinics installed in Recife city, Brazil; Avaliacao dos equipamentos de raios-X diagnostico convencionais e dos sistemas de protecao radiologica de clinicas e hospitais da cidade de Recife

    Energy Technology Data Exchange (ETDEWEB)

    Passos, Robson Silva

    1999-05-15

    Diagnostic radiology is the main contributor to the man-made exposure of general population. Since Quality Assurance (QA) programs ensure high quality diagnostic images with the lowest possible radiation dose to the patient, it has been recommended that all introduce QA programs for their radiological facilities. Consequently it is important to check the adequacy of equipment operating parameters in diagnostic radiography facilities, to ensure that a high quality of service is delivered. The purpose of this study was to evaluate the operating conditions of diagnostic units installed in Recife, Pernambuco. The study included 31 X-ray units from both public and private diagnostic services. The following parameters were evaluated: coincidence between the luminous and radiation fields; alignment of the radiation beam; agreement between the real and preset values of kVp and exposure time; filtration; half value lower (HVL); luminance of the view box; uniformity of the luminance; illuminance of the environment. The results showed that 20% of the equipment surveyed exhibited discrepancies between the luminous and radiation fields greater than 2% of the source to skin distance. The test of kilovoltage showed that 48% of the units do not fulfill the acceptability criteria, presenting discrepancies higher than {+-} 10% between the measured and preset values. The results of the accuracy of the timer indicated that 81% of the equipment surveyed present a discrepancy greater than {+-} 10% between the time selected in the control panel and actual exposure time.The test of the filtration shown that, in 20% of the equipment, this was inferior to 2,5 mm Al. The test of the luminance of view box shown that 96% of the equipment, shown a luminance lower of 2.000 cd/m{sup 2}. Related to the test of the uniformity of the luminance, 81 % of the equipment shown a variation of the uniformity higher then 10%. The test of the iluminancy of the environment shown that 61 % of the equipment presented on iluminancy level out of the gap between 50 and 100 lux. The results of this survey showed that a high percentage of the equipment surveyed demonstrated inadequate operating conditions, reinforcing the need to implement quality control protocols in conventional x-ray units located in Recife. (author)

  2. Evaluation of the response of polymeric gel modified MAGIC-f using a clinical brachytherapy source and Monte Carlo simulation with package PENELOPE; Avaliacao da resposta do gel polimerico MAGIC-f modificado utilizando uma fonte clinica de braquiterapia e simulacao Monte Carlo com o pacote PENELOPE

    Energy Technology Data Exchange (ETDEWEB)

    Quevedo, Ana Luiza; Nicolucci, Patricia [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Filosofia Ciencias e Letras. Dept. de Fisica; Borges, Leandro F. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Hospital das Clinicas. Setor de Radioterapia

    2016-07-01

    In this work a comparison of experimental and simulated relative doses of a clinical brachytherapy source was performed. A 5 x 5 x 7 cm{sup 3} phantom with a modified MAGIC-f gel was irradiated using a clinical {sup 192}Ir source and read using Magnetic Resonance Imaging. The Monte Carlo simulation package PENELOPE was used to simulate the dose distributions of the same radiation source. The dose distributions were obtained in two planes perpendicular to the source: one passing through the source's center and the other at 0.5 cm away from the source's center. The higher differences found between experimental and computational distributions were 12.5% at a point 0.62 cm from the source for the central plane and 8.6% at 1.3 cm from the source to the plane 0.5 cm away from the source's center. Considering the high dose gradient of these dose distributions, the results obtained show that the modified MAGIC-f gel is promising for brachytherapy dosimetry. (author)

  3. Evaluation of the response of modified MAGIC-f polymeric gel using a clinical brachytherapy source and Monte Carlo simulation with package PENELOPE; Avaliacao da resposta do gel polimerico MAGIC-f modificado utilizando uma fonte clinica de braquiterapia e simulacao Monte Carlo com o pacote PENELOPE

    Energy Technology Data Exchange (ETDEWEB)

    Quevedo, Ana Luiza; Nicolucci, Patricia, E-mail: anaquevedo@usp.br [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Dept. de Fisica; Borges, Leandro F. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Setor de Radioterapia

    2016-07-01

    A comparison of experimental and simulated relative doses of a clinical brachytherapy source was performed. A 5 x 5 x 7 cm{sup 3} phantom with a modified MAGIC-f gel was irradiated using a clinical {sup 192}Ir source, Varian, model GammaMed Plus. The phantom was irradiated with 7,5 Gy, commonly used in gynecological treatments. The dose distributions readings were performed 24h after irradiation using Magnetic Resonance Imaging, weighted in T2, with repetition time of 6000 ms, echo-time of 15 ms, 16 echos and 0.40 mm pixel size. The same brachytherapy source was modeled in the Monte Carlo package PENELOPE to obtain dose distributions. The energy cutoff for electrons, photons and positrons was 100 keV, the primary particles condensation parameters remained the same at 0.3. The dose distributions were obtained in two planes perpendicular to the source: one passing through the source’s center and the other at 0.5 cm away from the source’s center in direction of the top of encapsulation. A comparison of the experimental results using the polymeric gel to the computational results showed maximum differences of 12.5%, at 0.62 cm from the source for the central plane, and 6.4% at 0.5 cm from the source for the superior plane. Considering the high dose gradient of these clinical brachytherapy sources, the results obtained in these work show that MAGIC-f gel with modified formulation, is promising for dosimetry in brachytherapy. (author)

  4. Quantification of the influence of the choice of the algorithm and planning system on the calculation of a treatment plan; Cuantificacion de la influencia que tiene la eleccion del algoritmo y del sistema de planificacion en el calculo de una dosimetria clinica

    Energy Technology Data Exchange (ETDEWEB)

    Moral, F. del; Ramos, A.; Salgado, M.; Andrade, B; Munoz, V.

    2010-07-01

    In this work an analysis of the influence of the choice of the algorithm or planning system, on the calculus of the same treatment plan is introduced. For this purpose specific software has been developed for comparing plans of a series of IMRT cases of prostate and head and neck cancer calculated using the convolution, superposition and fast superposition algorithms implemented in the XiO 4.40 planning system (CMS). It has also been used for the comparison of the same treatment plan for lung pathology calculated in XiO with the mentioned algorithms, and calculated in the Plan 4.1 planning system (Brainlab) using its pencil beam algorithm. Differences in dose among the treatment plans have been quantified using a set of metrics. The recommendation for the dosimetry of a careful choice of the algorithm has been numerically confirmed. (Author).

  5. Association among nursing diagnoses, demographic variables, and clinical characteristics of patients with high blood pressure Asociación entre diagnósticos de enfermería y variables sociales/clinicas en pacientes hipertensos Associação entre diagnósticos de enfermagem e variáveis sociais/clínicas em pacientes hipertensos

    Directory of Open Access Journals (Sweden)

    Francisca de Fátima Vasconcelos

    2007-09-01

    Full Text Available OBJECTIVES: To analyze the association among diagnoses, demographic variables, and clinical characteristics of patients with high blood pressure. METHODS: The data were collected in 67 patients from a primary care unit in Fortaleza, Brazil. The NANDA Taxonomy was used to determine the nursing diagnoses. Data analysis consisted of Fisher's exact test, Chi-square test, and likelihood ratio test. RESULTS: Fifty four nursing diagnoses were identified; fifteen were above the 75th percentile. Ineffective individual therapeutic regimen management and number of medication, sleep pattern disturbance and marital status, activity intolerance and education, activity intolerance and time of diagnoses, sexual dysfunction and gender, sexual dysfunction and education, risk for falls and age, marital status and time of diagnoses, chronic pain and marital status all had significant association coefficients. CONCLUSION: Some demographic characteristics were associated with nursing diagnoses.OBJETIVO: Analizar la asociación estadística entre diagnósticos y características sociales / clínicas de pacientes hipertensos. MÉTODOS: Los datos fueron recolectados en una unidad básica de salud de Fortaleza-Ceará con 67 pacientes. La identificación de los diagnósticos se llevó a cabo según la taxonomía de la NANDA. Para el análisis de los datos se utilizó test de Fisher, Chi-Cuadrado de Pearson y Razón de Verosemejanza. RESULTADOS: Se encontró 54 diagnósticos de enfermería y 15 sobre el percentil 75. Se verificó asociación estadística entre: Control eficaz del régimen terapéutico y número de medicamentos; Patrón de sueño perturbado y estado civil; Intolerancia a la actividad y escolaridad y años de diagnóstico; Disfunción sexual y sexo y escolaridad; Riesgo para caídas y edad, estado civil y tiempo de diagnóstico de la enfermedad; Dolor crónico y estado civil. CONCLUSIÓN: Algunas características demográficas están asociadas a la ocurrencia de diagnósticos de enfermería.OBJETIVO: Analisar a associação estatística entre diagnósticos e características sociais / clínicas de pacientes hipertensos. MÉTODOS: Os dados foram coletados numa unidade básica de saúde de Fortaleza-Ce com 67 pacientes. A identificação dos diagnósticos foi procedida segundo a taxonomia da NANDA. Para análise dos dados utilizou-se testes de Fisher, Qui-Quadrado de Pearson e Razão de Verossimilhança. RESULTADOS: Encontrou-se 54 diagnósticos de enfermagem e 15 acima do percentil 75. Verificou-se associação estatística entre: Controle eficaz do regime terapêutico e número de medicamentos; Padrão de sono perturbado e estado civil; Intolerância à atividade e escolaridade e anos de diagnóstico; Disfunção sexual e sexo e escolaridade; Risco para quedas e idade, estado civil e tempo de diagnóstico da doença; Dor crônica e estado civil. CONCLUSÃO: Algumas características demográficas estão associadas à ocorrência de diagnósticos de enfermagem.

  6. Alteration in the absorption cell dose arising from the use of gold nanoparticle associated with the radionuclides of clinical application: simulate study; Alteracao na absorcao de dose celular decorrente da utilizacao de nanoparticulas de ouro associadas a radionuclideos de aplicacao clinica: estudo simulado

    Energy Technology Data Exchange (ETDEWEB)

    Culik, Lucas; Schwarcke, Marcelo, E-mail: mschwarcke@unifra.br [Centro Universitario Franciscano (UNIFRA), Santa Maria, RS (Brazil)

    2015-12-15

    The present work is a proposal to assess, which is the efficiency in the use of radionuclides of clinical application in nuclear medicine service conjugated system with gold nanoparticles.To obtain the results needed for the interpretation of this combination, was using the Monte Carlo simulation code PENELOPE, where was the main structures of a simulated eukaryote cell. To simulate irradiation on cellular structures was used the emission spectrum of main radionuclide clinical use in nuclear medicine service. The material containing gold nanoparticles was modeled according the stoichiometric proportions found in the literature. The results obtained, present for the simulated energies to smaller bodies than 2,0μm, no substantial response to the use of nanoparticles in the reinforcement of locally absorbed dose. Is observed a small decrease in locally dose absorbed due to emission of charged particles, it is believed that causes an increase in the emission secondary range to be placed outside the study body. But this effect is small when comparing to the increase of energy absorbed due to interaction with the bodies containing nanoparticles, so demonstrating an increase in the locally dose absorbed. Being observed that there is an increase in dose absorbed locally due to the use of nanoparticles. For protocols based on the principle of target radionuclide therapy, the imaging of the treaty sit will be affected in their statistical accuracy, since the gamma radiation will be attenuated by the nanoparticles present in the material. Being necessary to know if this increase in the locally absorbed dose has greater importance in the treatment protocol than the image of the absorption of the radioactive material in the target organ. (author)

  7. Clinical evaluation of the low intensity laser antialgic action of GaAlAs ({lambda}=785 nm) in the treatment of the temporomandibular disorders; Avaliacao clinica da acao antialgica do laser em baixa intensidade de arseneto de galio e aluminio ({lambda}=785 nm) no tratamento das disfuncoes da articulacao temporo-mandibular

    Energy Technology Data Exchange (ETDEWEB)

    Sanseverino, Nelly Tichauer Maluf

    2001-07-01

    The therapy with laser emitting low intensity has been currently used in the most diverse fields of medicine as therapeutic conduct for pain. It is a non invasive, painless, non-thermal and aseptic type therapy, without any collateral effects, having a good cost/benefit relationship. However, for the therapy with low-intensity laser to result in positive effects, a correct diagnosis is fundamental, as well as a protocol of adequate application. n odontology, the majority of patients diagnosed with temporomandibular disorders (TMD), present pain and limitations in the movements of the jaw. In this work, a GaAlAs laser emitting low intensity, was used, {lambda}=785 nm, in patients having a dysfunction of the temporomandibular joint with a complaint of pain. Twenty patients were divided into two groups. The group treated received laser therapy in the temporomandibular articulations and in the muscles affected. The dose applied was 45 J/cm{sup 2}, while the ten patients in the control group received 0 J/cm{sup 2}, in a total of nine applications, carried out three times a week, during three weeks. he evaluation of the patients was made through clinical examinations of manual palpation of the masseter, temporal, cervical, posterior neck and sternocleidomastoid muscles, and measurements of opening and laterality of the mouth. The results obtained showed a diminishing of the pain and an increase of the mandibular mobility in the patients treated, when compared to the control group. These results point to this therapy as being an important tool in the treatment of pain in patients with a dysfunction in the TMJ, indicating this therapeutic modality as a co-adjuvant in these treatments. (author)

  8. Collimator with compensated filtration: clinical adaptation for recommendation 4f of the EU about the radiation protection in oral dental radiology; Colimador con filtracion compensada: adaptacion clinica para alcanzar la recomendacion 4F de la Union Europea sobre proteccion radiologica al paciente en radiologia odontologica

    Energy Technology Data Exchange (ETDEWEB)

    Alcaraz, M.; Garcia-Vera, C.; Bravo, C. La; Morant, J. J.; Armedo, D. Y.; Canteras, M.

    2006-07-01

    Recent recommendations by the European Union (2004) for performing lateral cranial cephalometry (LCC) state that collimation should be maximized so that only those tissues necessary are irradiated when performing clinical diagnoses, although the fact that many manufacturers do not incorporate these elements in their equipment design has been recognised (recommendations 4f). Aim: the manufacture and utilization of a collimator with a pre-patient compensating filter for LLC which may be used in most extraoraldental radiology units, as well as determining the reduction in the dose of radiation absorbed by more sensitive tissues exposed to said clinical exploration. Making use of mannequins, phantom and craniums, we constructed a collimator with a compensating filter and established the necessary technical, dosimetric and quality specifications for its clinical use. Subsequently, we studied 16 patients referred for cephalometric study, determining the radiation dose (TLDs) in both the patients (crystalline lens, frontal lobe, parotid/submaxillary/thyroid glands and brain) and in the radiographic film, as well as in different parts of the collimator/filter. Al presented we are aiming for its clinical use by carrying out LCC in another 16 patients referred of orthodontic treatment but with the pre-a patient introduction of the tested collimator with the compensating filter as a substitute for the usual technique. The collimation reduced the field or radiation by some 40% and with that, so too the radiated tissues. The compensating filter reduced the dose in tissues by some 34.2. Our collimator has allowed the radiological image to be obtained with only one third the usual radiation dose. The dose reaching the film shies only between 17% less than in the usual technique and didn't alter its diagnostic capacity. A reduction of 61,6% of the dose administered to the patient is achieved by incorporating the collimator and filter to most radiological equipment without the need for renovating or substituting existing apparatus. (Author)

  9. Vinculos, transferencia y transversalidad en la clinica grupal. Un estudio realizado en la casa de la niñez II, con niños y adolescentes varones entre 8 y 17 años con experiencia de vida en calle

    OpenAIRE

    Leiva, Paola

    2011-01-01

    En América Latina el fenómeno de la callejización se agudiza cada día más transformándose en un problema social, gestando una población vulnerable del entorno callejero. En nuestro país este emergente se ha ido desarrollando a pasos muy gigantescos. UNICEF indica que existe un aproximado de cien millones de niños que viven en las calles del mundo. En algunas metrópolis de América Latina hay más de 100.0001 niños que viven en las calles, se ha ido incrementando este fenómeno y s...

  10. Práticas da psicologia clínica em face do sofrimento psíquico causado pelo desemprego contemporâneo Prácticas de psicologia clinica frente al sufrimiento psíquico causado por el desempleo contemporáneo Psychology clinical practices towards psychological suffering caused by contemporary unemployment

    Directory of Open Access Journals (Sweden)

    Daniel Abs

    2010-06-01

    Full Text Available Este estudo objetivou compreender as práticas da Psicologia Clínica em face do sofrimento psíquico causado pelo desemprego contemporâneo. Para tanto, foram entrevistados 8 psicólogos da região metropolitana de Porto Alegre, abordando os seus entendimentos sobre as temáticas de trabalho e desemprego, as suas consequências para a subjetividade dos pacientes, as intervenções utilizadas, o auxílio da abordagem teórica nessas intervenções e as possíveis contribuições da Psicologia em relação ao fenômeno estudado. Foi realizada análise de conteúdo para os dados coletados. Os enunciados foram agrupados em quatro temáticas, com as respectivas categorias: Trabalho, Desemprego, Intervenções sobre o desemprego na clínica e Lugar da Psicologia em face do desemprego. Os enunciados destacaram a falta de operadores clínicos para se lidar com esse fenômeno. Concluiu-se que o desemprego é uma temática da clínica psicológica contemporânea, e que esta necessita produzir operadores capazes de, na clínica, dar conta de fenômenos contemporâneos que estão emergindo, como o desemprego. Concluiu-se igualmente que são necessários mais estudos abordando essa temática.Este estudio tuvo el objetivo de comprender las prácticas de Psicología Clínica frente al sufrimiento psíquico causado por el desempleo contemporáneo. Para tal, fueron entrevistados 8 psicólogos de La región metropolitana de Porto Alegre, abordando sus entendimientos de las temáticas de trabajo y desempleo, consecuencias estas para la subjetividad de los pacientes, intervenciones utilizadas, auxilio del abordaje teórico en estas y posibles contribuciones de la Psicología frente al fenómeno estudiado. Fueron realizados análisis del contenido para los datos colectados. Los enunciados fueron agrupados en cuatro temáticas, con sus respectivas categorias: Trabajo, Desempleo, Intervenciones sobre el desempleo en la clínica y lugar de la Psicología frente al desempleo. Los enunciados destacaron la falta de operadores clínicos para lidar con ese fenómeno. Ese estudio concluyó que el desempleo es una temática de la Clínica Psicológica contemporánea, y que hay una necesidad de producirse operadores que den cuenta, en la clínica, de fenómenos contemporáneos que están emergiendo, como el desempleo, y que más estudios son necesarios acercándose a esta temática.This paper aims at understanding the practices of Clinical Psychology towards psychological suffering caused by contemporary unemployment. To this end, eight psychologists from Porto Alegre outskirts were interviewed. They were asked about their understanding of issues regarding work and unemployment and consequences to patients' subjectivity, intervention practices they used and the relationship of these interventions to theories and possible contributions of psychology towards the phenomenon under scrutiny. Content analysis was used to study the data collected during the interviews.Psychologists' utterances have been divided in four groups based on the following categories: work, unemployment, interventions towards unemployment and psychology's contributions to unemployment. The author concludes that clinical psychology needs to prepare professionals who are able to deal, in their clinical practices, with ever emerging contemporary phenomena such as unemployment. It is also highlighted that more investigations on this area of study are necessary.

  11. Práticas locais em clínica e educação: compromissos com a atual América = Local practices in education and clinical psychology: commitments to today’s America = Prácticas locales en clinica y educación: compromissos com la América actual

    Directory of Open Access Journals (Sweden)

    Menezes, Ana Luisa Teixeira de

    2016-01-01

    Full Text Available A experiência de 12 anos de contato e de pesquisa com os Guarani1, através de pesquisas acerca da dança Guarani2, além dos estudos "Infâncias e educação Guarani"3 e "Pensamento originário e mestiço: caminhos decoloniais na formação acadêmica da educação e da psicologia"4, tem oportunizado que se pense o lugar da atual América, os trabalhos clínicos, de educação em diálogo com a ciência moderna, tendo em vista o projeto científico no campo da psicologia e da educação que evidenciam as práticas locais. Por meio da obra de Rodolfo Kusch, propõe-se uma intersecção, desde um ponto de vista situado não apenas geograficamente

  12. Clinical and electrocardiographic characteristics of patients admitted to a thoracic pain unit in the context of a new definition of acute myocardial infarction; Caracteristicas clinicas y electrocardiograficas de los pacientes que ingresan a una unidad de dolor toracico en el contexto de la nueva definicion de infarto agudo de miocardio

    Energy Technology Data Exchange (ETDEWEB)

    Mora, Guillermo; Franco, Roberto; Fajardo, Hugo; Serrano, Daniel; Suarez, Martin

    2005-03-15

    In our environment we do ignore the clinical and para clinical characteristics from patients who come to a thoracic pain unit and more so with the new definition of acute myocardial infarction (Amid). 398 patients admitted to a thoracic pain unit were prospectively evaluated as to the pain characteristics, its risk factors, clinical examination findings, electrocardiographic findings and the troponin a T behaviour. 29.4% of the patients had a diagnosis of Amid, 29.9% of unstable angina and 40.7% of non-ischemic thoracic pain. retrosternal pain, irradiation to the neck, presence of diaphoresis, nausea or vomit are related with a higher probability to the diagnosis of Amid. Male sex and the presence of risk factors such as diabetes or dislipidemia increase the probability of the diagnosis. In the electrocardiogram, only the presence of a lesion, especially subepicardical favors the diagnosis. Unstable angina and in general acute coronary syndrome have a similar although not equal clinical behavior.

  13. Eesti nimekaim ilukirurg jagab enesekindlust / Peep Pree ; intevjueerinud Priit Pullerits

    Index Scriptorium Estoniae

    Pree, Peep, 1958-

    2006-01-01

    Vestlus Tartu esteetilise kirurgia erakliiniku Clinica juhatajaga tööst, vastutustundest, ebaõnnestumistest. Kommenteerivad Tartu linnapea Laine Jänes ja Tartu Ülikooli arstiteaduskonna emeriitprofessor Ennu Sepp

  14. Disease: H01580 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available l features and dietary history, and there is rapid resolution of signs and symptoms after vitamin C suppleme...because alcohol decreases the absorption of vitamin C. The diagnosis of scurvy is generally based on clinica

  15. Equipment for the extraction of 99sup(m)TcO4Na

    International Nuclear Information System (INIS)

    Pliego, O.H.; Fraga de Suarez, A.H.; Goncalvez, Maria de; Marques, Roberto; Guerrero, Gustavo; Mitta, A.E.A

    1980-04-01

    An equipment is described for the extraction of 99 sup(m)Tc by the liquid-liquid extraction method, installed at the Nuclear Medicine Center of theHospital de Clinicas ''Jose de San Martin''. (author) [es

  16. MACVIA clinical decision algorithm in adolescents and adults with allergic rhinitis

    DEFF Research Database (Denmark)

    Bousquet, Jean; Schünemann, Holger J; Hellings, Peter W

    2016-01-01

    The selection of pharmacotherapy for patients with allergic rhinitis (AR) depends on several factors, including age, prominent symptoms, symptom severity, control of AR, patient preferences, and cost. Allergen exposure and the resulting symptoms vary, and treatment adjustment is required. Clinica...

  17. Neonatal Malaria in the Gambia

    African Journals Online (AJOL)

    Uche

    Inclusion Criteria. All consecutive ... these, 105 (26.5%) satisfied the inclusion criteria ..... Bulletin de la Societe de Pathologie Exotique 1991; ... Revista do Hospital das Clinicas; Faculdade de. Medicina Da Universidade de Sao Paulo. 1993 ...

  18. Monochloramine Cometabolism by Nitrifying Biofilm Relevant to Drinking Water

    Science.gov (United States)

    Recently, biological monochloramine removal (i.e., cometabolism) by a pure culture ammonia–oxidizing bacteria, Nitrosomonas europaea, and a nitrifying mixed–culture have been shown to increase monochloramine demand. Although important, these previous suspended culture batch kine...

  19. Pathogenicity of Phytophthora species isolated from rhizosphere soil in the eastern United States

    Science.gov (United States)

    Y. Balci; S. Balci; W.L. MacDonald; K.W. Gottschalk

    2008-01-01

    Pathogenicity of seven Phytophthora species was assessed by inoculation of stem and foliar tissues of oak species (Quercus spp.) native to the eastern United States. Phytophthora cambivora, P. cinnamomi, P. citricola, P. europaea, P. quercina...

  20. Heavy metal accumulation in Melilotus officinalis under crown Olea ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-11-05

    Nov 5, 2008 ... crown Olea europaea L forest irrigated with wastewater. S. Seif Amiri1, H. ... mainly because they are non-biodegradable, non-thermo- ... Soils, as filters of ... transportation to the laboratory, soil samples were air dried, crush-.

  1. African Journal of Biotechnology - Vol 9, No 4 (2010)

    African Journals Online (AJOL)

    Comparative molecular analysis of old olive (Olea europaea L.) genotypes from Eastern Mediterranean Region of Turkey · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C Durgac, Y Kiyga, M Ulas ...

  2. Ethnomedicinal uses of plants among the Somali ethnic group ...

    African Journals Online (AJOL)

    user

    Age, gender, educational status and occupation were identified as important determinants for the use of herbal medicine. Conclusion: .... P.S.Green. (AI-35) ... coffee. Olea europaea L. subsp. cuspidate. (WalL.exG.Don) Cif. (AI-16). Oleaceae.

  3. EJST V9N2

    African Journals Online (AJOL)

    The effects of land use types and soil depth on soil properties of Agedit watershed, Northwest. Ethiopia ... are the most widely practiced activities in Ethiopia. (Eyayu Molla et al., .... are Olea europaea L. subsp cuspidata, Cordia africana Lam.

  4. Vorkommen und Soziologie der Cuscuta-Arten in der Ufervegetation des Niederrheins

    OpenAIRE

    Schmitz, Ulf; Lösch, Rainer

    2016-01-01

    Um den Stand der gegenwärtigen Verbreitung der drei in der Ufervegetation des Niederrheins vorkommenden Cuscuta-Arten C. lupuliformis KROCKER, C. europaea L. und C. gronovii WILLD. festzustellen, wurde eine Kartierung beider Rheinufer zwischen Monheim-Baumberg (Kr. Mettmann) und der niederländischen Grenze durchgeführt. Cuscuta europaea und Cuscuta lupuliformis sind im gesamten Rheinverlauf häufig zu finden, wobei letztere Art die Prallufer des Rheins bevorzugt. Die seltenere Art Cuscuta gron...

  5. Importance of parathyroid SPECT and {sup 99m}Tc scintigraphy, and of clinical, laboratorial, ultrasonographic and cytologic correlation in the pre-operative localization of the parathyroid adenoma - pictorial assay;Importancia da complementacao com SPECT e {sup 99m}Tc na cintilografia das paratiroides e da correlacao clinica, laboratorial, ultrassonografica e citologica na localizacao pre-operatoria do adenoma de paratiroide: ensaio pictorico

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Marco Antonio Conde de, E-mail: marco.oliveira@fleury.com.b [Fleury Medicina e Saude, Sao Paulo, SP (Brazil). Servicos de Medicina Nuclear; Maeda, Sergio Setsuo; Dreyer, Patricia; Lobo, Alberto; Andrade, Victor Piana de; Hoff, Ana O.; Biscolla, Rosa Paula Mello; Smanio, Paola; Brandao, Cynthia M.A.; Vieira, Jose G. [Fleury Medicina e Saude, Sao Paulo, SP (Brazil)

    2010-06-15

    Objective: In patients with primary hyperparathyroidism, candidates for surgical intervention, the parathyroid pre-operative localization is of fundamental importance in planning the appropriate surgical approach. Materials and methods: The additional acquisition of SPECT and Technetium-99m images, during parathyroid scintigraphy with Sestamibi, is not common practice. Usually, only planar image acquisition, 15 minutes prior and 2 hours after radiopharmaceutical administration, is performed. Results: in our experience, the complete protocol in parathyroid scintigraphy increases the accuracy of pre-operative parathyroid localization. Conclusion: the complete utilization of all available nuclear medicine methods (SPECT e {sup 99m}Tc) and image interpretation in a multidisciplinary context can improve the accuracy of parathyroid scintigraphy. (author)

  6. The Use of Technetium-99m as a Clinical Scanning Agent for Thyroid, Liver and Brain; Utilisation du {sup 99m}Tc comme Agent d'Exploration Clinique de la Thyroide, du Foie et du Cerveau; Ispol'zovanie Tc{sup 99m} kak klinicheskogo agenta pri skennirovanii shchitovidnoj zhelezy, pecheni i mozga; Empleo del {sup 99m}Tc como Agente para la Exploracion Clinica de la Tiroides, el Higado y el Cerebro

    Energy Technology Data Exchange (ETDEWEB)

    Harper, P. V.; Lathrop, K. A.; McCardle, R. J.; Andros, G. [Argonne Cancer Research Hospital and Department of Surgery, University of Chicago Hospitals and Clinics, Chicago, IL (United States)

    1964-10-15

    In the search for an isotope that will be ''ideal'' for scanning, Tc{sup 99m} appears to offer many advantages. This substance emits a clean 140-keV {gamma}-ray (9% converted) with no particle radiation, has a 6-h physical half-life, and is readily available at reasonable cost as the daughter of 2.7-d Mo{sup 99}, from which it is readily separated on an alumina column. In its usual form (Tc{sup 99m}O{sub 4}{sup -}) it is distributed in the body in a manner very similar to CIO{sub 4}{sup -} and I{sup -}, being rapidly distributed in the extracellular space and specifically trapped by the thyroid, stomach and salivary glands. Excretion data indicate a biological half-life of about 2 d. Thyroid scans of a superior quality, with an estimated radiation dosage of 100 mrad to the gland and 5 mrad total-body radiation, may be made between one-half and one hour after a 1-mc dose of this material - a very great improvement over I{sup 131}. TcO{sub 4} does not cross the blood-brain barrier freely, so that spectacular brain scans have been obtained with 2 to 5 min scanning time by making use of the high count-rate available from 5 to 10-mc doses of Tc{sup 99m}. As the pentavalent thiocyanate dissolved in fat emulsion, Tc{sup 99m} localizes in the liver to a large extent; the high count-rate available again permits rapid scans of this gland with improved resolution. It is anticipated that further gains with this isotope may be made possible by the use of probes of increased efficiency and by further manipulation of biological and chemical parameters. (author) [French] Dans la recherche du radioisotope 'ideal' pour la gammagraphie, {sup 99m}Tc- semble offrir de nombreux avantages. C'est un emetteur gamma pur de 140 keV (converti a 9%, sans rayonnement particulaire, ayant une periode de 6 h; on peut l'obtenir facilement et a peu de frais comme produit de filiation de {sup 99}Mo, qui a une periode de 67 h, dont on le separe aisement sur une colonne d'alumine. Sous sa forme habituelle ({sup 99m}TcO{sub 4}{sup -}), il se repartit dans le corps d'une facon tres semblable a CIO{sub 4}{sup -} et I{sup -}, c'est-a-dire qu'il est rapidement disperse dans l'espace extra-cellulaire et accumule selectivement par la thyroiede, l'estomac et les glandes salivaires. Les donnees fournies par les excreta indiquent que la periode biologique est d'environ deux jours. On peut faire d'excellents scintigrammes de la thyroiede; avec une irradiation evaluee a 100 mrad pour la thyroiede, et a 5 mrad pour l'ensemble du corps, une demi-heure a une heure apres administration de 1 mc de {sup 99m}TcO{sub 4}{sup -}, ce qui represente un tres grand progres par rapport a l'utilisation de {sup 131}I. TcO{sub 4} ne traverse pas librement la barriere sang-cerveau, de sorte que l'on a obtenu des scintigrammes spectaculaires du cerveau avec un temps de balayage de 2 a 5 min grace au taux de comptage eleve fourni par des doses de 5 a 10 me de 99mTc. Comme le thiocyanate pentavalent se dissout dans une emulsion de corps gras, {sup 99m}TcO{sub 4}{sup -} se localise en grande partie dans le foie; la aussi, le taux de comptage eleve permet des explorations rapides avec une meilleure resolution. On espere qu'il sera possible de faite de nouveaux progres avec ce radioisotope grace a l'utilisation de sondes plus efficaces et a une manipulation plus poussee des parametres biologiques et chimiques. (author) [Spanish] El {sup 99m}Tc es uno de los isotopos que mas ventajas ofrecen para la exploracion cen- telleografica. Emite rayos gamma limpios de 140 keV (9% de conversion) sin radiacion corpuscular, tiene un periodo fisico de 6 h y puede obtenerse facilmente a un precio razonalbe como descendiente del {sup 99}Mo, (periodo: 2,7 d) del que se separa sin dificultad en una columna de alumina. En su forma usual ({sup 99m}TcO{sub 4}{sup -}) se distribuye por el cuerpo de manera muy parecida al CIO{sub 4}{sup -} y al I{sup -}, penetra rapidamente en el espacio extra- celular y es captado selectivamente por la tiroides, el estomago y las glandulas salivales. Los datos facilitados por la excrecion indican que su periodo biologico es de unos 2 d. Con una dosis de irradiacion calculada en 100 mrad para la glandula y en 5 mrad para el cuerpo entero, se pueden efectuar exploraciones tiroideas de muy buena calidad entre meedia hora y una hora despues de administrar 1 me de esta sustancia lo que representa una gran ventaja sobre el {sup 131}I. El TcO{sub 4} no atraviesa libremente la barrera hematoencefalica, lo que ha permitido obtener excelentes imagenes del cerebro con un tiempo de exploracion de 2 a 5 min aprovechando el elevado fndice de recuento correspondiente a dosis de 5 a 10 me de {sup 99m}Tc. Como el tiocianap pentavalente se disuelve en una emulsion de grasa, gran parte del {sup 99m}Tc se localiza en el higado; en este caso el elevado fndice de recuento permite tambien proceder a una rapida exploracion de esta glandula con un'mayor poder de resolucion. Es muy probable que este tipo de mejores resultados aun utilizando sondas mas eficaces y adaptando los parametros biologicos y quimicos a condiciones optimas. (author) [Russian] Pri poiskah ''ideal'nogo'' izotopa dlja skennirovanija tehnecij-99m, povidimomu, imeet mnogo preimushhestv. Jeto veshhestvo javljaetsja chistym gamma-izluchatelem s jenergiej 140 kjev (9% konveosija) otsutstvii izluchenija chastic, imeet shestichasovoj fizicheskij period poluraspada, umerennuju stoimost', javljaetsja dostupnym dochernim produktom molibdena-99 s periodom poluraspada 2,7 dnja, ot kotorogo on legko otdeljaetsja na kolonke s okis'ju aljuminija. V obychnoj forme (Tc{sup 99m}O{sub 4}{sup -}) on raspredeljaetsja v organizme tak zhe kak CIO{sub 4}{sup -} i J, bystro rasprostranjajas' vo vnekletochnom prostranstve, izbiratel'no zahvatyvaetsja shhitovidnoj zhelezoj, zheludkom i sljunnymi zhelezami. 5 sootvetstvii s dannymi vydelenija period poluvyvedenija sostavljaet priblizitel'no dva dnja. Chetkie skennogrammy shhitovidnoj zhelezy s raschetnoj dozoj obluchenija 100 mlrd. na zhelezu i 5 mlrd. na ves' organizm mogut byt' snjaty v period ot poluchasa do 1 chasa posle vvedenija 1 mkjuri jetogo materiala -jeto bol'shoe preimushhestvo po sravneniju s jodom-131. Tc{sup 99m} ne pronikaet cherez gemato-jencefalicheskij bar'er, pojetomu jeffektnye skennogrammy mozga byli polucheny v techenie 2 - 5 minut pri vysokoj skorosti scheta v rezul'tate ispol'zovanija 5 - 10 mkjutjei tehnecija-99 t. Poskol'ku pjativalentnyj tiocianat rastvoren v zhirovoj jemul'sii, tehnecij-99t v znachitel'noj stepeni lokalizuetsja i pecheni: ppi bol'shoj skooosti schetja snova mozhno poluchit' skennogoammm jetogo opgjanja s luchshim razresheniem. Predpolagaetsja, chto pri ispol'zovanii jetogo izotopa mozhno poluchit' luchshie rezul'taty pri primenenii bolee jeffektivnyh prob i podbora biologicheskih i himicheskih parametrov. (author)

  7. Generator 113{sup S}n-113m{sup I}n. Study of the most important characteristics in the evaluate composition for the preparation of clinical labelled compounds; Generador de 113{sup S}n- 113m{sup I}n. Estudio de las caracteristicas mas relevantes en la composicion del eluido con miras a la obtencion de compuestos marcados de aplicacion clinica

    Energy Technology Data Exchange (ETDEWEB)

    Adan, L; Rebollo, D V

    1978-07-01

    The design for the construction of a generator 113{sup S}n -113m{sup l}n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs.

  8. Comparative study of bridge plate associated to the intramedullary pin and the dynamic compression plate on the experimental osteotomy fixation of femoral in rabbits (Oryctolagus cuniculus). Clinical, radiographic, histological and scintigraphy analyses; Estudo comparativo da placa em ponte associada ao pino intramedular e da placa de compressao dinamica na fixacao de osteotomia experimental em femur de coelhos (Oryctolagus cuniculus). Analises clinica, radiografica, histologica e cintilografica

    Energy Technology Data Exchange (ETDEWEB)

    Borges, Natalie Ferreira

    2011-07-01

    The objectives were to benchmark and monitor the fracture healing of femoral osteotomy in rabbits after fixation with dynamic compression plate and bridge plate associated with intramedullary pin. Were used 14 New Zealand rabbits, four months old with mean weight of 3.5 pounds, from the Experimental Farm Professor Helio Barbosa of the Veterinary School of Minas Gerais Federal Univ. (UFMG). The animals were randomly divided into two groups (I and II). All rabbits underwent osteotomy across the middle third of right femur. In the group I was made to fix the osteotomy with the bridge plate (BP) associated with intramedullary pin, introduced the technique of minimal invasion. In group II, we used dynamic compression plate (DCP) via the conventional approach. Both groups were evaluated clinical, radiographic, histologic and scintigraphic findings. Clinical assessments were performed weekly until the 12{sup th} postoperative week and radiographic examinations were performed before, immediately after, at 15, 30, 45, 60 and 90 days. The bone scintigraphy were performed before and at 20, 50 and 90 days after surgery to monitor the bone metabolism qualitatively and quantitatively. Observed perfusion and bone healing process. After 90 days of study, there was histopathologic evaluation of the osteotomized area and the insertion of screws. In the region of the osteotomy was observed predominance of trabecular bone in group I and group II, the predominance of bone osteons, compatible with the original bone. On insertion of the screws did not differ between groups and there was cortical discontinuity, little necrosis and local hemorrhage. The two types of fixation have led to consolidation within the scheduled period, maturing in early fixation with DCP fixation compared with BP. Scintigraphy demonstrated by the indices of activity and image characteristics, the process of bone healing was significantly greater in animals undergoing early fixation with DCP. (author)

  9. Cooley’s Anemia Symposium (6th) Held in New York on 13-15 March 1990. Annals of the New York Academy of Sciences. Volume 612

    Science.gov (United States)

    1990-12-28

    bIstituto di Ricerca sulle Talassemie e Anemie Mediterranee Consiglio Nazionale delle Ricerche Cagliari Italy dlstituto di Clinica e Biologia dell’Eta...Persistence of Fetal Hemoglobin S. OTTrOLENGHI,a S. NICOLIS, a C. BERTINI,a A. RONCHI, a S. CROTfA,a AND B. GIGLIONIb ’Dipartimento di Genetica e di Biologia ...TERESA TUVERI, b MARIA TERESA SCALAS,b GIOVANNI MONNI,d GIOVANNI OLLA,d AND RENZO GALANELLOb blstituto di Clinica e Biologia dell’Etti Evolutiva

  10. Walter Charleton (1620 - 1707 e sua Teoria Atômica The atomic theory of walter charleton (1620 - 1707

    Directory of Open Access Journals (Sweden)

    Paulo Alves Porto

    1997-06-01

    Full Text Available Several authors in the 17th century used the atomic hypothesis to explain observable phenomena. This paper analyzes some ideas about chemical transformation proposed by the English physician Walter Charleton. In Physiologia Epicuro-Gassendo-Charltoniana (London, 1654, Charleton examined philosophical aspects of the atomic theory, and suggested that the best explanation for all natural phenomena would be only in terms of atoms and their motions. Sometimes, however, he had to attribute to the atoms some kind of "internal virtue", to explain more complex properties of the matter. His idea of "element", and the little use of experimentation and quantification, also limited the range of Charleton's theory.

  11. [The physiotherapic aspect of omeral epicondilitis (author's transl)].

    Science.gov (United States)

    Marenghi, P; Tella, G C

    1976-01-01

    The Authors describe history, etiopatogenesis, clinic, therapy of omeral epicondilitis, very frequent affection. Physiotherapic aspects are studied by different methods. The indications are different compared to clinical aspect, pain modality, relapse eventuality. They conclude with personal considerations based on what observed in Orthopedic Clinica of Parma University.

  12. Vector competence of Culicoides sonorensis (Diptera: Ceratopogonidae) to epizootic hemorrhagic disease virus serotype 7

    Science.gov (United States)

    Background: Culicoides sonorensis (Diptera: Ceratopogonidae) is a vector of epizootic hemorrhagic disease virus (EHDV) serotypes 1 and 2 in North America, where these viruses are well-known pathogens of white-tailed deer (WTD) and other wild ruminants. Although historically rare, reports of clinica...

  13. Farmacos orales para el control quimico de las biopeliculas dentales (placa bacteriana

    Directory of Open Access Journals (Sweden)

    Rodrigo Abello Moreno

    2013-12-01

    Full Text Available La placa dentobacteriana o biopelicula es la responsable de patologias clinicas como la caries dental, gingivitis y enfermedad periodontal, por lo tanto productos con agentes germicidas actuan en la prevencion de la biopelicula dental cuando las medidas de higiene oral no son las mas apropiadas.

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 551 - 600 of 643 ... Samuel Adetunji Onasanwo, Gideon Nimedia Aitokhuehi, Opeyemi Temitayo Ajayi, Samuel Oluwaseun Faborode. Vol 4, No 3 (2001), the assessment of fasciola gigantica infection in the rabbit(Oryctolagus cuniculus) as a laboratory model parasite development - Clinica symptoms and liver pathology ...

  15. Phase 1 dose-escalation study of the antiplacental growth factor monoclonal antibody RO5323441 combined with bevacizumab in patients with recurrent glioblastoma

    DEFF Research Database (Denmark)

    Lassen, Ulrik; Chinot, Olivier L; McBain, Catherine

    2015-01-01

    BACKGROUND: We conducted a phase 1 dose-escalation study of RO5323441, a novel antiplacental growth factor (PlGF) monoclonal antibody, to establish the recommended dose for use with bevacizumab and to investigate the pharmacokinetics, pharmacodynamics, safety/tolerability, and preliminary clinica...

  16. Implementation of a radiology information system in an University Hospital

    International Nuclear Information System (INIS)

    Marques, Paulo Mazzoncini de Azevedo; Santos, Antonio Carlos; Elias Junior, Jorge; Trad, Clovis Simao; Goes, Wilson Moraes; Castro, Carlos Roberto de

    2000-01-01

    This paper describes a radiology information system (RIS) developed and in the process of implementation in an University Hospital (Hospital das Clinicas da Faculdade de Medicina de Ribeirao Preto - Universidade de Sao Paulo) which integrates a plan for a 'filmless' radiology facility. (author)

  17. Control of Chaos: New Perspectives in Experimental and Theoretical Science. International Journal of Bifurcation and Chaos in Applied Sciences and Engineering. Theme Issue. Part 2, Volume 8, Number 9, September 1998.

    Science.gov (United States)

    1998-09-01

    GARBO*, R. BALOCCHIt and S. CHILLEMI* *Istituto di Biofisica CNR, Via S. Lorenzo 26, 56127 Pisa, Italy tIstituto di Fisiologia Clinica CNR, Via...Publishing Company DIFFUSION PARAMETER CONTROL OF SPATIOTEMPORAL CHAOS RAUL MONTAGNE* Instituto de Fisica, Facultad de Ciencias & Facultad de Ingenieria

  18. Spanish Navy Up to Date Data in DCS

    Science.gov (United States)

    2001-06-01

    therapeutic measures. Final results are similar to another world navies diving centres Bibliography: 1.- Pujante, A.; Inoriza, J; Viqueira, A. Estudio de 121... casos de enfermedad descompresiva Medicina Clinica, vol . 94, n` 7, 1990 2.- Rivera, J.C. Decompression sickness among divers: An analysis of 935

  19. Temporal evolution of the environmental doce remaining in a clinical irradiation bunker after the cessation of irradiation

    International Nuclear Information System (INIS)

    Ruiz Egea, E.; Sanchez Carrascal, M.; Torres Pozas, S.; Monja Ray, P. de la; Perez Molina, J. L.; Madan Rodriguez, C.; Luque Japon, L.; Morera Molina, A.; Hernandez Perez, A.; Barquero Bravo, Y.; Morengo Pedagna, I.; Oliva Gordillo, M. C.; Martin Olivar, R.

    2011-01-01

    In this paper we try to quantify tite doce emitted by different radioactive processes that occur in the head of a clinica. Linear accelerator and the patient is irradiated, or wallc of the bunker, converted into tertiary sources of radiation trying to ectablish tite origin of the came in different parts of the bunker.

  20. Influence of Progressive Central Hypovolemia on Multifractal Dimension of Cardiac Interbeat Intervals

    Science.gov (United States)

    2010-05-07

    and 5 Istituto Fisiologia Clinica, CNR-Area Ricerca San Cataldo, Via Moruzzi 1, 56124-Pisa (Dated: May 7, 2010) Abstract We analyzed the heartbeat time...the research group of prof. B Ghe- larducci, Dipartimento di Fisiologia e Biochimica, Universitá di Pisa, and Dr. M. Varanini, Institute of Clinical

  1. From Self-Organized to Extended Criticality

    Science.gov (United States)

    2012-04-26

    Texas, Denton, TX, USA 2 Centro EXTREME, Scuola Superiore Sant’Anna, Pisa, Italy 3 Istituto di Fisiologia Clinica-CNR, Pisa, Italy 4 Department of Physics...Netherlands Klaus Linkenkaer-Hansen, Center for Neurogenomics and Cognitive Research, Netherlands *Correspondence: Paolo Allegrini , Istituto di Fisiologia

  2. Human immunodeficiency virus (HIV) seropositivity and hepatitis B ...

    African Journals Online (AJOL)

    Method: A total of 130 donors comprising 120 commercial donors and 10 voluntary donors were tested for antibodies to human immunodeficiency virus and hepatitis B surface antigen in Benin city using Immunocomb HIV - 1 and 2 Biospot kit and Quimica Clinica Aplicada direct latex agglutination method respectively.

  3. Musicoterapia e improvisaciòn libre

    DEFF Research Database (Denmark)

    Bergstrøm-Nielsen, Carl

    2003-01-01

    Muchos de los métodos de trabajo que se utilizan en musicoterapia se basan en la improvisación. En la practica clinica se plantean numerosas situaciones en las que el musicoterapeuta necesita contar con habilidades avanzadas de improvisación. Este articulo presenta algunas ideas y sugerencias prá...

  4. Executive functions in mono- and bilingual children with language impairment - issues for speech-language pathology.

    OpenAIRE

    Sandgren, Olof; Holmström, Ketty

    2015-01-01

    The clinical assessment of language impairment (LI) in bilingual children imposes challenges for speech-language pathology services. Assessment tools standardized for monolingual populations increase the risk of misinterpreting bilingualism as language impairment. This Perspective article summarizes recent studies on the assessment of bilingual LI and presents new results on including nonlinguistic measures of executive functions in the diagnostic assessment. Executive functions shows clinica...

  5. La Antracnosis del olivo y su efecto en la calidad del aceite

    Directory of Open Access Journals (Sweden)

    Moral, J.

    2014-06-01

    Full Text Available Olive (Olea europaea subsp. europaea var. europaea is one of the first domesticated and cultivated trees that is widely distributed in the Mediterranean regions. The Anthracnose, caused by the two complex fungal species Colletotrichum acutatum and C. gloeosporioides, is the most important disease adversely affecting the olive oil quality. Even so, the effect of Anthracnose on oil quality is largely unknown and many questions remain unanswered. This offers a unique opportunity to study how Colletotrichum species, cultivars, infection type (latent or visible and severity, and other factors that may affect different parameters of oil quality, such us acidity, peroxide value, K232, K270, phenolic compounds, or alkyl esters. This review focuses on the current knowledge of the biology, epidemiology, and management of Anthracnose and its effect on olive oil quality.El olivo (Olea europaea subsp. europaea var. europaea es uno de los primeros cultivos leñosos domesticados. Actualmente el olivo se encuentra ampliamente distribuido por todas las regiones de clima mediterráneo. La Antracnosis, causada por las especies complejas Colletotrichum acutatum y C. gloeosporioides, es la enfermedad del olivo que más afecta a la calidad del aceite. Aun así, el efecto de la Antracnosis en la calidad del aceite es ampliamente desconocido. Por lo que creemos esencial que se afronten estudios encaminados a dilucidar el efecto de las especies del patógeno, el cultivar de olivo y el tipo (latente o visible y severidad de las infecciones de la aceituna en los distintos parámetros de calidad del aceite como la acidez, índice de peróxidos, K232, K270, compuestos fenólicos o ésteres alquílicos. Esta revisión presenta los conocimientos actuales sobre la biología, epidemiología, control, y efecto en la calidad del aceite de la Antracnosis del olivo.

  6. Distribution and co-existence of the Macropis species and their cleptoparasite Epeoloides coecutiens (Fabr.) in NW Europe Hymenoptera: Apoidea, Melittidae and Apidae)

    DEFF Research Database (Denmark)

    Pekkarinen, Antti; Berg, Øistein; Calabuig, Isabel

    2003-01-01

    The Macropis species collect pollen and fatty oil secreted by flowers of loosestrifes (Lysimachia, Primulaceae) and are the only known oil-collecting bees in the Holarctic. In NW Europe, L. vulgaris is the main or (in large areas) sole pollen and oil source for M. europaea Warncke (labiata auct.......) and M. fulvipes (Fabr.). The species are largely sympatric in southern Finland and the Baltic countries, while in Scandinavia and most of Denmark only M. europaea has been recorded. The ranges of the Macropis species are restricted to the areas of common occurrence of L. vulgaris. Presumably, Epeoloides...

  7. Proceedings of the 13. Annual meeting of the Federation of Societies on Experimental Biology; 23. Brazilian congress on biophysics; 30. Brazilian congress on pharmacology and experimental therapeutics; 33. Brazilian congress on physiology; 14. Brazilian congress on clinical research; 22. Brazilian congress on neuroscience and behaviour. Abstracts; Anais do 13. Reuniao anual da Federacao de Sociedades de Biologia Experimental; 23. Congresso brasileiro de biofisica; 30. Congresso brasileiro de farmacologia e terapeutica experimental; 33. Congresso brasileiro de fisiologia; 14. Congresso brasileiro de investigacao clinica; 22. Congresso brasileiro de neurociencias e comportamento. Resumos

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-07-01

    Several aspects concerning neuroscience and behavior, compared physiology, endocrinology, pharmacology, molecular immunology and immuno diagnosis, biochemistry, genetic and toxicology of either animals, plants and microorganisms are studied. Topics such as cell membrane structures (including receptors), enzymatic assays, biological pathways, structural chemical analysis, metabolism, biological functions, blood pressure regulation are focused. The use of radiolabelled compounds, e.g. radioassay, radioimmunoassay, radioreceptor assay, are the most applied techniques.

  8. Mining olive genome through library sequencing and bioinformatics ...

    African Journals Online (AJOL)

    As one of the initial steps of olive (Olea europaea L.) genome analysis, a small insert genomic DNA library was constructed (digesting olive genomic DNA with SmaI and cloning the digestion products into pUC19 vector) and randomly picked 83 colonies were sequenced. Analysis of the insert sequences revealed 12 clones ...

  9. Antifungal activity of olive cake extracts

    OpenAIRE

    Ghandi H. Anfoka; Khalil I. Al-Mughrabi; Talal A. Aburaj; Wesam Shahrour

    2001-01-01

    Powdered, dried olive (Olea europaea) cake was extracted with hexane, methanol and butanol. Six phenolic compounds, coumaric acid, ferulic acid, oleuropein, caffeic acid, protocatechuic acid and cinnamic acid, were isolated from these extracts after fractionation. The fractions were tested for their antifungal activity against Verticillium sp., Fusarium oxysporum, Rhizopus sp., Penicillium italicum, Rhizoctonia solani, Stemphylium solani, Cladosporium sp., Mucor sp., Colletotrichu...

  10. Antithrombotic effect of repeated doses of the ethanolic extract of ...

    African Journals Online (AJOL)

    Antithrombotic effect of repeated doses of the ethanolic extract of local olive ( Olea europaea L.) leaves in rabbits. ... The incidence of thromboembolic diseases is increasing, and they are a major cause of mortality and morbidity worldwide. Mediterranean diet is known for its high content of olive products, especially olive oil, ...

  11. Komise pro dějiny a vývoj evropského zemědělství SIEF a česká etnografie v 60.-80. letech 20. století

    Czech Academy of Sciences Publication Activity Database

    Woitsch, Jiří

    2017-01-01

    Roč. 34, č. 1 (2017), s. 48-76 ISSN 1211-8117 R&D Projects: GA ČR GA15-03754S Institutional support: RVO:68378076 Keywords : SIEF * Commission for History and Development of European Agriculture * Ethnologia Europaea * agriculture * international projects Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  12. Fruit load governs transpiration of olive trees

    NARCIS (Netherlands)

    Bustan, Amnon; Dag, Arnon; Yermiyahu, Uri; Erel, Ran; Presnov, Eugene; Agam, Nurit; Kool, Dilia; Iwema, Joost; Zipori, Isaac; Ben-Gal, Alon

    2016-01-01

    We tested the hypothesis that whole-tree water consumption of olives (Olea europaea L.) is fruit load-dependent and investigated the driving physiological mechanisms. Fruit load was manipulated in mature olives grown in weighing-drainage lysimeters. Fruit was thinned or entirely removed from

  13. New chorological data and floristic notes for Albania

    DEFF Research Database (Denmark)

    Shuka, L.; Malo, Sadik; Tan, Kit

    2011-01-01

    Twelve taxa belonging to fi ve families are reported based on fi eldwork in Albania from 2007 to 2010. Eleven have not been recorded for the country in the relevant volumes of Flora Europaea, Flora of Albania or the Med-Checklist. Notes on ecology and distribution are provided and all the taxa ar...

  14. Ammonium and hydroxylamine uptake and accumulation in Nitrosomonas

    NARCIS (Netherlands)

    Schmidt, I.; Look, C.; Bock, E.; Jetten, M.S.M.

    2004-01-01

    Starved cells of Nitrosomonas europaea and further ammonia oxidizers were able to rapidly accumulate ammonium and hydroxylamine to an internal concentration of about 1 and 0.8 M, respectively. In kinetic studies, the uptake/accumulation rates for ammonium [3.1 mmol (g protein)(-1) min(-1)] and

  15. Dicty_cDB: Contig-U11840-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AJ304826 |pid:none) Vombatus ursinus complete mitochon... 278 1e-72 AY083457_1(... AY083457 |pid:none) Roboastra europaea mitochondrion, ... 278 1e-72 EU877953_2( EU877953 |pid:none) Tetraph

  16. Author Details

    African Journals Online (AJOL)

    Herb yield and chemical composition of basil (Ocimum basilicum L) essential oil in relation to the different harvest period and cultivation conditions. Abstract PDF · Vol 13, No 2 (2016) - Articles Relationship between total phenolic, total flavonoid and oleuropein in different aged olive (Olea europaea l.) Cultivar leaves

  17. Muistsed jumalad ühiskonna teenistuses : pseudomütoloogia Eesti avalikkuses 19. ja 20. sajandil / Ants Viires

    Index Scriptorium Estoniae

    Viires, Ants, 1918-2015

    2001-01-01

    Bibl. viidetes, lk. 519-520. Varem ilmunud: Ethnologia Europaea, 1991, nr. 21. Pealk.: Pseudomythology in Estonian publicity in the 19th and 20th century. Pseudomütoloogiliste kangelaste laiem levik algas Fr. R. Kreutzwaldi "Kalevipoja" ja Fr. R. Faehlmanni muistendite avaldamisega

  18. Author Details

    African Journals Online (AJOL)

    Sghir, F. Vol 61 (2013) - Articles Mycorrhizal status of Olea europaea spp. oleaster in Morocco Abstract PDF · Vol 64 (2013) - Articles Diversity of arbuscular mycorrhizal fungi in the rhizosphere of Coffea arabica in the Republic of Yemen Abstract PDF. ISSN: 1997-5902. AJOL African Journals Online. HOW TO USE AJOL.

  19. Environmental impact from mountainous olive orchards under different soil-management systems (SE Spain)

    NARCIS (Netherlands)

    Francia-Martinez, J.R.; Duran Zuazo, V.H.; Martinez-Raya, A.

    2006-01-01

    Soil erosion, runoff and nutrient-loss patterns over a two-year period (1999¿2000) were monitored in erosion plots on a mountainside with olive (Olea europaea cv. Picual) trees under three different types of soil management: (1) non-tillage with barley (Hordeum vulgare) strips of 4 m width (BS); (2)

  20. Antithrombotic effect of repeated doses of the ethanolic extract of ...

    African Journals Online (AJOL)

    2013-05-22

    May 22, 2013 ... extract of local olive (Olea europaea L.) leaves in rabbits. Abdallah M. ... olives have focused on olive oil and a few on olive leaves (OLEs). In this study .... thrombus was carefully removed, blotted on filter paper, and weighed ...

  1. Molecular characterization of olive cultivars grown in Iraq using ...

    African Journals Online (AJOL)

    The results of this research confirmed AFLP and SSR to be useful tools in genetic relationships among olive cultivars, in creating a molecular database for Iraqi olive cultivars, in breeding strategies and in correct cultivar identification. Keywords: Olea europaea, genetic diversity, amplified fragment length polymorphism ...

  2. AcEST: DK944957 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ant alignments: (bits) Value sp|Q82Y15|ORN_NITEU Oligoribonuclease OS=Nitrosomonas europaea G... 31 1.7 sp|Q9JLC8|SACS_MOUSE Sacsi...LVVTDAQLNTLAEAPVLVVHQPDDI 54 >sp|Q9JLC8|SACS_MOUSE Sacsin OS=Mus musculus GN=Sacs PE=1 SV=2 Length = 4582 Sc

  3. The significance of spatial and temporal patterns of algal mat deposition in structuring salt-marsh vegetation

    NARCIS (Netherlands)

    Van Soelen, J.; Herman, P.M.J.; Bouma, T.J.

    2006-01-01

    Question: Are there hot spots of algal mat deposition in space and time at the marsh scale and, if so, how does this affect the coexistence of a dominant (Spartina anglica) and gap dependent (Salicornia europaea) species? Location: The Rattekaai salt marsh in the Scheldt estuary in the southwestern

  4. Arbuscular mycorrhizal fungi improve the growth of olive trees and ...

    African Journals Online (AJOL)

    Two native Algerian mycorrhizal fungi (Glomus mosseae and Glomus intraradices) were tested for their effect on the growth of micropropagated olive tree (Olea europaea L.). The effect of inoculation of plantlets with G. mosseae was also compared with chemical fertilization using osmocote. Specific molecular techniques ...

  5. Growth rates of important East African montane forest trees, with ...

    African Journals Online (AJOL)

    These trees showed growth rates at least twice as high as those of the primary species. Juniperus procera was found to be the fastest growing species in the cedar forest, underlining its success in forming dense stands after a fire. Only young Podocarpus latifolius showed a similar fast growth. Olea europaea ssp. cuspidata, ...

  6. Effect of Extraction Conditions on the Antioxidant Activity of Olive Wood Extracts

    NARCIS (Netherlands)

    Pérez-Bonilla, M.; Salido, S.; Sánchez, A.; Beek, van T.A.; Altarejos, J.

    2013-01-01

    An investigation to optimize the extraction yield and the radical scavenging activity from the agricultural by-product olive tree wood (Olea europaea L., cultivar Picual) using six different extraction protocols was carried out. Four olive wood samples from different geographical origin, and

  7. Preliminary assay on the radical scavenging activity of olive wood extracts

    NARCIS (Netherlands)

    Altarejos, J.; Salido, S.; Pérez-Bonilla, M.; Linares-Palomino, P.J.; Beek, van T.A.; Nogueras, M.; Sánchez, A.

    2005-01-01

    The dichloromethane and ethanol extracts of Olea europaea wood (picual olive cultivar) were screened for antioxidant activity, determined by the DPPH free radical scavenging assay. The ethanol extract displayed potent antioxidant activity. (c) 2005 Elsevier B.V. All rights reserved.

  8. Phytotherapy for children's nocturnal enuresis | Ahmadipour ...

    African Journals Online (AJOL)

    Results have shown that Zingiber officinale, Valeriana officinalis, Alcea rosea, Elettaria cardamomum, Cinnamomum verum, Ribes uva-crispa, Cornus mas, Juglans regia, Vitis vinifera, Sinapis spp., Olea europaea, and Prunus cerasus are a number of important plants that are effective on nocturnal enuresis in traditional ...

  9. A decade of experience with the European Company

    NARCIS (Netherlands)

    Cremers, J.; Stollt, M.; Vitols, S.

    2013-01-01

    A little more than a decade ago one of the most significant developments in European company law and worker participation occurred: the European Union passed a Regulation and Directive on the European Company (or Societas Europaea, hereafter SE). This legislation is a major innovation in that it

  10. Preparation, characterization and antibacterial effects of eco-friendly ...

    African Journals Online (AJOL)

    Purpose: To synthesize and characterize eco-friendly gold nanorods (Au-NRs) and to assess their effects against two bacterial strains. Methods: Synthesis of eco-friendly gold nanorods was done from an aqueous solution of chloroauric acid and cetyltrimethylammonium bromide by mixing Olea europaea fruit and Acacia ...

  11. Near-infrared spectroscopy for detection of hailstorm damage on olive fruit

    Science.gov (United States)

    A rapid, robust, unbiased and inexpensive discriminant method capable of classifying olive fruit (Olea europaea L.) on the basis of the presence of hailstorm damage is economically important to the olive oil milling industry. Thus, in the present study, the feasibility of Near-Infrared (NIR) spectro...

  12. Syringa oblata Lindl var. alba as a source of oleuropein and related compounds

    NARCIS (Netherlands)

    Nenadis, N.; Vervoort, J.J.M.; Boeren, J.A.; Tsimidou, M.Z.

    2007-01-01

    The leaf methanol extract of Syringa oblata Lindl var. alba was investigated as a source of oleuropein and related compounds. The extract had a high total phenol content and a radical scavenging activity similar to that of the respective extract from Olea europaea leaves. HPLC-DAD characterisation

  13. Populations of Bactrocera oleae (Diptera: Tephritidae) and Its Parasitoids in Himalayan Asia

    Science.gov (United States)

    For a biological control program against olive fruit fly, Bactrocera oleae Rossi, olives were collected in the Himalayan foothills (China, Nepal, India, and Pakistan) to discover new natural enemies. Wild olives, Olea europaea ssp. cuspidata (Wall ex. G. Don), were sparsely distributed and fly-infes...

  14. Genome sequence and genetic diversity of European ash trees

    DEFF Research Database (Denmark)

    Sollars, Elizabeth S A; Harper, Andrea L; Kelly, Laura J

    2017-01-01

    -heterozygosity Fraxinus excelsior tree from Gloucestershire, UK, annotating 38,852 protein-coding genes of which 25% appear ash specific when compared with the genomes of ten other plant species. Analyses of paralogous genes suggest a whole-genome duplication shared with olive (Olea europaea, Oleaceae). We also re...

  15. How does corporate mobility affect lawmaking? A comparative analysis

    NARCIS (Netherlands)

    Bratton, W.W.; McCahery, J.A.; Vermeulen, E.P.M.

    2008-01-01

    This paper examines the impact of increased corporate mobility on corporate lawmaking in the European Union (EU). More specifically, we seek an answer to a simple question: Has the increased mobility which arose from the implementation of the Societas Europaea (SE) and the path-breaking decisions of

  16. How does corporate mobility affect lawmaking?: a comparative analysis

    NARCIS (Netherlands)

    Bratton, W.W.; McCahery, J.A.; Vermeulen, E.P.M.

    2009-01-01

    This paper examines the impact of increased corporate mobility on corporate lawmaking in the European Union (EU). More specifically, what is the answer to a simple question: has the increased mobility which arose from the implementation of the Societas Europaea (SE) and the path-breaking decisions

  17. Molecular characterization of olive cultivars grown in Iraq using ...

    African Journals Online (AJOL)

    husam

    database for Iraqi olive cultivars, in breeding strategies and in correct cultivar identification. Key words: Olea europaea, genetic diversity ... cultivated fruit tree species in the Mediterranean basin. It is a predominant allogamous species .... carried out using an automatic DNA analyzer (Model 3100 Prism;. Applied Biosystems).

  18. Efecto de la aireación y la concentración de cloruro sódico en el desarrollo de la flora microbiológica y en los parámetros fisicoquímicos en la fermentación de Olea europaea L. c.v. Sevillana al estilo negras naturales en la zona de La Yarada-Tacna

    Directory of Open Access Journals (Sweden)

    Clavijo Koc, C.

    2013-06-01

    Full Text Available The aerobic fermentation of the table olive variety, Sevillana a black style, was carried out, taking into account the parameters of fermentation of fixed acidity between 1.2 to 1.5% and depended on the chloride concentration in the brine. This concentration was under 6.5% in the 9 treatments assayed, allowing for the lactic bacteria to develop. In the aerobic fermentation there were no differences in the decline of pH in relation to the anaerobic fermentation, which reached values below 3.5. The air effect is of great significance in the purge of the carbon dioxide in the brine. At the same time, the effect of air significantly affects the increase in aerobic yeast. The facultative anaerobic yeasts developed in the treatments with an initial salt level of 12% at the beginning of fermentation. The reduction of sugar concentration into the fruit decreased significantly in the treatment with air. Aerobic fermentation is more rapid than anaerobic fermentation.La fermentación aerobia de aceituna variedad Sevillana estilo negra se desarrolló en los parámetros de acidez fija entre de 1.2 a 1.5%, debido a la concentración de cloruros en la salmuera los cuales se mantuvieron por debajo de 6.5% durante el periodo de fermentación en los 9 tratamientos ensayados lo que permitió el desarrollo de bacterias lácticas. No hubo diferencia en la evolución del pH entre la fermentación con aireación o en condiciones anaeróbicas alcanzándose valores menores a 3.5. La aireación tiene un efecto significativo en la purga del CO2 en la salmuera e incrementó la población de levaduras aerobias; así mismo en los tratamientos con 12% de sal se favoreció el desarrollo de levaduras fermentativas al inicio de la fermentación. La concentración de azúcares reductores en el fruto disminuyó significativamente en los tratamientos con aireación, acelerando el proceso de fermentación con respecto a la fermentación anaerobia.

  19. Selection of greenery plants' group tolerant to mineralized human wastes for their inclusion into intrasystem mass exchange of BTLSS

    Science.gov (United States)

    Tikhomirova, Natalia; Tikhomirov, Alexander A.; Kalacheva, Galina; Ushakova, Sofya; Trifonov, Sergey V.; Pavlova, Anastasiya

    2016-07-01

    A possible way solving the inclusion problem of the human liquid wastes containing sodium chloride into intrasystem mass exchange of bio-technical life support system (BTLSS) is selection of such species of greenery plants that can utilize sodium chloride, be edible for a human and have rather a high productivity. Our previous works showed that salt-accumulating halophyte Salicornia europaea L. was a promising candidate for sodium chloride inclusion into BTLSS mass exchange. However, with the aim of creation of more various human diet possibilities a set of greenery plants cultivated by the water culture method was estimated. Based on preliminary experiments the plants Brassica juncea L., Nasturtium officinale R. Br., Lepidium sativum angustifolia L. and Salicornia europaea L. were chosen as the investigation objects. The nutrient solution for greenery plant's cultivation was obtained after harvesting the wheat plants grown on the solution with mineralized human wastes' addition. The results of the first stage of the investigations carried out showed that plants of Brassica juncea and Lepidium sativum angustifolia are unpromising for their inclusion into BTLSS because of a set of physiological characteristics. On the next stage of investigations, an experimental model of closed ecosystem was created. For that purpose the plants of Salicornia europaea and Nasturtium officinale were introduced in the phototroph unit structure. It was determined that there was deficiency of main macronutrients for Salicornia europaea and Nasturtium officinale including sodium for Salicornia europaea. The deficiency had an effect on plants productivity and on carry-over of sodium from solution by Salicornia europaea. Thus in the future experiment it is necessary to carry out desalinization of solution by Salicornia europaea plants. Nasturtium officinale, that is rich in essential fatty acids and contributes into variety of human vegetable diet is planned to be cultivated by the

  20. Evoluzioni psicoanalitiche e cambiamento in psicoterapia psicoanalitica

    Directory of Open Access Journals (Sweden)

    Rosario Di Sauro

    2009-06-01

    Full Text Available In questo articolo si prende in considerazione l’evoluzione teoretica della psicoanalisi, passando dal modello freudiano monadico ad un approccio di matrice relazionale.  Altresì  viene evidenziato il contributo della psicologia clinica come elemento costitutivo della psicoterapia psicoanalitica, come espressività del continuum psicologia clinica-psicoterapia. Tutto ciò rappresenta, inoltre, la conditio sine qua non per il cambiamento terapeutico. Se ne evidenziano, infatti gli elementi caratteristici per una buona riuscita del processo terapeutico. L’Autore inoltre, mette in rilievo il ruolo della psicocorporeità nel trattamento psicoanalitico, sia come comunicazione del ‘non verbale’ sia come costrutto epistemologico di un nuovo apporto alla scienza psicoanalitica.