WorldWideScience

Sample records for es-31 es-43 est-6

  1. effect of habitat fragmentation on diversity and abundance of nesting

    African Journals Online (AJOL)

    cw

    Department of Zoology and Wildlife Conservation, University of Dar es ... Keywords: fragmentation, nesting birds, thickets, campus of the University of Dar es ... 43(1), 2017 ..... Yale University Press, ... bird species in urban parks: Effects of park.

  2. AMELIORER LA PERFORMANCE ORGANISATIONNELLE

    International Development Research Centre (IDRC) Digital Library (Canada)

    Quelles sont les meilleures sources de données ? 31 .... Vous pouvez nous joindre à l'adresse indiquée à la page d'information. ..... la disponibilité du personnel qui participera au processus, et le type de rapport que vous comptez présenter.

  3. A carboxylesterase, Esterase-6, modulates sensory physiological and behavioral response dynamics to pheromone in Drosophila

    Directory of Open Access Journals (Sweden)

    Chertemps Thomas

    2012-06-01

    Full Text Available Abstract Background Insects respond to the spatial and temporal dynamics of a pheromone plume, which implies not only a strong response to 'odor on', but also to 'odor off'. This requires mechanisms geared toward a fast signal termination. Several mechanisms may contribute to signal termination, among which odorant-degrading enzymes. These enzymes putatively play a role in signal dynamics by a rapid inactivation of odorants in the vicinity of the sensory receptors, although direct in vivo experimental evidences are lacking. Here we verified the role of an extracellular carboxylesterase, esterase-6 (Est-6, in the sensory physiological and behavioral dynamics of Drosophila melanogaster response to its pheromone, cis-vaccenyl acetate (cVA. Est-6 was previously linked to post-mating effects in the reproductive system of females. As Est-6 is also known to hydrolyze cVA in vitro and is expressed in the main olfactory organ, the antenna, we tested here its role in olfaction as a putative odorant-degrading enzyme. Results We first confirm that Est-6 is highly expressed in olfactory sensilla, including cVA-sensitive sensilla, and we show that expression is likely associated with non-neuronal cells. Our electrophysiological approaches show that the dynamics of olfactory receptor neuron (ORN responses is strongly influenced by Est-6, as in Est-6° null mutants (lacking the Est-6 gene cVA-sensitive ORN showed increased firing rate and prolonged activity in response to cVA. Est-6° mutant males had a lower threshold of behavioral response to cVA, as revealed by the analysis of two cVA-induced behaviors. In particular, mutant males exhibited a strong decrease of male-male courtship, in association with a delay in courtship initiation. Conclusions Our study presents evidence that Est-6 plays a role in the physiological and behavioral dynamics of sex pheromone response in Drosophila males and supports a role of Est-6 as an odorant-degrading enzyme (ODE in male

  4. Marine and estuarine methylotrophs: Their abundance, activity and identity

    Digital Repository Service at National Institute of Oceanography (India)

    Faria, D.; LokaBharathi, P.A.

    . Control tubes without methanol were included. Microbial Adhesion to Hydrocarbons (MATH) Assay was carried out to assess the ability of the isolates to uti l- ize hydrocarbons, as outlined by Rossenberg 17 . The assay was carried out as follows....02 Table 4. MATH assay Initial Final Fraction of a d herence Culture turbidity ( A ) turbidity ( C ) ( A ? C ) ES6 0.200 0.246 ? 0.230 ES7 0.200 0.170 0.178 ES31 0.206 0.211 ? 0.055 OF401 0.203 0.133 0.350 OF504 0...

  5. UniProt search blastx result: AK287865 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287865 J065201C22 P49890|ST1E6_RAT Estrogen sulfotransferase, isoform 6 (EC 2.8.2....4) (EST-6) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 1.00E-27 ...

  6. UniProt search blastx result: AK287898 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287898 J065210I16 P49890|ST1E6_RAT Estrogen sulfotransferase, isoform 6 (EC 2.8.2....4) (EST-6) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 2.00E-18 ...

  7. Parent and Friend Social Support and Adolescent Hope.

    Science.gov (United States)

    Mahon, Noreen E; Yarcheski, Adela

    2017-04-01

    The purpose of this study was to conduct two meta-analyses. The first examined social support from parents in relation to adolescent hope, and the second examined social support from friends in relation to adolescent hope. Using Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) guidelines for the literature reviewed, nine published studies or doctoral dissertations completed between 1990 and 2014 met the inclusion criteria. Using meta-analytic techniques and the mean weighted r statistic, the results indicated that social support from friends had a stronger mean effect size (ES = .31) than social support from parents (ES = .21); there was a statistically significant difference between the two ESs. Two of the four moderators for the parent social support-adolescent hope relationship were statistically significant. They were quality score and health status. Implications for school nurses and nurses in all settings are addressed, and conclusions are drawn based on the findings.

  8. School-based intervention for childhood disruptive behavior in disadvantaged settings: a randomized controlled trial with and without active teacher support.

    Science.gov (United States)

    Liber, Juliette M; De Boo, Gerly M; Huizenga, Hilde; Prins, Pier J M

    2013-12-01

    In this randomized controlled trial, we investigated the effectiveness of a school-based targeted intervention program for disruptive behavior. A child-focused cognitive behavioral therapy (CBT) program was introduced at schools in disadvantaged settings and with active teacher support (ATS) versus educational teacher support (ETS) (CBT + ATS vs. CBT + ETS). Screening (n = 1,929) and assessment (n = 224) led to the inclusion of 173 children ages 8-12 years from 17 elementary schools. Most of the children were boys (n = 136, 79%) of low or low-to-middle class socioeconomic status (87%); the sample was ethnically diverse (63% of non-Western origin). Children received CBT + ATS (n = 29) or CBT + ETS (n = 41) or were entered into a waitlist control condition (n = 103) to be treated afterward (CBT + ATS, n = 39, and CBT + ETS, n = 64). Effect sizes (ES), clinical significance (reliable change), and the results of multilevel modeling are reported. Ninety-seven percent of children completed treatment. Teachers and parents reported positive posttreatment effects (mean ES = .31) for CBT compared with the waitlist control condition on disruptive behavior. Multilevel modeling showed similar results. Clinical significance was modest. Changes had remained stable or had increased at 3-months follow-up (mean ES = .39). No consistent effect of teacher condition was found at posttreatment; however, at follow-up, children who received ETS fared significantly better. This study shows that a school-based CBT program is beneficial for difficult-to-reach children with disruptive behavior: The completion rate was remarkably high, ESs (mean ES = .31) matched those of previous studies with targeted intervention, and effects were maintained or had increased at follow-up.

  9. Airbreathing Propulsion for Missiles and Projectiles (Propulsion Aerobie des Missiles et Projectiles)

    Science.gov (United States)

    1992-09-01

    of external (A0/Al) and internal (A2 /Al) almost linear with Md.. This is to be expected contraction. However, the maximum contraction since A,/Ai...dans la formulation titude maximale est 6levde. (additif m~tallique, charge hydrocarbon~e, granulom ~trie du perchiorate d’ammonium). Llutilisation de...Oskam [61 demonstrate the usefulness of linearized potential flow codes ("Panel Methods") and in Fig. S engine installation effects on the wing

  10. Antimicrobial potential of endophytic fungi derived from three seagrass species: Cymodocea serrulata, Halophila ovalis and Thalassia hemprichii.

    Directory of Open Access Journals (Sweden)

    Preuttiporn Supaphon

    Full Text Available Endophytic fungi from three commonly found seagrasses in southern Thailand were explored for their ability to produce antimicrobial metabolites. One hundred and sixty endophytic fungi derived from Cymodoceaserrulata (Family Cymodoceaceae, Halophilaovalis and Thalassiahemprichii (Family Hydrocharitaceae were screened for production of antimicrobial compounds by a colorimetric broth microdilution test against ten human pathogenic microorganisms including Staphylococcus aureus ATCC 25923, a clinical isolate of methicillin-resistant S. aureus, Escherichia coli ATCC 25923, Pseudomonas aeruginosa ATCC 27853, Candida albicans ATCC 90028 and NCPF 3153, Cryptococcus neoformans ATCC 90112 and ATCC 90113 and clinical isolates of Microsporumgypseum and Penicilliummarneffei. Sixty-nine percent of the isolates exhibited antimicrobial activity against at least one test strain. Antifungal activity was more pronounced than antibacterial activity. Among the active fungi, seven isolates including Hypocreales sp. PSU-ES26 from C. serrulata, Trichoderma spp. PSU-ES8 and PSU-ES38 from H. ovalis, and Penicillium sp. PSU-ES43, Fusarium sp. PSU-ES73, Stephanonectria sp. PSU-ES172 and an unidentified endophyte PSU-ES190 from T. hemprichii exhibited strong antimicrobial activity against human pathogens with minimum inhibitory concentrations (MIC of less than 10 µg/ml. The inhibitory extracts at concentrations of 4 times their MIC destroyed the targeted cells as observed by scanning electron microscopy. These results showed the antimicrobial potential of extracts from endophytic fungi from seagrasses.

  11. Asphalts tests using onshore drilling oil wells residues; Ensaios asfalticos utilizando residuos de perfuracao onshore

    Energy Technology Data Exchange (ETDEWEB)

    Lucena, Adriano Elisio de F.L.; Rodrigues, John Kennedy G.; Ferreira, Heber Carlos; Lucena, Leda Christiane de F.L. [Universidade Federal de Campina Grande (UFCG), PB (Brazil); Lucena, Luciana de F.L. [Faculdade de Ciencias Sociais Aplicada (FACISA), Campina Grande, PB (Brazil)

    2008-07-01

    The drilling cuttings are one of the residues produced by the oils industries in large amounts during the drilling of oil wells. An alternative of final disposal of the drilling cutting residue is its utilization in asphalt mixtures. Based on this alternative, it was realized chemical and granulometric analysis and tests (Marshall and indirect tensile strength), on the asphaltic mixture using the residue from the oil drilling wells (well: 1-POTI-4-RN, located at Governador DIX-Sept Rosado - RN - Brazil). The achieved results to Marshall test indicated that for the analyzed mixture, the ideal content of residue that can be incorporated to the asphaltic composition and attend at the DNIT-ES 31 (2006) is 5%. To the indirect tensile strength test, the results showed a strength value higher than the minimum limit requested by the DNIT (0,65 MPa). The achieved results indicated the possibility of the utilization of the drilling cuttings in asphaltic pavements as fine aggregate, obeying the percentage limits, as an alternative to the final disposal. (author)

  12. Dicty_cDB: Contig-U09822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

  13. Adaptive evolution of simian immunodeficiency viruses isolated from two conventional progressor macaques with neuroaids

    Energy Technology Data Exchange (ETDEWEB)

    Foley, Brian T [Los Alamos National Laboratory; Korber, Bette T [Los Alamos National Laboratory

    2008-01-01

    Simian immunodeficiency virus infection of macaques may result in neuroAIDS, a feature more commonly observed in macaques with rapid progressive disease than in those with conventional disease. This is the first report of two conventional progressors (H631 and H636) with encephalitis in rhesus macaques inoculated with a derivative of SIVsmES43-3. Phylogenetic analyses of viruses isolated from the cerebral spinal fluid (CSF) and plasma from both animals demonstrated tissue compartmentalization. Additionally, virus from the central nervous system (CNS) was able to infect primary macaque monocyte-derived macrophages more efficiently than virus from plasma. Conversely, virus isolated from plasma was able to replicate better in peripheral blood mononuclear cells than virus from CNS. We speculate that these viruses were under different selective pressures in their separate compartments. Furthermore, these viruses appear to have undergone adaptive evolution to preferentially replicate in their respective cell targets. Analysis of the number of potential N-linked glycosylation sites (PNGS) in gp160 showed that there was a statistically significant loss of PNGS in viruses isolated from CNS in both macaques compared to SIVsmE543-3. Moreover, virus isolated from the brain in H631, had statistically significant loss of PNGS compared to virus isolated from CSF and plasma of the same animal. It is possible that the brain isolate may have adapted to decrease the number of PNGS given that humoral immune selection pressure is less likely to be encountered in the brain. These viruses provide a relevant model to study the adaptations required for SIV to induce encephalitis.

  14. Fully-covered metal stents with endoscopic suturing vs. partially-covered metal stents for benign upper gastrointestinal diseases: a comparative study

    Science.gov (United States)

    Ngamruengphong, Saowanee; Sharaiha, Reem; Sethi, Amrita; Siddiqui, Ali; DiMaio, Christopher J.; Gonzalez, Susana; Rogart, Jason; Jagroop, Sophia; Widmer, Jessica; Im, Jennifer; Hasan, Raza Abbas; Laique, Sobia; Gonda, Tamas; Poneros, John; Desai, Amit; Wong, Katherine; Villgran, Vipin; Brewer Gutierrez, Olaya; Bukhari, Majidah; Chen, Yen-I; Hernaez, Ruben; Hanada, Yuri; Sanaei, Omid; Agarwal, Amol; Kalloo, Anthony N.; Kumbhari, Vivek; Singh, Vikesh; Khashab, Mouen A.

    2018-01-01

    Background and study aims  Self-expandable metallic stents (SEMS) have been increasingly used in benign conditions (e. g. strictures, fistulas, leaks, and perforations). Fully covered SEMS (FSEMS) were introduced to avoid undesirable consequences of partially covered SEMS (PSEMS), but come with higher risk of stent migration. Endoscopic suturing (ES) for stent fixation has been shown to reduce migration of FSEMS. Our aim was to compare the outcomes of FSEMS with ES (FS/ES) versus PSEMS in patients with benign upper gastrointestinal conditions. Patients and methods  We retrospectively identified all patients who underwent stent placement for benign gastrointestinal conditions at seven US tertiary-care centers. Patients were divided into two groups: FSEMS with ES (FS/ES group) and PSEMS (PSEMS group). Clinical outcomes between the two groups were compared. Results  A total of 74 (FS/ES 46, PSEMS 28) patients were included. On multivariable analysis, there was no significant difference in rate of stent migration between FS/ES (43 %) and PSEMS (15 %) (adjusted odds ratio 0.56; 95 % CI 0.15 – 2.00). Clinical success was similar [68 % vs. 64 %; P  = 0.81]. Rate of adverse events (AEs) was higher in PSEMS group [13 (46 %) vs. 10 (21 %); P  = 0.03). Difficult stent removal was higher in the PSEMS group (n = 5;17 %) vs. 0 % in the FS/ES group; P  = 0.005. Conclusions  The proportion of stent migration of FS/ES and PSEMS are similar. Rates of other stent-related AEs were higher in the PSEMS group. PSEMS was associated with tissue ingrowth or overgrowth leading to difficult stent removal, and secondary stricture formation. Thus, FSEMS with ES for stent fixation may be the preferred modality over PSEMS for the treatment of benign upper gastrointestinal conditions. PMID:29404384

  15. Functional classification of esterases from leaves of Aspidosperma polyneuron M. Arg. (Apocynaceae

    Directory of Open Access Journals (Sweden)

    Carvalho Vanda Marilza de

    2003-01-01

    Full Text Available Polyacrylamide gel electrophoresis system (PAGE and inhibition tests for biochemical characterization of alpha- and beta-esterases were used to obtain a functional classification of esterases fromAspidosperma polyneuron. The characterization of alpha- and beta-esterases from young leaves of A. polyneuron by the PAGE system showed fourteen esterase isozymes. The differential staining pattern showed that Est-2 isozyme hydrolyzes beta-naphthyl acetate; Est-6, Est-7 and Est-8 isozymes hydrolyze alpha-naphthyl acetate, and Est-1, Est-3, Est-4, Est-5, Est-9, Est-10, Est-11, Est-12, Est-13, and Est-14 isozymes hydrolyze both alpha- and b-naphthyl acetate. Inhibition pattern of a- and beta-esterases showed that Folidol is a more potent inhibitor that Malathion, while Thiamethoxan (an insecticide with organophosphorus-like action acts as an Est-4 and Est-6 inhibitor and induces the appearance of Est-5 and Est-7 isozymes as more intensely stained bands. Inhibition tests showed that OPC insecticides inhibit or activate plant esterases. Thus, plant esterases may be used as bioindicators to detect the presence and toxicity of residues of topically applied insecticides in agriculture and may be valuable for monitoring pollutants in the environment.

  16. [The mechanism of vasculogenesis: the critical role of transforming growth factor-beta 1 in the formation of vessel-like structures during the differentiation in vitro of murine embryonic stem cells].

    Science.gov (United States)

    Tsung, H C; Yao, Z

    1996-09-01

    When ES-5 cells were transfected with an exogenous porcine TGF-beta 1 gene, one can obtain clones of genetically modified ES cells with over-expression of the transfected gene. We called the genetically modified ES-5 cells as ES-T cells. When ES-T cells were used to study their differentiation in vitro by all trans-retinoic acid (RA), it was soon noticed that embryoid bodies of ES-T cells can exclusively differentiate into endothelial cells and vessel-like structures, but not in their parent ES-5 cells. The above result is the first indication that the differentiation of tubular structures in embryoid bodies of ES-T cells may somehow be related to TGF-beta 1. To demonstrate further the role of TGF-beta 1 in the formation of vessel-like structures, the cultured ES-5 cells in the presence of added rhTGF-beta 1 were closely followed in the course of their differentiation. We have, thus, demonstrated the promoting effects of exogenous rhTGF-beta 1 in the formation of vessel-like structures, morphologically similar to those structures derived from ES-T6 cells, during the differentiation of ES-5 cells, both in monolayer culture, in three dimensional collagen gel and in embryoid bodies cultured on gelatin-coated tissue culture wells. Addition of suitable amount of anti-TGF-beta 1 monoclonal antibody IgG (TB21) to the culture medium of embryoid bodies of ES-T6 cells could effectively abolish the formation of vessel-like structures induced by retinoic acid. The percentage of the inhibition was very high, giving a figure comparable to that of atypical vessel-like structures formed in the control embryoid bodies from their parent ES-5 cells. The flat epithelial-like cells and round cells differentiated from embryoid bodies of ES-T6 cells were stained rather strongly for laminin and type IV collagen by immunofluorescent procedure. The above results indicate clearly that TGF-beta 1 is a crucial factor in organizing the differentiated derivatives (endothelial-like cells and their immediate progenitor cells) from ES-T6 cells to form vessel-like structures, and that the role of TGF-beta 1 in vasculogenesis might be performed, in part, through the modulation of the composition and organization of the extracellular matrix. In addition, the enhanced expression of bFGF mRNA in derivatives differentiated from both ES-5 cells treated with rhTGF-beta 1 and ES-T6 cells were detected by Northern blot analysis. Thus, aside from its effects on extracellular matrix, TGF-beta 1 might also modulate the bioactivity of bFGF in relation to the growth of vascular endothelial cells in the present system.

  17. Lg and Other Regional Phases in South America

    Science.gov (United States)

    1990-09-01

    L-StLdi’: del sistema crtoza -- mantc’ super io:r; entre eil’:’s s!:, puioden men’: ir-nar lo:s sig~uientest Mt:dc’s Sismi’:os, ciravime-tr icc’s...difarentes prc’piedades fisi’:ez. Este rn~ toc utiliza las leyes de Snell y de las velcidades aparuntes (Dcubrin y Olhc’vich, 1959). Con la api icaci~’I de...2.97 45 3.0 4.45 3.30 4t 8.0 4.40 3.32 140 S . 5 .50 3.35 100 TCC-CUS ( tabla * 2 ) El per fil Toc -onc:e-Cuzco (fig.2) est6 reduc.ido casi

  18. Proceedings of the regional conference dedicated to photovoltaic self-consumption, Great East Strasbourg 10/10/17

    International Nuclear Information System (INIS)

    2017-10-01

    In the sunniest regions of France, like the Great East, the photovoltaic self-consumption market growth is supported by the national tender (450 MW of projects to allocate) and regional aids, the new tariffing order and the new regulatory framework for collective self-consumption. This document brings together the presentations given during the Regional conference dedicated to photovoltaic self-consumption held at Strasbourg (FR) in October 2017: 1 - Conference program; 2 - Introduction (Bruno Flochon - Climaxion Region Grand Est); 3 - Regulatory context (Mathilde Ducatel - DREAL); 4 - Conditions of connection to the Enedis grid (Jean Luc Spaeth, Enedis); 5 - Experience feedback and regional support (Gautier Perrin - Region Grand Est); 6 - National news (Richard Loyen - Enerplan); 7 - Regional companies (Nicolas Randria - GMPV FFB); 8 - Great East Solar Association (Sandrine Bournaison); 9 - Electro-concept of a Supermarket at Wittelsheim (Philippe Soret); 10 - Roof PV generator on the C3 building at Clemessy-Mulhouse (Dominique Bitsch)

  19. Sopravvivenza e dispersione della lepre comune (Lepus europaeus Pallas, 1778 in relazione alla densità di popolazione e alle caratteristiche ambientali

    Directory of Open Access Journals (Sweden)

    Francesca Pella

    2003-10-01

    Full Text Available La presente ricerca è stata effettuata con lo scopo di valutare la sopravvivenza di lepri autoctone non traslocate in relazione alle caratteristiche ambientali e alla densità di popolazione. Inoltre è stata analizzata la capacità delle lepri di colonizzare territori a bassa densità, al di fuori delle aree protette, al fine di ricavare indicazioni utili per una gestione della lepre basata sulla corretta pianificazione delle aree protette. Lo studio è stato effettuato dal gennaio del 1999 al luglio del 2001 in due Zone di Ripopolamento e Cattura della Pianura Padana, caratterizzate da colture a seminativi irrigui una (Vistarino e colture a seminativi asciutti l?altra (Portalbera. Per determinare la densità di popolazione sono stati effettuati, in primavera ed autunno, censimenti notturni da autovettura, con proiettore alogeno orientabile manualmente. Per analizzare la sopravvivenza, l?uso dello spazio e la dispersione sono state catturate, con reti a tramaglio, valutate (peso, sesso, classe d?età e condizioni sanitarie e radiomarcate 16 lepri a Vistarino e 20 a Portalbera. I censimenti hanno evidenziato una differenza tra le due aree nelle densità che sono risultate comprese tra gli 11 ed i 20 individui per km² a Vistarino e tra i 29 e gli 83 a Portalbera. La sopravvivenza media delle lepri radiomarcate è stata di 295,5 giorni (ES=43,2, considerando le aree cumulate, e la probabilità di sopravvivenza nel periodo di studio è risultata pari a 0,36 (ES=0,094. Nell?area di studio di Vistarino la sopravvivenza media è stata di 426,4 giorni (ES=61,6 e la probabilità di sopravvivenza di 0,67 (ES=0,12 mentre a Portalbera la sopravvivenza media era di 142,2 giorni (ES=13,9 con una probabilità di sopravvivenza di 0,00 (ES=0,00. La dimensione media dell?area vitale per tutte le lepri catturate in entrambe le aree è stata pari a 47,9 ha (ES=6,08; minimo=0,01; massimo=171,1 se calcolata con il metodo del Minimo Poligono Convesso, mentre era di

  20. Esterase isozymes patterns of grape vine (Vitis vinifera L. are altered in response to fungicide exposure

    Directory of Open Access Journals (Sweden)

    Gleice Ribeiro Orasmo

    2015-10-01

    Full Text Available Current analysis characterizes the effect of different fungicides often applied for pest control on a-and b-esterase patterns of four economically important table-wine grape cultivars (Italia, Rubi, Benitaka and Brasil of Vitis vinifera. The a- and b-esterase patterns in bud leaves of the cultivars were assessed by native PAGE analysis. Cabrio Top® compound inhibited Est-2, Est-5, Est-6, Est-7, Est-8, Est-9 and Est-10 carboxylesterases, whereas Est-4, Est-11, Est-12, Est-13, Est-14 acetylesterases and Est-16 carboxylesterase were detected as weakly stained bands. Carboxylesterases and acetylesterases were also detected as weakly stained bands when exposed to fungicides Orthocide 500®, Positron Duo® and Folicur PM®. No changes in a- and b-esterase patterns were reported when the vines were exposed to the fungicides Rovral SC®, Kumulus DF®, Curzate M®, Score® or Cuprogarb 500®. The evidence of functional changes in carboxylesterase and acetylesterase levels in current study is a warning to grape producers on the dangers inherent in the indiscriminate use of potent and modern fungicides extensively used in agriculture. The inhibition effect of fungicides on esterase isozyme molecules seems to be independent of the fungicide chemical.

  1. Spatial distribution and esterase activity in populations of Aedes (Stegomyia aegypti (Linnaeus (Diptera: Culicidae resistant to temephos

    Directory of Open Access Journals (Sweden)

    Wanessa Porto Tito Gambarra

    2013-04-01

    Full Text Available INTRODUCTION: The need for studies that describe the resistance patterns in populations of Aedes aegypti (Linnaeus in function of their region of origin justified this research, which aimed to characterize the resistance to temephos and to obtain information on esterase activity in populations of Aedes aegypti collected in municipalities of the State of Paraíba. METHODS: Resistance to temephos was evaluated and characterized from the diagnostic dose of 0.352mg i.a./L and multiple concentrations that caused mortalities between 5% and 99%. Electrophoresis of isoenzymes was used to verify the patterns of esterase activity among populations of the vector. RESULTS: All populations of Aedes aegypti were resistant to temephos, presenting a resistance rate (RR greater than 20. The greatest lethal dose 50% of the sample (CL50 was found for the municipality of Lagoa Seca, approximately forty-one times the value of CL50 for the Rockefeller population. The populations characterized as resistant showed two to six regions of α and β-esterase, called EST-1 to EST-6, while the susceptible population was only seen in one region of activity. CONCLUSIONS: Aedes aegypti is widely distributed and shows a high degree of resistance to temephos in all municipalities studied. In all cases, esterases are involved in the metabolism and, consequently, in the resistance to temephos.

  2. Genome-wide analysis of esterase-like genes in the striped rice stem borer, Chilo suppressalis.

    Science.gov (United States)

    Wang, Baoju; Wang, Ying; Zhang, Yang; Han, Ping; Li, Fei; Han, Zhaojun

    2015-06-01

    The striped rice stem borer, Chilo suppressalis, a destructive pest of rice, has developed high levels of resistance to certain insecticides. Esterases are reported to be involved in insecticide resistance in several insects. Therefore, this study systematically analyzed esterase-like genes in C. suppressalis. Fifty-one esterase-like genes were identified in the draft genomic sequences of the species, and 20 cDNA sequences were derived which encoded full- or nearly full-length proteins. The putative esterase proteins derived from these full-length genes are overall highly diversified. However, key residues that are functionally important including the serine residue in the active site are conserved in 18 out of the 20 proteins. Phylogenetic analysis revealed that most of these genes have homologues in other lepidoptera insects. Genes CsuEst6, CsuEst10, CsuEst11, and CsuEst51 were induced by the insecticide triazophos, and genes CsuEst9, CsuEst11, CsuEst14, and CsuEst51 were induced by the insecticide chlorantraniliprole. Our results provide a foundation for future studies of insecticide resistance in C. suppressalis and for comparative research with esterase genes from other insect species.

  3. Meningoencefalite na fase aguda do sarampo : relato de seis casos

    Directory of Open Access Journals (Sweden)

    EL-FAR FABIANE

    2000-01-01

    Full Text Available Apresentamos 6 casos de meningoencefalite aguda por sarampo, diagnosticados durante epidemia na cidade de São Paulo, em 1997. Os prontuários dos 6 pacientes foram analisados retrospectivamente. O diagnóstico de meningoencefalite baseou-se nas alterações clínicas e liquóricas, e foi confirmado por sorologia específica. Dos 467 pacientes com sarampo atendidos no Instituto de Infectologia Emílio Ribas nesse período, estes 6 evoluíram com alterações neurológicas e liquóricas durante a fase exantemática, sendo a sonolência e rigidez de nuca os achados mais frequentes. Os pacientes tinham entre 2 meses e 28 anos de idade. O exame do líquor mostrou pleocitose em todos. Não houve correlação entre a severidade do quadro clínico e liquórico com a evolução. Em 4 casos foi necessária internação na unidade de terapia intensiva; destes, 2 foram intubados. Apenas 2 pacientes apresentaram alterações na tomografia computadorizada de crânio. Todos tiveram boa evolução, sem sequelas.

  4. Variables sociodemográficas y estilos de vida como predictores de la autovaloración de la salud de los inmigrantes en el País Vasco Sociodemographic variables and lifestyle as predictors of self-perceived health in immigrants in the Basque Country (Spain

    Directory of Open Access Journals (Sweden)

    Elena Rodríguez Álvarez

    2008-10-01

    Full Text Available Objetivo: Investigar la importancia de los factores sociodemográficos y de los estilos de vida en la autovaloración de la salud en los inmigrantes de origen magrebí, subsahariano, latinoamericano y europeo no comunitario del País Vasco. Métodos: Estudio descriptivo transversal con una muestra formada por 219 magrebíes (31,8%, 152 subsaharianos (22,1%, 167 latinoamericanos (24,2% y 151 europeos no comunitarios (21,9%. La herramienta para la recopilación de datos fue la Encuesta de Salud de la Comunidad Autónoma del País Vasco (ESCAV'2002. El análisis multivariante se realizó con regresión logística dicotómica (soporte SPSS 13. Resultados: Para la autovaloración de la salud, el 64,2% de los magrebíes, el 78,7% de los subsaharianos, el 66,1% de los latinoamericanos y el 67,1% de los europeos declararon tener una salud muy buena o buena. Las variables asociadas significativamente (p Objective: To explore the importance of socio-demographic factors as well as life-style and their influence in self-rated health of Maghribian, Sub-Saharian, Latin-American and non-Communitarian European immigrant groups living in the Basque Country (Spain. Methods: Descriptive cross-study with a convenience sample of 689 persons, consisting of 219 Maghribians (31.8%, 152 Sub-Saharians (22.1%, 167 Latino(as (24.2% and 151 non-Communitarian Europeans (21.9%. Data base have been completed with data collected using the 2002 Regional Basque Health Interview Survey (ESCAV 2002. The multivariate analysis was performed by using the dicotomic logistic regression (software SPSS 13. Results: We found that 64.2% of Maghribian, 78.7% of Sub-Saharian, 66.1% of Latin-American and 67.1% of non-Communitarian European assessed their health as very good or good. The significantly associated variables (p < 0.05 and p < 0.01 with self-rated health were collective membership, sex and age. Persons belonging to the Sub-Saharian collective showed a stronger advantage of

  5. An Ambystoma mexicanum EST sequencing project: analysis of 17,352 expressed sequence tags from embryonic and regenerating blastema cDNA libraries

    Science.gov (United States)

    Habermann, Bianca; Bebin, Anne-Gaelle; Herklotz, Stephan; Volkmer, Michael; Eckelt, Kay; Pehlke, Kerstin; Epperlein, Hans Henning; Schackert, Hans Konrad; Wiebe, Glenis; Tanaka, Elly M

    2004-01-01

    Background The ambystomatid salamander, Ambystoma mexicanum (axolotl), is an important model organism in evolutionary and regeneration research but relatively little sequence information has so far been available. This is a major limitation for molecular studies on caudate development, regeneration and evolution. To address this lack of sequence information we have generated an expressed sequence tag (EST) database for A. mexicanum. Results Two cDNA libraries, one made from stage 18-22 embryos and the other from day-6 regenerating tail blastemas, generated 17,352 sequences. From the sequenced ESTs, 6,377 contigs were assembled that probably represent 25% of the expressed genes in this organism. Sequence comparison revealed significant homology to entries in the NCBI non-redundant database. Further examination of this gene set revealed the presence of genes involved in important cell and developmental processes, including cell proliferation, cell differentiation and cell-cell communication. On the basis of these data, we have performed phylogenetic analysis of key cell-cycle regulators. Interestingly, while cell-cycle proteins such as the cyclin B family display expected evolutionary relationships, the cyclin-dependent kinase inhibitor 1 gene family shows an unusual evolutionary behavior among the amphibians. Conclusions Our analysis reveals the importance of a comprehensive sequence set from a representative of the Caudata and illustrates that the EST sequence database is a rich source of molecular, developmental and regeneration studies. To aid in data mining, the ESTs have been organized into an easily searchable database that is freely available online. PMID:15345051

  6. Leaf-cutting ants Acromyrmex niger Smith, 1858 (Hymenoptera; Formicidae) used as bioindicators of agrotoxics residues

    International Nuclear Information System (INIS)

    Liriana Belizi; Rio Cantagalli; Denise Alves Lopes; Ana Liscia Paz Barateiro Stuchi; Maria Claudia Colla Ruvolo Takasusuki

    2014-01-01

    Despite the condition of leaf-cutting ant pests in agroecosystems, it is undeniable the benefits they can bring in certain situations or environments. The leaf-cutting ants of the genus Acromyrmex attack mainly leaves of vegetables and fruit trees exposing not only to the agrochemicals used for their control as well as to those used for the control of other pests. Due to the bioindicator potential of environmental quality of the ants and their frequent exposure to agrochemicals such as organophosphates, neonicotinoids and growth regulators insecticide used for pest control, it is necessary to study the sublethal effects that these pesticides may cause. The electrophoresis technique was used to study the activity of esterase isozymes involved in the metabolism of xenobiotics of A. niger, combined with changes in the expression of isozymes after contamination by pesticides. A. niger showed eight regions of esterase activity, which were called EST-1, EST-2, EST-3, EST-4, EST-5, EST-6, EST-7 and EST-8 according to the electrophoretic mobility. As the specificity to α and β - naphthyl acetate substrates, the EST-7 and EST-8 may be classified as α esterase and the others as ± b esterases. EST-5 is considered an enzyme of the type cholinesterase ii and the others are of the type carboxylesterase. The electrophoretic analysis showed partial inhibition to all esterases subjected to the contact with Malathion organophosforate at the concentrations 1 x 10-3 % and 5 x 10-3 %, which may be considered as a biomarker for the presence of residues of this insecticide in the environment. The regression analysis for sublethal effects of the tested pesticides demonstrated correlation between dose and mortality only for Thiametoxam neonicotinoid pesticide.

  7. Prevalência de sintomas de asma e tratamento de crianças e adolescentes de 2 a 14 anos no Campus Aproximado da PUCRS Prevalence of asthma symptoms and treatment of children and adolescents from 2 to 14 years of age in Porto Alegre, Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Brasília Itália C. S. Ache

    2005-04-01

    Full Text Available INTRODUÇÃO: Nas últimas décadas tem havido aumento da prevalência da asma. OBJETIVO: Determinar a prevalência de sintomas de asma em crianças e adolescentes de 2 a 14 anos em Porto Alegre (RS, relacionando-a com o perfil socioeconômico, tratamento e hábito de fumar intradomiciliar. MÉTODO: Estudo transversal em que foram entrevistadas todas as famílias atendidas em junho de 2000. RESULTADOS: A prevalência de sintomas de asma foi de 49,5%. Em 66,8% das famílias a renda era inferior a quatro salários mínimos e em mais de 50% a escolaridade materna e paterna era menor que cinco anos. Em 98,5% não havia utilização de tratamento preventivo para asma. Nas 174 famílias estudadas 38,7% das mães, 43,7% dos pais e 32,7% de ambos eram fumantes. Houve associação entre as seguintes variáveis: exposição ao fumo intradomiciliar e número de crises de asma no último ano (p = 0,02; RR = 2,9; IC: 1,1 - 4,5; escolaridade materna e número de crises no último ano (p = 0,03; RR = 2,03; IC: 1,01 - 4,19; aglomeração e número de crises no último ano entre as crianças expostas ao fumo (p = 0,04; RR = 2,7; IC: 1,4 - 5,1; hospitalização e número de crises no último ano (p = 0,004; RR = 1,46; IC: 1,15 -1,86; hospitalização e aglomeração (p = 0,03; RR = 1,47; IC: 1,15 -1,86. Nos menores de cinco anos, houve associação entre fumo materno e número de crises no último ano (p = 0,03; RR = 1,79; IC: 1,04 - 3,08. CONCLUSÃO: A prevalência de sintomas de asma foi alta. A comunidade estudada é limitada do ponto de vista socioeconômico e não trata adequadamente a enfermidade, o que demonstra necessidade de atendimento priorizado, normatizado e com insumos e processos avaliativos para controle da doença.BACKGROUND: In recent decades, the prevalence of asthma has increased. OBJECTIVES: To determine the prevalence of asthma symptoms in children and adolescents from 2 to 14 years of age living in Porto Alegre (in the state of Rio Grande

  8. Evolução e prognóstico materno-fetal da cirurgia cardíaca durante a gravidez Evolución y pronóstico materno-fetal de la cirugía cardiaca durante el embarazo Maternal-fetal outcome and prognosis of cardiac surgery during pregnancy

    Directory of Open Access Journals (Sweden)

    Walkiria Samuel Ávila

    2009-07-01

    Full Text Available FUNDAMENTO: A cirurgia cardíaca favorece o prognóstico materno em casos refratários à terapêutica clínica, contudo associa-se a riscos ao concepto quando realizada durante a gravidez. OBJETIVO: Analisar a evolução e o prognóstico materno-fetal de gestantes submetidas à cirurgia cardíaca no ciclo gravídico-puerperal. MÉTODOS: Estudou-se a evolução de 41 gestações de mulheres que tiveram indicação de cirurgia cardíaca no ciclo gravídico puerperal. A cardiotocografia fetal foi mantida durante o procedimento nas pacientes com idade gestacional acima de 20 semanas. RESULTADOS: A média da idade materna foi de 27,8 ± 7,6 anos, houve predomínio da valvopatia reumática (87,8%, e 15 dessas (41,6% foram submetidas à reoperação, devido à disfunção de prótese valvar. A média do tempo de circulação extracorpórea foi de 87,4 ± 43,6 min, e a hipotermia foi utilizada em 27 casos (67,5%. Treze mães (31,7% não apresentaram intercorrências e tiveram seus recém-nascidos vivos e saudáveis. A evolução pós-operatória das demais 28 gestações (68,3% mostrou: 17 complicações maternas (41,5%; três óbitos (7,3%; 12 perdas fetais (29,2% e quatro casos de malformação neurológica (10%, dois dos quais evoluíram para óbito tardio. Houve uma perda de seguimento após a cirurgia. Nove pacientes (21,9% foram operadas em caráter de emergência, situação que influenciou (p FUNDAMENTO: La cirugía cardiaca favorece el pronóstico materno en casos refractarios a la terapéutica clínica, sin embargo está asociada a riesgos cuando realizada durante el embarazo. OBJETIVO: Analizar la evolución y el pronóstico materno-fetal de gestantes sometidas a la cirugía cardiaca en el ciclo grávido puerperal. MÉTODOS: Se estudió la evolución de 41 gestaciones de mujeres que tuvieron indicación de cirugía cardiaca en el ciclo grávido puerperal. La cardiotocografía fetal se mantuvo durante el procedimiento en las pacientes con

  9. Effect of the type of maternal pushing during the second stage of labour on obstetric and neonatal outcome: a multicentre randomised trial-the EOLE study protocol.

    Science.gov (United States)

    Barasinski, Chloé; Vendittelli, Françoise

    2016-12-20

    The scientific data currently available do not allow any definitive conclusion to be reached about what type of pushing should be recommended to women during the second stage of labour. The objective of this trial is to assess and compare the effectiveness of directed open-glottis pushing versus directed closed-glottis pushing. Secondary objectives are to assess, according to the type of pushing: immediate maternal and neonatal morbidity, intermediate-term maternal pelvic floor morbidity, uncomplicated birth, and women's satisfaction at 4 weeks post partum. This multicentre randomised clinical trial compares directed closed-glottis pushing (Valsalva) versus directed open-glottis pushing during the second stage of labour in 4 hospitals of France. The study population includes pregnant women who received instruction in both types of pushing, have no previous caesarean delivery, are at term and have a vaginal delivery planned. Randomisation takes place during labour once cervical dilation ≥7 cm. The principal end point is assessed by a composite criterion: spontaneous delivery without perineal lesion (no episiotomy or spontaneous second-degree, third-degree or fourth-degree lacerations). We will need to recruit 125 women per group. The primary analysis will be by intention-to-treat analysis, with the principal results reported as crude relative risks (RRs) with their 95% CIs. A multivariate analysis will be performed to take prognostic and confounding factors into account to obtain adjusted RRs. This study was approved by a French Institutional Review Board (Comité de Protection des Personnes Sud Est 6:N°AU1168). Results will be reported in peer-reviewed journals and at scientific meetings. This study will make it possible to assess the effectiveness of 2 types of directed pushing used in French practice and to assess their potential maternal, fetal and neonatal effects. Findings from the study will be useful for counselling pregnant women before and during

  10. Variation in sperm displacement and its association with accessory gland protein loci in Drosophila melanogaster.

    Science.gov (United States)

    Clark, A G; Aguadé, M; Prout, T; Harshman, L G; Langley, C H

    1995-01-01

    Genes that influence mating and/or fertilization success may be targets for strong natural selection. If females remate frequently relative to the duration of sperm storage and rate of sperm use, sperm displacement may be an important component of male reproductive success. Although it has long been known that mutant laboratory stocks of Drosophila differ in sperm displacement, the magnitude of the naturally occurring genetic variation in this character has not been systematically quantified. Here we report the results of a screen for variation in sperm displacement among 152 lines of Drosophilia melanogaster that were made homozygous for second and/or third chromosomes recovered from natural populations. Sperm displacement was assayed by scoring the progeny of cn;bw females that had been mated sequentially to cn;bw and tested males in either order. Highly significant differences were seen in both the ability to displace sperm that is resident in the female's reproductive tract and in the ability to resist displacement by subsequent sperm. Most lines exhibited nearly complete displacement, having nearly all progeny sired by the second male, but several lines had as few as half the progeny fathered by the second male. Lines that were identified in the screen for naturally occurring variation in sperm displacement were also characterized for single-strand conformation polymorphisms (SSCP) at seven accessory gland protein (Acp) genes, Glucose dehydrogenase (Gld), and Esterase-6 (Est-6). Acp genes encode proteins that are in some cases known to be transmitted to the female in the seminal fluid and are likely candidates for genes that might mediate the phenomenon of sperm displacement. Significant associations were found between particular Acp alleles at four different loci (Acp26Aa/Ab, Acp29B, Acp36DE and Acp53E) and the ability of males to resist displacement by subsequent sperm. There was no correlation between the ability to displace resident sperm and the ability

  11. High-resolution (noble) gas time series for aquatic research

    Science.gov (United States)

    Popp, A. L.; Brennwald, M. S.; Weber, U.; Kipfer, R.

    2017-12-01

    We developed a portable mass spectrometer (miniRUEDI) for on-site quantification of gas concentrations (He, Ar, Kr, N2, O2, CO2, CH4, etc.) in terrestrial gases [1,2]. Using the gas-equilibrium membrane-inlet technique (GE-MIMS), the miniRUEDI for the first time also allows accurate on-site and long-term dissolved-gas analysis in water bodies. The miniRUEDI is designed for operation in the field and at remote locations, using battery power and ambient air as a calibration gas. In contrast to conventional sampling and subsequent lab analysis, the miniRUEDI provides real-time and continuous time series of gas concentrations with a time resolution of a few seconds.Such high-resolution time series and immediate data availability open up new opportunities for research in highly dynamic and heterogeneous environmental systems. In addition the combined analysis of inert and reactive gas species provides direct information on the linkages of physical and biogoechemical processes, such as the air/water gas exchange, excess air formation, O2 turnover, or N2 production by denitrification [1,3,4].We present the miniRUEDI instrument and discuss its use for environmental research based on recent applications of tracking gas dynamics related to rapid and short-term processes in aquatic systems. [1] Brennwald, M.S., Schmidt, M., Oser, J., and Kipfer, R. (2016). Environmental Science and Technology, 50(24):13455-13463, doi: 10.1021/acs.est.6b03669[2] Gasometrix GmbH, gasometrix.com[3] Mächler, L., Peter, S., Brennwald, M.S., and Kipfer, R. (2013). Excess air formation as a mechanism for delivering oxygen to groundwater. Water Resources Research, doi:10.1002/wrcr.20547[4] Mächler, L., Brennwald, M.S., and Kipfer, R. (2013). Argon Concentration Time-Series As a Tool to Study Gas Dynamics in the Hyporheic Zone. Environmental Science and Technology, doi: 10.1021/es305309b

  12. Development of a life-cycle fugitive methane emissions model utilizing device level emissions and activity factors

    Science.gov (United States)

    Englander, J.; Brandt, A. R.

    2017-12-01

    There has been numerous studies in quantifying the scale of fugitive emissions from across the natural gas value chain. These studies have typically focused on either specific types of equipment (such as valves) or on a single part of the life-cycle of natural gas production (such as gathering stations).1,2 However it has been demonstrated that average emissions factors are not sufficient for representing leaks in the natural gas system.3 In this work, we develop a robust estimate of fugitive emissions rates by incorporating all publicly available studies done at the component up to the process level. From these known studies, we create a database of leaks with normalized nomenclature from which leak estimates can be drawn from actual leak observations. From this database, and parameterized by meta-data such as location, scale of study, or placement in the life-cycle, we construct stochastic emissions factors specific for each process unit. This will be an integrated tool as part of the Oil production greenhouse gas estimator (OPGEE) as well as the Fugitive Emissions Abatement Simulation Toolkit (FEAST) models to enhances their treatment of venting and fugitive emissions, and will be flexible to include user provided data and input parameters.4,51. Thoma, ED et al. Assessment of Uinta Basin Oil and Natural Gas Well Pad Pneumatic Controller Emissions. J. Environ. Prot. 2017. 2. Marchese, AJ et al. Methane Emissions from United States Natural Gas Gathering and Processing. ES&T 2015. doi:10.1021/acs.est.5b02275 3. Brandt, AR et al. Methane Leaks from Natural Gas Systems Follow Extreme Distributions. ES&T 2016. doi:10.1021/acs.est.6b04303 4. El-Houjeiri, HM et al. An open-source LCA tool estimating greenhouse gas emissions from crude oil production using field characteristics. ES&T 2013. doi: 10.1021/es304570m 5. Kemp, CE et al. Comparing Natural Gas Leakage Detection Technologies Using an Open-Source `Virtual Gas Field' Simulator. ES&T 2016. doi:10.1021/acs.est.5b

  13. Multi-Year On-Road Emission Factor Trends of Two Heavy-Duty California Fleets

    Science.gov (United States)

    Haugen, M.; Bishop, G.

    2017-12-01

    New heavy-duty vehicle emission regulations have resulted in the development of advanced exhaust after-treatment systems that specifically target particulate matter (PM) and nitrogen oxides (NOx = NO + NO2). This has resulted in significant decreases in the emissions of these species. The University of Denver has collected three data sets of on-road gaseous (CO, HC, NO and NOx) and PM (particle mass, black carbon and particle number) emission measurements from heavy-duty vehicles (HDVs) in the spring of 2013, 2015 and 2017 at two different locations in California. One site is located at the Port of Los Angeles, CA (1,150 HDVs measured in 2017) and the other site is located at a weigh station in Northern California near Cottonwood, CA (780 HDVs measured in 2017). The On-Road Heavy-Duty Measurement Setup measures individual HDV's fuel specific emissions (DOI: 10.1021/acs.est.6b06172). Vehicles drive under a tent-like structure that encapsulates vehicle exhaust and 15 seconds of data collection is integrated to give fuel specific information. The measurements obtained from these campaigns contain real-world emissions affected by different driving modes, after-treatment systems and location. The Port of Los Angeles contributes a fleet that is fully equipped with diesel particulate filters (DPFs) as a result of the San Pedro Ports Clean Air Action Plan enforced since 2010 that allows only vehicles model year 2007 or newer on the premises. This fleet, although comprised with relatively new HDVs with lower PM emissions, has increased PM emissions as it has aged. Cottonwood's fleet contains vehicles with and without after-treatment systems, a result of a gradual turnover rate, and fleet PM has decreased at a slower rate than at the Port of Los Angeles. The decrease in PM emissions is a result of more HDVs being newer model years as well as older model years being retrofit with DPFs. The complimentary fleets, studied over multiple years, have given the University of Denver

  14. LEAF-CUTTING ANTS Acromyrmex niger SMITH, 1858 (HYMENOPTERA; FORMICIDAE USED AS BIOINDICATORS OF AGROTOXICS RESIDUES

    Directory of Open Access Journals (Sweden)

    Liriana Belizário Cantagalli

    2014-05-01

    A pesar de la condición de plaga de las hormigas cortadoras en agroecosistemas, no se pueden negar los beneficios que ellas pueden traer en determinadas situaciones o en determinados ambientes. Las hormigas cortadoras del género Acromyrmex atacan principalmente las hojas de hortalizas y hojas de plantas fructíferas, exponiéndose no solo a los agroquímicos utilizados para su control sino también a aquellos utilizados en el control de otras plagas. Debido al potencial bioindicador de la calidad ambiental de las hormigas y su frecuente exposición a los agrotóxicos como organofosforados, neonicotinoides y reguladores de crecimiento, utilizados en el control de plagas, es necesario el estudio de los efectos subletales que estos agrotóxicos pueden causar. La técnica de electroforesis fue utilizada para evaluar la actividad de las isoenzimas esterasas involucradas en el metabolismo de xenobióticos de  A. niger, asociada a las alteraciones en la expresión de las isoenzimas después de la contaminación con pesticidas.  Acromyrmex niger demostró ocho regiones de actividad esterasa, las cuales fueron denominadas EST-1, EST-2, EST-3, EST-4, EST-5, EST-6, EST-7 e EST-8 de acuerdo con la movilidad electroforética. En cuanto a la especificación de los substratos α y β-nafitl acetato, las EST-7 e EST-8 son clasificadas como α- esterasa y las demás αβ esterasas. EST-5 es considerada una enzima del tipo colinesterasa II y las demás son carboxilesterasas. El análisis electroforético presentó inhibición parcial para todas las esterasas sometidas al contacto con malathion en las concentraciones 1x10-3 % e 5x10-3 %, que puede ser considerado un biomarcador para la presencia de residuos de este insecticida en el ambiente. El análisis de regresión para el efecto subletal de los pesticidas evaluados demostró correlación entre la dosis y la causa de muerte solo para el pesticida neonicotinoide thiametoxam.

  15. Effect of the type of maternal pushing during the second stage of labour on obstetric and neonatal outcome: a multicentre randomised trial—the EOLE study protocol

    Science.gov (United States)

    Barasinski, Chloé; Vendittelli, Françoise

    2016-01-01

    Introduction The scientific data currently available do not allow any definitive conclusion to be reached about what type of pushing should be recommended to women during the second stage of labour. The objective of this trial is to assess and compare the effectiveness of directed open-glottis pushing versus directed closed-glottis pushing. Secondary objectives are to assess, according to the type of pushing: immediate maternal and neonatal morbidity, intermediate-term maternal pelvic floor morbidity, uncomplicated birth, and women's satisfaction at 4 weeks post partum. Methods and analysis This multicentre randomised clinical trial compares directed closed-glottis pushing (Valsalva) versus directed open-glottis pushing during the second stage of labour in 4 hospitals of France. The study population includes pregnant women who received instruction in both types of pushing, have no previous caesarean delivery, are at term and have a vaginal delivery planned. Randomisation takes place during labour once cervical dilation ≥7 cm. The principal end point is assessed by a composite criterion: spontaneous delivery without perineal lesion (no episiotomy or spontaneous second-degree, third-degree or fourth-degree lacerations). We will need to recruit 125 women per group. The primary analysis will be by intention-to-treat analysis, with the principal results reported as crude relative risks (RRs) with their 95% CIs. A multivariate analysis will be performed to take prognostic and confounding factors into account to obtain adjusted RRs. Ethics and dissemination This study was approved by a French Institutional Review Board (Comité de Protection des Personnes Sud Est 6:N°AU1168). Results will be reported in peer-reviewed journals and at scientific meetings. This study will make it possible to assess the effectiveness of 2 types of directed pushing used in French practice and to assess their potential maternal, fetal and neonatal effects. Findings from the study will be

  16. Introduction to diffuse interfaces and transformation fronts modelling in compressible media

    Directory of Open Access Journals (Sweden)

    Saurel Richard

    2013-07-01

    coefficients de relaxation des vitesses et des pressions. Cette analyse conduit à un modèle à une seule vitesse et une seule pression, mais en déséquilibre de températures. La résolution numérique de ce modèle présente néanmoins certaines difficultés, en raison du caractère non conservatif d’une des équations. En présence d’ondes de choc, des relations de saut ont été proposées [42] et justifiées dans la limite des chocs faibles. Ces relations ont été validées par rapport à toutes les expériences disponibles, à la fois pour les chocs faibles et forts. Elles ont donc été acceptées comme relations de fermeture aux chocs pour le modèle de [22] et ont permis l’étude des ondes de détonation dans les matériaux énergétiques hétérogènes. Des conditions de Chapman-Jouguet généralisées ont été obtenues ainsi que la structure des ondes de détonation correspondantes (non idéales [36]. A l’opposé des situations précédentes de transformations exothermiques dans des écoulements à grandes vitesses, des réactions d’évaporation endothermiques ont été considérées [43] pour traiter les écoulements cavitants et l’évaporation ’flash’. Lorsque cette modélisation de la transition de phase est combinée aux effets capillaires [33] et diffusifs, il est possible de traiter la simulation numérique directe de l’ébullition nucléée [25]. Enfin, d’autres extensions sont aussi envisageables, telles que la compaction dynamique des poudres [38] ou le couplage solide-fluide en déformations extrêmes [12].